4LNHA

Crystal structure of uridine phosphorylase from vibrio fischeri es114, nysgrc target 29520.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
245
structure length
239
Chain Sequence
FQSMSKQPHICVDENQVSPYVIVCGEPDRVNRIVELMDNVELLAENREYRVFNGVYKGTTITICSTGIGAPSMIIAVEELKLCGATHVIRVGSAGAMQDHIQLGELIVAEGAVRDEGGSKAYISSAYPAYASFALLKEISHFLENQSVKYYFGVVRSHDSFYTDEEDQLCQYWNKKGILGADMETSALFTVGRLRGLQVASILNNVVLYQVNQYVNDNKAMMNGERLAAITALETLCKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title Crystal structure of uridine phosphorylase from Vibrio fischeri ES114, NYSGRC Target 29520.
rcsb
source organism Vibrio fischeri
molecule tags Transferase
total genus 83
structure length 239
sequence length 245
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2013-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lnhA00
4TXLA 1RYZA 5F78A 1U1EA 3EEIA 2QPLA 1V4NA 4WKPA 4QATA 2A8YA 1SD2A 2AI2A 5FAKA 4D8VA 4RJ2A 4DAOA 5EFOA 2QDKA 1VHWA 4OY3A 1YR3A 1SD1A 1K9SA 5CXSA 4BMXA 4TTAA 3PHCA 1V2HE 4R2WA 4WKBA 3FOWA 1OVGA 1PR2A 4BMYA 1JDZA 5F7JA 2OECA 3ENZA 1JYSA 3DP9A 1PWYE 5EUBA 3SCZA 5EPUA 3PNSA 3U40A 1PF7E 1JDVA 3NBQA 3UAWA 1I80A 5IU6A 3ODGA 4NSNA 4WKNA 2QTTA 4TS9A 5CYGA 5CXQA 4D98A 4I2VA 4NY1A 1T8RA 3ONVA 1A9SA 5B7PA 1U1DA 3NM5A 1JPVA 1VHJA 1Y1SA 2P4SA 1RXUA 1YQUA 2OC9A 1JE0A 1A9TA 3UAXA 1ZOSA 1TGYA 3O4VA 4DABA 4DARA 3FNQA 3LGSA 3PNPA 4GMHA 1B8OA 5CCDA 4E1VA 1PW7A 1Z5PA 3P0EA 3UAVA 2ON6A 1TCVA 4BMZA 1ULAA 2QSUA 3KVRA 5DK6A 2H8GA 3OPVA 1YBFA 5F7ZA 1OU4A 5F76A 4LDNA 1FXUA 3OF3A 1ODIA 4F3KA 1Y6QA 1Z34A 4EB8A 3UAZA 1T8SA 1PR5A 1NW4A 5I3CA 3BGSA 2BSXA 4BN0A 1K3FA 4QFBA 4TS3A 4U2KA 1V3QE 1RFGE 1V45E 3OCCA 4KN5A 1PK9A 4OGLA 3UAYA 1PR1A 3OZEA 3T94A 3MMSA 4G41A 3KVVA 4EARA 4G89A 4F3CA 1NC3A 3QPBA 4OJTA 1PK7A 1RT9A 4GKAA 4R2XA 4LNHA 3KVYA 1Y1RA 4JP5A 4L0MA 4OGKA 2HN9A 1OUMA 1A9OA 4DANA 1VFNA 4ECEA 5F7OA 4LKRA 1OTYA 3E9RA 4DA7A 2B94A 3OOHA 2HSWA 2Q7OE 3NM6B 4R31A 1G2OA 4L6IA 2A0YA 3KU4A 5F77A 4IP0A 4F1WA 4F2WA 3OZCA 4MARA 4UC0A 1Y6RA 3MB8A 4QEZA 1SJ9A 4OEHA 3FUCA 3FWPA 4G8JA 1RXCA 1PR4A 5F73A 1OV6A 4D9HA 1ODJA 2I4TA 4WKCA 4YNBA 1ODKA 4D8YA 1TD1A 3D1VA 2IQ5A 4M7WA 1K27A 1RR6A 4LNAA 1V41E 1Z5NA 2GUWA 4MCIA 1U1CA 1CB0A 4MCHA 2OXFA 4QAQA 4GLFA 1ZL2A 3DDOA 4DA6A 4WKOA 4YMLA 4OF4A 1A9QA 1ODLA 4K6OA 5KB3A 4TXNA 1RXYA 4M1EA 3PHBE 1WTAA 2OC4A 4QASA 3DPSA 1RCTE 3LBAA 4L5CA 5B7QA 4TXJA 1RSZA 3F8WA 4JWTA 4F2PA 3KHSA 3UT6A 1TCUA 3C74A 3NM4A 4DA0A 1QE5A 2A0WA 4JOSA 2XRFA 2PGAA 2ISCA 2I8AA 1Z36A 1ULBA 4DAEA 5CCEA 1Z37A 3EUEA 1A69A 4DA8A 4L5YA 1Z38A 5C80A 3GGSA 2HWUA 4GLJA 1A9PA 1JP7A 1U1GA 2RJ3A 3BJEA 1B8NA 3TL6A 1Z33A 1PR0A 4TTIA 1VMKA 3BL6A 5IFKA 4X24A 1LX7A 4YO8A 1U1FA 3O6VA 3LA8A 3E9ZA 1C3XA 3FB1A 4TXMA 3K8OE 5B7GA 4FFSA 1V48A 3DJFA 5F7XA 3OOEA 3INYA 5B7NA 4P54A 4TTJA 1LV8A 4PR3A 1Q1GA 1Z35A 3KUKA 3GB9A 4TYMA 1PKEA 5JPCA 1M73E 4TXHA 4YJKA 3OZBA 4D8XA 4PNPA 1PR6A 5CYFA 1ECPA 1OTXA 4QARA 3K8QA 1RXSA 3OZDA 1NC1A 3IOMA 2QTGA 1Y1TA 3P0FA 1XE3A 1JE1A 1LVUA 1T8WA 1JDUA 5K1ZA 2AI3A 4LZWA 3E0QA 3FAZA 3IEXA 1JDSA 1T0UA 1PBNA 3BSFA 2A0XA 2HRDA 1A9RA 5ETJA 1YRYE 2AI1A 1Z5OA 1TGVA 4L5AA 1T8YA 1CG6A 1SQ6A 4M3NA 4NS1A 1Y1QA 1JDTA 3DF9A 1N3IA 3EUFA 2AC7A 1Z39A 3EMVA 1YQQA 4H1TA
chains in the Genus database with same CATH superfamily
3HGMA 3I2HA 5DF1A 2WVJA 4NE2A 4FEAA 1CY6A 1RC1A 1XD8A 1WOYA 1C4KA 1U3TA 2P1RA 3NAMA 3PE4A 1CYEA 1GDHA 3H1AA 4GE3A 4UVEA 5AK6A 5A1TA 5CH8A 2RHCA 3OLCX 3AM1A 5JXHA 1EA5A 5CLQA 4K6MA 2B36A 2NT3A 3Q3IA 1R6XA 3KJQA 3ZHUA 1B42A 3DEAA 3LHIA 2O59A 4KYVA 2VN8A 3RFFA 4D9NA 5DH9A 1F60A 3UG7A 5FBQB 1R0CA 1UBMS 2HWWA 5AKHA 5K0BA 2O1SA 2XCLA 4XTCS 1RWOA 2G5GX 4IH9A 4LMRA 1XZ8A 3VR2D 3GGCA 5A4DA 1EZ1A 3HDVA 1XDZA 4ROSA 3N2KB 4UEQA 1IXSB 2VJAA 3FUWA 5DYNA 3S7TA 4ZYZA 3TBFA 3BA6A 2RGCA 4JSRA 4Y9RA 5BW6B 5ULLA 3LVFO 1C1DB 2NT4A 3JARB 4P98A 3IP1A 6PFKA 2P3SA 4GU5A 2H92A 2WM2A 3NC0C 4IPTA 1UMDA 3GJRA 4UBNA 4EIWA 1NONA 3FUXA 3ORFA 4UDXX 3FVVA 1LSSA 3T4PA 3ZQJA 1BHJA 1IULA 1XK7A 2WT4A 2NU9B 1UP7A 4M0DA 4P7KA 2C57A 2J3KA 5EEGA 1TU4A 2QUAA 1B43A 3K4QA 4RHEA 4BPRA 3HK2A 2Y1OA 1TJ3A 3GT4A 4IS2A 2WR8A 1E6CA 2C7QA 1VE5A 2SCUA 4WRRA 2YY6A 3R7FA 2ORYA 3B1XA 2FEPA 2WTUA 4NHEA 4XPIA 3G2MA 1G2PA 2PA3A 2OT3B 3FCYA 3TYXA 1IVYA 1KO7A 1CY1A 1UZLA 4MKHA 3LO5A 4Z49A 4CM3A 2NP7A 3H5NA 1FVXA 5ALFA 4CL3A 3ESXA 4MI3A 1IY8A 4G65A 4TVKA 5JTTA 3UHJA 5HHTA 1U31A 4JVMA 4CV3A 4R1QA 1NLYA 3GRPA 5EE3A 2FW6A 2QAJA 2YY7A 5GZ3A 3O4IA 2C0PA 2IIQA 3CLKA 3DE3X 4HNUA 2JGDA 4MI6A 3BIFA 3DKRA 4K8RB 3ZOKA 3AJDA 4ZJPA 2Z5GA 1D0IA 1BAPA 2PZBA 3RYFA 5IX8A 1VYHA 3AV3A 1WVMA 1NMXA 4UD2A 1L6RA 1ZVMA 2BDUA 2O3TA 3T7AA 3X2EA 3Q15C 1HKHA 3AUAA 3MHPA 1BG6A 2VQDA 1B7GO 2R85A 1H69A 1DIRA 1U7ZA 2Q29A 2QRVB 3DGFC 5CT4A 3AWDA 1JEJA 4UOEA 2XSZA 4DT1A 4ETWA 1UR5A 3R0XA 3RTEA 3GZJA 3G9ZA 4ZD6A 5K0NA 4LCBA 2H5IA 3A0RB 1OC2A 3J7AC 3N28A 3HA3A 4TZTA 1BH6A 2P62A 2N1MA 3WK5A 2XLBA 1YQUA 4FKBA 4JU8A 5LDHA 3EPJA 1M33A 3EVGA 5A9TA 3AZQA 4ZZ2A 5IBPA 5A4KA 4I55A 2ZS9A 3LL7A 4LHZA 3UJ8A 2PT6A 3UNXA 3FG9A 1KQFA 2NO0A 1B1CA 3HA2A 4G23A 1U4NA 1VYTA 2H0AA 1ADJA 3EGOA 3FVWA 1U5CA 1HT2E 2ZLBA 2FLVA 5F5XA 1XN1A 2GI4A 2ZJ6A 3OECA 1C1YA 1WEKA 1AUOA 2VHTA 2IUEA 1P1CA 3C6BA 1U9IC 2EYQA 4CMEA 1TF5A 1OXKB 4ZQEA 2V7TA 2AMYA 1SVNA 3H1GA 3VR3D 3URKA 5JOQA 3FYCA 1VQ1A 3E48A 5HIJA 3TGWA 3QY9A 4EPYA 4F3NA 2WUVA 2OPBA 5K8LA 3N3BC 4YY3B 1NFFA 2X9QA 1DS6A 1YBMA 3IDSA 4J1TC 3MHTA 1QR2A 4LDNA 5AVRA 1W36B 4YP1A 3BSSA 1PJLA 4C2AA 1TZJA 1KC3A 2PAAA 4M1WA 4LF7B 1E2GA 5AVXA 1SXJB 2B1RA 2FZ4A 1YC5A 2GCIA 1RKVA 3ITKA 3NRBA 4DZRA 4BFCA 4XWKA 3ZVKA 1IZZA 4TLEA 3VC3A 4ALJA 2JZCA 4RY8A 2DSTA 3VDQA 2P77A 4MWOA 1CPYA 5BQ3A 1Q0PA 5G3ZA 5E7IA 4JA0A 1L4KA 3ENKA 1TM2A 1DC5A 2Y2VA 1T4GA 3GLIA 4C7OB 2CDCA 4H7DA 4FDVA 3PUZA 2CEKA 3G8DA 5B37A 1Q1EA 2VJNA 3I5UA 5NLLA 5H70A 4QG3A 2OO5A 4XQ9A 3AWIA 3ZJ4A 1CEQA 2QTAA 3QELB 4YMTA 3RK4A 4RUKA 1FOEB 2R6GA 2AE1A 3NUZA 3WTCA 3ZD6A 3JZDA 3IVCA 1FMFA 1XDGA 1PT8A 4FGSA 3NYRA 4R8LA 4WJKB 5TNXA 3HEBA 1TOAA 3ZCPA 3QSYA 3MFYA 1MX3A 3WK6A 4DJTA 4ZN6A 3U2QA 3GVXA 5JDIA 1HE8B 2IBSA 5C4MA 4F4FA 1N2CB 4YRQA 2B0CA 1JVBA 2OCDA 3FNRA 4FINA 1XHLA 1ZSNA 4UCWA 3UUGA 4MS3B 3KS9A 4N9QA 4DUZB 4BO4A 4KU4A 5DNAA 1R9JA 3DUFA 3HB4X 3WB2A 4MAAA 5C2JB 2JLRA 3PFFA 1OWOA 1L8LA 2HYIC 2GA9A 2JHPA 1K7YA 3WKCA 1TNDA 1TTTA 3DFUA 4R2XA 1TZKA 2N0SA 4LJRA 4PZ0A 4MW6A 4NIMA 1WUJS 1OX4A 1U99A 4P4TA 1O77A 1JR3D 1O96A 2C07A 3DFMA 4LAFA 2AVDA 3DD5A 5FUYA 3AF3A 1UT8A 3AXTA 3MT9A 1HKUA 1NVVQ 2H11A 3IVMA 3PS9A 3QV1A 1TLFA 2BFPA 4WINA 5AYVA 2FMTA 3PDWA 4JBLA 4LZJA 3ZU5A 5F7OA 4UTNA 2FEAA 1X8XA 3MK31 4CLOB 2WWFA 1ZC3A 3I01A 3GK3A 3Q9UA 2PIAA 4O1MA 3RSSA 4ABTA 2EZTA 4OXYA 5EJ5A 2LE0A 3SYNA 2XUGA 1DOAA 4JLVA 1HEYA 2A57A 4BP3A 3R3YA 1Q17A 1D3AA 4KFRA 3EQ2A 3LT4A 4PFKA 4PE5B 9ATCA 1FFSA 2HO5A 2VNAA 2R1TA 1D07A 3Q98A 4ILEA 5D3MB 3UCFA 4AZ3A 2XWQA 2X0DA 4LVNA 4CI0B 3R76A 4XIJA 2FSHA 1MJNA 4YRIA 3C3MA 3MINA 4IUDS 3N6XA 1PTJA 4ZTZB 1ISRA 4PRYA 4CNBA 1NZJA 3FSEA 1E1MA 3RSCA 1IBSA 4OMUA 1CZNA 1GAXA 4WW0A 4Y2TA 1V8OA 1FUYB 1FE8A 3SHWA 3V8EA 4N0PA 1W6RA 3MB8A 5EUCA 2PD6A 3TVTA 4DLAA 3OE7A 4Q48A 4QRIA 5DSZA 2O0JA 1JILA 1ODCA 4UAJA 3ZDXB 5BN3B 2R751 1NP3A 4IG4A 2LUOA 4X6YA 1UMCB 4IOJA 2R2AA 3GMDA 1U0LA 4JLWA 4LTNA 5D3ZA 4YWJA 4ZEWA 3RFUA 3TQCA 1XFAA 3NHKA 3HSYA 1VHQA 2G6TA 2H1CA 2OCPA 1ZCBA 2IZZA 2DTDA 1X7XA 4JJ7A 3T41A 3R40A 5KTMA 2QX8A 2DBRA 5KHOC 3RUEA 1M76A 1OV6A 1UZUA 4H7HA 4PXYA 3BE5A 4MH0R 4U2GA 4WERA 1M1UA 4QM6A 4REMA 1NQOA 1MX9A 3PC4A 1ODKA 1RVV1 5K3SA 2QK4A 3GLGB 1GA4A 1K97A 5DIFA 5IKPA 4HSGA 4KI0A 1MT0A 3JQ8A 2C5AA 2YWEA 3BE4A 5EIBC 4ZAFA 3ZNQA 1UXIA 4RSRA 4FYWA 4G25A 2NPFA 1KJJA 3PJDA 4WDRA 1YZYA 2VTDA 3U7GA 1DGQA 2XOKD 1LCIA 4NMWA 3PC6A 4O2BB 2AWNA 3QRWA 1T15A 3K31A 2O2CA 4AQDA 1AF7A 4GL4A 4NG4A 4TKMA 2GN4A 1U4OA 4HYQA 3HCPA 5DT2A 4JEUA 4BKPA 2SKDA 4MR8B 4L0QA 1T1GA 3IT3A 4UU0A 1QG6A 2FF5A 3RIXA 4ESEA 5KOIA 4HUTA 3UWMA 3ZHYA 5GIOE 1PGOA 2AG8A 4RAOA 5BPHA 4MCIA 1JEQB 4HVCA 1HA3A 2ZUEA 1W46A 2Y1WA 1U1CA 5KVQA 4AL4A 1O5TA 5E1DA 1MIHA 4BBZA 3NDPA 2B4TO 2G9QA 1UM9B 3AR4A 3LCRA 2LVBA 1UOQA 1TYDE 2O7RA 3HVKA 3LUJA 1QE0A 5GGXA 4JB3A 3BJMA 3LIIA 4D92A 4UQOA 3KVOA 1H05A 1PN3A 4KPUA 2FSVC 4L9AA 1JHMA 1TADA 2VR1A 1VFPA 1LBEA 1SXGA 3MFQA 3NIGB 4RH3A 5GZ1A 3IUBA 1K6JA 3FZNA 5EKTA 4AYTA 1IAVA 2CLSA 3GDFA 3W3AH 3QQ5A 1UQUA 2J85A 4ZRDA 1UPAA 4ZIRB 3V7UA 3ES9A 4Y2PA 4ZYXA 2OHGA 4F71A 4I6JA 4IIUA 2JLXA 1GRQA 1LDNA 1PQWA 3Q9NA 5DI3A 1M5RA 2V7GA 3PFWO 2PKQP 3HKDB 4D3XA 2ST1A 2P9JA 4QBFA 4IJ5A 1N5DA 4FQ7A 1EA7A 4KW7A 2P2DA 4AD8A 4GI7A 2FFJA 3U56A 2WTMA 1NVBA 4D6YA 4E32A 1HEUA 3LY5A 4OUDA 1IZYA 4QYIA 3LF1A 4GYYA 1KR2A 1MQSA 1RYBA 4QQNA 3AF1A 1Z7EA 4RIGA 3S8MA 3VV2A 5M34A 4PZYA 1NBOA 3NV7A 3VR4H 2ORIA 2EZ8A 3LXUX 3UOGA 4NBVA 3CU5A 3JALA 3HP1A 4QTTB 2QVYX 1VPEA 1E4YA 1AKMA 4ZVVA 3NHPA 3MGAA 4ZEMA 4HAIA 3LW8A 1JFTA 1KFCB 2BM1A 2YZNA 4QZVA 1QG2A 1XQ9A 5IP5A 1WZUA 4XCXA 4QVGA 3UW3A 1VDZA 3HI4A 4JIMA 1IQUA 1W0JD 4YJDA 3ITNA 5HFNA 4GEGA 2CVPA 5LYYA 1N1GA 3EEYA 3DVLA 1DZ3A 2CK3A 3BB3A 1SR8A 3PDIA 3QXSA 4NI5A 5L7TA 1B6SA 1L8QA 1SIUA 1P0PA 4IFBA 4Q9KA 4YRTA 2GEUA 3WGZA 4CKYA 3EIWA 2W22A 4LQCA 4O1IA 5ECGC 4PLZA 4RZIA 5IRCD 1KZ1A 2NU8A 1WY5A 3G0OA 4RTNA 3E7PA 1Y4SA 3GGSA 2JFNA 3AESB 1GRCA 4N5LA 4KAAA 3RC9A 4KTTE 3RRZA 1CZKA 1GT6A 3GQBA 3I04A 4EEXA 3E3OA 4GLJA 3RAPR 1HFJA 2NVBA 1NNLA 5GM1A 1QYVA 1WIWA 3CO5A 2FDCA 1QGAA 4V0ME 4YJ2B 1OB2A 3RWMB 4L8WB 2IZ6A 2VYCA 3CVJA 3RUAA 5DO9A 3RSOA 2V9PA 3SQMA 4R1TA 2G4VA 2VXOA 2R96A 1RRKA 1Q3HA 1U8ZA 4OSOA 2VHEA 1IHDA 2VF4X 1XVLA 1DOHA 3GG2A 1MGOA 5A7HA 3HUEA 1RLIA 2Q5LA 4IHJF 2J45A 5TMPA 1CUWA 1U1FA 1D04A 2YC2C 4AC9A 2P3LA 3WGQA 1CUYA 2R4UA 3BUSA 3QVSA 4OOFA 4NG5A 4ZARA 2I5PO 2HEGA 2WAOA 5C8YB 4JP2A 2WE7A 4RVSA 5I8WA 1LY1A 4HYTA 3H9CA 3INYA 4V0RA 5EA2A 4CTJA 2ZI6A 1J56A 2VPQA 3V4PB 3PVSA 1KSFX 1UKCA 2BZ0A 3IAM1 5DN6D 2YMQA 5EIEA 3OKFA 1DRWA 2Q5QA 3DTYA 1Y1KE 1TUIA 2L2QA 3U3RA 7YASA 1ZU4A 3DYIA 4ZMBA 2XECA 4H4EA 4ONEA 1IBCA 1SPXA 3Q3HA 1WCXA 1L7QA 4B8YA 5K0FA 1QHFA 3WGGA 4TXHA 1C0PA 2AZDA 4OXKA 1ECPA 1OTXA 2GBPA 2VOEA 3LVRE 4TX1A 1RXSA 3DV0B 7REQA 3KQKA 4TUYA 1FJ2A 3IMGA 3TIGA 3WISA 1AB6A 3COVA 1COWA 3QTTA 5D6NA 4AIIA 3SBXA 4OFBA 1HQKA 4UTPA 3ZJVA 2EQ5A 1WUHS 3U1TA 3WDSA 4D9JA 2CBXA 2J0QA 4PFSA 4WBNA 1JE1A 4L9SA 3RRYA 2VUHB 4LDJA 5GQSA 1M0WA 2C5BA 4W4TA 3A7EA 4IV5A 3N0TA 3HFGA 1N0IA 3OMWA 3N70A 2EGHA 3T3GA 5C34B 5DT9A 3SI7A 1G3IA 2AR7A 3M6IA 4WA7A 3SFTA 1IOLA 4UCXA 2WT9A 3DSRA 3GRVA 3AV0B 4DLUA 4RF2A 1X38A 3WSTA 2WWIA 2I1LA 2AZ4A 3R09A 5JD3A 4E94A 3NMUF 1NMEA 3A9VA 4OHUA 4WADA 1HR0B 2A9PA 2JIPA 4O63O 3FIUA 3G0CA 4ZI7A 1EIZA 3HWRA 5FUVA 1G0NA 3TOZA 3AL0C 4MLCA 5IASA 2WUDA 4TMVA 2Z9DA 2C04A 1BXZA 4K05A 2OCYC 2CD7A 5AW6A 5LU9A 1ECCA 4WZAB 4A2QA 1M2NA 4QJ5A 1CULC 1NU6A 4RS4A 5T8KA 2CXTA 5BRAA 2B5WA 3DKIA 3HNPA 4MS4B 1ULSA 1KZYC 3H4VA 4JC4A 4EJ6A 4H1WA 1KVQA 5F9MA 3PEEA 3VH4A 2ZUUA 1LI4A 4F4UA 3H9BA 1QCYA 3AHIA 3AETB 5GJWC 4EDHA 3P0JA 2VQ3A 4WXRA 1GQQA 2FWMX 5C18A 2GZAA 2GVZC 3N2YA 1MW9X 2VZ9A 3MCUA 1Z0ZA 2R8PA 1E3MA 2UVQA 1SVLA 2HC9A 3I9JA 4D4GA 2ZAIA 1PLJA 3KBBA 2CYCA 3LS2A 4S1NA 1RI2A 5LA6B 1XTJA 3Q7TA 1W0CA 5CDYA 2WSYB 3ONFA 2YN0A 3R5HA 4JJFA 1EFUA 2YH2A 2ZYTX 4ND8B 3KJXA 3LUDA 3EC7A 2L17A 2P11A 2MTBA 4BLPA 2XCRB 2BJHA 5ALKA 3ZLTA 3GZ4A 4K9DA 3IKLA 2HQOA 1NOJA 1EE1A 5I9IA 3HXMA 2VRCD 1II8B 5AMXA 2OMKA 1DLJA 4NNPA 3UN1A 5JNTA 5DGCA 1LQTA 3BE8A 4Q1FA 3ZYZA 2I22A 1N2EA 4G4JA 4GP6A 1G8AA 2EHJA 4IV8A 5TARA 3RIMA 3LBHA 1WUYA 2OCLA 1NVXQ 2Q6KA 3U9SA 1C5KA 2OORA 3A0UA 4PSCA 1G20B 4PCLA 3S2ZA 3RANA 3LKDA 4CF4A 1NQAO 1S9DA 5A6VA 5BR8B 1K9SA 3DDCA 3OETA 4MEBA 5FAXA 3ZTTA 4BMXA 2ZBQA 2C3OA 2X41A 2XZPA 4YXWA 3W5DA 2HADA 3UVEA 1NUHA 3L6UA 1EFVB 2HHAA 3R3WA 4G5RA 3WYNA 4R2WA 4RZ2A 2JAPA 1PFWA 4FZRA 3B6MA 1HG0A 2ZS8A 2WLSA 3WL3A 2NZJA 5TQ2A 4JASB 2ZYDA 1BYUA 1FUKA 1ZVQA 3COSA 3P7MA 2WP8J 3UB4A 5KCZA 4UHDA 5AKGA 3RO7A 2ESRA 2PZEA 2OECA 5C1PA 1N2XA 1NX6A 2YW2A 1NYRA 1AQ6A 1NUPA 1I01A 2GKGA 2GXSA 3HLTA 2OBLA 3IIJA 4GPTA 4M9ZA 3RIYA 2QN9A 3QPWA 2G9RA 5ITVA 5KYVA 1FB5A 4GPAA 3RNLA 4IIXA 2F9MA 3LDFA 4Y6GB 4BS9A 2VZ0A 2BELA 1K5DA 1PF7E 2F1KA 2TS1A 4LW8A 5FNVF 1SN7A 1EUCB 3BJRA 3ACDA 3I4LA 3MGBA 4WA8A 3ESZA 1DXQA 3FOAA 2Q62A 1ZGGA 1JX6A 3CWZA 5CAEA 4NJOA 3BGDA 2ZR9A 3T3PB 1X7ZB 3OE1A 2C4HA 1V11B 1O0SA 1QYXA 3KXIA 1Y81A 1UFRA 3REQB 4WZBE 2QY9A 5CIQA 1CB7A 4U9UA 3C3CA 1BHO1 3MUOA 3WHIA 5KYUB 5FIUA 1UJNA 5K3CA 4ZZIA 2O2DA 4M49A 1VI6A 1XB2A 5KQMA 5BQXA 2KWIA 2AJLI 2HU2A 2O9JA 4PANA 3HGTA 1WUTA 4NFHA 1NF2A 2OCAA 1WG8A 1OD6A 2B5VA 3T5BA 1DBRA 2F17A 2HK7A 3JZFA 3NHYA 3JXEA 4X1YA 3T5MA 4ENUA 3HJNA 1V5EA 2A9FA 2W6QA 4IZOA 2P4SA 3LSYA 4BOYA 1SC9A 3VNBA 1P3JA 4WXPA 1FVHA 5F21A 1QLWA 4W9RA 5JADA 4JHLA 2R8EA 2NIPA 2VBGA 2YR0A 3NATA 3UWSA 4B34A 4EK9A 4WOJA 1NFRA 4QX6A 4YJGB 4E51A 1IQ0A 4XSGA 1RACA 2X9GA 3K15A 4Y0NA 2HGZA 3GZNB 4RBNA 1A2KC 4PG8A 1RKXA 3D7MA 3IIMA 2GNOA 2X76A 1Z5PA 1KQGA 3ESYA 4AJPA 1M2OA 3R7LA 1BU5A 2R25B 4LWZA 2J7KA 5J47A 2YXPX 5JS7A 3HJUA 1CLUA 3W6UA 4XIGS 1WHSB 2PM8A 5LB2A 4BN4A 1J2RA 2PXCA 4F2DA 2X0JA 3ZG6A 4ZEXA 4G0NA 1OGJA 3ZV7A 3OZRA 3GT0A 1E5LA 2I78A 3LUKA 1D4ZA 4JENA 4QXOA 3K8ZA 3ZH9B 2K6GA 1GRVA 1I36A 4Q1VA 2NO5A 4B33A 3VTKA 1JEYB 1RVDA 4GMKA 2ZRKA 5JMTA 2CV2A 1Z3CA 1IJKA 2PG3A 1C3LA 2XUAA 4O2AA 3SHFA 1E60A 3DMYA 4I50B 4QTXA 5G4KB 1Z45A 2I2FA 1GZDA 1GCOA 4YAEA 4A9AA 4R16A 5HWSA 2IW3A 5BQ5A 3BB4A 1WCIB 2CXPA 1V1RA 2D3TA 2ZRQA 3A58B 4WGFA 5EP2A 2D62A 3ICQB 2VCHA 3RVPA 4P22A 1SRQA 4J6EA 2QE7A 3A2MA 4LGVA 2VJMA 4R3NA 5J2TF 2BGGA 3TXXA 3IE2A 3MJ4A 121PA 1QIGA 1Y8QA 5U4QA 5DU2A 4YROA 3TB4A 1DRUA 4CN8A 2ZTLA 3I9V6 2XXBA 5HBGA 1UJBA 3IAXA 4GLBA 5JSKA 2G9UA 1I7NA 3Q7IA 5JSYA 5KNDH 4TSRA 1K66A 1O8BA 2DQKA 1SZPA 4K5QA 1IVNA 3IKVA 3AB3A 3NBAA 4YP0A 4BLTA 3EEOA 3GCZA 2ISQA 1Z8NA 1Q3TA 2OBNA 3G2PA 1H85A 1ZR2A 4HEA1 1UDXA 3W8FA 1P60A 1ZIYA 1QHXA 2WHRA 4S3MA 2ZXUA 4PIMA 2VDPB 5AICA 4MVYA 3K5WA 4KQMA 5JS6A 2G4LA 1KEKA 4UUQA 2XDQB 3ZYCA 1KAEA 3TECE 4ZOLB 3R9KA 1C9JA 1TPZA 3EH2A 3WMWA 1QQBA 1FW6A 3V8VA 1C80A 1XA0A 4P3PA 4D42A 1KH2A 4B7CA 2IXGA 1PK7A 2HDWA 3AB8A 5GIPE 2C5EA 1UBHS 2GYWA 4RH1A 4GKAA 1KJYA 2IUFA 3U81A 1L5YA 2E85A 4CKBB 3ZVNA 3EX7C 2HCFA 2R4TA 4F46A 1Y3AA 2DPYA 2YFHA 2HQBA 4P3OA 4PY2A 1R0BA 4M60A 2C2MA 4TMKA 4HFMA 1QVAA 4Z8XA 5IXJA 4DCPA 5KTPA 4Q4JA 3PI6A 4RVGA 5HBRA 4R1LA 2OZEA 2O8FA 1TUBB 3BH6A 5EEHA 3UJPA 4UM8B 1YVUA 1QCZA 1BMQA 1NDQA 2VDRB 2WB4A 3HB9A 1JIKA 1B1AA 4UE6A 3UAGA 1SBYA 4HH0A 3BL8A 3QF7A 4JYMA 2GM3A 4CTNA 2IXAA 1KYWA 2QNRA 3P9SA 2ORED 3QE9Y 1OKKA 2BF4A 3HVJA 2QMZA 2ZS7A 1Q2UA 5DLQC 2C88A 2YV4A 3LXMA 2HZBA 3H2GA 1V35A 2I4IA 3RF7A 1QV6A 4GR9A 1KOJA 3I01M 4CIDA 2EZ9A 2YL2A 2A1TS 1RQXA 3EIQA 3OPMA 3ZIDA 3K1YA 4BTLA 3OKCA 3U6KA 3AW8A 4KV9A 4JBYA 4KR6A 1XJQA 4DYHA 5BVHA 2XMSA 4K9NA 5FYQA 4V0KA 4KH1A 3GU3A 1NN1A 2GTHA 3KKEA 4J2TA 4UC0A 4CFSA 5IZ4A 1U2EA 3HGQA 1PKXA 2YNMD 3II6X 3W3AA 1OQAA 1XKXA 4NVRA 3CEMA 3UT0A 4A92A 4DQVA 1B2RA 2PH5A 1KAQA 3FUCA 3TH5A 3ZHCA 3HVIA 5CA1B 1MNAA 3AGQA 2IEAA 1QGUB 4X7RA 5TPZA 3LUHA 3W78A 3R7AA 1A2QA 1SXIA 5LZ9A 1PR3A 2WJJA 3EXIA 1OR8A 2VVTA 3EOZA 4CKEA 1QU3A 3CEJA 3OU2A 3TZQA 3HL4A 2Z95A 5E1MA 2H5EA 2I7DA 3CZ4A 3CVOA 1ZL0A 1IDN1 3C4QA 3JR3A 2ZSAA 3FD8A 4URFA 3VR4A 2FHSA 5JFTA 2JLYA 3JD1A 3C87A 3GFFA 1KJNA 4ZT4A 2CT8A 3H5IA 3KL2A 2DYKA 1IOZA 1M2VB 3EK2A 3QLEA 1L7DA 4M37A 4O4HF 4Z0NA 4MAFA 4D8YA 1C1DA 2Q7XA 3JARA 1EVKA 3F8SA 2CL5A 2DFNA 3DBVO 1GZ3A 1NXTA 3E2MA 4CM9D 2NG1A 2XH8A 4HAOA 2CHUA 4EHLA 3GGOA 1M1YE 4CPDA 4EGAA 4LJ5A 4AF7A 2UVPA 1Z3IX 1XTTA 4CWAA 4RLFA 4B80A 1F9EA 2WMYA 2AN4A 3DNMA 4BU0A 2JBAB 3LT5A 4H1HA 2QTWB 1V9LA 1FPQA 1WSDA 1Q12A 3RHZA 2BBSA 4FGUA 3BRSA 1FNSA 3KHTA 4DJFC 4DYDA 1QIDA 5CG2A 4NBWA 1YHZA 8LDHA 2R8YA 1CP2A 4EY5A 3BDVA 2VZEA 2A5LA 2OL4A 1ZIOA 1I5EA 2Q1YA 2QKYA 4OQFA 5FBHA 1GQOA 1LI7A 2KYRA 3MG9A 5G41A 2HPHA 2PO5A 1P5ZB 4O2LA 1ST2A 5DTQA 4D8TA 1OYOA 3NG1A 3TOVA 1PLKA 3RVOA 2F62A 2X5XA 5CB0A 4C3OB 3GR6A 5BR4A 3E82A 4QUJA 4HXEB 2QAGC 3CLHA 1OYVA 5JSFA 1ZCAA 1W87A 2EKPA 4OB8A 4CLEA 1BFKA 3CX8A 2RHGB 5KB3A 3LQKA 4PC7A 2FKAA 3GHHA 5FJJA 2P90A 1G3UA 4I46A 4ME6A 1H2XA 2X1VA 3C3JA 4ZT2A 5EMMA 3T1QA 3B9RA 3FWKA 5E3IA 2C2KA 1P19A 4I1IA 3DPSA 2QI9C 3K9CA 3PFBA 4JWKA 5D00A 5BYJA 3E3LA 5EMHA 5ELMA 2QRVA 5IJZA 3B1KA 1E2IA 2P5SA 1TO6A 2FJPA 1S3GA 4FDTA 5EE5B 4F2PA 3OWOA 1EBFA 2DECA 3DR5A 5FRDA 3P9PA 4QDZA 4QGSA 4I4LA 3IT0A 1UFKA 2AIRA 5I7WA 3PQEA 4BAGA 5AUNB 1PRYA 3MT8A 5B3AA 1WVGA 3KQWA 3OUTA 3D43A 1W6UA 2MYNA 2HJHA 5F2NA 1YUNA 4TZ6A 1GFSA 1H3EA 5BMOA 2IYZA 2H51A 5DJ5A 3F90A 4BYMA 1N3YA 2G63A 4Y98A 4KHPB 1TTQB 3RAFC 1YE3A 5KYNA 1IZ7A 1U3VA 2O50A 4U5QA 5KINB 4DC9A 1XZMA 2B5OA 3CXRA 3Q2IA 2CHGA 2G80A 3QE4A 3OT5A 1FQJA 1C8VB 4HNGA 1F0YA 2J3HA 4B40A 3NPAA 1NRIA 2O3QA 4WZ6A 5FPSA 3WGOA 4B3BA 5A7GA 1E69A 4J76A 1IDOA 1CZOA 1NRJB 4MICA 3R7DA 1U90A 3FFXA 5E9JA 1XUOA 4GI1A 5F4BA 3HU5A 3VNRA 3QKTA 5B6JA 2ADFA 1KMNA 2YWHA 3DXYA 1VJCA 1ADGA 3E5HA 3GUYA 1UJ4A 3I2FA 1I1HA 4G0MA 4JLBA 3DWGA 4OHBA 4FEGA 5DXFA 3ZWPA 4GLLA 5JBQA 2R97A 3HXKA 3OEYA 3KEGA 4IQ4A 4UNPA 3T4UA 1P0CA 4B4WA 3TUZC 5JU6A 2FDRA 4NQRA 3RW9A 3I83A 2EJUA 4GZLA 1D0SA 3I9KA 4QLOA 4RFLA 4Y6RA 1T36A 1GA1A 3FR7A 5EAIA 3WB1A 2QM8A 1WABA 5KUTA 1TO1E 5FNVB 1Y9AA 4LE1A 2PZJA 4MUKA 4EPXA 1ORHA 2RI6A 3A9TA 1BZYA 1VE6A 5AVJA 1XCOA 1G64A 2GT1A 2MSLA 3QVVA 1Q0ZA 4K6FA 3D6NB 5TQ0B 1AGNA 5CJPA 2D0OB 3K8YA 5DYWA 1YVPA 1D2AA 2A5JA 4RELA 1K06A 2XT6A 4PTLA 4POOA 2D0PB 5DLDA 1ZH8A 2M6KA 4O08A 3TI9A 3MA0A 1N5LA 3HWSA 3OOEA 1CEXA 3WXBA 3M2TA 3CXUA 1CRPA 1WXXA 5JW6A 3HWWA 3LOUA 4L1KA 4W5JA 3IB6A 3PC2A 3DM5A 4J0HA 2FN8A 1FMJA 4D96A 1JI0A 3SLRA 1NL3A 1W85B 2Q5HA 4RYDA 1ULUA 2P35A 4DA7A 1PQYA 1A4XA 1E1CB 4PTZA 3ONWA 5LQKA 3E7XA 3MYYA 4OH1A 3WAGA 1Z73A 4L51A 4LPKA 3A7DA 4MI1A 4PWYA 1SMKA 4WK0B 5GVSA 4Z3OA 3GNSA 1OI7A 2HTFA 3I6IA 3UFXA 4D8WA 1ZJYA 1WNTA 4FFNA 4Q18A 5JXIA 5BV1A 3DYVA 3PD7A 3PRHA 1PCXA 4BEVA 2AV6A 1ZICA 1QGZA 3AYXB 3AINA 2RGNC 5DNEA 1J22A 2VK4A 2ONKA 4KIJA 1ZBQA 2Q5OA 4Q66C 4NZOA 2JCBA 1I51A 4ZODA 4CLOA 1G41A 4RTSA 3QOFA 5K2MA 1NQWA 1XEWY 4HHEA 3G0BA 1XZDA 3I45A 3M8KA 4BIMA 1VGRA 4QC2A 3TCKA 1U11A 4N12A 1UJ6A 4H31A 4IDQA 1HQDA 2RBKA 2Q2NA 2NUAB 2DCUA 3SQXA 1T4MA 2Y4NA 4GPEA 4U2DA 2J3JA 4KNYA 2O48X 4OTZA 5BOSB 1DTEA 3MQ2A 2IV2X 2WYVA 3NTUA 1RC8A 3SXUB 3VC2A 1YRHA 4L4XA 1HGXA 2X9VA 3M49A 3NQ41 1GHTA 3DPUA 5HOEA 3KOXA 2GEKA 4Z4FA 5B7PA 3A4LA 4D45A 5JNUA 4JB8A 1YS7A 3KT6A 3TE7A 5L53A 4TYWA 3GIWA 4DMUB 4ND5A 3RWBA 3G85A 4RIFA 2R6ZA 3G2KA 1XZEA 4MA4A 1L5ZA 3QBJA 2AQHA 3UFBA 3V1KA 3FYDA 3OZIA 2W2LA 4YWHA 1ZFNA 4HDRB 1E94E 2EJVA 3HTXA 2PUWA 2R6CA 1RYZA 2J1LA 2NYVA 1L7BA 4GKBA 3I5MA 3O2SB 3DCYA 1DIOB 3SG0A 3FBGA 1CIVA 2GLXA 5CA0F 3WADA 1N1DA 2R6AA 2J08A 1ZNXA 3QY0A 3TW8B 1DC6A 3G9QA 3UWDA 5J3JA 4K1XA 1ZJWA 5E9QA 3NC1C 4EABA 4P7GA 4RZUA 5HMMA 2ATEA 3VPGA 1BWRA 3NRCA 2EP8A 1ONPA 2RGDA 3ND7A 1OZ0A 4U8HA 1PS9A 2PWPA 3M70A 5K20A 3T1TA 5I01A 3SBEA 3A9CA 3HZRA 1PL0A 2M32A 3F49S 2A5YB 2GHRA 3BWDD 4BAUA 4G0PA 4IIEA 2CL0X 4RW0A 2ZE5A 4P33A 4AMVA 2JGJA 5E3HA 2WJZB 2AQIA 1F1BA 1LLFA 4XLZA 1K3UB 5HDBB 3AEUB 2I6XA 4IBOA 5ALGA 4BCDA 2X3FA 1HL7A 3MRTA 2H6EA 3DR3A 2ZJOA 4H7JA 4OBEA 4IMPA 2H2HA 2VJBA 3RSQA 1U7XA 2AS0A 2CBGA 2LIVA 2O4UX 1V7PC 5E1OA 5ARCA 3VR2A 3WHKA 3MAJA 3VNUA 2JJ1A 4GBGA 2PQ6A 2VUSA 3TEFA 1VMAA 2O8CB 3FH0A 3OPYB 4AJKA 2YWJA 3FI9A 5AKXA 1EG2A 2B21A 2O2ZA 3DWIA 3B1YA 4BJ6A 4TYNA 4LXTA 1FRNA 3UGTA 2F55A 1N25A 4YT5A 3HCFA 1SQ5A 3NAGA 2P9FA 2E6KA 1PWYE 2I54A 3HO8A 4TSFD 1K0FA 3Q4GA 5JQGB 2GN1A 3EC1A 3ILYA 3PNSA 1FSPA 3U13A 5GADl 1LI5A 1U2SA 2E0IA 2HNBA 4LDPA 2HA7A 3H9UA 5F2OA 5KTYA 5HM8A 1E79D 2H2AA 3ORHA 4FBLA 5TT1A 3CLSC 3LFHA 3NHWA 4LKOA 2FRDA 4BO6A 3EXG1 2QTFA 3OQPA 4IDOA 2JD2A 3MAGA 4NYMR 1RHKA 3WSWA 2KX7A 3TZ6A 4WAUA 4QYWA 5ALXA 4DTIA 5FTKA 4D02A 1EX9A 2YCBA 4EZIA 2XYVA 5BVGA 2VPWA 3U4AA 2Z57A 4YDSA 2IYAA 3GJYA 3D0QA 3OAAD 4RANA 2ZJ5A 1DEXA 3OZUA 4FYYA 1M5UA 2MYPA 2WOOA 4MW9A 5MN5A 1EPUA 2PCJA 4YV1A 4ZDKA 1FP6A 3V1TC 2IGTA 2X2PA 3EVTA 3LCJA 2AOXA 4NATA 4FZJA 5KNDA 2QJTA 2QZ9A 2NP6A 3HXOA 1XEXA 5ALDA 4XWOA 1PGQA 4O0MA 1F6BA 3FI0A 2DUNA 1FLVA 1PS0A 1JPVA 5EFZA 3ZE8A 4YJFB 1P4RA 4MCJA 1BDJA 1CC1S 3DDNA 3ZKAA 3YASA 2Q99A 5K05A 2J6CA 5AOAA 4NZ9A 1JE0A 2H54A 4FMBB 3P2EA 4J29A 4XAQA 5ALNA 4E2ZA 1TGYA 4FN4A 1SA0A 4B84A 5JI3E 2C78A 3KX2A 4EG8A 1C9MA 1HOXA 4UTRA 1FP2A 3TQTA 1HRDA 3C5CA 5G1OA 3IURA 1RBQA 2QRQA 1FNNA 1T9HA 3EOBI 4P0TA 4Q3OA 3INNA 4S2EA 2JC3A 1PW7A 2R8XA 4GMDA 2ZYHA 5KDLA 2XRYA 4HTAA 3WMRA 5EWMB 1Y0BA 1EFKA 3MJFA 1NW6A 4UMEA 4YJ2A 1KJ9A 2I7CA 4EHBA 1PUIA 1X1AA 4X85A 3CW9A 4MP3A 4DQLA 1XTBA 2I0FA 3F67A 1R0RE 3TEMA 2B8NA 4XJXA 3CKLA 3DTVB 2XMBA 4XVUA 1QKJA 4QGAA 4F9TA 2ODEA 4K88A 3T6KA 3EXAA 2G9ZA 3F5QA 5K8JB 1FFHA 5IG2A 3QX7A 2OENG 3CIOA 3TTYA 5K0ZA 1CCWA 4FUQA 1ZH4A 1NJFA 2DX7A 3BILA 2R8OA 4MVJF 1QRUA 2X8WA 4EMBA 5AK0A 1T8SA 3CZCA 4B2IA 1GPYA 4BAZA 5C8YA 1S7GA 2IK8A 1ZVKA 4UE3S 3ABZA 3UENA 4KLRA 3T54A 3TQOA 2FSSA 5KIAA 2XZLA 1Q2XA 3P45A 2WNSA 2YASA 1FVFA 3MJHA 1VLMA 2ZB3A 3L7JA 1E1QD 5CFOA 3G6WA 4OL0A 1C14A 5DM70 2D4HA 2BH2A 4U2KA 1VJDA 2I3BA 2BHSA 3UZUA 3VU8A 1K6MA 2OXCA 3ZC3A 4MHSA 1RYNA 5CNKA 4DV4B 1TJNA 3NFRA 3W9UA 3KDSE 2ZQ5A 5IYZF 3O4JA 3R3HA 2VUUA 1L7PA 2V5UA 2RHMA 3DV0A 3GOHA 3ZWXA 3VV3A 1W96A 2PL3A 2X8BA 1E2HA 2DVMA 4WACA 5LXTB 3WLOA 1BX0A 2ZTUA 1XA3A 3BGWA 1VHLA 3NCHA 1C4OA 3INTA 2RIPA 2HF7A 1I1QB 3AVOA 3COJA 1U0NA 2CGEA 3I2YX 3R8FA 2HNKA 5CTJA 4FWTA 4GZ5A 5CMLA 4MB2A 5MHTA 4JXXA 3DL0A 3P0IA 1E2KA 3OQ6A 4ZKEA 3TLMA 1ND5A 1YCGA 4N3AA 2IITA 4Q39A 1ZJJA 1VLJA 3JYPA 4BNZA 1KOGA 3S1AA 3VX3A 1V7CA 3GC6A 3LQQA 3T9DA 3EFHA 2RGUA 2DERA 1B3RA 3D6FA 5FOWA 4R51A 3L7KA 1LNZA 2OO7A 2YIMA 3V2GA 5HKOA 4BLVA 3KYDB 4ECEA 4PHCA 3MJEA 2CDAA 4MV4A 4D9IA 5HKLA 4D80A 2ODBA 1WXHA 4KQGA 1BKYA 2VO1A 1LBSA 2ZWMA 3O75A 1YRLA 5JZMA 1J5EB 3KSUA 5E2IA 1S0UA 4PX3A 1WKCA 5IC6A 4CMIB 3ICEA 2JFZA 1X0VA 2QP9X 3HG7A 4R1MA 1VSTA 3EGDA 4P4GA 4ZHQF 5BYKA 2RGRA 5GONF 3TCXB 3SP1A 1BN6A 3ABQB 1DFGA 4JUFA 4XKJA 4EUHA 4LK2A 1QP7A 4F6LA 1I30A 2IFTA 3EMBA 3H11A 3PQDA 4IMIB 3U9TA 3WFZA 3C6ZA 3SBOA 4QXMA 2C4NA 4LY6A 3A9SA 3OT1A 4BNYA 1HX7A 3ABRB 3DZCA 2PUDA 4I9HA 3VHRA 3TXYA 2W71A 1TYBE 3T34A 1W47A 1J49A 1TVKB 5TQVA 4US0R 3OPXA 4F21A 2OPHA 3GLRA 1E3SA 1G5TA 1WLSA 2YV1A 3FWNA 4EA6A 1YZ3A 5KSOA 2ZIEA 2YJNA 2PYZA 4DMHA 3JRNA 2RDMA 3H75A 4RK5A 1Q3KA 2J9FA 1XLUA 2XE7A 1PSWA 2ZG6A 1K8RA 5I9MA 1KMCA 2ZRHA 1OIXA 3HVUA 3RUFA 3NWEA 1LPNA 2ERXA 3DFKA 3NBZC 4TYYA 1I2AA 1TZCA 5IDXA 1RW4A 3BAFA 3AR8A 3FA2A 3TLXA 5ICGA 2I4TA 5CRIA 4WKCA 2R1VB 4EG5A 2D7DA 5K99A 4H77A 1PYDA 1W44A 4TS1A 4KJZA 1JXOA 2QU7A 3KQQA 5PNTA 4XR9A 4NNOA 1SFRA 1ADFA 2XIQA 1F20A 2OBMA 3HCNA 4LVCA 4R2MA 4CUZA 1H0RA 3MPUA 1D2CA 5FX2A 2XHZA 3VA7A 5DWQA 4G0UA 3WLHA 2IDMA 2G4CA 4LQLA 1VBMA 2C82A 2OFPA 2RMKA 1DP4A 1F12A 2WSSD 3DBLA 3R44A 4I3FA 4RMHA 4YTEA 2ZCVA 1E4VA 3W7AA 4C4RA 1H5QA 2W00A 2BHNA 3AP3A 3LLVA 1MRZA 3CCFA 1PDOA 3ZI7A 2IDZA 4DSTA 4N82A 1FLNA 4DIDA 4O8ZA 4A10A 3CBQA 3UYKA 1DC7A 4G24A 4QQKA 2YRFA 3RVLA 3ZV6A 3W34A 1Y4ZA 3G7NA 1KY2A 4O4LF 3CQ9A 3T38A 3CX6A 2H2IA 3CT4A 3FF4A 3JAWA 2IY9A 4PX2A 5KYKA 1HFEL 4RM3A 4M0CA 1PZMA 2ZULA 3OFSA 3ICCA 1PU2A 4L15A 1UP4A 4MMZB 1SD5A 5CA0B 4ZGBA 4B2PA 4XGRA 1NQUA 1PUJA 1XXHE 3NHMA 2YN4A 1NY5A 2A84A 4N6NA 2IS4A 4R9SA 5B36A 1NG9A 4GMXA 2FYTA 5JAZA 1V11A 1E3WA 4CEIB 1R5OA 4GQIA 3K9QO 1EVJA 3ASUA 3M6XA 4LN1A 1PVOA 2Q4RA 5H5JA 2XPCA 3M1YA 1FYWA 1MVOA 3EGCA 4UJ3A 5KYUA 3WIDA 2A4KA 2FLKA 3FHJA 4PZCA 1G66A 3SZOA 4O4IF 3U4DA 2WF5A 2DUWA 3K6RA 1C8BA 1LPPA 1T6XA 3CLUD 3B8EA 1ONSA 1D6MA 3FYTA 4JBWA 4C0HA 5U9CA 1EIWA 1SM4A 4FK8A 2KI5A 3SD7A 1F0PA 4ZEVA 5JS8A 1Z83A 3JQFC 4WVFA 2EG9A 4BB0A 4DM4A 3WLFA 3A37A 3RS9A 3OM1A 4HNRA 2B4QA 1MDFA 3TO5A 2XJ4A 2OV2A 2OSVA 2VP0A 5BQOA 3KVNA 1CRZA 1WUIS 3OQHA 4N6OA 2P4HX 3O83A 1JPJA 2B9VA 4DJEC 5LQJA 2X22A 1VG0B 2ZDGA 4JB2A 4OG2A 3L1VA 1MABA 4XWGA 5JRDS 1NN5A 3GVPA 4XM1A 5AI6A 3UJ3X 3L8CA 1IB0A 5LD2C 4HBGA 4YJGA 2WHPA 4WV3A 4DSOA 3N0RA 1VSUA 5MGNA 3B5JA 3UMBA 2OZLA 3JWHA 1EINA 2AYYA 3O7MA 3PWKA 3L4EA 5EYPB 4MPTA 1YQEA 1ZDMA 2BW0A 4Z9BA 5KNBA 4IW3B 3KPUA 4GYKA 4TTPA 1MTOA 4BX0A 1XZNA 4X0EA 4J0CA 1GN8A 2CVHA 1GYPA 2PX5A 5KWVA 4LHXA 1KEVA 2BFMA 4O4JA 3B6IA 3L4BA 4XM2A 1SHLA 1W0JA 3ILXA 3KV3O 1P9WA 1Q0QA 2HRBA 3NIFB 4HGRA 3UXHA 4DNXA 1X1EA 2I2BA 2MINA 3I6MA 1TJPB 4HAYA 4C6TB 1O3YA 3D3NA 4RMJA 4B7UA 1M6HA 2BFBA 4Q1DA 4MO9A 3LZDA 3EWSA 4FMPA 2H0QA 4I50A 1HFKA 1O8CA 5G4KA 3HDYA 4QA9A 2GK6A 1B8NA 3ME5A 4JT8A 1BKDR 4YLYA 5ALSA 3MS2A 2W48A 1AVTA 1R8QA 1Y5IA 1WQ1R 2WYHA 4GVXA 1KI8A 3FYSA 3EARA 5EZ6B 2A1UA 4MSUA 3EGXA 5F98A 3UXMA 4NV1A 4TV9A 4PGFA 3SZMA 2X1HA 1YBHA 3KKPA 2P4QA 4TMWA 1UBEA 3M5WA 1T4DA 3KYIB 1X2BA 2PZKA 5F23A 4GX2A 1J6UA 5JCZA 1YDMA 4TLMB 2QMHA 1NLZA 4DS3A 4JEHA 5EWLB 1QFMA 1U2DC 5JY1A 1WMDA 4W5NA 1ENYA 4MUFA 1J7KA 2C5HA 2PS0A 1Z6QA 2JCGA 2J5XA 4NH4A 4QYSA 3TCNA 3PF9A 3C0KA 3GRAA 1CUFA 4J2HA 3HU1A 2X1LA 2GZHA 3CCCA 1QR6A 2DBYA 1YBAA 1Z35A 1ZMTA 2VWGA 1BOFA 2QR5A 4CIYA 4D0NA 2VAVA 4IDHA 5F9HA 1Z7WA 4I1RA 4IUBS 2ILTA 4F85A 4FEEA 1EK6A 1KY5A 2X7HA 5CFZA 5CT6A 4QHTA 4KXYA 4V0LA 4ZOLA 4EMUA 3EBPA 1PR6A 1O6ZA 2VP5A 1N2BA 3IPLA 5CYFA 1UDWA 3C41J 3JPYA 3L1UA 4LHSA 3WYDA 1XPOA 2SICE 1NC1A 2XMCA 4EY7A 5A4FS 1T2CA 3PUYA 1QH0A 4CKBA 1MB3A 1Y1TA 2VNIA 4Z9YA 2CD9A 2N1BA 1P2GA 4A27A 1UAAA 1EP3B 4Y2GA 4DLPA 3O95A 1I9CA 4E2YA 1Z75A 4RQTA 3FUVA 3G5LA 4JL8A 4E88A 1GFWA 1IJEA 1PFVA 1ZBDA 1FRFS 2WIJA 3QWBA 5JSZA 1E3JA 1M2KA 1QOQB 3E0QA 1C41A 2VUTA 2B92A 3JTEA 5SICE 4AMBA 3RDPA 2PSFA 5JDCA 3DZHA 2W2VA 3L5KA 3HXLA 3DC2A 5HGJA 1XSEA 1I3NA 2L42A 3BYZA 4OKNA 3JVUA 4JKIA 4M4SA 3ESRA 3JQ7B 3UMMA 4G0XA 3L92A 2H7YA 4TQAA 4BWYA 3AKCA 1CUIA 3LO8A 1ZM4A 3LLSA 4L27A 3E3MA 3H2SA 1E6KA 3IBYA 1JLLB 3FY4A 5BSWA 2CFOA 2ONYA 4BP1A 5JJIA 1RAEA 4C20A 4GO1A 1F8XA 4X00A 3GLIE 4NU0A 2CHFA 4Z4HA 3CCBA 3PL1A 3ZJ5A 3RRNA 1UBKS 2C31A 1I2DA 3DBHB 3LH5A 4NS1A 3RU2A 3G2IA 4OBWA 5HRUA 2P79A 4IDAA 1I7SB 3JZAA 4C22A 4W9NA 1E0AA 4JI4B 4PO3X 3ANLA 4KQFA 1I3CA 2UKDA 4MW4A 1PAUA 1U4SA 5IYZB 3LCUA 2BR3A 3MLEA 2JL1A 2XZOA 2X4LA 4EGJA 2AUMA 4EI9A 2WB2A 1XMQB 5DB4A 2QI9F 1OBCA 3BWCA 4XASA 4TYPA 2EDAA 1KDPA 3SSAA 5HCIA 1M8GA 2LKDA 1MCZA 2H52A 2A8YA 3AUJB 3D7LA 3GPBA 4OIFA 2HCJB 2O7VA 2VPZA 2BRUA 1NUSA 3EXEA 3JZIA 4RF4A 4D8VA 5LQDA 2YHIB 3O94A 4BKQA 5CIYA 3N2LA 1ST3A 3QFCA 1M2VA 4GMFA 3CRZA 1GPDG 3D4NA 4NC9A 4LISA 3V8NA 3MGGA 4AUEA 5I4CA 4BO3A 4KN6A 1T9DA 2QQ0A 3FRJA 2DH6A 1Y8RA 2KMLA 3FGZA 1O95D 3SR3A 3H6GA 3IAHA 2DGDA 3QFRA 3PDCA 4JUBA 4UHFA 2CJFA 2V0NA 3LP6A 1EVEA 3AL2A 5FUBA 1X7WB 1B4DA 4IXMA 5ARBA 3TG2A 3A3YA 1OI4A 1B15A 2P4EA 4YMSA 5F1PA 2F48A 1EUDA 2VRCA 4Z99A 3K72B 2V7WA 1SULA 3W3ZB 2QLMA 3PTLA 4P7FA 4AXBA 1WCWA 2PBZA 4DSZA 1R0YA 4F8JA 4EYGA 4DYVA 1T8UA 2FN3A 4XLLA 2ZRIA 5DTIA 4XQ0A 1QTIA 3N5KA 1KZ9A 5EJGA 3UK6A 1L4LA 4PGMA 4DRYA 4BGVA 2QROA 2VTEA 1O0BA 5SZIA 1X42A 1T4CB 3UMRA 1TQ6A 3N39C 1MR3F 3H2JA 5B3JA 1XMPA 2Z2ZA 3GBSA 4RY9A 5AKKA 3AEYA 3IP5A 5BXQC 4U7DA 1DKLA 1RS0A 1T34A 2HSJA 1FQKA 3UWOA 3E9QA 4JOCA 5LIPA 4M0KA 1GTSA 1Q16A 2MR6A 1ZEMA 1QK5A 3LAWA 1YDFA 3QPAA 4OFWA 1H1TA 4GYWA 1E1RD 1F6WA 3MMZA 4Y30A 1QU2A 1EKXA 4NARA 2QLJA 1HDZA 2VJKA 3ABSB 1DQZA 4G5OA 3KJGA 4OIMA 4WNCA 3C6XA 5CYPA 4KGZA 4ZOBA 2XCTB 1J1IA 2RGAA 2VWHA 3A70A 4PAGA 4ARZA 4FFMA 5TT0A 3WLEA 1GPWB 1XQVA 2XI4A 4FHCA 3TFWA 4CZ2A 1Q83A 5MF6A 1WU7A 4HN4B 4QVIA 4PNEA 3KV1A 3MILA 3AF0A 4NYIQ 5CLJA 4URWR 5CYGA 4URYR 4OXQA 3RKRA 1C8LA 3AOGA 3IR6A 1V6CA 4HX9A 4L07A 2JVKA 4UE2A 3HP7A 1P0IA 3VSBA 4OJKA 2RGYA 1JPUA 3AX6A 3Q72A 2F7SA 4XFJA 4EKNB 3ER8A 1LA2A 2QYOA 3LBNA 4ND2A 2WK1A 3H2YA 2IIPA 4I9UA 4UEKA 2QUIA 3RSFA 1JSCA 1XNJA 1Q11A 4WHMA 4DDVA 2X0IA 1SUBA 4TPKA 2LDBA 1FNBA 1VHJA 5I5EA 1AUPA 3ZGOA 1JAZA 4MDEA 2DE0X 4ZHSA 2PZMA 4PHGA 4TV8F 1J8FA 3TNDA 2ZB7A 4CHTA 3U4QB 2G36A 1PX2A 2QU8A 4U8GA 2R6R1 3M4NA 3NBUA 3D5QA 1CNMA 4K81B 3CFYA 4F97A 3K0KA 2CUZA 5B2ZA 2Q49A 3W5AA 1K86A 1YMVA 4GF5A 3H5OA 4MWCA 4NMMA 4RPGA 4QWWA 1NZFA 2B2CA 3A10A 5FA8A 1QNFA 3SR0A 2BR5A 3UEOA 3W8NA 2P1ZA 4KPEC 3A1UA 1MC8A 4F60A 2XTJA 3DMGA 3FM9A 3L0IB 4Q03A 1FFYA 1NW9B 4FLEA 1Q7GA 3QOYA 4BZZA 5IF9A 3BF7A 4GOJA 5FEMA 1TMKA 1C0LA 1G7CA 1N0UA 1SBIA 1ULAA 2P9YA 2XITA 5ERXA 3KVRA 4KQWA 3ROPA 3S99A 1WPGA 1TKAA 5CUQA 1AQUA 1VYUA 3IJ5A 2ODPA 2ACVA 3ADOA 3OTHA 4C3ZA 1YFKA 3C14C 3WA7A 3V2IA 4LZZA 2YKGA 4Q19A 1TTHA 3A31A 3QTBA 1O89A 4S1TA 5LDGA 3L6RA 4MPPA 1XHEA 2GFQA 2PUVA 5EERA 5AQEA 1YS9A 3T7JA 1RPNA 4OMDA 1EGQA 1XL1A 4B4VA 5ITSA 2NYAA 1EI9A 2DPGA 2QT0A 2BUBA 4MUEA 5BSUA 2FA9A 2GNPA 2C98A 2H63A 1WXEA 3C7CB 3WLRA 4EI2A 4EQ6A 1GGJA 5E4YA 4W1RA 3GD7A 1CUUA 1U5BA 2FMXA 4J4HA 4JBIA 4G01B 4BB5A 3C6KA 2PMBA 2E18A 1R66A 1FF9A 1TFUA 2ZI7A 4TS3A 4BV8A 3X1YA 5EXXA 1KEPA 1KZGB 4AFNA 4QJ3A 3ZUGA 4GX1A 1QFSA 2JGMA 1E1CA 3QHAA 5JAOA 4XX0A 1O58A 2I2XB 5I47A 1U0BB 4AY2A 2D1SA 4KZPA 2B61A 4AMGA 4AO8A 5A02A 3BD7A 2FFHA 4YH1A 4M8LA 2GBIA 4KN5A 3P2IA 4MS1B 2CXUA 2VYFA 1ZCZA 4R8VA 3E22A 1N2ZA 3MLAA 1IXZA 1NJ2A 4M0MA 1Y5MA 4UCQA 4R0NA 5AD1A 2BF7A 2QNBA 2PYDA 4JCCA 5LJLA 5C9ZA 3LJKA 3LI2A 2IS2A 3Q1KA 4L8GA 4XVQA 3K35A 4EYQA 4RLHA 1NQ5A 5D2CA 4I6EA 1FYDA 1KO8A 3VJKA 4PLTA 4D5EA 4FYJA 5J1SB 2QQGA 3OIYA 4LYAA 4MYSA 5LP6C 3S27A 4LYEA 2G71A 3O74A 1YASA 3LLMA 1BS9A 2HJRA 4LNHA 1SU7A 2W11A 1P17A 2Q6OA 2ZSFA 3ZCTA 3G17A 5IZCC 1V1MB 5FHRA 2HT1A 1NLMA 1NG1A 2OKCA 5D5HA 5BOSA 2DH5A 2RBGA 4NWIA 2G67A 5BY2A 5HZMA 3CZ9A 4QUEA 3W1EA 2GJ4A 5B2FA 3PLAE 1SCKA 1X1CA 2NV6A 5DMXA 2B94A 3QVXA 4HK4A 3H6KA 4I14A 5BMVF 4W8OA 1ULZA 1BD4A 5AOBA 1HG1A 4CN9A 1F38A 3LP5A 1P72A 3NM6B 4RL6A 3VO9A 2JCYA 1U7WA 4MV8A 5HVNA 2XAUA 4UFNA 4CMEC 1ESDA 2OYSA 4XIIA 2EJBA 4NFLA 5A2GA 5DTMA 2QL6A 1S8FA 2QX9A 4OUKX 2W2OA 5IKEA 4Q3LA 2IYXA 2XOXA 5L8VA 3BXPA 2GAOA 3LC0A 2VK2A 1G8SA 2EX1A 4R1UA 1DAGA 3MYRA 3RYTC 3IX7A 3AUSA 3KTAA 3FOBA 1Z47A 3Q1LA 3DG9A 1AOXA 3QU9A 3U62A 1Y6RA 1B41A 4AZ0B 1J25A 3BKXA 3T9EA 2RK6A 3KB1A 5JH7B 3CLTD 3TW8A 3H6HA 3N7AA 2PZAA 2EYUA 2FPGB 4HMPA 2DKFA 2BFWA 3K5IA 4AQ7A 1E7WA 2VBFA 4TLCA 4LF8B 4R6XA 3PGMA 2Q3FA 3AZPA 3BZUA 4GPD1 4WMLA 1JBKA 4KR7A 1ZN9A 1X9HA 3FYUC 1DIAA 4HLQB 2I55A 1GKYA 4NU6A 1GT91 3TF5A 5REQB 3EYWA 1TKCA 3JQ9C 1WXQA 4EYSA 2HRQA 3E4CA 1AKEA 2HLNA 4EH1A 3X1JA 2PX4A 2JEYA 4BMOB 4OGFA 1ONNA 2BGLA 3PIDA 1J33A 1LLUA 3AEUA 4RXUA 4H4DA 4ZQCB 3VPFA 2RE8A 4MUYA 2O19A 1J0DA 4YDRA 1P5RA 5DIZA 1RAIA 2AVNA 1T6YA 4R8KA 3ZLVA 3AY6A 2ZCJA 3AUFA 3STVA 3PGLA 1RRPA 1P2TA 1SUIA 1XLVA 2IUUA 1E5XA 1Q15A 3D59A 5CLLA 4QRHA 5E0OA 1T24A 3HCAA 1L4EA 4DA4A 3N5CA 1QIHA 5KMGB 1E2DA 3B9QA 4OX9Y 9LDTA 2O8CA 3L7LA 3LQYA 4II2A 4WBSA 1S2OA 3T0FA 1JQJC 4NEHB 2IELA 1BTOA 1G8GA 1F17A 2D00A 1SOMA 3V4ZA 1TF7A 1VG8A 3WRYA 2A9QA 1TVEA 1Z5UA 2FAXA 2JK1A 1ORVA 3ER6A 4FOPA 4JY7A 4RF3A 4FM9A 2AC4A 3W0LB 5JRJA 4DCVA 2R8RA 1R3UA 3I58A 5JQGA 5ILQA 1R0ZA 2ETVA 3H3FA 4L7QA 1L5SA 2GO1A 3FBTA 1BX1A 1TT5B 1C8KA 1XELA 2PRJA 3GMTA 3IALA 2IEZA 2LCIA 2LV8A 4K9SA 4WN9B 1RZ3A 4Y7CA 2D1YA 5T6MA 4RXMA 1TQDA 3OESA 1E9AA 1DKPA 2JHAA 2QAGB 3QXHA 4KUGA 4WOPA 2ZWAA 4F72A 1J0AA 4D9GA 3V2HA 1H4VB 2D3WA 3LPDA 4QG7A 4RQUA 4UEOA 2NTYC 3KTOA 2VYQA 1EQ2A 4M1EA 2RHHA 4PFJA 1XA4A 1JHDA 3PRYA 2F1HA 4AX4A 4R0MA 2GKSA 1CQZA 4RENA 5LKAA 1PQ4A 1QZXA 2YOFA 2JB9A 1HF3A 1WWKA 4TTVA 4NXNB 4TROA 3CUTA 4Q4HB 4TXJA 1AA9A 3RT7A 1JIUA 1RLUA 1RRFA 3MMXA 3F3MA 3NONA 3DD1A 4MW0A 4Y9SA 3UA3A 1PTJC 4CM6A 5IABA 4L5JA 1MOZA 4TTSA 5JCPA 3ZWQA 2XDAA 4K0KB 4JEMA 5CK5A 4D4JA 2WWWA 2P9TA 2RJNA 1U9CA 1M5TA 2VK1A 1N1MA 2H48A 1T1SA 3C74A 1N92A 1GCUA 1NI5A 4F12A 2GTIA 1S89A 2P7HA 3DE7X 4JEIA 5DNVA 2XNJA 3K5HA 5HRAA 1AY0A 1VXOA 1NI4B 2PL5A 4AJ1A 3BXHA 3JR7A 3L40A 2ZTSA 1K2VN 4ISBA 1QVVA 4ZAGA 5A6SB 5IC4A 3UJBA 4ZCSA 3BIWA 4HGQA 1MLDA 3CX3A 3O1IC 4Q6WA 2M6RA 3ILHA 4BGIA 3V3KA 3OFVA 1HE5A 4WZBB 2ROQA 5EOVA 2MMCA 4DR1B 2MR5A 2IYWA 5GWXA 2YDYA 3LK7A 1LLQA 2ZOSA 1HC7A 5IS2A 2QG6A 4JQYA 4F1JA 4D44A 2WQ6A 1E7MA 2E5FA 2A1TR 1W48A 2ZBFA 1IHYA 3N7TA 1ESZA 1QHGA 5FTMA 2C3YA 4O5AA 3T52A 1MFPA 2FMUA 2YZKA 5CCXA 1U0JA 5KVVA 3CKYA 4BC0A 1LLCA 3FDFA 5A05A 2NVOA 3RJTA 1Y9ZA 3L8YA 1QHYA 3LHDA 1JVNA 1QVWA 1CJCA 4G2NA 4LJKA 4HZUA 4OI2A 4X6UA 2FE4A 3P96A 1W5TA 2FX3A 1P29A 2JRLA 2ADMA 2WD7B 3DTTA 1I1NA 2J9GA 2NUTB 3AU9A 4HAUA 4LNUA 3JWJA 4RKEA 3B51X 4V1CB 3CINA 3PC8C 5CVDA 3HABA 1QOPB 4JVSB 1T25A 1XMXA 5C1IA 3DNFA 1NX9A 3GEGA 3U44B 3EPRA 4IJMA 1K8ZB 2OZPA 4J49A 5EHXA 2WU8A 3WKEA 1IEVA 1ISSA 2LPMA 4CYMA 4JI0B 5E4TA 2EHDA 3L04A 3LA6A 2A58A 5EXDA 2JI6A 3CC8A 2VKTA 5AI5A 4D1YA 4RXTA 1TMYA 1IONA 2JATA 1NURA 1EWRA 2BTQB 5K3BA 4CU5A 1XWIA 2VDWA 4P0QB 1P45A 3RROA 5E9WA 2W2NA 3WGTA 5JPCA 3W6PA 1FU4A 4JLNA 1YI8A 1XLWA 4URUR 5DGIA 1GG2A 1JAYA 1E0SA 1DTWA 1POWA 3HLKA 2GF9A 3G2JA 1P33A 5TVKA 3RTCA 3JASB 1AKNA 1TK2A 3CZ5A 3IIKA 4HXGA 2C5LA 4C21A 3VTFA 4UMFA 1GL6A 4QDTA 3VSAA 1Q1ZA 4MUNA 1SHTX 2GCPA 3H9JA 1ZMXA 3HJRA 2C4TA 5LL6P 4XRGA 2K5UA 4LZWA 3KYDA 1T10A 2H1VA 3O8OB 1I1OA 4EY4A 1WVIA 1WZCA 3VZCA 2NZVG 1SG0A 3H8VA 4S1WA 3SHTA 4CV2A 1GAEO 2PXXA 4M8NE 5IFLA 4ARIA 3D5TA 5B58T 5FLYA 2RH8A 1AS0A 3CA8A 4D43A 1HM5A 4F4CA 5JNLA 5HILA 5MN4A 4B3RB 4J3NA 1I2CA 3VPXA 1R4MB 3B60A 2Q28A 2I99A 2EDCA 2I3DA 2CXSA 3BF8A 1E2QA 3MM4A 1TYZA 4MDYA 4W5OA 4IS3A 4Q9HA 4BFYA 3ZQ4A 2J0SA 2PY6A 4GD3Q 3RJ5A 3A4YA 3MMNA 2Z2XA 1JQDA 2Q21A 3C24A 3T95A 1LPMA 3EPLA 2GESA 2C94A 3SR4A 3KG2A 1CDEA 2YVLA 4L5AA 2CF5A 1NSFA 4MKXA 5EZQA 4BVJA 3RC1A 3JAMA 4FHZA 4X60A 5BSGA 4ANFA 1L4UA 1QONA 1W94A 4ZMSA 3W2TA 5CB4F 1XX6A 1TVKA 5J2UF 1AKUA 1TM5E 4W8HA 4RIIA 1IPFA 3EFOB 2I8LA 3DP7A 1KL7A 4H1TA 1CR2A 3KKOA 4CL8A 1GZSA 3IC5A 1OZHA 1L4NA 2HSZA 2AXEA 1J8MF 1YC2A 4IDCA 3UMYA 1X92A 3OEEA 5AP9A 4AY3A 2O2YA 2OK7A 1KRHA 4EKDA 2GEFA 3EVCA 4LDZA 3V1MA 2W2MA 4ZYUA 3F4BA 1IOVA 1C1XA 1MAUA 2NQ8A 2R1VA 1HY3A 1ZI8A 2G9VA 2Z4RA 3H4MA 3CURA 1TQ2A 2BGUA 4K28A 4MUJA 4ZCQA 1XRPA 5I8ZA 3AF4A 3W5CA 1MIOB 3GROA 1TZBA 3ECCA 4TL8A 1VPTA 1EDEA 2J8ZA 3MTJA 4IEIA 4Y0VA 3KNZA 5J9FA 1DDOA 2PT5A 4H7PA 3ETGA 5LB4A 5HJ7A 3ASZA 3KR9A 3GRUA 2QQFA 3ML1A 4IXWA 1XDWA 2QGZA 4MIOA 4QBTA 2A1IA 5G0WA 2AOUB 2FZCA 3QLVA 2YRWA 1V39A 3C48A 3M2PA 4HATA 5JPIA 1OLUB 4CDRA 1WSBA 4EYEA 1Z5VA 3EF3A 16PKA 1PGNA 1U7TA 3TUIC 5FWXB 5E0KB 2JD1A 4Z4CA 4CTMA 4FSDA 4Z0TA 3RAJA 1AF4A 4WTOA 1THGA 4BZXA 1L4MA 4LJ9A 4CQMD 5KWJA 2H57A 4TGLA 4WKBA 1I3KA 2EIXA 2OHIA 4BECA 2QRUA 5ADUS 4H17A 2BMJA 4K8OA 1OVGA 1UBTS 4HAXA 4CFZA 4TKUA 3IQDB 2NN3C 1R4NA 2QRLA 5C0OE 3OIDA 1QV9A 4MWGA 1QG4A 4G67A 5EGSA 4FE4A 4MMXB 4MYTA 5KOJB 3D2CA 1UXJA 2QVBA 2ZWPA 3OJWA 1XU4A 3SM9A 2YN2A 3DMPA 3WL5A 4ESVA 1X80A 3M6VA 3OIGA 2VHWA 1CQJA 2OOKA 3E3NA 4CEIA 1U80A 4UUPA 2GVDC 4BBAA 1T0PA 4Q4AB 4KRGA 4B1FA 3ZNNA 4E2XA 4JI2B 3C3KA 3KB8A 1NSTA 4C4AA 721PA 1M1YB 4B75A 2JG3A 5ALTA 1OAKA 2WYWA 4INZA 2REOA 3AUKA 1QTNA 3D8SA 6YASA 4TS4A 3WZMA 1ODFA 1TIBA 3ELDA 4NCBA 1DXOA 4X6LA 3H9EO 1Z6YA 3PRJA 3Q5GA 5T8KC 3L8HA 5DMHA 1JJIA 3F96A 3L8GA 1EGMB 5E8JA 5EIWA 4NYJR 2YYYA 1E79A 2X0KA 5DP2A 5H3CA 4E0BA 5E7QA 4KFTA 4HF7A 5KWSA 1SIOA 2ZYGA 3EAGA 4MUHA 1XFDA 3OP1A 4HLCA 2I34A 4FLMA 1CQIA 3QJ5A 5AO9A 1QF7A 2D5BA 2Z8XA 4IVQA 4ZANA 5IBQA 3QVOA 1RLMA 2VHVA 1CR1A 2QN2A 4QTYA 2OV6A 2IU3A 3AY3A 2E3JA 3F7MA 3M3PA 3ND6A 4MKGA 2LTAA 1RRMA 1I0LA 3IHTA 3OAAA 1A27A 1NR5A 4AS1A 3WNDA 1OV4A 3ETDA 4DQKA 5D86A 1VL8A 3RC8A 3DONA 2VF5X 2WVAA 2RK3A 5GMOA 3GEHA 1HL3A 3KR0A 4AQYB 4O25A 3T7TA 2FEWB 2X7JA 5IT9A 1P2DA 1M75A 2B78A 3SC2A 1A1SA 4CDNA 2WZBA 2P65A 3MTDA 3CF0A 3JYOA 4C6TA 1EFRA 4EMTA 3PJGA 5GY7A 4U2FA 3ST7A 2GD1O 3EA5A 3HJCA 3MS4A 2QA5A 3U7RA 3BMOB 4PIPA 3ZY6A 4GOOD 4MKIA 1Y3FE 3CMCO 5GV7A 4J07A 3TGPA 3K6SA 3HJHA 3ROQA 2YHBA 2C9DA 2A6PA 1WEHA 1XRNA 2DQYA 2OORC 1G3QA 2JAQA 4G8BA 4HMQA 2RC6A 4FOLA 4DIKA 2NU7B 3NYQA 2V1UA 3GEIA 2X40A 2WM9B 1EFTA 1Z2NX 2WE8A 3O1JC 5G1NA 1N4AA 1XDBA 3TRJA 3G1WA 2PGNA 1VYVA 2ZAYA 1U8YA 5LBIA 4XTRA 1N0WA 2PT7A 5C3UA 3EZFA 4D0RA 2FW0A 4EFMA 4D25A 1LJUA 1VSVA 1P2FA 1UK9A 3DMRA 3KD3A 1J1ZA 2E49A 3U3OA 1D6SA 2EFYA 1KH1A 4DLKA 5C5CA 3E5MA 4K26A 5IVKA 4Q1AA 4G9BA 1MAWA 2Z6VA 4B3DA 4JVOA 5B55A 2D6FA 1W29A 3HUDA 3IPRA 4P3KA 2D8MA 3D4IA 3OWHA 3PUJA 4UPEA 4CEJB 3HU2A 1IHUA 1Z5WA 4IIJF 1N8TA 2ECFA 2XA1A 4KVZA 3W06A 2WFLA 1LK7A 1VJRA 1WL8A 2LW7A 3HKEB 3TJRA 3TW0A 3PR3A 3RFXA 3ROXA 5BV0A 1YZUA 1H1LA 1QJCA 3RV3A 3S40A 5DHTA 1Z2AA 4N54A 2AMLA 4NOKA 3TQSA 3W90A 3PQ7A 4BO5A 2NTVA 3MTAA 5JO0A 1UC4B 1V45E 4K6GA 1E7RA 4LFBB 4TKZA 2V7XA 4IO0A 2CYAA 4CLRB 1E1QA 1YZQA 1ZJ6A 1PNVA 4HDKA 5BV2P 1E9DA 2PRZA 5JZ9A 2WTBA 3L8FA 3O93A 4IFIA 1IU9A 3VDRA 1PR1A 5BXYA 1DWUA 4BUCA 2WIAA 2XVXA 1KZ6A 3M9WA 2GM9A 4J2OA 2V6JA 1JFLA 1RQ2A 2AOTB 2FTKE 3ASYA 1CZUA 3NWJA 4NX2A 3S70A 3M1AA 5J5AA 4RTKA 3MWEA 2VHZA 3R9XB 3T1OA 4XA8A 3CWQA 1PJZA 3RGGA 4ZDJA 3ORSA 2IX9A 4S12A 2Y4OA 5F3DA 4AJ9A 4B82A 4DMFA 2ZYIA 3GRYA 2WJHA 4N9WA 2X15A 3S2FA 2DR3A 2FSPA 3FZYA 2OY0A 4UUNA 4KMOA 4MX8A 1KEEB 4IWXA 5AKJA 4F86A 5CDFE 4X1IB 1F2TA 1VLVA 3F5MA 3G1UA 2LKCA 4HZGA 1R2QA 4FWIB 2Q2WA 1K75A 3OLQA 5CXUA 2G07A 1AK1A 1X1DA 1W0KA 2VJCA 4YB8A 4A0SA 2HK8A 2JK0A 3WLTA 4ZK6A 5JVDA 1KWKA 1WW3A 1G2IA 3UBTA 5A71A 1HE1C 4DTCA 3OU7A 2QBYB 1LEHA 1ATIA 2AQ8A 4WWHA 1DUVG 2CMDA 3JQDA 4G8DA 4I0WB 4W82A 3A4TA 5CVVA 5FUWA 2I4OA 2OTCA 1OAOA 2AD1A 1E96A 3KJNA 4LOJA 4MRMB 3Q41A 1P4GA 3ZD8A 3ANMA 3ZWNA 1MO5A 1DPFA 1Z82A 3EEFA 3LE8A 3WJ1A 2WU3A 4D97A 2A0YA 1Q77A 1G1MA 1RQ7A 1Z2EA 1OA1A 3N2ZB 1Z7YA 4WPGA 5BQPA 5JJBA 1JYFA 1L7EA 1CHNA 1X1SA 2CSUA 1C2YA 3SIPA 2Y0CA 1DBQA 1JU4A 1XCBA 2IP2A 3B2EA 3EG5A 3RU9A 2YOHA 1G98A 2I3ZA 3GFRA 2PA0A 4J0QA 4OL9A 4M6WB 2H4XA 5DLEA 3LC2O 3K16A 2MIIA 2Y1CA 3E70C 3MIZA 2RSLA 4TN5A 2XUZA 1SOUA 2QB5A 5JYBA 1JUDA 4K9KA 1I6LA 1DCKA 4JK3A 2Y1FA 3B6JA 4F11A 2OUKA 3E23A 2AG1A 2XB2A 2YQ4A 2FQ1A 3PA8A 1TMGE 1MC4A 4YMGA 3L7OA 2PKEA 3L0CA 1VCHA 4J0DA 3L6OO 4XGKA 4URXR 4I1UA 4TMFA 2G9NA 1ML3A 1U28A 2Q4OA 3HDHA 4XCVA 4ZXPA 4BJ1A 5H8WA 5FHQA 4LEIA 1T8TA 1RZRD 4LQ4A 4REOA 3EPHA 4DA0A 2EV9A 2Q07A 1X94A 4RGBA 4CG0A 2M6LA 1NRXA 1AZSC 2EBWA 2JFQA 3PYXA 2YJTD 2FFAA 4AJEA 1KDTA 1Q19A 2GMWA 2P9HA 5EWJA 3W5SA 3SBDA 3QZUA 5FFMA 3FNFA 4H6XA 5EE1A 3KOYA 2VQFB 1E6WA 5FUMA 3A9UA 3AUXA 1BYIA 1W52X 3GAAA 2JFBA 2PXHA 1E1LA 3GJ5A 3ZZMA 3GAMA 3IBFA 3RVSA 1MMFB 2GX6A 1BKSB 4B3CA 5EZ5A 2WAYA 2X5KO 5IK2D 521PA 4YC7A 1RR6A 3KSDO 1C7QA 5JAIA 4XYLA 4CIWA 1E64A 1KYTA 4W5TA 1I0IA 4KJXA 4NPCA 3P9XA 1AHNA 1YZLA 3A8TA 3KXLA 4M83A 2VT7A 2ONJA 2H9AA 2FMHA 1FDOA 4TLDA 4CT5A 5AW5A 3M3HA 4TT8A 1KSJA 3LC1O 2OV4A 5ALEA 1WTCA 2OXFA 1RZVA 3D1JA 4U3JA 3UPDA 3KE8A 5BN1A 2Z8YA 2JIDA 5HR5A 3UUEA 3FTFA 1M6YA 5J2UB 1VCNA 5EIBD 3WSVA 3EA0A 2REXB 2Q2QA 1D2GA 4Q7LA 1U3DA 3LD9A 3FN4A 2HAEA 1E2FA 1GOTA 3PGJA 5I45A 2P5TB 2Y68A 3KHKA 1XDUA 5THQA 2HO4A 1GUAA 2GQ0A 3TBKA 3ZV3A 3Q6MA 3MZ0A 2XRZA 2P78A 1VE7A 2AFIB 2ZB8A 2Y0PA 3KHUA 4PS0A 1W4BA 3BEOA 1NKVA 3WLSA 2RAPA 3IVXA 4FVTA 2J6BA 4B32A 3ZZ1A 1Y7HA 3LBAA 4Q7EA 2W6ZA 3W5IA 1B2LA 1B14A 5CDSA 4UBKA 1R6TA 2OHXA 2Z2JA 4Q3CA 4OFXA 3C5HA 5JD6A 4GKVA 2FN9A 2BBTA 4MLZA 1GFZA 2VXYA 4HLNA 4RMGA 1ZU5A 1BJTA 1JW9B 2XW6A 3DLBA 2CW5A 2ZKIA 5C32A 3LUPA 3D4BA 4RHTA 1VECA 4FFOA 5T4HA 1YUMA 4CR6A 1JXMA 1A9XB 1UJ5A 1SU4A 2HF8A 2NACA 2OV8A 1PVDA 3E84A 3QKUA 3T9AA 3U4QA 4WY8A 1QGED 4Z4EA 1EK5A 4HRYA 4L76A 2C9MA 2PV0A 4Z0HO 2HU8A 4I19A 4PAOA 2JCSA 4V0SA 1RJ9A 3RTGA 2JI4A 4MYDA 4WLNA 3N0XA 4BQRA 1W581 3I23A 2FV8A 4QYXA 3W5VA 1DARA 2VF2A 4IKEA 2E1PA 3IV6A 4PC6A 1VKNA 4F7WA 3D7SA 4H3HB 2H1HA 3BD6A 4EB6B 5CCEA 4IVRA 1O94A 4MW5A 3OLZA 1PFUA 4Z8YA 3V1YA 3U7FB 3KKLA 2JLAA 4NE7A 1F8UA 2ZPTX 1Y82A 1N9KA 5JYDA 5LP6F 5EKSA 4L5YA 4DC1A 4NBTA 1WCV1 4M9RA 1Q0UA 1T5OA 3OIWA 5SY4A 4EFLA 1I94B 3B1JA 5JCJD 4WEQA 1KIFA 4I66A 3QNMA 1CJUC 1UWLA 1MVLA 2IE0A 2IE8A 3PQ5A 4IZ6A 2X7XA 3QKSA 2VJDA 1VPWA 1OBOA 2WG0A 2FJUA 1K5PA 2V74B 2V97A 1BMDA 3WIOA 3C97A 3LY7A 3NTRA 1UWCA 2GGSA 1OFUA 1ZQ9A 3WWDA 1INLA 1TLTA 4UKDA 3TSZA 4B43A 4GI5A 3G0DA 1K9VF 2PJRA 3ANTA 1G8PA 3T9FA 1AQYA 2IPOA 2DU8A 2R7AA 4OQMA 5K0EA 4HNVA 3STHA 3BGOS 3LHKA 2L0XA 4QO7A 3RRBA 4WNIA 2L18A 1M72A 1QUEA 2Q4TA 5B64A 5DXJA 2ID8A 1PYOA 1QIIA 4GVPA 2X1MA 4K7JA 5JE8A 3RYIA 1AK9A 1WCYA 3HM9A 3I73A 4DRXB 4B7AA 1IZ8A 1V48A 4AUMA 4A1OA 3Q8WA 4U6SA 1IWPB 3JYQA 3C7AA 1LNQA 2Z98A 4HTFB 4FT4A 2OM2A 4ZQHA 1CVLA 3W2FA 3NUQA 2RH9B 4XJTA 4MS1A 4INAA 2W7TA 5T41A 4PC2A 4I8IA 2VPIA 5DTEA 1N8KA 4DRZA 1LF0A 4HH4A 5B5SA 1XPRA 4I1PA 4G6ZA 3VJRA 3FRIA 4FX5A 3PF8A 3Q3EA 1PDWA 4RZ3A 4DIUA 2WYIA 1A1VA 3K2QA 2Z9BA 2WQ7A 1ABEA 1WM1A 3DXXA 3USZA 5AM2A 1DXYA 2VA9A 4OLAA 2FCRA 2FWPA 2VP6A 4MW1A 2VP4A 4R3WA 3X1DA 1YJ5A 5DHAA 2CXRA 2N46A 2FMKA 3P2JA 2CNOA 1H0HA 4JVLA 5BNTA 1T1EA 4C1BA 3L84A 5EIAA 3OQNA 2IEDA 5LLSA 4IEFB 2JHGA 1JDUA 2FOIA 2IHVA 4U7GA 3P9CA 4C7KA 4A6PA 1G59A 1DKMA 1E2MA 4X1KB 2HDHA 1SVSA 4KYTA 3ORQA 2C8KA 2UYQA 4NYIR 4EF4A 2QZ4A 1KDVA 1KZ4A 1NJ8A 1RXIA 3VNSA 3LGAA 1UFOA 2C2YA 2QQ5A 1JNYA 2EKLA 2FQYA 2NZYA 3KZNA 3QVTA 5B1DA 4K9OA 3UHFA 5HKBA 1KRWA 2JJ2D 3GJ4A 1Z4KA 2JEOA 2JFYA 2W43A 2AI1A 3SOZA 1PNRA 4MHOA 3AT1A 4JI8B 1T2UA 2JI7A 1FYFA 1QJ4A 3R0VA 1A7JA 2AA3A 4QSMA 4AF6A 1BMFD 3P27A 4HX2A 1XMVA 1N5IA 1DDIA 2BI8A 5GV8A 3ZV4A 3K9FC 1OFVA 2EJTA 2ZI9A 3G79A 2DHQA 3DFZA 4KQEA 2YW9A 1CD5A 1T3ZA 2CNWD 3L0DA 3V46A 5FCDA 1FQWA 4IXDA 1EYZA 3TAHA </