4LNQA

Crystal structure of ifi202 hina domain in complex with 20bp dsdna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
195
structure length
195
Chain Sequence
GPHMKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYYRVKVFNMDLKEKFTENKFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-activable protein 202
publication title Structural mechanism of DNA recognition by the p202 HINa domain: insights into the inhibition of Aim2-mediated inflammatory signalling.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein/dna
total genus 40
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lnqA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lnqA01
1JJCB 2YTXA 4ME3A 4GKJL 4LF7L 3UDXA 3CMAA 1G6PA 1GO3E 2VQEQ 3I56A 1NE3A 1LUZA 2R6GA 4DV2L 2E5LQ 5C0XJ 1Z47A 4JI7L 4HJ9A 3BZCA 1ASZA 3AQQA 4PMWA 1SROA 2UUAQ 1JMCA 4B3ML 2V1CC 1IZ6A 1WCMH 3HOWG 4IPHA 4DK6C 1SFOH 4B3SQ 2ID0A 4X6AH 2AWNA 1MJEA 2YYZA 4JV5L 3CP0A 3G6EA 4NB3A 4HJAA 3VDYA 3UDGA 2BH2A 4OX9Q 3ULJA 1N34L 2EXDA 2D0PA 1XNQL 3S14H 1VQ9A 1V43A 1Y1WG 3F2DA 3S1MH 1K3RA 3UDIA 3CCJA 1PH2A 3KFUA 3CMEA 5C3EG 3KOJA 4DKAC 5AJ3Q 1P8LA 1NJIC 3RN5A 2R7DA 2AWOA 1ASYA 1VQAA 1Q7YC 3B6YA 1PH9A 1D7QA 3RNUA 4DUYQ 3G4SA 3PCOB 4A3GH 4QY7A 2ES2A 3CC4A 1IBML 3RZDH 5JJKA 4LWCA 3CAMA 1PYBA 2YV5A 4JBJA 1VQ7A 1N33L 1VQKA 5C4XH 4JI8Q 2F3IA 5C0XI 4GLXA 1X56A 2NZHA 1G51A 2WB1E 1Q86C 1M1KC 4DR5L 2VUMG 1X54A 2WB1G 2UXDL 1T9HA 4YWKA 4R1JA 3TS0A 4R4IA 4PZ7A 4BY1H 3HOXG 1MKHA 3TREA 4DR2L 2VQFL 3HFZB 2QA4A 4NXNL 4LF8L 3KYHC 1YHQA 2A1AA 4JI1Q 1PH1A 1J6QA 1A63A 5IP9G 1N32L 4DV0Q 4LUVA 4JYAQ 4JI0L 4LFBQ 4LFCL 1JB7A 4DR5Q 2UXDQ 1UE6A 4R4OA 2JE6I 2PI2A 5IYCH 1RIPA 1A62A 2Y0SG 4DV5Q 4DR1Q 3J81j 3T1HQ 2KCMA 3S17H 1GM5A 2K5HA 4IFDI 4X66L 4O0AA 4KHPL 1EWIA 4BBRH 2NZOA 1E1TA 1YEZA 2HIVA 4DK3C 4A76A 1XNRQ 3PV0A 2E2IH 2Q2UA 2PQAB 3EIVA 4XIGS 1PHJA 3NENA 4DPGA 4L5TA 3H0GG 5GAHC 3ULPA 1K8AC 4GOPB 1L0WA 1NTGA 2Q2HA 4YHHL 4DV1L 3S15H 1AE3A 2K5NA 2ATWA 4B3TQ 1QVCA 3S16H 4JI3L 1QZGA 3HOWH 3W5OA 4OWXB 3GD7A 2DUDA 1OXSC 2AKWB 4IOAA 4JI6L 3STBD 2D62A 3A0JA 3UDFA 5FLMG 2AMCB 2WFWA 4LF6Q 3KF8B 1XPUA 3GTPH 2NN6I 4DV6L 1O7IA 4JOIA 3M85A 4RG1A 4JI2L 1AH9A 4X62L 2E8GA 2KBNA 2UUBL 4JI3Q 3T1YL 1WJJA 1C7YA 3OYYA 2B29A 3ERSX 4QGUA 3CCLA 3F2BA 1YJ9A 3CCRA 4A3FG 1SRUA 1Y1WH 5C44G 2NVQH 3S2DH 4A3BG 1Q12A 5LMUQ 4TVAB 4AQYQ 1IXRA 1VQ4A 1HZCA 5C3EH 1K9MC 2OTLA 4HJ8A 4OO1G 2K14A 2PI2E 1QZHA 5IYDG 1FVIA 1XPRA 1X9NA 3W1GA 2ZM6L 1SN8A 1X3EA 4DR4Q 3LGJA 4LUZA 2JA6G 3TEHB 4A3DG 4K0KQ 4UY8C 4GS3A 4OWTB 5J3BA 1HNZL 4Y52H 2CWAA 2RF4A 3BU2A 4A3MG 1VQNA 1CSPA 2JEBI 3FKIH 4QJFA 5GQOA 5HGQA 5IE8A 4HIDA 3ZJYC 1OTCA 1KL9A 4R4TA 4LW1A 1SMXA 3GTLH 4GNXC 3S2HH 1B7YB 1WYDA 3U4ZA 1I94Q 2PNHA 1N8RC 4J15A 4BA1I 1EQRA 5H1SE 3HOXH 4X65L 2OQKA 2HQLA 4LFAL 4IO9A 5GAGC 1S3OA 2PQAA 2HT1A 2UXBL 1E24A 2K50A 4C3IH 3L2PA 4JI5Q 4GOPA 4JI4L 1P16A 4DV7L 5GROA 4NXMQ 1K73C 2D0OA 2Q2IA 3S1RH 1VQPA 1FJGL 1V1QA 4YCVA 4Y7NH 4LF5L 1JJGA 1XMOL 2R7FA 3PUXA 4H02A 1K83H 4P73A 4UP7A 2Z6KA 4B3MQ 4A93G 3J7A5 3U50C 1HNWL 2DGYA 4WJ3M 3UE0A 4GKJQ 4LF7Q 2R7ZG 2MO0A 3U4VA 2Q2TA 3I4MG 2N49A 3MXNB 4DV2Q 2HHHL 2F52A 2JA8G 4BBSG 4KLKA 4JI7Q 2EQSA 3HOYH 1PH5A 2VW9A 3PIOA 4A3JG 2OQ0A 5LMNW 3H0GH 1HZBA 5M5XH 2F4VL 4DAYB 3J80i 1HJPA 3D31A 1SLJA 4JV5Q 4JOIC 3RLNA 4AH6A 4POGA 1Q46A 1E1OA 1UEBA 1WFQA 4FDBA 4A75A 2JA5H 4LUOA 2CWPA 2LXJA 2RHSB 3GTGH 1B70B 3EN2A 5FLMH 1VQBA 4L5SA 1VQFA 3I4OA 2WP8J 1AE2A 4L5QA 1N34Q 5IYBG 4YY3L 4A3EG 1XNQQ 2UUCL 4BY7G 5LMNL 3M4QA 4A3IH 1OXTA 2IX1A 4DAMA 1B8AA 2JA9A 1LM0A 2NVXH 1EYGA 4A3FH 2FXQA 3PUVA 4A3BH 3FHWA 2N78A 3E0EA 1IBMQ 2OTJA 4GN5A 1L1OC 2QGQA 3HKSA 5BR8L 3AEVA 1YJNA 2ZTDA 2KHJA 1N33Q 4A3DH 1PFSA 1WOCA 1YITA 1YHBA 2B3GA 4A3MH 4DNIA 4DR3L 2XTIA 1TXYA 2ASBA 4DR2Q 3I55A 1W3SA 2VQFQ 4GKKL 2A19A 1X65A 4NXNQ 1DGSA 1D8LA 1YI2A 4LF8Q 5BR8Q 4X64L 4DV4L 5EAYA 1W2BA 1N36L 1NMGA 2ALYB 1N32Q 4MNOA 3IRBA 4DUZL 2VY3A 1KQSA 3RN2A 1YHAA 2XGTA 4KHZA 1PH6A 4JI0Q 4LFCQ 5M3FG 1VQHA 3J7ZC 1HR0W 3CC2A 3STBC 5JEAG 1KRSA 1QVFA 3JAMi 2UXCL 3AFPA 2HIXA 3GTKH 1MJCA 3K0XA 4C3JH 1E7ZA 3M4OH 1LTLA 3KF6B 1V9PA 3CF5A 4HIKA 3HOVG 4LF9L 2JQOA 4IPGA 4YCUA 1E22A 4X66Q 1X55A 5FLXc 3DLLA 4KHPQ 4HIOA 4A3LG 1WCMG 1YNXA 2YTYA 4A93H 3PSIA 2VNUD 3H15A 3I7FA 4P74A 3FP9A 1PV4A 1E3PA 4MTNA 2ZJPA 4PZ8A 2R7ZH 3ICEA 4YHHQ 4DV1Q 1TWCH 3I4MH 2R93G 1YZ6A 1EUJA 1YVCA 2JA8H 3EBEA 4BBSH 1G291 3CCSA 4OWWB 4A3JH 1HR0L 2VS1A 4JCVE 1A0IA 4O2DA 1UE1A 1FGUA 2ZJRA 4A3KG 4GLVB 2YTVA 1VQLA 1A8VA 3J80c 2N8NA 2A8VA 2I5LX 4UP9A 4JI6Q 5IP7G 1Q82C 1HZ9A 1VQ8A 3M9BA 1CKOA 4DV6Q 3KDFB 1I6HH 3A74A 2GN5A 2IHFA 4JI2Q 1BBWA 3GDEA 1VQJA 4X62Q 2UUBQ 4QQBX 3RLFA 3T1YQ 1VQCA 5IWAL 3NELA 4DV3L 1J5EL 1I50H 1S72A 4BA2I 3CCQA 2IX0A 2MO1A 4AIMA 3CCUA 4BY7H 1XJVA 3TS2A 3PO3G 3OTOL 3L0OA 1PH8A 2QEXA 4BXXG 1IBKL 2CFMA 4YWLA 5JEAJ 4DR7L 2I5MX 2VUMH 1OXUA 2ZM6Q 1IBLL 3GTJH 1VQOA 3KJPA 2I5HA 1J5EQ 1TWGH 2GVAA 2CQOA 1HNZQ 4LF4L 3M3YH 1YJWA 3BZKA 1I5FA 1YBYA 4DR6L 3HOZG 1QUQB 3U58A 4A3CG 1YIJA 4IOCA 2CKZB 4IFDG 5IP9H 5JJLA 1X3GA 4L5RC 4DR7Q 1CKMA 4B3RL 2UU9L 3K81C 3KF6A 1Q1EA 4GN3B 4AYBE 1HNXL 4UP8A 1PH3A 4AYBG 5IYCG 4GLAC 3F1ZA 4X65Q 1KC8C 3HOUG 3PGZA 2VQEL 2ZJQA 4LFAQ 4LNQA 3PO2G 2UXBQ 1M90C 2L15A 1X6OA 4P75A 3NBHB 5DLQE 3RLOA 4APVA 3PUWA 2UUAL 4JI4Q 4DV7Q 4JG2A 1PH7A 4JC0A 4PG3A 1GD7A 5M3FH 4B3SL 3I4NG 1FJGQ 1VQGA 5IY0A 3JAMc 4GNXB 4LF5Q 1XMOQ 1VQ6A 3K7UC 1C0AA 2NN6G 3G48A 1C9OA 3HOVH 1HNWQ 4GN4B 4C3HH 3BJUA 3CXCA 1VQIA 1N9WA 2HHHQ 4A3LH 4QIWE 1KHIA 5M3MG 3KDFA 4OX9L 1GVPA 2RHQB 4JBMA 2LXKA 2JJQA 4QL5A 2LSSA 2KCTA 3CW2C 2F4VQ 3ULLA 3GTMH 4UPAA 2R93H 1TWHH 3GO5A 5HY6A 4NPSA 1EQQA 3M7NA 5AJ3L 2GVBA 2K4KA 2K75A 2C35B 3PF4A 4A3KH 1XTDA 3K8AA 4P71A 5FJ8G 4A4IA 1VQEA 4DUYL 3E9IA 5IP7H 1U5KA 4ALPA 3GTQH 4IFDJ 5C44H 4WJ4A 4KI0A 2NVYH 4EX5A 1UE7A 2R92G 3DM3A 3S1NH 4YY3Q 4HJ5A 2B63G 2UUCQ 5LMNQ 3CPWA 4RMFA 4IPDA 5IYDH 1WI5A 4OXPA 3L7ZC 4JI8L 1Y1VG 1SE8A 2E2HH 1BBUA 2K5VA 4P72A 1QUQA 2JA6H 2IHEA 1KXLA 4C2MH 3NEMA 3HKZE 3CCEA 1CKNB 1RL2A 1X3FA 3TQYA 1S40A 2JA7G 3HKZG 3PO3H 3D0FA 4BXXH 3FKIG 4XTCS 1VCIA 4OO1I 4HJ7A 4JI1L 1EFWA 4R4CA 4IPCA 1LYLA 3WWVA 1U0LA 4YCWA 4DV0L 3I2ZA 4JYAL 4JBWA 1IL2A 1BKBA 3ER0A 4GOPC 2YU9H 2MFIA 4LFBL 2BA0A 2I0QA 3PF5A 3S24A 1JE5A 5M5WH 5GAEC 2OCEA 2Z0SA 4DV5L 4POFA 4DR1L 3J81i 3T1HL 3HOZH 1IYJB 4DR3Q 4A3CH 2PMZE 2Z6KC 4GNXA 4GKKQ 1UWVA 1NBWA 3TRZA 1XNRL 1HH2P 4X64Q 4DV4Q 1K0RA 1L2FA 1L1OB 1NMFA 1N36Q 4DUZQ 1Q8KA 2Y0SE 1I3QH 1KIXA 4PZ6A 3HOUH 3F2CA 2ZTCA 2WAQE 2RCNA 3PO2H 2UXCQ 2WAQG 1CSQA 1OXXK 3K7AH 1EIYB 4EQ5A 3OW2A 3KLWA 4LF9Q 3RR5A 1XPOA 3HOYG 5K36G 3I4NH 1CUKA 1VQMA 2E2JH 1PA6A 3CPFA 2NVTH 1UE5A 1XMQL 1PH4A 3G71A 2CCZA 1MIUA 1TWAH 3AYHB 3CQZH 2KENA 2BH8A 4OONA 5M3MH 1EOVA 3SGIA 1BVSA 4HIMA 2JA5G 1HR0Q 5GADC 1EIFA 3E9HA 2JK8A 5C0XG 2AHOB 2EIFA 3K80C 3A5UA 5LMUL 5IYBH 4LF6L 4AQYL 3H3VH 4A3EH 3A5ZB 3CCMA 1XMQQ 1VQ5A 4R4QA 5ELOA 4A3GG 2BA1A 1Q1BA 3MEFA 4A3IG 2H5XA 1CKNA 3PUYA 5FJ8H 4DR4L 1GKHA 3KJOA 2IT1A 4IJHA 3UE1A 4K0KL 5C4XG 3JC66 5IWAQ 1JT8A 4DV3Q 4IJLA 2R92H 3H3VI 1PVOA 3PIPA 4B3TL 4JBKA 4BY1G 2B63H 4MZ9A 2MQHA 1HZAA 3CD6A 4YWMA 3RZOH 5C4JH 3M4PA 3OTOQ 1OXVA 1Y1VH 2OWOA 1VQDA 2MNAA 1R9TH 1IBKQ 3GTOH 1I94L 1PYSB 1KRTA 3CCVA 2VL6A 2N3SA 5E7NA 1K8GA 3CC7A 1IBLQ 2JA7H 2K52A 1VS0A 1Z9FA 2JEAI 5JJIA 1QVGA 1L1OA 1NY4A 1SR3A 3Q8DA 5M5YH 1TWFH 4JI5L 1JJ2A 4LF4Q 2E5LL 4DR6Q 2IY5B 1Q81C 5IT9c 1H95A 4NXML 2KHIA 1KD1C 3F8TA 2VZAA 5ELNA 4TQUS 4BBRG 3PUZA 3S1QH 1FL0A 2UU9Q 1Y14B 4B3RQ 1KAWA 2ZTEA 1HNXQ 3W1BA 3AFQA 3J81c
chains in the Genus database with same CATH superfamily
5CMDA 4GKJL 5T1GA 4LF7L 3HP3A 3S1NB 1GO3E 5CV8A 2VQEQ 2E5LQ 1LUZA 2R6GA 1EYAA 5C0XJ 3E3XA 1LLRD 4PMWA 2F0SA 1JMCA 3HOWG 4DK6C 1WTQA 1MSHA 2F0WA 4B3SQ 2F4IA 1IYVA 1H9MA 2A6HD 5BN5A 2SEBD 3DEOA 1GUWA 1CT1D 3DWQA 1AFPA 4FF3A 1V1OA 3NTIA 5M5WB 3TBIB 3S14H 1V43A 3HOZB 5C4ZA 3UDIA 4X3UA 3CCJA 1PH2A 1I4XA 1JCKB 3KFUA 2Z8LA 1P8LA 2I46A 2RCFA 3M4YA 2EYFA 3RN5A 4ZKBB 2EJFC 4RHSA 3B6YA 1PH9A 4XQQA 5EGTA 2ES2A 1ML0D 1NCVA 4ZQ3A 1QJOA 3MZ5A 2K7VA 1LT3D 1PYBA 2YV5A 3R2IA 1VQKA 5C4XH 1L0XB 2VUMG 4L6TB 1JQYD 1STYA 1M1KC 4XXEA 3VR6A 4NXNL 1MI2A 2CHBD 1PH1A 1A63A 4JI1Q 1EIHA 1J6QA 4C3IG 1N32L 3VR2A 4QIWB 4LUVA 4JYAQ 1AP0A 4LFCL 4DFAA 1JWSD 2PI2A 3SE0A 1A62A 2Y0SG 4A3EB 3T56B 2HCCA 2HIVA 2PQAB 2NBFA 1X32A 2EOTA 4G57A 3K59A 1B9MA 4YHHL 2K5NA 2ATWA 3D8GA 3ITPA 1Y1VB 4JI3L 3HOWH 3W5OA 1KABA 3V96A 1CZWA 4G4KA 4IOAA 4V190 4JI6L 3Q23A 5FLMG 1PYWD 3QO2A 4H7BA 3BS1A 3ONAB 2NN6I 4JOIA 4R8IA 3V2TA 2O2LD 5I2XA 4X62L 4JI3Q 5CV6A 2UUBL 2OEOA 1WJJA 1C7YA 2AUJD 3ERSX 3CCLA 3F2BA 3CCRA 1TR5A 1EY4A 1VQ4A 4HJ8A 3TP8A 2K14A 1QZHA 5IYDG 1FVIA 2F3WA 1SN8A 4DR4Q 3TEHB 1SFOB 4A3DG 3A7LA 2CWAA 1VQNA 3D6WA 4KY6A 4QJFA 4B3TQ 3ZJYC 1SMXA 2EYOA 2PYKA 4GNXC 3S2HH 5CORA 1WYDA 2PNHA 2XWBB 4X65L 2OQKA 3E0JA 1LTBD 2HQLA 2A6HC 4IO9A 4L63B 2HT1A 1B9NA 2KQ3A 2A5HA 3S1MB 3KLSX 4C3IH 1D5ZC 1P16A 1BBXC 3E6ZX 4DV7L 4M1UB 2D0OA 3S1RH 1WTOA 4H02A 1K83H 4J8QA 2V4DA 2J4XA 2L55A 3VA5A 4WJ3M 3UE0A 4YIJA 3MXNB 4BBSG 4RGTA 3U9OA 3HOYH 3PIOA 4A3JG 2OQ0A 5LMNW 4RGMA 4XT1B 3OIQA 1G2TA 1HZBA 3J80i 1DJRD 2L1BA 1HJPA 1STHA 4JV5Q 1E1OA 4FDBA 2ZT9C 2CW0C 5FLMH 4DXGA 2E2DC 1FNVA 1ICFB 5IOCA 1AE2A 4L5QA 1N34Q 1AW7A 3NE5B 3Q6SA 4ZK9B 1LM0A 1SJHD 1Y8PB 5EPJA 2FXQA 3PUVA 3FHWA 3NWSA 2AQ1B 2EXZA 3OWEB 4RGOS 3SK4A 1L1OC 3MXUA 3RMHA 3HKSA 4ID6A 5BR8L 3AEVA 1GJXA 2B8FA 4A3DH 1GUOA 2BCOA 2BDNA 3GTPB 2Q8RE 2EJGC 1HQRD 2ASBA 3MFYA 4GKKL 4IURA 5M9OA 5ELFA 1SYBA 5BR8Q 1NMGA 2ALYB 3FDTA 3NP8A 3Q24A 1KQSA 3PMFA 5CV5A 1PH6A 4JI0Q 1HHVA 2FFKB 1VQHA 3J7ZC 1KRSA 3JAMi 1Q3LA 1R4QB 3AFPA 3I91A 3K0XA 3KF6B 4HIKA 2X6GA 1BDOA 4IPGA 2E74C 1TS4A 4HIOA 4P74A 4XDXA 1DOMA 1E3PA 4MTNA 3HKZB 2ZJPA 1HFGA 4IQZA 2R93G 4BBSH 1TS2A 3CCSA 4A3JH 4G7OC 4JCVE 4O2DA 1UE1A 1FGUA 2P5ZX 3I70A 4GLVB 1VQLA 2WB1B 1S5BD 3J80c 4MTKA 3OMCA 2I5LX 1DOKA 1HZ9A 1DD2A 1ZEQX 1CKOA 3BVZA 3KDFB 4BS9A 4JI2Q 2GN5A 5JVG3 1VQJA 4QB4A 4DV3L 4Y7NB 1EY6A 1E2ZA 1A6XA 3CCUA 3Q22A 4RCOA 3OTOL 3IFDA 3TZUA 1LTTD 2QEXA 4BXXG 5JEAJ 4P2CB 2WV6D 2J0TD 1VQOA 1V1PA 1TWGH 3ZYYX 2CQOA 5M5XB 1HNZQ 3HOZG 4H44C 4IFDG 1LTSD 5IP9H 4L5RC 2JA5B 2PZTA 4FYDA 2UU9L 1TS3A 3GTGB 2RDHA 4CBVA 2RQXA 4KMUC 1QE6A 5IYCG 2ZJQA 5L37A 4P75A 3RLOA 2UUAL 2F0GA 1PH7A 2NTTA 2PW7A 1FJGQ 3JAMc 3KK7A 1XMOQ 2KEEA 2LS01 3OIPA 1TU2B 3EVQA 2L12A 1G2SA 2DY8A 2RHQB 2SNSA 3M7GA 2F4VQ 3GTMH 2R93H 1F77A 1O7LA 1TWHH 2K05A 5C6AA 2ICEC 3EA6A 2E76C 3K8AA 4IUTA 4P71A 5FJ8G 4DUYL 2XSCA 4K5VA 3E9IA 1D5MC 4LAAA 1UE7A 5IODA 2BOSA 4YY3Q 3S1NH 3D4RA 4C3JB 4HJ5A 3M4OB 2UUCQ 1B50A 1GHKA 3DHQA 3L7ZC 3P7JA 1Y1VG 1BBUA 1QUQA 5C4HA 1KXLA 1LTID 3HKZE 2EYJA 1CKNB 4X3SA 3TQYA 1JR0D 3SK6A 4BXXH 3FKIG 4XTCS 1VCIA 5FLXL 2JA8B 4R4CA 2KVMA 2A73B 4YCWA 3OMGA 3ER0A 4I65A 1E2WA 3PF5A 5M5WH 2MUYA 3BDLA 2HD3A 5D3DA 4POFA 1H9JA 3HOZH 4IFDH 3QR8A 1UWVA 3TRZA 1IYUA 1HH2P 4QMGA 4DV4Q 1K0RA 1NMFA 2FMCA 4DUZQ 2EE1A 4PZ6A 4FF1A 4MIUA 2WAQE 1IKLA 4BY7B 3L9AX 1K3BC 5K5PA 3KLWA 3RR5A 5K36G 1UEAB 1K8OA 2VUMB 3E5SA 5CBAE 1PA6A 3CPFA 3MXPA 1EY8A 4RFBA 1XMQL 1HTPA 3G71A 2CCZA 3M3YB 2KECA 4OONA 1XTCD 1B44D 5GADC 2WACA 3K57A 4LF6L 4A3EH 1XMQQ 2F0OA 3MEFA 2H5XA 2K32A 1XWEA 4OHJA 4ZUIA 5FJ8H 2IT1A 3UE1A 4IJLA 5JVH3 3H3VI 1H9SB 3PIPA 2CH4A 3SXHA 1F9SA 4YWMA 1PRTB 3OWFA 4CKCA 2RSOA 1Y1VH 3CHBD 1FNWA 3A54A 4FXGC 2F0DA 4JI5L 2DJFC 4IZ8A 5KEEA 1TY2A 4DR6Q 2IY5B 5IT9c 1H95A 4NXML 2EY6A 2KHIA 1CA6A 4O42A 1PXUA 3NTKA 1DONA 3PUZA 1B53A 5LL6S 1RTOA 3GTQB 1HNXQ 3W1BA 4B3ML 4R9WA 5EKIA 3UDXA 3CMAA 1HCZA 5KNBA 3I56A 1Z47A 4HJ9A 1RD9D 3Q0AA 1UAPA 2V1CC 2E2HB 1SFOH 1HA5A 4C2MB 3PO3B 2YYZA 2K6AA 3MHBA 4NB3A 2QCPX 4HJAA 5K36H 2LFNA 4X3KA 1EEID 1EY0A 2G5DA 3ULJA 1SYGA 1O80A 2D0PA 5KNCA 1MSGA 3F2DA 3S1MH 1K3RA 3CMEA 4DKAC 5AJ3Q 1ASYA 1VQAA 3WDNA 4AYBB 1YNJD 3HOUB 3G4SA 4QY7A 3CC4A 5DEHA 1IBML 4RAUC 3AB9A 1O7ZA 2ZXPA 3K7AB 2K03A 3BVMA 1N33L 4JBJA 1VQ7A 2JN4A 3VYUA 4H0LC 5C0XI 4JI8Q 1Q86C 3CKIB 1RJTA 2WB1G 4R4IA 1MKHA 3U9SA 4F87A 2VQFL 3HFZB 4LF8L 3KYHC 2A1AA 5D14A 2VB2X 2FMMA 4DV0Q 2RDGA 4ME5A 1JB7A 2HDLA 4R4OA 3VYRA 4DR1Q 3J81j 2KCMA 1GM5A 3EQLC 2K5HA 4IFDI 2NZOA 1E1TA 4DK3C 1Y69U 3PV0A 1U9RA 3ULPA 2K04A 4GOPB 2EYLA 2R92B 2FHTA 4DV1L 2NN6H 1AE3A 1SNOA 2B63B 4DU9A 4JPBW 5EBCA 2MP1A 4RKLA 3HG9A 1BCPB 1EY7A 1JOKA 1QZGA 3GTOB 4OWXB 3GD7A 4KV6A 5CR3A 2D62A 3UDFA 2SOBA 3GTPH 1XPUA 4DN4M 2F0PA 1A2TA 3N52A 3M85A 4RG1A 5M5YB 2PQEA 1U4MA 3KBGA 5C3WA 3T1YL 3X3MA 3JAME 1G6ZA 1PRTC 5ELEA 5C44G 5LMUQ 4AQYQ 5C5MA 1K9MC 1HUMA 2OTLA 2PMZB 4OO1G 4CKBA 1X9NA 4HTHA 3J81L 3C1EA 4TKOB 4LUZA 2JA6G 1D6EC 2MPMA 3MWYW 5J3BA 3MAQA 2RF4A 5GQOA 3TDQA 2CVRA 2E75C 2F0LA 1LO5D 2F1MA 2B2YA 1IKMA 1T5XD 3GV6A 1AEXA 1I94Q 3C2PA 1N8RC 3H94A 1VDZA 4LFAL 5GAGC 2PQAA 2UXBL 2K33A 2K5WA 3D6CA 3TSSA 4C3JG 2A74C 1K73C 2Q2IA 3NK9A 4YCVA 4Y7NH 4FP5D 4LF5L 1JJGA 4UP7A 1WD1A 3T16A 3J7A5 1HNWL 1K8MA 4IALA 3VR4A 4GKJQ 4LF7Q 2RA4A 3KBXA 2HHHL 2JA8G 4KLKA 2EQSA 1R4PB 4DGZA 5M5XH 1F9RA 1YNJC 5AFWA 4DAYB 5JPMC 4BY1B 1SLJA 3RLNA 1Q46A 3TN2A 2F0NA 2JA5H 4LUOA 2RHSB 3GTGH 1B70B 3EN2A 1VQBA 4L5SA 3QWNA 4BY7G 5LMNL 3S17B 2IWHA 1B8AA 5KGUA 2JA9A 1PTOB 4BBRB 3BYYB 2CW0D 1EYGA 2E2IB 2B2VA 4TRDA 4FF2A 1PZKD 4KK7A 5JJZA 2PCFB 4OO1H 3BVGA 4GN5A 4K14A 1KDBA 3MXGA 2ZTDA 4HN7A 3H3VC 1PFSA 2B3GA 1CM9A 3ND8A 2XRQD 3GV3A 2XTIA 1TXYA 3MFGA 5NUCA 1YNNC 1W3SA 1B2TA 1U4PA 4NXNQ 1DGSA 1YI2A 4X64L 1NAPA 1Y8OB 4KY5A 5A2QL 1ZXTA 1N36L 1N32Q 3RN2A 1YHAA 1FR3A 3MXNA 4LFCQ 3J7YW 1HR0W 3S2DB 1BCPC 1KAAA 2NVQB 3AU7A 1F2YA 1TY0A 4C3JH 1LTLA 3M4OH 1V9PA 3CF5A 2J7ZA 2JQOA 5EQ0A 4YCUA 3DLLA 4OL7A 1WCMG 1YNXA 4C1NI 2K28A 2VNUD 3A8JE 4QUFA 2DNEA 3ICEA 3EJIA 3FKIB 4YHHQ 5IT9E 1YZ6A 3WOEA 2JA8H 3TMEA 4FXDA 1F9PA 1SE3A 2KJXA 1GUGA 2JXMB 1A3VA 4JI6Q 4RHRA 3A74A 4XQJA 1QILA 1BBWA 2KUMA 3EFXD 4X62Q 2UUBQ 4QQBX 2DJGC 1VQCA 5IWAL 4OELB 3NELA 1HQMC 4HSVA 5JAVA 1J5EL 4OIKA 5J39A 4CHTB 2IX0A 4BY7H 5D3IB 1XJVA 3PO3G 1MGSA 1I4HA 1IBKL 3DXJC 3C3LA 5DNFA 2VUMH 2XWJB 3H0GB 3NSWA 5KRUA 1J5EQ 3F2UA 1GUSA 1WTXA 1FGBD 1EL0A 4V0BA 4LF4L 3M3YH 1YJWA 1I5FA 2H4OA 3U58A 4IN3A 2A68C 3KF6A 3S9WA 1PH3A 4AYBG 2NZ1D 3F1ZA 4GLAC 4X65Q 3HOUG 3K5LA 4C56C 1M90C 3NBHB 2EYPA 4DV7Q 2RBMA 4JG2A 4JC0A 2NVXB 1GD7A 5IY0A 1Z6HA 1EQTA 1VQ6A 3K7UC 2HUGA 4K5WA 4GN4B 3BJUA 3CXCA 1VQIA 3R8BA 1N9WA 4QIWE 3KDFA 1EYCA 4OX9L 2QW7A 4JBMA 4F7XA 1PTOC 1SYDA 4UPAA 4DAVA 1ZKOA 2A6ED 1HA6A 2GVBA 2K4KA 2L5TA 3D4DA 3MC0B 1CI3M 3GQBA 2EZVA 1VQEA 3R3OA 1U5KA 3GTQH 4WJ4A 4KN4C 4EX5A 2R92G 3DM3A 2MGSA 2B63G 1PZID 4KD3A 2RSNA 3CPWA 5IYDH 1TVXA 2E2HH 3WOFA 2B2YC 1WTHA 4A93B 3TP7A 4C2MH 1B3QA 3CCEA 1X3FA 3PO3H 3OSOA 5KYIA 5DM73 3I4MB 2LMCB 4OO1I 1ILPA 4IPCA 2G9DA 5I4DA 1U0LA 1IL2A 1BKBA 4B08A 4LFBL 1X3QA 4O1NA 1F2ZA 5E3FA 4DV5L 1SNQA 2F0FA 3T1HL 2EYHA 2RVLA 1PMRA 2A69D 4JW0A 4GKKQ 1XNRL 1KIXA 2Q8IB 3HOUH 1HUNA 1I50B 2F0QA 5EJWA 2ZTCA 2PZUA 2RCNA 4KKTA 3K7AH 4EQ5A 3OW2A 1JWMD 1CUKA 3I8ZA 2E2JH 1PH4A 1D5XC 2BH8A 1ZYRC 1UUPA 1EOTA 3HRZC 3NQTA 3SGIA 1WTRA 3K5NA 4X3TA 3HS0C 1D1IA 2JK8A 3HZXA 5C0XG 1S5ED 1FD7D 1STAA 2B2VC 3H3VH 1AZQA 4KN7C 1VQ5A 5F2DA 5ELOA 2BA1A 4A3IG 2IL8A 1CKNA 5M3FB 4ZLTF 4K0KL 4DV3Q 1KDAA 1AN8A 2R92H 2DY7A 4BY1G 2B63H 3CD6A 1FYCA 4C3HB 3OTOQ 1OXVA 2OWOA 3GTOH 5IGDA 3CCVA 4CDCC 2VL6A 5E7NA 3CC7A 3T51B 1VS0A 1Z9FA 4RWSC 2JEAI 5M5YH 1Q81C 1K0SA 4RKBA 1KD1C 5BN3A 4BBRG 2UU9Q 2ZXRA 1PFMA 3A7AB 5C44B 4ME3A 1QOHA 3GP7A 1RF2D 2DNCA 4DV2L 3PIO3 2A6EC 2BE5D 4JI7L 4FO2A 4ZUJA 3AQQA 1SROA 1PFBA 2NTSA 1LT6D 4LMQD 1IZ6A 5KIXA 2UUAQ 2JA6B 2F0VA 1JE4A 5HGTA 2CH4W 5I2YA 2BH2A 2N55A 1ENAA 1ICWA 2YU9B 1GUNA 4FVMA 4EGVA 4CDEC 1EZ8A 2EXDA 1XNQL 4U68A 4WJWA 1QG7A 4EVOA 5G3LD 4N8X1 1H9SA 2EDGA 2R7DA 2AWOA 5C0XH 1EU3A 1Q7YC 2XN9C 2F0IA 1D7QA 3RNUA 1I3QB 4DUYQ 3PCOB 1VMPA 4NP5A 3MVVA 5JJKA 4Q5VA 4CJ1B 2A69C 4GLXA 3H09A 1X56A 2NZHA 2WB1E 4OEMB 1ENFA 5CV4A 1KNEA 4S3SA 1T9HA 3TS0A 4R1JA 5D65A 4BY1H 1HFNA 4DR2L 2NVTB 2QA4A 1SMYC 2R61A 3CQZB 1QNKA 1H9KA 1NSNS 1YHQA 5KNDA 1II3A 4G7HC 5IYCH 2JE6I 3KLRA 3S17H 1B3AA 1KDCA 4X66L 5C3XA 1PTOH 1TT2A 4O0AA 2B2UA 1EWIA 4BBRH 4DNTB 1YEZA 4NDXA 4KHPL 4GZYC 2E2IH 2Q2UA 1TIID 3EIVA 3NENA 4L5TA 3H0GG 1K8AC 5FO8B 5CBEE 3QG1A 1L0WA 1NTGA 4IUPA 2MHVA 1QVCA 2KA7A 4CDDC 2KCCA 1IHZA 1OXSC 2D9UA 3IL8A 3KLSA 1GXDC 1GOZA 2AMCB 2WFWA 3KF8B 4DV6L 1C8CA 1O7IA 2AQ2B 1EWHA 4HAEA 2C9OA 2E8GA 2KBNA 4KD4A 2XRSD 2Z4IA 3NUCA 2B29A 3S1QB 3DM1A 2K5DA 1KNAA 1K28A 1YJ9A 1SRUA 1A3UA 2NVQH 3S2DH 3QOLA 1Q12A 4LF6Q 4TVAB 1IXRA 1HZCA 2PZWA 1BUVT 1B4OA 2ZXOA 3BDOA 4WRDA 5FKAC 5CV7A 1DM0B 2ZM6L 1X3EA 1WCMB 3LGJA 2RKSA 3D3RA 1PRTD 1EQVA 4F8MA 4UY8C 3BU2A 1CSPA 2JEBI 2JSOA 3FKIH 4LJZC 1S5FD 4OIJA 1EY5A 2BE5C 3P20A 1F2MA 3T53B 3U4ZA 4J15A 4N9TA 1EQRA 5H1SE 4ZAIA 1W6JA 4PQXA 2NUCA 2K50A 3L2PA 4JI5Q 4GOPA 4JI4L 1S4ZA 5GROA 4NXMQ 1VQPA 3SR1A 4A93G 1HPCA 4B3MQ 4A3GB 3T4AC 3U50C 2DGYA 3RZDB 5I6YA 2MO0A 4PMCA 3U4VA 3VR3A 3I4MG 2N49A 1CQVA 3H91A 5LL6X 4CGYB 3H0GH 4HEDA 5EKLA 2NWGA 5I9OA 4XT3B 1GUTA 3D31A 4AH6A 4POGA 3SK5A 1STBA 1UEBA 3K5OA 2CWPA 2LXJA 3NBIA 1XX8A 3EROA 3I4OA 2WP8J 5IYBG 2L9HA 1O7YA 2AQ3B 3P75A 1OXTA 4EQOA 4DAMA 2IX1A 3CU7A 2NVXH 4I7ZC 2X6LA 3OHXC 3E0EA 2SNMA 3S15B 4U673 1IBMQ 3S16B 3ERQA 2QGQA 4Q0FA 5A2QE 2TMPA 2HQEA 1N33Q 2KHJA 4KJNA 2QILA 5FO7B 1YITA 3J7AV 3BZDB 3K6OA 1J8IA 4DNIA 4DR3L 2VQFQ 5EKKA 2F0EA 4LF8Q 1G91A 3IRBA 2VY3A 2XGTA 4KHZA 4DNRB 5M3FG 1Q90A 1QVFA 4CJ0B 1Y1WB 3CC2A 5JEAG 2UXCL 1DYQA 1EIGA 2HIXA 3NTHA 2TSSA 4M8AA 1MJCA 1YNND 3SVMA 5C3EB 4DAYA 1CFMA 4LF9L 1I6VC 4OGQC 4C3HG 5FLXc 1X55A 2K5QA 4A3LG 2XVSA 2YTYA 3N6RA 4A93H 3PSIA 1JB3A 3FP9A 1PV4A 1BCPD 2IW3A 4PZ8A 4DV1Q 3I4MH 1G291 4OWWB 1M8AA 1HR0L 3GTLB 2VS1A 2ZJRA 1BNZA 2N8NA 3HOXB 4UP9A 5T1IA 1VQ8A 3M9BA 5BN4A 2IHFA 1M4VA 3T1YQ 3SHLA 4QCLA 1I50H 5HURA 1S72A 4BA2I 2MO1A 1PRTF 3RD4A 3TP5A 2I5MX 4WFN3 1OXUA 1SNMA 1IBLL 2PW5A 3KJPA 2I5HA 2GVAA 3H6MA 3HGBA 1YBYA 3BG3A 1YIJA 4IOCA 2CKZB 3NPPA 5JJLA 1X3GA 4B3RL 3ND9A 2B8GA 3K81C 2B2UC 4IUVA 4AYBE 4CJ2C 4UP8A 4HCSA 1HRJA 3PGZA 1TS5A 2VQEL 4LFAQ 4LNQA 2UXBQ 1BO0A 4EQPA 4A3IB 4HMJA 1CK1A 2A68D 2L15A 1X6OA 2FINB 5DLQE 3PUWA 2WIIB 5M3FH 4B3SL 2H1EA 4A3FB 5JEAH 1SYCA 4A3BB 4GNXB 4LF5Q 1C9OA 1HNWQ 1RKNA 4C3HH 1S5CD 2HHHQ 4A3LH 1KHIA 2K01A 4QL5A 2LSSA 4A3MB 2KCTA 2L0CA 2C5CA 2Z6BA 5HY6A 4NPSA 1EQQA 4KTAA 2K75A 2C35B 2EY5A 4A4IA 2O5IC 4ALPA 4IFDJ 2CQAA 5C44H 3I73A 1PTOD 3GTKB 4RGNA 1PDQA 5LMNQ 4RA8A 4IPDA 2GA4B 1WI5A 1KLGD 1Z7TA 1SE8A 2K5VA 2JA6H 4C1NK 2IHEA 2QDBA 4B9WA 1IW7C 3I72A 5FOBB 4MHEA 2R7ZB 3D0FA 5IGFA 1TWCB 4JI1L 1FNUA 4L8JA 1LYLA 4JYAL 3I2ZA 4JBWA 4GOPC 4NW2A 1CTMA 2MFIA 2YU9H 3LNNA 2BA0A 2I0QA 2L4NA 4UAIA 5FO9B 4QF4A 3NBHA 5GAEC 3J81i 1SNPA 1F2LA 1IYJB 2PMZE 2KEDA 1RCVD 1I6HB 1DXMA 3DWPA 1NBWA 3J80L 4NKLA 3DWAA 4X64Q 1N36Q 1L1OB 1I3QH 1STEA 5TSSA 3F2CA 3URYA 1SNDA 1RODA 5IGGA 1CSQA 4I7AA 1BCPF 2Z9HA 3HOYG 1QNUA 2XNAC 3VA7A 3GTJB 1STGA 2RDFA 2NVTH 4FNFA 1WTPA 3CQZH 1ET6A 2KENA 3MTSA 2F3VA 3E9HA 2AHOB 2EIFA 3FPUB 4HR7B 4KJOA 3A5ZB 5I6WA 3CCMA 4R4QA 4A3GG 5JPNC 3C1FA 1ZYRD 3LWEA 3O13A 3PUYA 4ZCKA 1WD0A 3QOJA 4DR4L 1GKHA 3KJOA 3DUZA 5KYLA 2M00A 3JC66 5IWAQ 1JT8A 2EJMA 5FK9C 2G9HD 4B3TL 4JBKA 3HOVB 2D2CC 1HZAA 2MQHA 1ESRA 1LTAD 4BWGB 1VQDA 2MNAA 1IBKQ 2EPBA 3JAML 2KCNA 3FRPB 2N3SA 3BDCA 2K52A 1QVGA 3Q8DA 1EWCA 2B39A 1JJ2A 1I4PA 4LF4Q 1NNXA 1CHQD 4UHVA 1E0BA 2LKVA 2WKDA 4A3KB 4JK1C 2VZAA 5ELNA 4TQUS 2IX3A 3S1QH 1FL0A 1Y14B 2ZTEA 1YJNA 3AFQA 3J81c 1JJCB 1RTNA 2YTXA 1BF4A 2NVYB 1G6PA 1NE3A 4EQNA 5CGKA 1VMCA 1EZ6A 3BZCA 1ASZA 4HMIA 1WCMH 4IPHA 3TZDA 2ID0A 2B2TA 3DMUA 2AWNA 1MJEA 4X6AH 4JV5L 1BXTA 3CP0A 4K6DA 3G6EA 4IUNA 3VDYA 2WKCA 3UDGA 1STNA 4JVZA 5ELBA 3I4LA 1SAPA 2JYOA 3OOCA 4OX9Q 1ILQA 1N34L 1VQ9A 1Y1WG 1SYEA 5FLXE 1PTOF 5C3EG 3KOJA 2L11A 1NJIC 1G8ZD 1AZPA 4A3GH 4E6IA 3PO2B 3RZDH 1CQFA 3CAMA 4LWCA 3X3NA 1MBYA 3I4NB 1DCZA 2F3IA 1G51A 1EEFD 4DK1A 4DR5L 4ABNA 2KOLA 1X54A 2UXDL 1HXYD 4YWKA 1S5DD 4PZ7A 4DF7A 3HOXG 3TREA 3VYSA 1SJED 1TWAB 5A35A 5M3MB 5ISRA 5IP9G 2ICIA 4JI0L 4LFBQ 1SDFA 4DR5Q 2UXDQ 1UE6A 1RIPA 4DV5Q 1XXGA 3T1HQ 1SMYD 4QUCA 1JC7A 1I4GA 2VXWA 4DXFA 1LTRD 4A76A 1XNRQ 1WVLA 4XIGS 1PHJA 4DPGA 5GAHC 1KTKA 1LV9A 3J7AF 4H13C 1BQQT 2Q2HA 3W3AA 3S15H 3NWTA 1LACA 3S16H 3RZOB 5C4JB 1R9TB 2QF7A 4ILWA 3VR5A 2DUDA 2AKWB 4K2LA 3STBD 2JA7B 3A0JA 2B2WA 1W6KA 1F9QA 5E4XA 1MHWC 4K8JA 1TWFB 4JI2L 4IUUA 1AH9A 1EYDA 1CZGA 2HCIA 2M2LA 3OYYA 1EY9A 4QGUA 1Y1WH 4A3FG 4ZRZA 4A3BG 4FF4A 5IT9L 5E4WC 5C3EH 3FVQA 5DM63 2PI2E 1JWUD 1ONLA 4ODGA 1XPRA 3W1GA 3K58A 4HSPA 4K0KQ 4Y52H 4GS3A 4OWTB 1HNZL 2WAQB 4A3MG 5IE8A 5HGQA 4HIDA 1OTCA 1KL9A 4R4TA 4LW1A 2EY2A 2IPKD 3GTLH 3PQIA 4DA2A 2ENBA 1B7YB 1UNSA 2MJ8A 4BA1I 3HOXH 3S14B 1PLFA 3A56A 1S3OA 3L3OC 1E24A 2F0UA 3CRLC 5CV9A 1FJGL 1V1QA 1C48A 1XMOL 4CDFC 2R7FA 3PUXA 1A2UA 4P73A 4WORA 2Z6KA 2OT2A 2R7ZG 2Q2TA 3P1HA 4DV2Q 2VB3X 3KF8A 2F52A 4JI7Q 1PH5A 2VW9A 5C4XB 2PPBC 4K6LA 3A55A 2F4VL 4Z9CB 1LT5D 4KHVA 4F88A 4K2KA 4JOIC 1MD2D 1WFQA 4A75A 1WTWA 3TP6A 1L0YB 5CYUA 1VQFA 2F0TA 3I90A 4YY3L 4A3EG 1XNQQ 2UUCL 3W2DA 3M4QA 3BYTB 3K5MA 4RCNA 4A3IH 4ZKCB 2AUKA 3LWUA 3V05A 4A3FH 4A3BH 2N78A 1H9RA 1LT4D 2EYMA 3HEJA 4K5XA 2PNRC 2OTJA 2X69A 3NXWA 3HOWB 3OW7A 1WOCA 3AMUA 1V8QA 2KHSA 1YHBA 5J1ZA 4A3MH 4MN3A 1X3PA 1D2BA 4DR2Q 3I55A 2HDMA 2A19A 3SEBA 1X65A 2DN8A 1D8LA 1V1PB 4DV4L 5EAYA 1W2BA 4MNOA 2K1BA 4DUZL 3STBC 1ENCA 1NR4A 2OXPA 3GTKH 2B2TC 1E7ZA 4J6HA 3C46A 5IGEA 3HOVG 4RH6A 1E22A 1A3TA 4PNYA 4X66Q 4KHPQ 2Z1CA 3IKJA 2Q8TA 3H15A 1SYFA 3I7FA 1HTLD 2R7ZH 1JOQA 1TWCH 2QKIC 1EUJA 1YVCA 3EBEA 4TSSA 3SDZA 2Z4HA 1A0IA 4A3KG 3S2HB 2YTVA 3J81E 1A8VA 2PO4A 1LTGD 2A8VA 5IP7G 1Q82C 3UI2A 1C4QA 5EPKA 4DV6Q 1A15A 4C3IB 1T5EA 1I6HH 1PZJD 1VF7A 2XIWA 3GDEA 5J22A 3RLFA 3S1RB 2D5DA 5DAUA 3IAYA 4ULLA 2JP1A 4XYOA 2Y0SB 3NHHA 1K83B 1I4RA 4AIMA 3CCQA 3TS2A 3L0OA 3G7LA 1PH8A 2CFMA 4YWLA 3HOYB 3QB3A 4DR7L 5IGBA 1Q8IA 2LY7A 2ZM6Q 3GTJH 3MA2B 4HCEA 1QB5D 3BZKA 5I9PA 4DR6L 1QUQB 4A3CG 4IUQA 1TKWB 5LHY1 4DR7Q 1JORA 1CKMA 5ELCA 5C5LA 3T13A 1Q1EA 4GN3B 1HNXL 1KC8C 2I07B 1GHJA 4NMZA 3PO2G 1Y8NB 3LX0A 4JI4Q 3FMCA 1J9OA 1SE2A 4APVA 1OO9B 4PG3A 1NUCA 3I4NG 2F0MA 1QCBD 1VQGA 2QEJC 1QWYA 1NR2A 1C0AA 2NN6G 3G48A 2B2WC 3HOVH 3SK8A 1SNCA 5JOBA 5M3MG 3DEPA 4A3DB 1GVPA 1SEBD 5G3LF 2LXKA 2JJQA 3CW2C 3ULLA 4KKUA 3GO5A 2WINB 3M7NA 5AJ3L 2O4XA 1RHPA 3PF4A 1EU4A 4A3KH 1SE4A 2SDFA 1XTDA 2FJ2A 5IGCA 1XYIA 5IP7H 4KI0A 2NVYH 4G7ZC 2EY1A 4RMFA 1E2VA 5EPLA 4OXPA 4JI8L 3FPPA 4P72A 4R8NA 3NEMA 1RL2A 1SBBB 1S40A 2JA7G 4J1MA 3HKZG 3A8KE 3IFTA 4DAPA 4CKEA 4HJ7A 3NQIA 1EFWA 4BBSB 3D4WA 3WWVA 4DV0L 3J80E 4A3JB 4XYQA 1O78A 1RDPD 1VF5C 1JE5A 1CHPD 3S24A 1CA5A 1IW7D 3OPOA 2E2JB 2OCEA 2Z0SA 4DR1L 5EBDA 1PFNA 2OF1A 4DR3Q 4A3CH 2Z6KC 2BDOA 1SXTA 4GNXA 1JICA 2IJ0A 4N8FA 1L2FA 5IIFA 1Q8KA 2M9VA 2Y0SE 3RUZA 1U4LA 2NYZD 4ZYSA 2O5JC 2UXCQ 3PO2H 2WAQG 1OXXK 1DOLA 1EIYB 4DK0A 1IL8A 2F0HA 4LF9Q 1XPOA 1EFID 3I4NH 1VQMA 2F0KA 1TWGB 2R3ZA 1BR9A 2QDLA 1UE5A 1SSOA 1MIUA 1TWAH 3AYHB 4FXKC 4B9XA 5M3MH 1EOVA 1BVSA 4HIMA 2JA5G 1HR0Q 1B1ZA 4UDUC 1EIFA 3FEWX 1TQOA 3PIP3 1LABA 3K80C 3A5UA 1DZ1A 5LMUL 5IYBH 4AQYL 3A8IE 3R2TA 4KKSA 3KUPA 4PV1C 1I4QA 1Q1BA 5CC4A 1WTVA 4XQNA 2EVBA 4IJHA 2F03A 2N88A 5E1FA 5C4XG 1KLUD 4PMBA 3QIAA 1PVOA 5ELDA 4MZ9A 3CRKC 3MEHA 3RZOH 5C4JH 3M4PA 1ESFA 1R9TH 4LK1C 3K0YA 1I94L 1ET9A 1PYSB 1KRTA 1U4RA 3I3CA 4K8IA 4KY7A 2JA7H 1K8GA 1IBLQ 3R93A 5COYA 2NB0A 5JJIA 1BOSA 3GTMB 1L1OA 1NY4A 1JOOA 1SR3A 2R93B 1TWFH 1TWHB 3G6JB 2E5LL 3QJYA 3VYTA 4N9PA 3F8TA 4B3RQ 2F0JA 1D1KA 1KAWA
chains in the Genus database with same CATH topology
1JJCB 2YTXA 4ME3A 4GKJL 4LF7L 3UDXA 3CMAA 1G6PA 1GO3E 2VQEQ 3I56A 1NE3A 1LUZA 2R6GA 4DV2L 2E5LQ 5C0XJ 1Z47A 4JI7L 4HJ9A 3BZCA 1ASZA 3AQQA 4PMWA 1SROA 2UUAQ 1JMCA 4B3ML 2V1CC 1IZ6A 1WCMH 3HOWG 4IPHA 4DK6C 1SFOH 4B3SQ 2ID0A 4X6AH 2AWNA 1MJEA 2YYZA 4JV5L 3CP0A 3G6EA 4NB3A 4HJAA 3VDYA 3UDGA 2BH2A 4OX9Q 3ULJA 1N34L 2EXDA 2D0PA 1XNQL 3S14H 1VQ9A 1V43A 1Y1WG 3F2DA 3S1MH 1K3RA 3UDIA 3CCJA 1PH2A 3KFUA 3CMEA 5C3EG 3KOJA 4DKAC 5AJ3Q 1P8LA 1NJIC 3RN5A 2R7DA 2AWOA 1ASYA 1VQAA 1Q7YC 3B6YA 1PH9A 1D7QA 3RNUA 4DUYQ 3G4SA 3PCOB 4A3GH 4QY7A 2ES2A 3CC4A 1IBML 3RZDH 5JJKA 4LWCA 3CAMA 1PYBA 2YV5A 4JBJA 1VQ7A 1N33L 1VQKA 5C4XH 4JI8Q 2F3IA 5C0XI 4GLXA 1X56A 2NZHA 1G51A 2WB1E 1Q86C 1M1KC 4DR5L 2VUMG 1X54A 2WB1G 2UXDL 1T9HA 4YWKA 4R1JA 3TS0A 4R4IA 4PZ7A 4BY1H 3HOXG 1MKHA 3TREA 4DR2L 2VQFL 3HFZB 2QA4A 4NXNL 4LF8L 3KYHC 1YHQA 2A1AA 4JI1Q 1PH1A 1J6QA 1A63A 5IP9G 1N32L 4DV0Q 4LUVA 4JYAQ 4JI0L 4LFBQ 4LFCL 1JB7A 4DR5Q 2UXDQ 1UE6A 4R4OA 2JE6I 2PI2A 5IYCH 1RIPA 1A62A 2Y0SG 4DV5Q 4DR1Q 3J81j 3T1HQ 2KCMA 3S17H 1GM5A 2K5HA 4IFDI 4X66L 4O0AA 4KHPL 1EWIA 4BBRH 2NZOA 1E1TA 1YEZA 2HIVA 4DK3C 4A76A 1XNRQ 3PV0A 2E2IH 2Q2UA 2PQAB 3EIVA 4XIGS 1PHJA 3NENA 4DPGA 4L5TA 3H0GG 5GAHC 3ULPA 1K8AC 4GOPB 1L0WA 1NTGA 2Q2HA 4YHHL 4DV1L 3S15H 1AE3A 2K5NA 2ATWA 4B3TQ 1QVCA 3S16H 4JI3L 1QZGA 3HOWH 3W5OA 4OWXB 3GD7A 2DUDA 1OXSC 2AKWB 4IOAA 4JI6L 3STBD 2D62A 3A0JA 3UDFA 5FLMG 2AMCB 2WFWA 4LF6Q 3KF8B 1XPUA 3GTPH 2NN6I 4DV6L 1O7IA 4JOIA 3M85A 4RG1A 4JI2L 1AH9A 4X62L 2E8GA 2KBNA 2UUBL 4JI3Q 3T1YL 1WJJA 1C7YA 3OYYA 2B29A 3ERSX 4QGUA 3CCLA 3F2BA 1YJ9A 3CCRA 4A3FG 1SRUA 1Y1WH 5C44G 2NVQH 3S2DH 4A3BG 1Q12A 5LMUQ 4TVAB 4AQYQ 1IXRA 1VQ4A 1HZCA 5C3EH 1K9MC 2OTLA 4HJ8A 4OO1G 2K14A 2PI2E 1QZHA 5IYDG 1FVIA 1XPRA 1X9NA 3W1GA 2ZM6L 1SN8A 1X3EA 4DR4Q 3LGJA 4LUZA 2JA6G 3TEHB 4A3DG 4K0KQ 4UY8C 4GS3A 4OWTB 5J3BA 1HNZL 4Y52H 2CWAA 2RF4A 3BU2A 4A3MG 1VQNA 1CSPA 2JEBI 3FKIH 4QJFA 5GQOA 5HGQA 5IE8A 4HIDA 3ZJYC 1OTCA 1KL9A 4R4TA 4LW1A 1SMXA 3GTLH 4GNXC 3S2HH 1B7YB 1WYDA 3U4ZA 1I94Q 2PNHA 1N8RC 4J15A 4BA1I 1EQRA 5H1SE 3HOXH 4X65L 2OQKA 2HQLA 4LFAL 4IO9A 5GAGC 1S3OA 2PQAA 2HT1A 2UXBL 1E24A 2K50A 4C3IH 3L2PA 4JI5Q 4GOPA 4JI4L 1P16A 4DV7L 5GROA 4NXMQ 1K73C 2D0OA 2Q2IA 3S1RH 1VQPA 1FJGL 1V1QA 4YCVA 4Y7NH 4LF5L 1JJGA 1XMOL 2R7FA 3PUXA 4H02A 1K83H 4P73A 4UP7A 2Z6KA 4B3MQ 4A93G 3J7A5 3U50C 1HNWL 2DGYA 4WJ3M 3UE0A 4GKJQ 4LF7Q 2R7ZG 2MO0A 3U4VA 2Q2TA 3I4MG 2N49A 3MXNB 4DV2Q 2HHHL 2F52A 2JA8G 4BBSG 4KLKA 4JI7Q 2EQSA 3HOYH 1PH5A 2VW9A 3PIOA 4A3JG 2OQ0A 5LMNW 3H0GH 1HZBA 5M5XH 2F4VL 4DAYB 3J80i 1HJPA 3D31A 1SLJA 4JV5Q 4JOIC 3RLNA 4AH6A 4POGA 1Q46A 1E1OA 1UEBA 1WFQA 4FDBA 4A75A 2JA5H 4LUOA 2CWPA 2LXJA 2RHSB 3GTGH 1B70B 3EN2A 5FLMH 1VQBA 4L5SA 1VQFA 3I4OA 2WP8J 1AE2A 4L5QA 1N34Q 5IYBG 4YY3L 4A3EG 1XNQQ 2UUCL 4BY7G 5LMNL 3M4QA 4A3IH 1OXTA 2IX1A 4DAMA 1B8AA 2JA9A 1LM0A 2NVXH 1EYGA 4A3FH 2FXQA 3PUVA 4A3BH 3FHWA 2N78A 3E0EA 1IBMQ 2OTJA 4GN5A 1L1OC 2QGQA 3HKSA 5BR8L 3AEVA 1YJNA 2ZTDA 2KHJA 1N33Q 4A3DH 1PFSA 1WOCA 1YITA 1YHBA 2B3GA 4A3MH 4DNIA 4DR3L 2XTIA 1TXYA 2ASBA 4DR2Q 3I55A 1W3SA 2VQFQ 4GKKL 2A19A 1X65A 4NXNQ 1DGSA 1D8LA 1YI2A 4LF8Q 5BR8Q 4X64L 4DV4L 5EAYA 1W2BA 1N36L 1NMGA 2ALYB 1N32Q 4MNOA 3IRBA 4DUZL 2VY3A 1KQSA 3RN2A 1YHAA 2XGTA 4KHZA 1PH6A 4JI0Q 4LFCQ 5M3FG 1VQHA 3J7ZC 1HR0W 3CC2A 3STBC 5JEAG 1KRSA 1QVFA 3JAMi 2UXCL 3AFPA 2HIXA 3GTKH 1MJCA 3K0XA 4C3JH 1E7ZA 3M4OH 1LTLA 3KF6B 1V9PA 3CF5A 4HIKA 3HOVG 4LF9L 2JQOA 4IPGA 4YCUA 1E22A 4X66Q 1X55A 5FLXc 3DLLA 4KHPQ 4HIOA 4A3LG 1WCMG 1YNXA 2YTYA 4A93H 3PSIA 2VNUD 3H15A 3I7FA 4P74A 3FP9A 1PV4A 1E3PA 4MTNA 2ZJPA 4PZ8A 2R7ZH 3ICEA 4YHHQ 4DV1Q 1TWCH 3I4MH 2R93G 1YZ6A 1EUJA 1YVCA 2JA8H 3EBEA 4BBSH 1G291 3CCSA 4OWWB 4A3JH 1HR0L 2VS1A 4JCVE 1A0IA 4O2DA 1UE1A 1FGUA 2ZJRA 4A3KG 4GLVB 2YTVA 1VQLA 1A8VA 3J80c 2N8NA 2A8VA 2I5LX 4UP9A 4JI6Q 5IP7G 1Q82C 1HZ9A 1VQ8A 3M9BA 1CKOA 4DV6Q 3KDFB 1I6HH 3A74A 2GN5A 2IHFA 4JI2Q 1BBWA 3GDEA 1VQJA 4X62Q 2UUBQ 4QQBX 3RLFA 3T1YQ 1VQCA 5IWAL 3NELA 4DV3L 1J5EL 1I50H 1S72A 4BA2I 3CCQA 2IX0A 2MO1A 4AIMA 3CCUA 4BY7H 1XJVA 3TS2A 3PO3G 3OTOL 3L0OA 1PH8A 2QEXA 4BXXG 1IBKL 2CFMA 4YWLA 5JEAJ 4DR7L 2I5MX 2VUMH 1OXUA 2ZM6Q 1IBLL 3GTJH 1VQOA 3KJPA 2I5HA 1J5EQ 1TWGH 2GVAA 2CQOA 1HNZQ 4LF4L 3M3YH 1YJWA 3BZKA 1I5FA 1YBYA 4DR6L 3HOZG 1QUQB 3U58A 4A3CG 1YIJA 4IOCA 2CKZB 4IFDG 5IP9H 5JJLA 1X3GA 4L5RC 4DR7Q 1CKMA 4B3RL 2UU9L 3K81C 3KF6A 1Q1EA 4GN3B 4AYBE 1HNXL 4UP8A 1PH3A 4AYBG 5IYCG 4GLAC 3F1ZA 4X65Q 1KC8C 3HOUG 3PGZA 2VQEL 2ZJQA 4LFAQ 4LNQA 3PO2G 2UXBQ 1M90C 2L15A 1X6OA 4P75A 3NBHB 5DLQE 3RLOA 4APVA 3PUWA 2UUAL 4JI4Q 4DV7Q 4JG2A 1PH7A 4JC0A 4PG3A 1GD7A 5M3FH 4B3SL 3I4NG 1FJGQ 1VQGA 5IY0A 3JAMc 4GNXB 4LF5Q 1XMOQ 1VQ6A 3K7UC 1C0AA 2NN6G 3G48A 1C9OA 3HOVH 1HNWQ 4GN4B 4C3HH 3BJUA 3CXCA 1VQIA 1N9WA 2HHHQ 4A3LH 4QIWE 1KHIA 5M3MG 3KDFA 4OX9L 1GVPA 2RHQB 4JBMA 2LXKA 2JJQA 4QL5A 2LSSA 2KCTA 3CW2C 2F4VQ 3ULLA 3GTMH 4UPAA 2R93H 1TWHH 3GO5A 5HY6A 4NPSA 1EQQA 3M7NA 5AJ3L 2GVBA 2K4KA 2K75A 2C35B 3PF4A 4A3KH 1XTDA 3K8AA 4P71A 5FJ8G 4A4IA 1VQEA 4DUYL 3E9IA 5IP7H 1U5KA 4ALPA 3GTQH 4IFDJ 5C44H 4WJ4A 4KI0A 2NVYH 4EX5A 1UE7A 2R92G 3DM3A 3S1NH 4YY3Q 4HJ5A 2B63G 2UUCQ 5LMNQ 3CPWA 4RMFA 4IPDA 5IYDH 1WI5A 4OXPA 3L7ZC 4JI8L 1Y1VG 1SE8A 2E2HH 1BBUA 2K5VA 4P72A 1QUQA 2JA6H 2IHEA 1KXLA 4C2MH 3NEMA 3HKZE 3CCEA 1CKNB 1RL2A 1X3FA 3TQYA 1S40A 2JA7G 3HKZG 3PO3H 3D0FA 4BXXH 3FKIG 4XTCS 1VCIA 4OO1I 4HJ7A 4JI1L 1EFWA 4R4CA 4IPCA 1LYLA 3WWVA 1U0LA 4YCWA 4DV0L 3I2ZA 4JYAL 4JBWA 1IL2A 1BKBA 3ER0A 4GOPC 2YU9H 2MFIA 4LFBL 2BA0A 2I0QA 3PF5A 3S24A 1JE5A 5M5WH 5GAEC 2OCEA 2Z0SA 4DV5L 4POFA 4DR1L 3J81i 3T1HL 3HOZH 1IYJB 4DR3Q 4A3CH 2PMZE 2Z6KC 4GNXA 4GKKQ 1UWVA 1NBWA 3TRZA 1XNRL 1HH2P 4X64Q 4DV4Q 1K0RA 1L2FA 1L1OB 1NMFA 1N36Q 4DUZQ 1Q8KA 2Y0SE 1I3QH 1KIXA 4PZ6A 3HOUH 3F2CA 2ZTCA 2WAQE 2RCNA 3PO2H 2UXCQ 2WAQG 1CSQA 1OXXK 3K7AH 1EIYB 4EQ5A 3OW2A 3KLWA 4LF9Q 3RR5A 1XPOA 3HOYG 5K36G 3I4NH 1CUKA 1VQMA 2E2JH 1PA6A 3CPFA 2NVTH 1UE5A 1XMQL 1PH4A 3G71A 2CCZA 1MIUA 1TWAH 3AYHB 3CQZH 2KENA 2BH8A 4OONA 5M3MH 1EOVA 3SGIA 1BVSA 4HIMA 2JA5G 1HR0Q 5GADC 1EIFA 3E9HA 2JK8A 5C0XG 2AHOB 2EIFA 3K80C 3A5UA 5LMUL 5IYBH 4LF6L 4AQYL 3H3VH 4A3EH 3A5ZB 3CCMA 1XMQQ 1VQ5A 4R4QA 5ELOA 4A3GG 2BA1A 1Q1BA 3MEFA 4A3IG 2H5XA 1CKNA 3PUYA 5FJ8H 4DR4L 1GKHA 3KJOA 2IT1A 4IJHA 3UE1A 4K0KL 5C4XG 3JC66 5IWAQ 1JT8A 4DV3Q 4IJLA 2R92H 3H3VI 1PVOA 3PIPA 4B3TL 4JBKA 4BY1G 2B63H 4MZ9A 2MQHA 1HZAA 3CD6A 4YWMA 3RZOH 5C4JH 3M4PA 3OTOQ 1OXVA 1Y1VH 2OWOA 1VQDA 2MNAA 1R9TH 1IBKQ 3GTOH 1I94L 1PYSB 1KRTA 3CCVA 2VL6A 2N3SA 5E7NA 1K8GA 3CC7A 1IBLQ 2JA7H 2K52A 1VS0A 1Z9FA 2JEAI 5JJIA 1QVGA 1L1OA 1NY4A 1SR3A 3Q8DA 5M5YH 1TWFH 4JI5L 1JJ2A 4LF4Q 2E5LL 4DR6Q 2IY5B 1Q81C 5IT9c 1H95A 4NXML 2KHIA 1KD1C 3F8TA 2VZAA 5ELNA 4TQUS 4BBRG 3PUZA 3S1QH 1FL0A 2UU9Q 1Y14B 4B3RQ 1KAWA 2ZTEA 1HNXQ 3W1BA 3AFQA 3J81c
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJC B;  2YTX A;  4ME3 A;  4GKJ L;  4LF7 L;  3UDX A;  3CMA A;  1G6P A;  1GO3 E;  2VQE Q;  3I56 A;  1NE3 A;  1LUZ A;  2R6G A;  4DV2 L;  2E5L Q;  5C0X J;  1Z47 A;  4JI7 L;  4HJ9 A;  3BZC A;  1ASZ A;  3AQQ A;  4PMW A;  1SRO A;  2UUA Q;  1JMC A;  4B3M L;  2V1C C;  1IZ6 A;  1WCM H;  3HOW G;  4IPH A;  4DK6 C;  1SFO H;  4B3S Q;  2ID0 A;  4X6A H;  2AWN A;  1MJE A;  2YYZ A;  4JV5 L;  3CP0 A;  3G6E A;  4NB3 A;  4HJA A;  3VDY A;  3UDG A;  2BH2 A;  4OX9 Q;  3ULJ A;  1N34 L;  2EXD A;  2D0P A;  1XNQ L;  3S14 H;  1VQ9 A;  1V43 A;  1Y1W G;  3F2D A;  3S1M H;  1K3R A;  3UDI A;  3CCJ A;  1PH2 A;  3KFU A;  3CME A;  5C3E G;  3KOJ A;  4DKA C;  5AJ3 Q;  1P8L A;  1NJI C;  3RN5 A;  2R7D A;  2AWO A;  1ASY A;  1VQA A;  1Q7Y C;  3B6Y A;  1PH9 A;  1D7Q A;  3RNU A;  4DUY Q;  3G4S A;  3PCO B;  4A3G H;  4QY7 A;  2ES2 A;  3CC4 A;  1IBM L;  3RZD H;  5JJK A;  4LWC A;  3CAM A;  1PYB A;  2YV5 A;  4JBJ A;  1VQ7 A;  1N33 L;  1VQK A;  5C4X H;  4JI8 Q;  2F3I A;  5C0X I;  4GLX A;  1X56 A;  2NZH A;  1G51 A;  2WB1 E;  1Q86 C;  1M1K C;  4DR5 L;  2VUM G;  1X54 A;  2WB1 G;  2UXD L;  1T9H A;  4YWK A;  4R1J A;  3TS0 A;  4R4I A;  4PZ7 A;  4BY1 H;  3HOX G;  1MKH A;  3TRE A;  4DR2 L;  2VQF L;  3HFZ B;  2QA4 A;  4NXN L;  4LF8 L;  3KYH C;  1YHQ A;  2A1A A;  4JI1 Q;  1PH1 A;  1J6Q A;  1A63 A;  5IP9 G;  1N32 L;  4DV0 Q;  4LUV A;  4JYA Q;  4JI0 L;  4LFB Q;  4LFC L;  1JB7 A;  4DR5 Q;  2UXD Q;  1UE6 A;  4R4O A;  2JE6 I;  2PI2 A;  5IYC H;  1RIP A;  1A62 A;  2Y0S G;  4DV5 Q;  4DR1 Q;  3J81 j;  3T1H Q;  2KCM A;  3S17 H;  1GM5 A;  2K5H A;  4IFD I;  4X66 L;  4O0A A;  4KHP L;  1EWI A;  4BBR H;  2NZO A;  1E1T A;  1YEZ A;  2HIV A;  4DK3 C;  4A76 A;  1XNR Q;  3PV0 A;  2E2I H;  2Q2U A;  2PQA B;  3EIV A;  4XIG S;  1PHJ A;  3NEN A;  4DPG A;  4L5T A;  3H0G G;  5GAH C;  3ULP A;  1K8A C;  4GOP B;  1L0W A;  1NTG A;  2Q2H A;  4YHH L;  4DV1 L;  3S15 H;  1AE3 A;  2K5N A;  2ATW A;  4B3T Q;  1QVC A;  3S16 H;  4JI3 L;  1QZG A;  3HOW H;  3W5O A;  4OWX B;  3GD7 A;  2DUD A;  1OXS C;  2AKW B;  4IOA A;  4JI6 L;  3STB D;  2D62 A;  3A0J A;  3UDF A;  5FLM G;  2AMC B;  2WFW A;  4LF6 Q;  3KF8 B;  1XPU A;  3GTP H;  2NN6 I;  4DV6 L;  1O7I A;  4JOI A;  3M85 A;  4RG1 A;  4JI2 L;  1AH9 A;  4X62 L;  2E8G A;  2KBN A;  2UUB L;  4JI3 Q;  3T1Y L;  1WJJ A;  1C7Y A;  3OYY A;  2B29 A;  3ERS X;  4QGU A;  3CCL A;  3F2B A;  1YJ9 A;  3CCR A;  4A3F G;  1SRU A;  1Y1W H;  5C44 G;  2NVQ H;  3S2D H;  4A3B G;  1Q12 A;  5LMU Q;  4TVA B;  4AQY Q;  1IXR A;  1VQ4 A;  1HZC A;  5C3E H;  1K9M C;  2OTL A;  4HJ8 A;  4OO1 G;  2K14 A;  2PI2 E;  1QZH A;  5IYD G;  1FVI A;  1XPR A;  1X9N A;  3W1G A;  2ZM6 L;  1SN8 A;  1X3E A;  4DR4 Q;  3LGJ A;  4LUZ A;  2JA6 G;  3TEH B;  4A3D G;  4K0K Q;  4UY8 C;  4GS3 A;  4OWT B;  5J3B A;  1HNZ L;  4Y52 H;  2CWA A;  2RF4 A;  3BU2 A;  4A3M G;  1VQN A;  1CSP A;  2JEB I;  3FKI H;  4QJF A;  5GQO A;  5HGQ A;  5IE8 A;  4HID A;  3ZJY C;  1OTC A;  1KL9 A;  4R4T A;  4LW1 A;  1SMX A;  3GTL H;  4GNX C;  3S2H H;  1B7Y B;  1WYD A;  3U4Z A;  1I94 Q;  2PNH A;  1N8R C;  4J15 A;  4BA1 I;  1EQR A;  5H1S E;  3HOX H;  4X65 L;  2OQK A;  2HQL A;  4LFA L;  4IO9 A;  5GAG C;  1S3O A;  2PQA A;  2HT1 A;  2UXB L;  1E24 A;  2K50 A;  4C3I H;  3L2P A;  4JI5 Q;  4GOP A;  4JI4 L;  1P16 A;  4DV7 L;  5GRO A;  4NXM Q;  1K73 C;  2D0O A;  2Q2I A;  3S1R H;  1VQP A;  1FJG L;  1V1Q A;  4YCV A;  4Y7N H;  4LF5 L;  1JJG A;  1XMO L;  2R7F A;  3PUX A;  4H02 A;  1K83 H;  4P73 A;  4UP7 A;  2Z6K A;  4B3M Q;  4A93 G;  3J7A 5;  3U50 C;  1HNW L;  2DGY A;  4WJ3 M;  3UE0 A;  4GKJ Q;  4LF7 Q;  2R7Z G;  2MO0 A;  3U4V A;  2Q2T A;  3I4M G;  2N49 A;  3MXN B;  4DV2 Q;  2HHH L;  2F52 A;  2JA8 G;  4BBS G;  4KLK A;  4JI7 Q;  2EQS A;  3HOY H;  1PH5 A;  2VW9 A;  3PIO A;  4A3J G;  2OQ0 A;  5LMN W;  3H0G H;  1HZB A;  5M5X H;  2F4V L;  4DAY B;  3J80 i;  1HJP A;  3D31 A;  1SLJ A;  4JV5 Q;  4JOI C;  3RLN A;  4AH6 A;  4POG A;  1Q46 A;  1E1O A;  1UEB A;  1WFQ A;  4FDB A;  4A75 A;  2JA5 H;  4LUO A;  2CWP A;  2LXJ A;  2RHS B;  3GTG H;  1B70 B;  3EN2 A;  5FLM H;  1VQB A;  4L5S A;  1VQF A;  3I4O A;  2WP8 J;  1AE2 A;  4L5Q A;  1N34 Q;  5IYB G;  4YY3 L;  4A3E G;  1XNQ Q;  2UUC L;  4BY7 G;  5LMN L;  3M4Q A;  4A3I H;  1OXT A;  2IX1 A;  4DAM A;  1B8A A;  2JA9 A;  1LM0 A;  2NVX H;  1EYG A;  4A3F H;  2FXQ A;  3PUV A;  4A3B H;  3FHW A;  2N78 A;  3E0E A;  1IBM Q;  2OTJ A;  4GN5 A;  1L1O C;  2QGQ A;  3HKS A;  5BR8 L;  3AEV A;  1YJN A;  2ZTD A;  2KHJ A;  1N33 Q;  4A3D H;  1PFS A;  1WOC A;  1YIT A;  1YHB A;  2B3G A;  4A3M H;  4DNI A;  4DR3 L;  2XTI A;  1TXY A;  2ASB A;  4DR2 Q;  3I55 A;  1W3S A;  2VQF Q;  4GKK L;  2A19 A;  1X65 A;  4NXN Q;  1DGS A;  1D8L A;  1YI2 A;  4LF8 Q;  5BR8 Q;  4X64 L;  4DV4 L;  5EAY A;  1W2B A;  1N36 L;  1NMG A;  2ALY B;  1N32 Q;  4MNO A;  3IRB A;  4DUZ L;  2VY3 A;  1KQS A;  3RN2 A;  1YHA A;  2XGT A;  4KHZ A;  1PH6 A;  4JI0 Q;  4LFC Q;  5M3F G;  1VQH A;  3J7Z C;  1HR0 W;  3CC2 A;  3STB C;  5JEA G;  1KRS A;  1QVF A;  3JAM i;  2UXC L;  3AFP A;  2HIX A;  3GTK H;  1MJC A;  3K0X A;  4C3J H;  1E7Z A;  3M4O H;  1LTL A;  3KF6 B;  1V9P A;  3CF5 A;  4HIK A;  3HOV G;  4LF9 L;  2JQO A;  4IPG A;  4YCU A;  1E22 A;  4X66 Q;  1X55 A;  5FLX c;  3DLL A;  4KHP Q;  4HIO A;  4A3L G;  1WCM G;  1YNX A;  2YTY A;  4A93 H;  3PSI A;  2VNU D;  3H15 A;  3I7F A;  4P74 A;  3FP9 A;  1PV4 A;  1E3P A;  4MTN A;  2ZJP A;  4PZ8 A;  2R7Z H;  3ICE A;  4YHH Q;  4DV1 Q;  1TWC H;  3I4M H;  2R93 G;  1YZ6 A;  1EUJ A;  1YVC A;  2JA8 H;  3EBE A;  4BBS H;  1G29 1;  3CCS A;  4OWW B;  4A3J H;  1HR0 L;  2VS1 A;  4JCV E;  1A0I A;  4O2D A;  1UE1 A;  1FGU A;  2ZJR A;  4A3K G;  4GLV B;  2YTV A;  1VQL A;  1A8V A;  3J80 c;  2N8N A;  2A8V A;  2I5L X;  4UP9 A;  4JI6 Q;  5IP7 G;  1Q82 C;  1HZ9 A;  1VQ8 A;  3M9B A;  1CKO A;  4DV6 Q;  3KDF B;  1I6H H;  3A74 A;  2GN5 A;  2IHF A;  4JI2 Q;  1BBW A;  3GDE A;  1VQJ A;  4X62 Q;  2UUB Q;  4QQB X;  3RLF A;  3T1Y Q;  1VQC A;  5IWA L;  3NEL A;  4DV3 L;  1J5E L;  1I50 H;  1S72 A;  4BA2 I;  3CCQ A;  2IX0 A;  2MO1 A;  4AIM A;  3CCU A;  4BY7 H;  1XJV A;  3TS2 A;  3PO3 G;  3OTO L;  3L0O A;  1PH8 A;  2QEX A;  4BXX G;  1IBK L;  2CFM A;  4YWL A;  5JEA J;  4DR7 L;  2I5M X;  2VUM H;  1OXU A;  2ZM6 Q;  1IBL L;  3GTJ H;  1VQO A;  3KJP A;  2I5H A;  1J5E Q;  1TWG H;  2GVA A;  2CQO A;  1HNZ Q;  4LF4 L;  3M3Y H;  1YJW A;  3BZK A;  1I5F A;  1YBY A;  4DR6 L;  3HOZ G;  1QUQ B;  3U58 A;  4A3C G;  1YIJ A;  4IOC A;  2CKZ B;  4IFD G;  5IP9 H;  5JJL A;  1X3G A;  4L5R C;  4DR7 Q;  1CKM A;  4B3R L;  2UU9 L;  3K81 C;  3KF6 A;  1Q1E A;  4GN3 B;  4AYB E;  1HNX L;  4UP8 A;  1PH3 A;  4AYB G;  5IYC G;  4GLA C;  3F1Z A;  4X65 Q;  1KC8 C;  3HOU G;  3PGZ A;  2VQE L;  2ZJQ A;  4LFA Q;  4LNQ A;  3PO2 G;  2UXB Q;  1M90 C;  2L15 A;  1X6O A;  4P75 A;  3NBH B;  5DLQ E;  3RLO A;  4APV A;  3PUW A;  2UUA L;  4JI4 Q;  4DV7 Q;  4JG2 A;  1PH7 A;  4JC0 A;  4PG3 A;  1GD7 A;  5M3F H;  4B3S L;  3I4N G;  1FJG Q;  1VQG A;  5IY0 A;  3JAM c;  4GNX B;  4LF5 Q;  1XMO Q;  1VQ6 A;  3K7U C;  1C0A A;  2NN6 G;  3G48 A;  1C9O A;  3HOV H;  1HNW Q;  4GN4 B;  4C3H H;  3BJU A;  3CXC A;  1VQI A;  1N9W A;  2HHH Q;  4A3L H;  4QIW E;  1KHI A;  5M3M G;  3KDF A;  4OX9 L;  1GVP A;  2RHQ B;  4JBM A;  2LXK A;  2JJQ A;  4QL5 A;  2LSS A;  2KCT A;  3CW2 C;  2F4V Q;  3ULL A;  3GTM H;  4UPA A;  2R93 H;  1TWH H;  3GO5 A;  5HY6 A;  4NPS A;  1EQQ A;  3M7N A;  5AJ3 L;  2GVB A;  2K4K A;  2K75 A;  2C35 B;  3PF4 A;  4A3K H;  1XTD A;  3K8A A;  4P71 A;  5FJ8 G;  4A4I A;  1VQE A;  4DUY L;  3E9I A;  5IP7 H;  1U5K A;  4ALP A;  3GTQ H;  4IFD J;  5C44 H;  4WJ4 A;  4KI0 A;  2NVY H;  4EX5 A;  1UE7 A;  2R92 G;  3DM3 A;  3S1N H;  4YY3 Q;  4HJ5 A;  2B63 G;  2UUC Q;  5LMN Q;  3CPW A;  4RMF A;  4IPD A;  5IYD H;  1WI5 A;  4OXP A;  3L7Z C;  4JI8 L;  1Y1V G;  1SE8 A;  2E2H H;  1BBU A;  2K5V A;  4P72 A;  1QUQ A;  2JA6 H;  2IHE A;  1KXL A;  4C2M H;  3NEM A;  3HKZ E;  3CCE A;  1CKN B;  1RL2 A;  1X3F A;  3TQY A;  1S40 A;  2JA7 G;  3HKZ G;  3PO3 H;  3D0F A;  4BXX H;  3FKI G;  4XTC S;  1VCI A;  4OO1 I;  4HJ7 A;  4JI1 L;  1EFW A;  4R4C A;  4IPC A;  1LYL A;  3WWV A;  1U0L A;  4YCW A;  4DV0 L;  3I2Z A;  4JYA L;  4JBW A;  1IL2 A;  1BKB A;  3ER0 A;  4GOP C;  2YU9 H;  2MFI A;  4LFB L;  2BA0 A;  2I0Q A;  3PF5 A;  3S24 A;  1JE5 A;  5M5W H;  5GAE C;  2OCE A;  2Z0S A;  4DV5 L;  4POF A;  4DR1 L;  3J81 i;  3T1H L;  3HOZ H;  1IYJ B;  4DR3 Q;  4A3C H;  2PMZ E;  2Z6K C;  4GNX A;  4GKK Q;  1UWV A;  1NBW A;  3TRZ A;  1XNR L;  1HH2 P;  4X64 Q;  4DV4 Q;  1K0R A;  1L2F A;  1L1O B;  1NMF A;  1N36 Q;  4DUZ Q;  1Q8K A;  2Y0S E;  1I3Q H;  1KIX A;  4PZ6 A;  3HOU H;  3F2C A;  2ZTC A;  2WAQ E;  2RCN A;  3PO2 H;  2UXC Q;  2WAQ G;  1CSQ A;  1OXX K;  3K7A H;  1EIY B;  4EQ5 A;  3OW2 A;  3KLW A;  4LF9 Q;  3RR5 A;  1XPO A;  3HOY G;  5K36 G;  3I4N H;  1CUK A;  1VQM A;  2E2J H;  1PA6 A;  3CPF A;  2NVT H;  1UE5 A;  1XMQ L;  1PH4 A;  3G71 A;  2CCZ A;  1MIU A;  1TWA H;  3AYH B;  3CQZ H;  2KEN A;  2BH8 A;  4OON A;  5M3M H;  1EOV A;  3SGI A;  1BVS A;  4HIM A;  2JA5 G;  1HR0 Q;  5GAD C;  1EIF A;  3E9H A;  2JK8 A;  5C0X G;  2AHO B;  2EIF A;  3K80 C;  3A5U A;  5LMU L;  5IYB H;  4LF6 L;  4AQY L;  3H3V H;  4A3E H;  3A5Z B;  3CCM A;  1XMQ Q;  1VQ5 A;  4R4Q A;  5ELO A;  4A3G G;  2BA1 A;  1Q1B A;  3MEF A;  4A3I G;  2H5X A;  1CKN A;  3PUY A;  5FJ8 H;  4DR4 L;  1GKH A;  3KJO A;  2IT1 A;  4IJH A;  3UE1 A;  4K0K L;  5C4X G;  3JC6 6;  5IWA Q;  1JT8 A;  4DV3 Q;  4IJL A;  2R92 H;  3H3V I;  1PVO A;  3PIP A;  4B3T L;  4JBK A;  4BY1 G;  2B63 H;  4MZ9 A;  2MQH A;  1HZA A;  3CD6 A;  4YWM A;  3RZO H;  5C4J H;  3M4P A;  3OTO Q;  1OXV A;  1Y1V H;  2OWO A;  1VQD A;  2MNA A;  1R9T H;  1IBK Q;  3GTO H;  1I94 L;  1PYS B;  1KRT A;  3CCV A;  2VL6 A;  2N3S A;  5E7N A;  1K8G A;  3CC7 A;  1IBL Q;  2JA7 H;  2K52 A;  1VS0 A;  1Z9F A;  2JEA I;  5JJI A;  1QVG A;  1L1O A;  1NY4 A;  1SR3 A;  3Q8D A;  5M5Y H;  1TWF H;  4JI5 L;  1JJ2 A;  4LF4 Q;  2E5L L;  4DR6 Q;  2IY5 B;  1Q81 C;  5IT9 c;  1H95 A;  4NXM L;  2KHI A;  1KD1 C;  3F8T A;  2VZA A;  5ELN A;  4TQU S;  4BBR G;  3PUZ A;  3S1Q H;  1FL0 A;  2UU9 Q;  1Y14 B;  4B3R Q;  1KAW A;  2ZTE A;  1HNX Q;  3W1B A;  3AFQ A;  3J81 c; 
#chains in the Genus database with same CATH topology
 5CMD A;  4GKJ L;  5T1G A;  4LF7 L;  3HP3 A;  3S1N B;  1GO3 E;  5CV8 A;  2VQE Q;  2E5L Q;  1LUZ A;  2R6G A;  1EYA A;  5C0X J;  3E3X A;  1LLR D;  4PMW A;  2F0S A;  1JMC A;  3HOW G;  4DK6 C;  1WTQ A;  1MSH A;  2F0W A;  4B3S Q;  2F4I A;  1IYV A;  1H9M A;  2A6H D;  5BN5 A;  2SEB D;  3DEO A;  1GUW A;  1CT1 D;  3DWQ A;  1AFP A;  4FF3 A;  1V1O A;  3NTI A;  5M5W B;  3TBI B;  3S14 H;  1V43 A;  3HOZ B;  5C4Z A;  3UDI A;  4X3U A;  3CCJ A;  1PH2 A;  1I4X A;  1JCK B;  3KFU A;  2Z8L A;  1P8L A;  2I46 A;  2RCF A;  3M4Y A;  2EYF A;  3RN5 A;  4ZKB B;  2EJF C;  4RHS A;  3B6Y A;  1PH9 A;  4XQQ A;  5EGT A;  2ES2 A;  1ML0 D;  1NCV A;  4ZQ3 A;  1QJO A;  3MZ5 A;  2K7V A;  1LT3 D;  1PYB A;  2YV5 A;  3R2I A;  1VQK A;  5C4X H;  1L0X B;  2VUM G;  4L6T B;  1JQY D;  1STY A;  1M1K C;  4XXE A;  3VR6 A;  4NXN L;  1MI2 A;  2CHB D;  1PH1 A;  1A63 A;  4JI1 Q;  1EIH A;  1J6Q A;  4C3I G;  1N32 L;  3VR2 A;  4QIW B;  4LUV A;  4JYA Q;  1AP0 A;  4LFC L;  4DFA A;  1JWS D;  2PI2 A;  3SE0 A;  1A62 A;  2Y0S G;  4A3E B;  3T56 B;  2HCC A;  2HIV A;  2PQA B;  2NBF A;  1X32 A;  2EOT A;  4G57 A;  3K59 A;  1B9M A;  4YHH L;  2K5N A;  2ATW A;  3D8G A;  3ITP A;  1Y1V B;  4JI3 L;  3HOW H;  3W5O A;  1KAB A;  3V96 A;  1CZW A;  4G4K A;  4IOA A;  4V19 0;  4JI6 L;  3Q23 A;  5FLM G;  1PYW D;  3QO2 A;  4H7B A;  3BS1 A;  3ONA B;  2NN6 I;  4JOI A;  4R8I A;  3V2T A;  2O2L D;  5I2X A;  4X62 L;  4JI3 Q;  5CV6 A;  2UUB L;  2OEO A;  1WJJ A;  1C7Y A;  2AUJ D;  3ERS X;  3CCL A;  3F2B A;  3CCR A;  1TR5 A;  1EY4 A;  1VQ4 A;  4HJ8 A;  3TP8 A;  2K14 A;  1QZH A;  5IYD G;  1FVI A;  2F3W A;  1SN8 A;  4DR4 Q;  3TEH B;  1SFO B;  4A3D G;  3A7L A;  2CWA A;  1VQN A;  3D6W A;  4KY6 A;  4QJF A;  4B3T Q;  3ZJY C;  1SMX A;  2EYO A;  2PYK A;  4GNX C;  3S2H H;  5COR A;  1WYD A;  2PNH A;  2XWB B;  4X65 L;  2OQK A;  3E0J A;  1LTB D;  2HQL A;  2A6H C;  4IO9 A;  4L63 B;  2HT1 A;  1B9N A;  2KQ3 A;  2A5H A;  3S1M B;  3KLS X;  4C3I H;  1D5Z C;  1P16 A;  1BBX C;  3E6Z X;  4DV7 L;  4M1U B;  2D0O A;  3S1R H;  1WTO A;  4H02 A;  1K83 H;  4J8Q A;  2V4D A;  2J4X A;  2L55 A;  3VA5 A;  4WJ3 M;  3UE0 A;  4YIJ A;  3MXN B;  4BBS G;  4RGT A;  3U9O A;  3HOY H;  3PIO A;  4A3J G;  2OQ0 A;  5LMN W;  4RGM A;  4XT1 B;  3OIQ A;  1G2T A;  1HZB A;  3J80 i;  1DJR D;  2L1B A;  1HJP A;  1STH A;  4JV5 Q;  1E1O A;  4FDB A;  2ZT9 C;  2CW0 C;  5FLM H;  4DXG A;  2E2D C;  1FNV A;  1ICF B;  5IOC A;  1AE2 A;  4L5Q A;  1N34 Q;  1AW7 A;  3NE5 B;  3Q6S A;  4ZK9 B;  1LM0 A;  1SJH D;  1Y8P B;  5EPJ A;  2FXQ A;  3PUV A;  3FHW A;  3NWS A;  2AQ1 B;  2EXZ A;  3OWE B;  4RGO S;  3SK4 A;  1L1O C;  3MXU A;  3RMH A;  3HKS A;  4ID6 A;  5BR8 L;  3AEV A;  1GJX A;  2B8F A;  4A3D H;  1GUO A;  2BCO A;  2BDN A;  3GTP B;  2Q8R E;  2EJG C;  1HQR D;  2ASB A;  3MFY A;  4GKK L;  4IUR A;  5M9O A;  5ELF A;  1SYB A;  5BR8 Q;  1NMG A;  2ALY B;  3FDT A;  3NP8 A;  3Q24 A;  1KQS A;  3PMF A;  5CV5 A;  1PH6 A;  4JI0 Q;  1HHV A;  2FFK B;  1VQH A;  3J7Z C;  1KRS A;  3JAM i;  1Q3L A;  1R4Q B;  3AFP A;  3I91 A;  3K0X A;  3KF6 B;  4HIK A;  2X6G A;  1BDO A;  4IPG A;  2E74 C;  1TS4 A;  4HIO A;  4P74 A;  4XDX A;  1DOM A;  1E3P A;  4MTN A;  3HKZ B;  2ZJP A;  1HFG A;  4IQZ A;  2R93 G;  4BBS H;  1TS2 A;  3CCS A;  4A3J H;  4G7O C;  4JCV E;  4O2D A;  1UE1 A;  1FGU A;  2P5Z X;  3I70 A;  4GLV B;  1VQL A;  2WB1 B;  1S5B D;  3J80 c;  4MTK A;  3OMC A;  2I5L X;  1DOK A;  1HZ9 A;  1DD2 A;  1ZEQ X;  1CKO A;  3BVZ A;  3KDF B;  4BS9 A;  4JI2 Q;  2GN5 A;  5JVG 3;  1VQJ A;  4QB4 A;  4DV3 L;  4Y7N B;  1EY6 A;  1E2Z A;  1A6X A;  3CCU A;  3Q22 A;  4RCO A;  3OTO L;  3IFD A;  3TZU A;  1LTT D;  2QEX A;  4BXX G;  5JEA J;  4P2C B;  2WV6 D;  2J0T D;  1VQO A;  1V1P A;  1TWG H;  3ZYY X;  2CQO A;  5M5X B;  1HNZ Q;  3HOZ G;  4H44 C;  4IFD G;  1LTS D;  5IP9 H;  4L5R C;  2JA5 B;  2PZT A;  4FYD A;  2UU9 L;  1TS3 A;  3GTG B;  2RDH A;  4CBV A;  2RQX A;  4KMU C;  1QE6 A;  5IYC G;  2ZJQ A;  5L37 A;  4P75 A;  3RLO A;  2UUA L;  2F0G A;  1PH7 A;  2NTT A;  2PW7 A;  1FJG Q;  3JAM c;  3KK7 A;  1XMO Q;  2KEE A;  2LS0 1;  3OIP A;  1TU2 B;  3EVQ A;  2L12 A;  1G2S A;  2DY8 A;  2RHQ B;  2SNS A;  3M7G A;  2F4V Q;  3GTM H;  2R93 H;  1F77 A;  1O7L A;  1TWH H;  2K05 A;  5C6A A;  2ICE C;  3EA6 A;  2E76 C;  3K8A A;  4IUT A;  4P71 A;  5FJ8 G;  4DUY L;  2XSC A;  4K5V A;  3E9I A;  1D5M C;  4LAA A;  1UE7 A;  5IOD A;  2BOS A;  4YY3 Q;  3S1N H;  3D4R A;  4C3J B;  4HJ5 A;  3M4O B;  2UUC Q;  1B50 A;  1GHK A;  3DHQ A;  3L7Z C;  3P7J A;  1Y1V G;  1BBU A;  1QUQ A;  5C4H A;  1KXL A;  1LTI D;  3HKZ E;  2EYJ A;  1CKN B;  4X3S A;  3TQY A;  1JR0 D;  3SK6 A;  4BXX H;  3FKI G;  4XTC S;  1VCI A;  5FLX L;  2JA8 B;  4R4C A;  2KVM A;  2A73 B;  4YCW A;  3OMG A;  3ER0 A;  4I65 A;  1E2W A;  3PF5 A;  5M5W H;  2MUY A;  3BDL A;  2HD3 A;  5D3D A;  4POF A;  1H9J A;  3HOZ H;  4IFD H;  3QR8 A;  1UWV A;  3TRZ A;  1IYU A;  1HH2 P;  4QMG A;  4DV4 Q;  1K0R A;  1NMF A;  2FMC A;  4DUZ Q;  2EE1 A;  4PZ6 A;  4FF1 A;  4MIU A;  2WAQ E;  1IKL A;  4BY7 B;  3L9A X;  1K3B C;  5K5P A;  3KLW A;  3RR5 A;  5K36 G;  1UEA B;  1K8O A;  2VUM B;  3E5S A;  5CBA E;  1PA6 A;  3CPF A;  3MXP A;  1EY8 A;  4RFB A;  1XMQ L;  1HTP A;  3G71 A;  2CCZ A;  3M3Y B;  2KEC A;  4OON A;  1XTC D;  1B44 D;  5GAD C;  2WAC A;  3K57 A;  4LF6 L;  4A3E H;  1XMQ Q;  2F0O A;  3MEF A;  2H5X A;  2K32 A;  1XWE A;  4OHJ A;  4ZUI A;  5FJ8 H;  2IT1 A;  3UE1 A;  4IJL A;  5JVH 3;  3H3V I;  1H9S B;  3PIP A;  2CH4 A;  3SXH A;  1F9S A;  4YWM A;  1PRT B;  3OWF A;  4CKC A;  2RSO A;  1Y1V H;  3CHB D;  1FNW A;  3A54 A;  4FXG C;  2F0D A;  4JI5 L;  2DJF C;  4IZ8 A;  5KEE A;  1TY2 A;  4DR6 Q;  2IY5 B;  5IT9 c;  1H95 A;  4NXM L;  2EY6 A;  2KHI A;  1CA6 A;  4O42 A;  1PXU A;  3NTK A;  1DON A;  3PUZ A;  1B53 A;  5LL6 S;  1RTO A;  3GTQ B;  1HNX Q;  3W1B A;  4B3M L;  4R9W A;  5EKI A;  3UDX A;  3CMA A;  1HCZ A;  5KNB A;  3I56 A;  1Z47 A;  4HJ9 A;  1RD9 D;  3Q0A A;  1UAP A;  2V1C C;  2E2H B;  1SFO H;  1HA5 A;  4C2M B;  3PO3 B;  2YYZ A;  2K6A A;  3MHB A;  4NB3 A;  2QCP X;  4HJA A;  5K36 H;  2LFN A;  4X3K A;  1EEI D;  1EY0 A;  2G5D A;  3ULJ A;  1SYG A;  1O80 A;  2D0P A;  5KNC A;  1MSG A;  3F2D A;  3S1M H;  1K3R A;  3CME A;  4DKA C;  5AJ3 Q;  1ASY A;  1VQA A;  3WDN A;  4AYB B;  1YNJ D;  3HOU B;  3G4S A;  4QY7 A;  3CC4 A;  5DEH A;  1IBM L;  4RAU C;  3AB9 A;  1O7Z A;  2ZXP A;  3K7A B;  2K03 A;  3BVM A;  1N33 L;  4JBJ A;  1VQ7 A;  2JN4 A;  3VYU A;  4H0L C;  5C0X I;  4JI8 Q;  1Q86 C;  3CKI B;  1RJT A;  2WB1 G;  4R4I A;  1MKH A;  3U9S A;  4F87 A;  2VQF L;  3HFZ B;  4LF8 L;  3KYH C;  2A1A A;  5D14 A;  2VB2 X;  2FMM A;  4DV0 Q;  2RDG A;  4ME5 A;  1JB7 A;  2HDL A;  4R4O A;  3VYR A;  4DR1 Q;  3J81 j;  2KCM A;  1GM5 A;  3EQL C;  2K5H A;  4IFD I;  2NZO A;  1E1T A;  4DK3 C;  1Y69 U;  3PV0 A;  1U9R A;  3ULP A;  2K04 A;  4GOP B;  2EYL A;  2R92 B;  2FHT A;  4DV1 L;  2NN6 H;  1AE3 A;  1SNO A;  2B63 B;  4DU9 A;  4JPB W;  5EBC A;  2MP1 A;  4RKL A;  3HG9 A;  1BCP B;  1EY7 A;  1JOK A;  1QZG A;  3GTO B;  4OWX B;  3GD7 A;  4KV6 A;  5CR3 A;  2D62 A;  3UDF A;  2SOB A;  3GTP H;  1XPU A;  4DN4 M;  2F0P A;  1A2T A;  3N52 A;  3M85 A;  4RG1 A;  5M5Y B;  2PQE A;  1U4M A;  3KBG A;  5C3W A;  3T1Y L;  3X3M A;  3JAM E;  1G6Z A;  1PRT C;  5ELE A;  5C44 G;  5LMU Q;  4AQY Q;  5C5M A;  1K9M C;  1HUM A;  2OTL A;  2PMZ B;  4OO1 G;  4CKB A;  1X9N A;  4HTH A;  3J81 L;  3C1E A;  4TKO B;  4LUZ A;  2JA6 G;  1D6E C;  2MPM A;  3MWY W;  5J3B A;  3MAQ A;  2RF4 A;  5GQO A;  3TDQ A;  2CVR A;  2E75 C;  2F0L A;  1LO5 D;  2F1M A;  2B2Y A;  1IKM A;  1T5X D;  3GV6 A;  1AEX A;  1I94 Q;  3C2P A;  1N8R C;  3H94 A;  1VDZ A;  4LFA L;  5GAG C;  2PQA A;  2UXB L;  2K33 A;  2K5W A;  3D6C A;  3TSS A;  4C3J G;  2A74 C;  1K73 C;  2Q2I A;  3NK9 A;  4YCV A;  4Y7N H;  4FP5 D;  4LF5 L;  1JJG A;  4UP7 A;  1WD1 A;  3T16 A;  3J7A 5;  1HNW L;  1K8M A;  4IAL A;  3VR4 A;  4GKJ Q;  4LF7 Q;  2RA4 A;  3KBX A;  2HHH L;  2JA8 G;  4KLK A;  2EQS A;  1R4P B;  4DGZ A;  5M5X H;  1F9R A;  1YNJ C;  5AFW A;  4DAY B;  5JPM C;  4BY1 B;  1SLJ A;  3RLN A;  1Q46 A;  3TN2 A;  2F0N A;  2JA5 H;  4LUO A;  2RHS B;  3GTG H;  1B70 B;  3EN2 A;  1VQB A;  4L5S A;  3QWN A;  4BY7 G;  5LMN L;  3S17 B;  2IWH A;  1B8A A;  5KGU A;  2JA9 A;  1PTO B;  4BBR B;  3BYY B;  2CW0 D;  1EYG A;  2E2I B;  2B2V A;  4TRD A;  4FF2 A;  1PZK D;  4KK7 A;  5JJZ A;  2PCF B;  4OO1 H;  3BVG A;  4GN5 A;  4K14 A;  1KDB A;  3MXG A;  2ZTD A;  4HN7 A;  3H3V C;  1PFS A;  2B3G A;  1CM9 A;  3ND8 A;  2XRQ D;  3GV3 A;  2XTI A;  1TXY A;  3MFG A;  5NUC A;  1YNN C;  1W3S A;  1B2T A;  1U4P A;  4NXN Q;  1DGS A;  1YI2 A;  4X64 L;  1NAP A;  1Y8O B;  4KY5 A;  5A2Q L;  1ZXT A;  1N36 L;  1N32 Q;  3RN2 A;  1YHA A;  1FR3 A;  3MXN A;  4LFC Q;  3J7Y W;  1HR0 W;  3S2D B;  1BCP C;  1KAA A;  2NVQ B;  3AU7 A;  1F2Y A;  1TY0 A;  4C3J H;  1LTL A;  3M4O H;  1V9P A;  3CF5 A;  2J7Z A;  2JQO A;  5EQ0 A;  4YCU A;  3DLL A;  4OL7 A;  1WCM G;  1YNX A;  4C1N I;  2K28 A;  2VNU D;  3A8J E;  4QUF A;  2DNE A;  3ICE A;  3EJI A;  3FKI B;  4YHH Q;  5IT9 E;  1YZ6 A;  3WOE A;  2JA8 H;  3TME A;  4FXD A;  1F9P A;  1SE3 A;  2KJX A;  1GUG A;  2JXM B;  1A3V A;  4JI6 Q;  4RHR A;  3A74 A;  4XQJ A;  1QIL A;  1BBW A;  2KUM A;  3EFX D;  4X62 Q;  2UUB Q;  4QQB X;  2DJG C;  1VQC A;  5IWA L;  4OEL B;  3NEL A;  1HQM C;  4HSV A;  5JAV A;  1J5E L;  4OIK A;  5J39 A;  4CHT B;  2IX0 A;  4BY7 H;  5D3I B;  1XJV A;  3PO3 G;  1MGS A;  1I4H A;  1IBK L;  3DXJ C;  3C3L A;  5DNF A;  2VUM H;  2XWJ B;  3H0G B;  3NSW A;  5KRU A;  1J5E Q;  3F2U A;  1GUS A;  1WTX A;  1FGB D;  1EL0 A;  4V0B A;  4LF4 L;  3M3Y H;  1YJW A;  1I5F A;  2H4O A;  3U58 A;  4IN3 A;  2A68 C;  3KF6 A;  3S9W A;  1PH3 A;  4AYB G;  2NZ1 D;  3F1Z A;  4GLA C;  4X65 Q;  3HOU G;  3K5L A;  4C56 C;  1M90 C;  3NBH B;  2EYP A;  4DV7 Q;  2RBM A;  4JG2 A;  4JC0 A;  2NVX B;  1GD7 A;  5IY0 A;  1Z6H A;  1EQT A;  1VQ6 A;  3K7U C;  2HUG A;  4K5W A;  4GN4 B;  3BJU A;  3CXC A;  1VQI A;  3R8B A;  1N9W A;  4QIW E;  3KDF A;  1EYC A;  4OX9 L;  2QW7 A;  4JBM A;  4F7X A;  1PTO C;  1SYD A;  4UPA A;  4DAV A;  1ZKO A;  2A6E D;  1HA6 A;  2GVB A;  2K4K A;  2L5T A;  3D4D A;  3MC0 B;  1CI3 M;  3GQB A;  2EZV A;  1VQE A;  3R3O A;  1U5K A;  3GTQ H;  4WJ4 A;  4KN4 C;  4EX5 A;  2R92 G;  3DM3 A;  2MGS A;  2B63 G;  1PZI D;  4KD3 A;  2RSN A;  3CPW A;  5IYD H;  1TVX A;  2E2H H;  3WOF A;  2B2Y C;  1WTH A;  4A93 B;  3TP7 A;  4C2M H;  1B3Q A;  3CCE A;  1X3F A;  3PO3 H;  3OSO A;  5KYI A;  5DM7 3;  3I4M B;  2LMC B;  4OO1 I;  1ILP A;  4IPC A;  2G9D A;  5I4D A;  1U0L A;  1IL2 A;  1BKB A;  4B08 A;  4LFB L;  1X3Q A;  4O1N A;  1F2Z A;  5E3F A;  4DV5 L;  1SNQ A;  2F0F A;  3T1H L;  2EYH A;  2RVL A;  1PMR A;  2A69 D;  4JW0 A;  4GKK Q;  1XNR L;  1KIX A;  2Q8I B;  3HOU H;  1HUN A;  1I50 B;  2F0Q A;  5EJW A;  2ZTC A;  2PZU A;  2RCN A;  4KKT A;  3K7A H;  4EQ5 A;  3OW2 A;  1JWM D;  1CUK A;  3I8Z A;  2E2J H;  1PH4 A;  1D5X C;  2BH8 A;  1ZYR C;  1UUP A;  1EOT A;  3HRZ C;  3NQT A;  3SGI A;  1WTR A;  3K5N A;  4X3T A;  3HS0 C;  1D1I A;  2JK8 A;  3HZX A;  5C0X G;  1S5E D;  1FD7 D;  1STA A;  2B2V C;  3H3V H;  1AZQ A;  4KN7 C;  1VQ5 A;  5F2D A;  5ELO A;  2BA1 A;  4A3I G;  2IL8 A;  1CKN A;  5M3F B;  4ZLT F;  4K0K L;  4DV3 Q;  1KDA A;  1AN8 A;  2R92 H;  2DY7 A;  4BY1 G;  2B63 H;  3CD6 A;  1FYC A;  4C3H B;  3OTO Q;  1OXV A;  2OWO A;  3GTO H;  5IGD A;  3CCV A;  4CDC C;  2VL6 A;  5E7N A;  3CC7 A;  3T51 B;  1VS0 A;  1Z9F A;  4RWS C;  2JEA I;  5M5Y H;  1Q81 C;  1K0S A;  4RKB A;  1KD1 C;  5BN3 A;  4BBR G;  2UU9 Q;  2ZXR A;  1PFM A;  3A7A B;  5C44 B;  4ME3 A;  1QOH A;  3GP7 A;  1RF2 D;  2DNC A;  4DV2 L;  3PIO 3;  2A6E C;  2BE5 D;  4JI7 L;  4FO2 A;  4ZUJ A;  3AQQ A;  1SRO A;  1PFB A;  2NTS A;  1LT6 D;  4LMQ D;  1IZ6 A;  5KIX A;  2UUA Q;  2JA6 B;  2F0V A;  1JE4 A;  5HGT A;  2CH4 W;  5I2Y A;  2BH2 A;  2N55 A;  1ENA A;  1ICW A;  2YU9 B;  1GUN A;  4FVM A;  4EGV A;  4CDE C;  1EZ8 A;  2EXD A;  1XNQ L;  4U68 A;  4WJW A;  1QG7 A;  4EVO A;  5G3L D;  4N8X 1;  1H9S A;  2EDG A;  2R7D A;  2AWO A;  5C0X H;  1EU3 A;  1Q7Y C;  2XN9 C;  2F0I A;  1D7Q A;  3RNU A;  1I3Q B;  4DUY Q;  3PCO B;  1VMP A;  4NP5 A;  3MVV A;  5JJK A;  4Q5V A;  4CJ1 B;  2A69 C;  4GLX A;  3H09 A;  1X56 A;  2NZH A;  2WB1 E;  4OEM B;  1ENF A;  5CV4 A;  1KNE A;  4S3S A;  1T9H A;  3TS0 A;  4R1J A;  5D65 A;  4BY1 H;  1HFN A;  4DR2 L;  2NVT B;  2QA4 A;  1SMY C;  2R61 A;  3CQZ B;  1QNK A;  1H9K A;  1NSN S;  1YHQ A;  5KND A;  1II3 A;  4G7H C;  5IYC H;  2JE6 I;  3KLR A;  3S17 H;  1B3A A;  1KDC A;  4X66 L;  5C3X A;  1PTO H;  1TT2 A;  4O0A A;  2B2U A;  1EWI A;  4BBR H;  4DNT B;  1YEZ A;  4NDX A;  4KHP L;  4GZY C;  2E2I H;  2Q2U A;  1TII D;  3EIV A;  3NEN A;  4L5T A;  3H0G G;  1K8A C;  5FO8 B;  5CBE E;  3QG1 A;  1L0W A;  1NTG A;  4IUP A;  2MHV A;  1QVC A;  2KA7 A;  4CDD C;  2KCC A;  1IHZ A;  1OXS C;  2D9U A;  3IL8 A;  3KLS A;  1GXD C;  1GOZ A;  2AMC B;  2WFW A;  3KF8 B;  4DV6 L;  1C8C A;  1O7I A;  2AQ2 B;  1EWH A;  4HAE A;  2C9O A;  2E8G A;  2KBN A;  4KD4 A;  2XRS D;  2Z4I A;  3NUC A;  2B29 A;  3S1Q B;  3DM1 A;  2K5D A;  1KNA A;  1K28 A;  1YJ9 A;  1SRU A;  1A3U A;  2NVQ H;  3S2D H;  3QOL A;  1Q12 A;  4LF6 Q;  4TVA B;  1IXR A;  1HZC A;  2PZW A;  1BUV T;  1B4O A;  2ZXO A;  3BDO A;  4WRD A;  5FKA C;  5CV7 A;  1DM0 B;  2ZM6 L;  1X3E A;  1WCM B;  3LGJ A;  2RKS A;  3D3R A;  1PRT D;  1EQV A;  4F8M A;  4UY8 C;  3BU2 A;  1CSP A;  2JEB I;  2JSO A;  3FKI H;  4LJZ C;  1S5F D;  4OIJ A;  1EY5 A;  2BE5 C;  3P20 A;  1F2M A;  3T53 B;  3U4Z A;  4J15 A;  4N9T A;  1EQR A;  5H1S E;  4ZAI A;  1W6J A;  4PQX A;  2NUC A;  2K50 A;  3L2P A;  4JI5 Q;  4GOP A;  4JI4 L;  1S4Z A;  5GRO A;  4NXM Q;  1VQP A;  3SR1 A;  4A93 G;  1HPC A;  4B3M Q;  4A3G B;  3T4A C;  3U50 C;  2DGY A;  3RZD B;  5I6Y A;  2MO0 A;  4PMC A;  3U4V A;  3VR3 A;  3I4M G;  2N49 A;  1CQV A;  3H91 A;  5LL6 X;  4CGY B;  3H0G H;  4HED A;  5EKL A;  2NWG A;  5I9O A;  4XT3 B;  1GUT A;  3D31 A;  4AH6 A;  4POG A;  3SK5 A;  1STB A;  1UEB A;  3K5O A;  2CWP A;  2LXJ A;  3NBI A;  1XX8 A;  3ERO A;  3I4O A;  2WP8 J;  5IYB G;  2L9H A;  1O7Y A;  2AQ3 B;  3P75 A;  1OXT A;  4EQO A;  4DAM A;  2IX1 A;  3CU7 A;  2NVX H;  4I7Z C;  2X6L A;  3OHX C;  3E0E A;  2SNM A;  3S15 B;  4U67 3;  1IBM Q;  3S16 B;  3ERQ A;  2QGQ A;  4Q0F A;  5A2Q E;  2TMP A;  2HQE A;  1N33 Q;  2KHJ A;  4KJN A;  2QIL A;  5FO7 B;  1YIT A;  3J7A V;  3BZD B;  3K6O A;  1J8I A;  4DNI A;  4DR3 L;  2VQF Q;  5EKK A;  2F0E A;  4LF8 Q;  1G91 A;  3IRB A;  2VY3 A;  2XGT A;  4KHZ A;  4DNR B;  5M3F G;  1Q90 A;  1QVF A;  4CJ0 B;  1Y1W B;  3CC2 A;  5JEA G;  2UXC L;  1DYQ A;  1EIG A;  2HIX A;  3NTH A;  2TSS A;  4M8A A;  1MJC A;  1YNN D;  3SVM A;  5C3E B;  4DAY A;  1CFM A;  4LF9 L;  1I6V C;  4OGQ C;  4C3H G;  5FLX c;  1X55 A;  2K5Q A;  4A3L G;  2XVS A;  2YTY A;  3N6R A;  4A93 H;  3PSI A;  1JB3 A;  3FP9 A;  1PV4 A;  1BCP D;  2IW3 A;  4PZ8 A;  4DV1 Q;  3I4M H;  1G29 1;  4OWW B;  1M8A A;  1HR0 L;  3GTL B;  2VS1 A;  2ZJR A;  1BNZ A;  2N8N A;  3HOX B;  4UP9 A;  5T1I A;  1VQ8 A;  3M9B A;  5BN4 A;  2IHF A;  1M4V A;  3T1Y Q;  3SHL A;  4QCL A;  1I50 H;  5HUR A;  1S72 A;  4BA2 I;  2MO1 A;  1PRT F;  3RD4 A;  3TP5 A;  2I5M X;  4WFN 3;  1OXU A;  1SNM A;  1IBL L;  2PW5 A;  3KJP A;  2I5H A;  2GVA A;  3H6M A;  3HGB A;  1YBY A;  3BG3 A;  1YIJ A;  4IOC A;  2CKZ B;  3NPP A;  5JJL A;  1X3G A;  4B3R L;  3ND9 A;  2B8G A;  3K81 C;  2B2U C;  4IUV A;  4AYB E;  4CJ2 C;  4UP8 A;  4HCS A;  1HRJ A;  3PGZ A;  1TS5 A;  2VQE L;  4LFA Q;  4LNQ A;  2UXB Q;  1BO0 A;  4EQP A;  4A3I B;  4HMJ A;  1CK1 A;  2A68 D;  2L15 A;  1X6O A;  2FIN B;  5DLQ E;  3PUW A;  2WII B;  5M3F H;  4B3S L;  2H1E A;  4A3F B;  5JEA H;  1SYC A;  4A3B B;  4GNX B;  4LF5 Q;  1C9O A;  1HNW Q;  1RKN A;  4C3H H;  1S5C D;  2HHH Q;  4A3L H;  1KHI A;  2K01 A;  4QL5 A;  2LSS A;  4A3M B;  2KCT A;  2L0C A;  2C5C A;  2Z6B A;  5HY6 A;  4NPS A;  1EQQ A;  4KTA A;  2K75 A;  2C35 B;  2EY5 A;  4A4I A;  2O5I C;  4ALP A;  4IFD J;  2CQA A;  5C44 H;  3I73 A;  1PTO D;  3GTK B;  4RGN A;  1PDQ A;  5LMN Q;  4RA8 A;  4IPD A;  2GA4 B;  1WI5 A;  1KLG D;  1Z7T A;  1SE8 A;  2K5V A;  2JA6 H;  4C1N K;  2IHE A;  2QDB A;  4B9W A;  1IW7 C;  3I72 A;  5FOB B;  4MHE A;  2R7Z B;  3D0F A;  5IGF A;  1TWC B;  4JI1 L;  1FNU A;  4L8J A;  1LYL A;  4JYA L;  3I2Z A;  4JBW A;  4GOP C;  4NW2 A;  1CTM A;  2MFI A;  2YU9 H;  3LNN A;  2BA0 A;  2I0Q A;  2L4N A;  4UAI A;  5FO9 B;  4QF4 A;  3NBH A;  5GAE C;  3J81 i;  1SNP A;  1F2L A;  1IYJ B;  2PMZ E;  2KED A;  1RCV D;  1I6H B;  1DXM A;  3DWP A;  1NBW A;  3J80 L;  4NKL A;  3DWA A;  4X64 Q;  1N36 Q;  1L1O B;  1I3Q H;  1STE A;  5TSS A;  3F2C A;  3URY A;  1SND A;  1ROD A;  5IGG A;  1CSQ A;  4I7A A;  1BCP F;  2Z9H A;  3HOY G;  1QNU A;  2XNA C;  3VA7 A;  3GTJ B;  1STG A;  2RDF A;  2NVT H;  4FNF A;  1WTP A;  3CQZ H;  1ET6 A;  2KEN A;  3MTS A;  2F3V A;  3E9H A;  2AHO B;  2EIF A;  3FPU B;  4HR7 B;  4KJO A;  3A5Z B;  5I6W A;  3CCM A;  4R4Q A;  4A3G G;  5JPN C;  3C1F A;  1ZYR D;  3LWE A;  3O13 A;  3PUY A;  4ZCK A;  1WD0 A;  3QOJ A;  4DR4 L;  1GKH A;  3KJO A;  3DUZ A;  5KYL A;  2M00 A;  3JC6 6;  5IWA Q;  1JT8 A;  2EJM A;  5FK9 C;  2G9H D;  4B3T L;  4JBK A;  3HOV B;  2D2C C;  1HZA A;  2MQH A;  1ESR A;  1LTA D;  4BWG B;  1VQD A;  2MNA A;  1IBK Q;  2EPB A;  3JAM L;  2KCN A;  3FRP B;  2N3S A;  3BDC A;  2K52 A;  1QVG A;  3Q8D A;  1EWC A;  2B39 A;  1JJ2 A;  1I4P A;  4LF4 Q;  1NNX A;  1CHQ D;  4UHV A;  1E0B A;  2LKV A;  2WKD A;  4A3K B;  4JK1 C;  2VZA A;  5ELN A;  4TQU S;  2IX3 A;  3S1Q H;  1FL0 A;  1Y14 B;  2ZTE A;  1YJN A;  3AFQ A;  3J81 c;  1JJC B;  1RTN A;  2YTX A;  1BF4 A;  2NVY B;  1G6P A;  1NE3 A;  4EQN A;  5CGK A;  1VMC A;  1EZ6 A;  3BZC A;  1ASZ A;  4HMI A;  1WCM H;  4IPH A;  3TZD A;  2ID0 A;  2B2T A;  3DMU A;  2AWN A;  1MJE A;  4X6A H;  4JV5 L;  1BXT A;  3CP0 A;  4K6D A;  3G6E A;  4IUN A;  3VDY A;  2WKC A;  3UDG A;  1STN A;  4JVZ A;  5ELB A;  3I4L A;  1SAP A;  2JYO A;  3OOC A;  4OX9 Q;  1ILQ A;  1N34 L;  1VQ9 A;  1Y1W G;  1SYE A;  5FLX E;  1PTO F;  5C3E G;  3KOJ A;  2L11 A;  1NJI C;  1G8Z D;  1AZP A;  4A3G H;  4E6I A;  3PO2 B;  3RZD H;  1CQF A;  3CAM A;  4LWC A;  3X3N A;  1MBY A;  3I4N B;  1DCZ A;  2F3I A;  1G51 A;  1EEF D;  4DK1 A;  4DR5 L;  4ABN A;  2KOL A;  1X54 A;  2UXD L;  1HXY D;  4YWK A;  1S5D D;  4PZ7 A;  4DF7 A;  3HOX G;  3TRE A;  3VYS A;  1SJE D;  1TWA B;  5A35 A;  5M3M B;  5ISR A;  5IP9 G;  2ICI A;  4JI0 L;  4LFB Q;  1SDF A;  4DR5 Q;  2UXD Q;  1UE6 A;  1RIP A;  4DV5 Q;  1XXG A;  3T1H Q;  1SMY D;  4QUC A;  1JC7 A;  1I4G A;  2VXW A;  4DXF A;  1LTR D;  4A76 A;  1XNR Q;  1WVL A;  4XIG S;  1PHJ A;  4DPG A;  5GAH C;  1KTK A;  1LV9 A;  3J7A F;  4H13 C;  1BQQ T;  2Q2H A;  3W3A A;  3S15 H;  3NWT A;  1LAC A;  3S16 H;  3RZO B;  5C4J B;  1R9T B;  2QF7 A;  4ILW A;  3VR5 A;  2DUD A;  2AKW B;  4K2L A;  3STB D;  2JA7 B;  3A0J A;  2B2W A;  1W6K A;  1F9Q A;  5E4X A;  1MHW C;  4K8J A;  1TWF B;  4JI2 L;  4IUU A;  1AH9 A;  1EYD A;  1CZG A;  2HCI A;  2M2L A;  3OYY A;  1EY9 A;  4QGU A;  1Y1W H;  4A3F G;  4ZRZ A;  4A3B G;  4FF4 A;  5IT9 L;  5E4W C;  5C3E H;  3FVQ A;  5DM6 3;  2PI2 E;  1JWU D;  1ONL A;  4ODG A;  1XPR A;  3W1G A;  3K58 A;  4HSP A;  4K0K Q;  4Y52 H;  4GS3 A;  4OWT B;  1HNZ L;  2WAQ B;  4A3M G;  5IE8 A;  5HGQ A;  4HID A;  1OTC A;  1KL9 A;  4R4T A;  4LW1 A;  2EY2 A;  2IPK D;  3GTL H;  3PQI A;  4DA2 A;  2ENB A;  1B7Y B;  1UNS A;  2MJ8 A;  4BA1 I;  3HOX H;  3S14 B;  1PLF A;  3A56 A;  1S3O A;  3L3O C;  1E24 A;  2F0U A;  3CRL C;  5CV9 A;  1FJG L;  1V1Q A;  1C48 A;  1XMO L;  4CDF C;  2R7F A;  3PUX A;  1A2U A;  4P73 A;  4WOR A;  2Z6K A;  2OT2 A;  2R7Z G;  2Q2T A;  3P1H A;  4DV2 Q;  2VB3 X;  3KF8 A;  2F52 A;  4JI7 Q;  1PH5 A;  2VW9 A;  5C4X B;  2PPB C;  4K6L A;  3A55 A;  2F4V L;  4Z9C B;  1LT5 D;  4KHV A;  4F88 A;  4K2K A;  4JOI C;  1MD2 D;  1WFQ A;  4A75 A;  1WTW A;  3TP6 A;  1L0Y B;  5CYU A;  1VQF A;  2F0T A;  3I90 A;  4YY3 L;  4A3E G;  1XNQ Q;  2UUC L;  3W2D A;  3M4Q A;  3BYT B;  3K5M A;  4RCN A;  4A3I H;  4ZKC B;  2AUK A;  3LWU A;  3V05 A;  4A3F H;  4A3B H;  2N78 A;  1H9R A;  1LT4 D;  2EYM A;  3HEJ A;  4K5X A;  2PNR C;  2OTJ A;  2X69 A;  3NXW A;  3HOW B;  3OW7 A;  1WOC A;  3AMU A;  1V8Q A;  2KHS A;  1YHB A;  5J1Z A;  4A3M H;  4MN3 A;  1X3P A;  1D2B A;  4DR2 Q;  3I55 A;  2HDM A;  2A19 A;  3SEB A;  1X65 A;  2DN8 A;  1D8L A;  1V1P B;  4DV4 L;  5EAY A;  1W2B A;  4MNO A;  2K1B A;  4DUZ L;  3STB C;  1ENC A;  1NR4 A;  2OXP A;  3GTK H;  2B2T C;  1E7Z A;  4J6H A;  3C46 A;  5IGE A;  3HOV G;  4RH6 A;  1E22 A;  1A3T A;  4PNY A;  4X66 Q;  4KHP Q;  2Z1C A;  3IKJ A;  2Q8T A;  3H15 A;  1SYF A;  3I7F A;  1HTL D;  2R7Z H;  1JOQ A;  1TWC H;  2QKI C;  1EUJ A;  1YVC A;  3EBE A;  4TSS A;  3SDZ A;  2Z4H A;  1A0I A;  4A3K G;  3S2H B;  2YTV A;  3J81 E;  1A8V A;  2PO4 A;  1LTG D;  2A8V A;  5IP7 G;  1Q82 C;  3UI2 A;  1C4Q A;  5EPK A;  4DV6 Q;  1A15 A;  4C3I B;  1T5E A;  1I6H H;  1PZJ D;  1VF7 A;  2XIW A;  3GDE A;  5J22 A;  3RLF A;  3S1R B;  2D5D A;  5DAU A;  3IAY A;  4ULL A;  2JP1 A;  4XYO A;  2Y0S B;  3NHH A;  1K83 B;  1I4R A;  4AIM A;  3CCQ A;  3TS2 A;  3L0O A;  3G7L A;  1PH8 A;  2CFM A;  4YWL A;  3HOY B;  3QB3 A;  4DR7 L;  5IGB A;  1Q8I A;  2LY7 A;  2ZM6 Q;  3GTJ H;  3MA2 B;  4HCE A;  1QB5 D;  3BZK A;  5I9P A;  4DR6 L;  1QUQ B;  4A3C G;  4IUQ A;  1TKW B;  5LHY 1;  4DR7 Q;  1JOR A;  1CKM A;  5ELC A;  5C5L A;  3T13 A;  1Q1E A;  4GN3 B;  1HNX L;  1KC8 C;  2I07 B;  1GHJ A;  4NMZ A;  3PO2 G;  1Y8N B;  3LX0 A;  4JI4 Q;  3FMC A;  1J9O A;  1SE2 A;  4APV A;  1OO9 B;  4PG3 A;  1NUC A;  3I4N G;  2F0M A;  1QCB D;  1VQG A;  2QEJ C;  1QWY A;  1NR2 A;  1C0A A;  2NN6 G;  3G48 A;  2B2W C;  3HOV H;  3SK8 A;  1SNC A;  5JOB A;  5M3M G;  3DEP A;  4A3D B;  1GVP A;  1SEB D;  5G3L F;  2LXK A;  2JJQ A;  3CW2 C;  3ULL A;  4KKU A;  3GO5 A;  2WIN B;  3M7N A;  5AJ3 L;  2O4X A;  1RHP A;  3PF4 A;  1EU4 A;  4A3K H;  1SE4 A;  2SDF A;  1XTD A;  2FJ2 A;  5IGC A;  1XYI A;  5IP7 H;  4KI0 A;  2NVY H;  4G7Z C;  2EY1 A;  4RMF A;  1E2V A;  5EPL A;  4OXP A;  4JI8 L;  3FPP A;  4P72 A;  4R8N A;  3NEM A;  1RL2 A;  1SBB B;  1S40 A;  2JA7 G;  4J1M A;  3HKZ G;  3A8K E;  3IFT A;  4DAP A;  4CKE A;  4HJ7 A;  3NQI A;  1EFW A;  4BBS B;  3D4W A;  3WWV A;  4DV0 L;  3J80 E;  4A3J B;  4XYQ A;  1O78 A;  1RDP D;  1VF5 C;  1JE5 A;  1CHP D;  3S24 A;  1CA5 A;  1IW7 D;  3OPO A;  2E2J B;  2OCE A;  2Z0S A;  4DR1 L;  5EBD A;  1PFN A;  2OF1 A;  4DR3 Q;  4A3C H;  2Z6K C;  2BDO A;  1SXT A;  4GNX A;  1JIC A;  2IJ0 A;  4N8F A;  1L2F A;  5IIF A;  1Q8K A;  2M9V A;  2Y0S E;  3RUZ A;  1U4L A;  2NYZ D;  4ZYS A;  2O5J C;  2UXC Q;  3PO2 H;  2WAQ G;  1OXX K;  1DOL A;  1EIY B;  4DK0 A;  1IL8 A;  2F0H A;  4LF9 Q;  1XPO A;  1EFI D;  3I4N H;  1VQM A;  2F0K A;  1TWG B;  2R3Z A;  1BR9 A;  2QDL A;  1UE5 A;  1SSO A;  1MIU A;  1TWA H;  3AYH B;  4FXK C;  4B9X A;  5M3M H;  1EOV A;  1BVS A;  4HIM A;  2JA5 G;  1HR0 Q;  1B1Z A;  4UDU C;  1EIF A;  3FEW X;  1TQO A;  3PIP 3;  1LAB A;  3K80 C;  3A5U A;  1DZ1 A;  5LMU L;  5IYB H;  4AQY L;  3A8I E;  3R2T A;  4KKS A;  3KUP A;  4PV1 C;  1I4Q A;  1Q1B A;  5CC4 A;  1WTV A;  4XQN A;  2EVB A;  4IJH A;  2F03 A;  2N88 A;  5E1F A;  5C4X G;  1KLU D;  4PMB A;  3QIA A;  1PVO A;  5ELD A;  4MZ9 A;  3CRK C;  3MEH A;  3RZO H;  5C4J H;  3M4P A;  1ESF A;  1R9T H;  4LK1 C;  3K0Y A;  1I94 L;  1ET9 A;  1PYS B;  1KRT A;  1U4R A;  3I3C A;  4K8I A;  4KY7 A;  2JA7 H;  1K8G A;  1IBL Q;  3R93 A;  5COY A;  2NB0 A;  5JJI A;  1BOS A;  3GTM B;  1L1O A;  1NY4 A;  1JOO A;  1SR3 A;  2R93 B;  1TWF H;  1TWH B;  3G6J B;  2E5L L;  3QJY A;  3VYT A;  4N9P A;  3F8T A;  4B3R Q;  2F0J A;  1D1K A;  1KAW A; 
#chains in the Genus database with same CATH homology
 1JJC B;  2YTX A;  4ME3 A;  4GKJ L;  4LF7 L;  3UDX A;  3CMA A;  1G6P A;  1GO3 E;  2VQE Q;  3I56 A;  1NE3 A;  1LUZ A;  2R6G A;  4DV2 L;  2E5L Q;  5C0X J;  1Z47 A;  4JI7 L;  4HJ9 A;  3BZC A;  1ASZ A;  3AQQ A;  4PMW A;  1SRO A;  2UUA Q;  1JMC A;  4B3M L;  2V1C C;  1IZ6 A;  1WCM H;  3HOW G;  4IPH A;  4DK6 C;  1SFO H;  4B3S Q;  2ID0 A;  4X6A H;  2AWN A;  1MJE A;  2YYZ A;  4JV5 L;  3CP0 A;  3G6E A;  4NB3 A;  4HJA A;  3VDY A;  3UDG A;  2BH2 A;  4OX9 Q;  3ULJ A;  1N34 L;  2EXD A;  2D0P A;  1XNQ L;  3S14 H;  1VQ9 A;  1V43 A;  1Y1W G;  3F2D A;  3S1M H;  1K3R A;  3UDI A;  3CCJ A;  1PH2 A;  3KFU A;  3CME A;  5C3E G;  3KOJ A;  4DKA C;  5AJ3 Q;  1P8L A;  1NJI C;  3RN5 A;  2R7D A;  2AWO A;  1ASY A;  1VQA A;  1Q7Y C;  3B6Y A;  1PH9 A;  1D7Q A;  3RNU A;  4DUY Q;  3G4S A;  3PCO B;  4A3G H;  4QY7 A;  2ES2 A;  3CC4 A;  1IBM L;  3RZD H;  5JJK A;  4LWC A;  3CAM A;  1PYB A;  2YV5 A;  4JBJ A;  1VQ7 A;  1N33 L;  1VQK A;  5C4X H;  4JI8 Q;  2F3I A;  5C0X I;  4GLX A;  1X56 A;  2NZH A;  1G51 A;  2WB1 E;  1Q86 C;  1M1K C;  4DR5 L;  2VUM G;  1X54 A;  2WB1 G;  2UXD L;  1T9H A;  4YWK A;  4R1J A;  3TS0 A;  4R4I A;  4PZ7 A;  4BY1 H;  3HOX G;  1MKH A;  3TRE A;  4DR2 L;  2VQF L;  3HFZ B;  2QA4 A;  4NXN L;  4LF8 L;  3KYH C;  1YHQ A;  2A1A A;  4JI1 Q;  1PH1 A;  1J6Q A;  1A63 A;  5IP9 G;  1N32 L;  4DV0 Q;  4LUV A;  4JYA Q;  4JI0 L;  4LFB Q;  4LFC L;  1JB7 A;  4DR5 Q;  2UXD Q;  1UE6 A;  4R4O A;  2JE6 I;  2PI2 A;  5IYC H;  1RIP A;  1A62 A;  2Y0S G;  4DV5 Q;  4DR1 Q;  3J81 j;  3T1H Q;  2KCM A;  3S17 H;  1GM5 A;  2K5H A;  4IFD I;  4X66 L;  4O0A A;  4KHP L;  1EWI A;  4BBR H;  2NZO A;  1E1T A;  1YEZ A;  2HIV A;  4DK3 C;  4A76 A;  1XNR Q;  3PV0 A;  2E2I H;  2Q2U A;  2PQA B;  3EIV A;  4XIG S;  1PHJ A;  3NEN A;  4DPG A;  4L5T A;  3H0G G;  5GAH C;  3ULP A;  1K8A C;  4GOP B;  1L0W A;  1NTG A;  2Q2H A;  4YHH L;  4DV1 L;  3S15 H;  1AE3 A;  2K5N A;  2ATW A;  4B3T Q;  1QVC A;  3S16 H;  4JI3 L;  1QZG A;  3HOW H;  3W5O A;  4OWX B;  3GD7 A;  2DUD A;  1OXS C;  2AKW B;  4IOA A;  4JI6 L;  3STB D;  2D62 A;  3A0J A;  3UDF A;  5FLM G;  2AMC B;  2WFW A;  4LF6 Q;  3KF8 B;  1XPU A;  3GTP H;  2NN6 I;  4DV6 L;  1O7I A;  4JOI A;  3M85 A;  4RG1 A;  4JI2 L;  1AH9 A;  4X62 L;  2E8G A;  2KBN A;  2UUB L;  4JI3 Q;  3T1Y L;  1WJJ A;  1C7Y A;  3OYY A;  2B29 A;  3ERS X;  4QGU A;  3CCL A;  3F2B A;  1YJ9 A;  3CCR A;  4A3F G;  1SRU A;  1Y1W H;  5C44 G;  2NVQ H;  3S2D H;  4A3B G;  1Q12 A;  5LMU Q;  4TVA B;  4AQY Q;  1IXR A;  1VQ4 A;  1HZC A;  5C3E H;  1K9M C;  2OTL A;  4HJ8 A;  4OO1 G;  2K14 A;  2PI2 E;  1QZH A;  5IYD G;  1FVI A;  1XPR A;  1X9N A;  3W1G A;  2ZM6 L;  1SN8 A;  1X3E A;  4DR4 Q;  3LGJ A;  4LUZ A;  2JA6 G;  3TEH B;  4A3D G;  4K0K Q;  4UY8 C;  4GS3 A;  4OWT B;  5J3B A;  1HNZ L;  4Y52 H;  2CWA A;  2RF4 A;  3BU2 A;  4A3M G;  1VQN A;  1CSP A;  2JEB I;  3FKI H;  4QJF A;  5GQO A;  5HGQ A;  5IE8 A;  4HID A;  3ZJY C;  1OTC A;  1KL9 A;  4R4T A;  4LW1 A;  1SMX A;  3GTL H;  4GNX C;  3S2H H;  1B7Y B;  1WYD A;  3U4Z A;  1I94 Q;  2PNH A;  1N8R C;  4J15 A;  4BA1 I;  1EQR A;  5H1S E;  3HOX H;  4X65 L;  2OQK A;  2HQL A;  4LFA L;  4IO9 A;  5GAG C;  1S3O A;  2PQA A;  2HT1 A;  2UXB L;  1E24 A;  2K50 A;  4C3I H;  3L2P A;  4JI5 Q;  4GOP A;  4JI4 L;  1P16 A;  4DV7 L;  5GRO A;  4NXM Q;  1K73 C;  2D0O A;  2Q2I A;  3S1R H;  1VQP A;  1FJG L;  1V1Q A;  4YCV A;  4Y7N H;  4LF5 L;  1JJG A;  1XMO L;  2R7F A;  3PUX A;  4H02 A;  1K83 H;  4P73 A;  4UP7 A;  2Z6K A;  4B3M Q;  4A93 G;  3J7A 5;  3U50 C;  1HNW L;  2DGY A;  4WJ3 M;  3UE0 A;  4GKJ Q;  4LF7 Q;  2R7Z G;  2MO0 A;  3U4V A;  2Q2T A;  3I4M G;  2N49 A;  3MXN B;  4DV2 Q;  2HHH L;  2F52 A;  2JA8 G;  4BBS G;  4KLK A;  4JI7 Q;  2EQS A;  3HOY H;  1PH5 A;  2VW9 A;  3PIO A;  4A3J G;  2OQ0 A;  5LMN W;  3H0G H;  1HZB A;  5M5X H;  2F4V L;  4DAY B;  3J80 i;  1HJP A;  3D31 A;  1SLJ A;  4JV5 Q;  4JOI C;  3RLN A;  4AH6 A;  4POG A;  1Q46 A;  1E1O A;  1UEB A;  1WFQ A;  4FDB A;  4A75 A;  2JA5 H;  4LUO A;  2CWP A;  2LXJ A;  2RHS B;  3GTG H;  1B70 B;  3EN2 A;  5FLM H;  1VQB A;  4L5S A;  1VQF A;  3I4O A;  2WP8 J;  1AE2 A;  4L5Q A;  1N34 Q;  5IYB G;  4YY3 L;  4A3E G;  1XNQ Q;  2UUC L;  4BY7 G;  5LMN L;  3M4Q A;  4A3I H;  1OXT A;  2IX1 A;  4DAM A;  1B8A A;  2JA9 A;  1LM0 A;  2NVX H;  1EYG A;  4A3F H;  2FXQ A;  3PUV A;  4A3B H;  3FHW A;  2N78 A;  3E0E A;  1IBM Q;  2OTJ A;  4GN5 A;  1L1O C;  2QGQ A;  3HKS A;  5BR8 L;  3AEV A;  1YJN A;  2ZTD A;  2KHJ A;  1N33 Q;  4A3D H;  1PFS A;  1WOC A;  1YIT A;  1YHB A;  2B3G A;  4A3M H;  4DNI A;  4DR3 L;  2XTI A;  1TXY A;  2ASB A;  4DR2 Q;  3I55 A;  1W3S A;  2VQF Q;  4GKK L;  2A19 A;  1X65 A;  4NXN Q;  1DGS A;  1D8L A;  1YI2 A;  4LF8 Q;  5BR8 Q;  4X64 L;  4DV4 L;  5EAY A;  1W2B A;  1N36 L;  1NMG A;  2ALY B;  1N32 Q;  4MNO A;  3IRB A;  4DUZ L;  2VY3 A;  1KQS A;  3RN2 A;  1YHA A;  2XGT A;  4KHZ A;  1PH6 A;  4JI0 Q;  4LFC Q;  5M3F G;  1VQH A;  3J7Z C;  1HR0 W;  3CC2 A;  3STB C;  5JEA G;  1KRS A;  1QVF A;  3JAM i;  2UXC L;  3AFP A;  2HIX A;  3GTK H;  1MJC A;  3K0X A;  4C3J H;  1E7Z A;  3M4O H;  1LTL A;  3KF6 B;  1V9P A;  3CF5 A;  4HIK A;  3HOV G;  4LF9 L;  2JQO A;  4IPG A;  4YCU A;  1E22 A;  4X66 Q;  1X55 A;  5FLX c;  3DLL A;  4KHP Q;  4HIO A;  4A3L G;  1WCM G;  1YNX A;  2YTY A;  4A93 H;  3PSI A;  2VNU D;  3H15 A;  3I7F A;  4P74 A;  3FP9 A;  1PV4 A;  1E3P A;  4MTN A;  2ZJP A;  4PZ8 A;  2R7Z H;  3ICE A;  4YHH Q;  4DV1 Q;  1TWC H;  3I4M H;  2R93 G;  1YZ6 A;  1EUJ A;  1YVC A;  2JA8 H;  3EBE A;  4BBS H;  1G29 1;  3CCS A;  4OWW B;  4A3J H;  1HR0 L;  2VS1 A;  4JCV E;  1A0I A;  4O2D A;  1UE1 A;  1FGU A;  2ZJR A;  4A3K G;  4GLV B;  2YTV A;  1VQL A;  1A8V A;  3J80 c;  2N8N A;  2A8V A;  2I5L X;  4UP9 A;  4JI6 Q;  5IP7 G;  1Q82 C;  1HZ9 A;  1VQ8 A;  3M9B A;  1CKO A;  4DV6 Q;  3KDF B;  1I6H H;  3A74 A;  2GN5 A;  2IHF A;  4JI2 Q;  1BBW A;  3GDE A;  1VQJ A;  4X62 Q;  2UUB Q;  4QQB X;  3RLF A;  3T1Y Q;  1VQC A;  5IWA L;  3NEL A;  4DV3 L;  1J5E L;  1I50 H;  1S72 A;  4BA2 I;  3CCQ A;  2IX0 A;  2MO1 A;  4AIM A;  3CCU A;  4BY7 H;  1XJV A;  3TS2 A;  3PO3 G;  3OTO L;  3L0O A;  1PH8 A;  2QEX A;  4BXX G;  1IBK L;  2CFM A;  4YWL A;  5JEA J;  4DR7 L;  2I5M X;  2VUM H;  1OXU A;  2ZM6 Q;  1IBL L;  3GTJ H;  1VQO A;  3KJP A;  2I5H A;  1J5E Q;  1TWG H;  2GVA A;  2CQO A;  1HNZ Q;  4LF4 L;  3M3Y H;  1YJW A;  3BZK A;  1I5F A;  1YBY A;  4DR6 L;  3HOZ G;  1QUQ B;  3U58 A;  4A3C G;  1YIJ A;  4IOC A;  2CKZ B;  4IFD G;  5IP9 H;  5JJL A;  1X3G A;  4L5R C;  4DR7 Q;  1CKM A;  4B3R L;  2UU9 L;  3K81 C;  3KF6 A;  1Q1E A;  4GN3 B;  4AYB E;  1HNX L;  4UP8 A;  1PH3 A;  4AYB G;  5IYC G;  4GLA C;  3F1Z A;  4X65 Q;  1KC8 C;  3HOU G;  3PGZ A;  2VQE L;  2ZJQ A;  4LFA Q;  4LNQ A;  3PO2 G;  2UXB Q;  1M90 C;  2L15 A;  1X6O A;  4P75 A;  3NBH B;  5DLQ E;  3RLO A;  4APV A;  3PUW A;  2UUA L;  4JI4 Q;  4DV7 Q;  4JG2 A;  1PH7 A;  4JC0 A;  4PG3 A;  1GD7 A;  5M3F H;  4B3S L;  3I4N G;  1FJG Q;  1VQG A;  5IY0 A;  3JAM c;  4GNX B;  4LF5 Q;  1XMO Q;  1VQ6 A;  3K7U C;  1C0A A;  2NN6 G;  3G48 A;  1C9O A;  3HOV H;  1HNW Q;  4GN4 B;  4C3H H;  3BJU A;  3CXC A;  1VQI A;  1N9W A;  2HHH Q;  4A3L H;  4QIW E;  1KHI A;  5M3M G;  3KDF A;  4OX9 L;  1GVP A;  2RHQ B;  4JBM A;  2LXK A;  2JJQ A;  4QL5 A;  2LSS A;  2KCT A;  3CW2 C;  2F4V Q;  3ULL A;  3GTM H;  4UPA A;  2R93 H;  1TWH H;  3GO5 A;  5HY6 A;  4NPS A;  1EQQ A;  3M7N A;  5AJ3 L;  2GVB A;  2K4K A;  2K75 A;  2C35 B;  3PF4 A;  4A3K H;  1XTD A;  3K8A A;  4P71 A;  5FJ8 G;  4A4I A;  1VQE A;  4DUY L;  3E9I A;  5IP7 H;  1U5K A;  4ALP A;  3GTQ H;  4IFD J;  5C44 H;  4WJ4 A;  4KI0 A;  2NVY H;  4EX5 A;  1UE7 A;  2R92 G;  3DM3 A;  3S1N H;  4YY3 Q;  4HJ5 A;  2B63 G;  2UUC Q;  5LMN Q;  3CPW A;  4RMF A;  4IPD A;  5IYD H;  1WI5 A;  4OXP A;  3L7Z C;  4JI8 L;  1Y1V G;  1SE8 A;  2E2H H;  1BBU A;  2K5V A;  4P72 A;  1QUQ A;  2JA6 H;  2IHE A;  1KXL A;  4C2M H;  3NEM A;  3HKZ E;  3CCE A;  1CKN B;  1RL2 A;  1X3F A;  3TQY A;  1S40 A;  2JA7 G;  3HKZ G;  3PO3 H;  3D0F A;  4BXX H;  3FKI G;  4XTC S;  1VCI A;  4OO1 I;  4HJ7 A;  4JI1 L;  1EFW A;  4R4C A;  4IPC A;  1LYL A;  3WWV A;  1U0L A;  4YCW A;  4DV0 L;  3I2Z A;  4JYA L;  4JBW A;  1IL2 A;  1BKB A;  3ER0 A;  4GOP C;  2YU9 H;  2MFI A;  4LFB L;  2BA0 A;  2I0Q A;  3PF5 A;  3S24 A;  1JE5 A;  5M5W H;  5GAE C;  2OCE A;  2Z0S A;  4DV5 L;  4POF A;  4DR1 L;  3J81 i;  3T1H L;  3HOZ H;  1IYJ B;  4DR3 Q;  4A3C H;  2PMZ E;  2Z6K C;  4GNX A;  4GKK Q;  1UWV A;  1NBW A;  3TRZ A;  1XNR L;  1HH2 P;  4X64 Q;  4DV4 Q;  1K0R A;  1L2F A;  1L1O B;  1NMF A;  1N36 Q;  4DUZ Q;  1Q8K A;  2Y0S E;  1I3Q H;  1KIX A;  4PZ6 A;  3HOU H;  3F2C A;  2ZTC A;  2WAQ E;  2RCN A;  3PO2 H;  2UXC Q;  2WAQ G;  1CSQ A;  1OXX K;  3K7A H;  1EIY B;  4EQ5 A;  3OW2 A;  3KLW A;  4LF9 Q;  3RR5 A;  1XPO A;  3HOY G;  5K36 G;  3I4N H;  1CUK A;  1VQM A;  2E2J H;  1PA6 A;  3CPF A;  2NVT H;  1UE5 A;  1XMQ L;  1PH4 A;  3G71 A;  2CCZ A;  1MIU A;  1TWA H;  3AYH B;  3CQZ H;  2KEN A;  2BH8 A;  4OON A;  5M3M H;  1EOV A;  3SGI A;  1BVS A;  4HIM A;  2JA5 G;  1HR0 Q;  5GAD C;  1EIF A;  3E9H A;  2JK8 A;  5C0X G;  2AHO B;  2EIF A;  3K80 C;  3A5U A;  5LMU L;  5IYB H;  4LF6 L;  4AQY L;  3H3V H;  4A3E H;  3A5Z B;  3CCM A;  1XMQ Q;  1VQ5 A;  4R4Q A;  5ELO A;  4A3G G;  2BA1 A;  1Q1B A;  3MEF A;  4A3I G;  2H5X A;  1CKN A;  3PUY A;  5FJ8 H;  4DR4 L;  1GKH A;  3KJO A;  2IT1 A;  4IJH A;  3UE1 A;  4K0K L;  5C4X G;  3JC6 6;  5IWA Q;  1JT8 A;  4DV3 Q;  4IJL A;  2R92 H;  3H3V I;  1PVO A;  3PIP A;  4B3T L;  4JBK A;  4BY1 G;  2B63 H;  4MZ9 A;  2MQH A;  1HZA A;  3CD6 A;  4YWM A;  3RZO H;  5C4J H;  3M4P A;  3OTO Q;  1OXV A;  1Y1V H;  2OWO A;  1VQD A;  2MNA A;  1R9T H;  1IBK Q;  3GTO H;  1I94 L;  1PYS B;  1KRT A;  3CCV A;  2VL6 A;  2N3S A;  5E7N A;  1K8G A;  3CC7 A;  1IBL Q;  2JA7 H;  2K52 A;  1VS0 A;  1Z9F A;  2JEA I;  5JJI A;  1QVG A;  1L1O A;  1NY4 A;  1SR3 A;  3Q8D A;  5M5Y H;  1TWF H;  4JI5 L;  1JJ2 A;  4LF4 Q;  2E5L L;  4DR6 Q;  2IY5 B;  1Q81 C;  5IT9 c;  1H95 A;  4NXM L;  2KHI A;  1KD1 C;  3F8T A;  2VZA A;  5ELN A;  4TQU S;  4BBR G;  3PUZ A;  3S1Q H;  1FL0 A;  2UU9 Q;  1Y14 B;  4B3R Q;  1KAW A;  2ZTE A;  1HNX Q;  3W1B A;  3AFQ A;  3J81 c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...