4LNQA

Crystal structure of ifi202 hina domain in complex with 20bp dsdna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
195
structure length
195
Chain Sequence
b'GPHMKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYYRVKVFNMDLKEKFTENKFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-activable protein 202
publication title Structural mechanism of DNA recognition by the p202 HINa domain: insights into the inhibition of Aim2-mediated inflammatory signalling.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein/dna
total genus 40
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lnqA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lnqA01
1SE8A 3CD6A 4NXNL 1X65A 1VQDA 2ZM6Q 2PMZE 2OWOA 2YYZA 3E9HA 3J80c 2F4VQ 4JI2L 2KCMA 1KC8C 4HJAA 4JBMA 4DV0Q 3TRZA 5C44H 2Q2TA 4BBSH 1XMOL 5C0XJ 2F52A 2B29A 4P73A 4DV4L 1SMXA 1QZGA 1Q81C 2WFWA 3M4OH 5EAYA 1L1OA 1VQBA 4JV5L 3MEFA 4GNXC 2I5MX 1WOCA 4BY1G 2MO1A 4Y7NH 4A3IG 4R4OA 4BBRG 1B70B 4YHHL 3CQZH 3CAMA 4JOIA 1FL0A 4IJHA 4YCVA 1OTCA 2BH2A 5K36G 1UE7A 1X56A 1YHAA 4C3IH 5C4XG 2B3GA 2YTYA 3TREA 1KHIA 5IP7H 4GKKQ 3G71A 4DPGA 3CPFA 2GN5A 2I5HA 4TQUS 4DKAC 2CWAA 1PH3A 4A3LG 3G4SA 5IE8A 4QL5A 3BJUA 1Q82C 1VCIA 4LFCQ 1Q46A 3HOWG 3AYHB 4X65L 5M3FG 2AWNA 4JYAQ 1SFOH 5IYDH 4DR4Q 2JA9A 3L0OA 2KHIA 3AFPA 4QGUA 1IBMQ 3D31A 1AH9A 5FLMG 1I5FA 1YHBA 2I5LX 4LFAL 4JI5Q 4BY1H 4GOPB 1VQNA 3GTJH 3F2DA 5LMUQ 2UU9Q 4NPSA 3SGIA 3CCVA 3KYHC 4A4IA 2VQEL 2A1AA 2E8GA 2RF4A 1TWGH 3CC4A 4BXXH 4RMFA 3T1YL 5ELNA 2R92G 1C0AA 3UDIA 1BBWA 2YV5A 2EXDA 3MXNB 4A3LH 1LUZA 1HH2P 4LF9Q 4A76A 3ICEA 2HHHQ 3HOWH 4PZ6A 5IWAQ 3I4NH 1CSPA 1VQFA 3ERSX 3PUYA 4A93H 3S1MH 1D7QA 1N36L 1U5KA 2BH8A 4DR1L 3GTLH 3ULPA 5IYBG 4A3FG 1EIFA 4NXMQ 2NVXH 4DAYB 2HT1A 1UEBA 1IBLQ 2JA6G 1VQ5A 1XJVA 4OWWB 1K9MC 1KAWA 4JI1L 4YCUA 3RLFA 3TQYA 2XGTA 4C3HH 1NJIC 2R7DA 1XNRQ 3GTPH 2R92H 2ZTCA 3M85A 4QJFA 3H15A 1NBWA 3CCMA 3CCSA 5DLQE 3PO2H 4WJ4A 4P72A 4UP9A 4DK6C 5LMNQ 2IT1A 3NENA 1C9OA 1OXVA 3K8AA 3RN2A 4B3SL 1AE2A 4OXPA 1MKHA 1KRSA 1VQGA 1X3GA 3HOXH 2DUDA 1HR0L 2CKZB 5M5XH 3AQQA 4XIGS 2GVBA 4JI6L 2AKWB 4GKJL 2E2IH 1VQHA 5AJ3L 3F2BA 1R9TH 1NMFA 1VQPA 4LF7Q 2UXDL 3ULLA 1M90C 3KF8B 3A5UA 3M3YH 1VQIA 2K5HA 1V43A 4P75A 3CW2C 4JI3Q 1HNZL 5C3EH 3D0FA 5GADC 4DUYL 4HIDA 5M5YH 1XNQL 4DR7Q 1YJWA 1K3RA 1A8VA 4FDBA 4AQYL 4IJLA 1ASZA 3STBD 1PH5A 1A62A 4PZ7A 1SRUA 5JEAJ 4YY3Q 4A3KG 2E2JH 2UUAQ 4K0KQ 1WCMH 1Y1VG 4OWXB 1UE1A 1I50H 1GM5A 4Y52H 4B3TQ 3CXCA 4PMWA 4A3DH 1I94L 1JJGA 4L5QA 1KRTA 4JC0A 2QEXA 2UUCQ 2Y0SG 3KLWA 4ME3A 1X6OA 4JI4Q 1N9WA 2NN6G 3K7UC 4GLAC 5M3MH 2CFMA 1XPUA 1U0LA 4UP7A 2YU9H 4DV2Q 4JI7L 1OXUA 1XPOA 4EX5A 3EBEA 1HJPA 4J15A 4DR3L 1HNXQ 2JA5H 2QGQA 1G6PA 4X62Q 4X64Q 1IBKL 2JEBI 3L7ZC 4IFDG 2OQKA 1PA6A 2WAQE 4P74A 1LTLA 2R93H 2E5LQ 1EQRA 4JI8Q 3I4OA 1SR3A 2EQSA 1VS0A 4X66L 3RLNA 3S24A 3BU2A 1N34L 1IL2A 1J5EL 4OO1G 2V1CC 1HNWQ 3PUZA 5IP7G 2UUBL 2JE6I 2ZJPA 1D8LA 1NMGA 1I6HH 4DV1Q 5IP9H 1X55A 3KFUA 3U4VA 5BR8Q 1Q1BA 3T1HQ 4LFBL 1KXLA 4DV5L 1K0RA 1TWHH 4GN3B 3GTQH 1Y14B 2BA0A 2MO0A 3OTOL 4QY7A 2HIVA 5IY0A 5E7NA 1XMQQ 3CPWA 3GTOH 5IYDG 1PH6A 2PI2E 1BBUA 3A0JA 3CF5A 3M7NA 1SROA 4DV0L 3KJOA 2JJQA 2Q2IA 3NEMA 4BA2I 3CCUA 1M1KC 3M4PA 1XMOQ 1VQLA 3PF5A 4BXXG 4DV4Q 4JBWA 2K50A 1E3PA 3B6YA 3GTGH 5IYCG 2VQFL 1IZ6A 1VQMA 3H0GG 1PH2A 4JV5Q 3VDYA 1K8GA 5GQOA 2ATWA 1V1QA 2ZJQA 1P8LA 1K83H 3Q8DA 1XNQQ 1KL9A 4YHHQ 3PCOB 3AEVA 3I4NG 4A93G 1S40A 2LXKA 1Q1EA 3EN2A 4IPCA 2UXBL 1C7YA 3L2PA 3PV0A 3W1BA 4A3JG 2Q2UA 1FJGQ 2WB1G 4PZ8A 4IO9A 3KJPA 1B7YB 2EIFA 4GOPC 4DR4L 1P16A 3GTMH 4A75A 3RZDH 4KHPL 4OWTB 4RG1A 1O7IA 3H3VH 4QQBX 4JI5L 1EIYB 4X65Q 5IYCH 1HZBA 2K5NA 5J3BA 3H0GH 3K0XA 3ZJYC 4L5RC 1GO3E 4LFAQ 2H5XA 2PQAA 2RHQB 4R4TA 1QVGA 3PO2G 3A74A 5GAEC 4LF5L 2VQEQ 4H02A 2ES2A 1FVIA 1DGSA 2R7FA 4DV6L 3DLLA 5JJKA 1S3OA 3HOXG 4AYBE 3KDFB 4A3JH 2JA7H 3T1YQ 1PH1A 2HHHL 5IWAL 5LMNW 1OXTA 3AFQA 3CCJA 2E2HH 2HQLA 2B63H 3E9IA 1YJNA 1KD1C 3PF4A 4DV3Q 3S2DH 1CUKA 1S72A 1YIJA 2FXQA 1JJ2A 3KF6B 4LUZA 4LF6Q 5C3EG 2K52A 4A3EH 3CC7A 3GDEA 4UP8A 2NN6I 4DR1Q 1HZAA 1IYJB 1N8RC 4LWCA 3STBC 3TS0A 4A3GH 1MJCA 1PYSB 2D0PA 5GAGC 3I56A 1GVPA 4DV7L 4B3MQ 3J81i 2N3SA 2VZAA 1L1OB 2CQOA 3UDGA 4KI0A 2OCEA 1B8AA 1WCMG 1EQQA 1SLJA 5JJLA 1RL2A 2YTVA 4DUZL 1UWVA 3GD7A 1Z47A 2K4KA 4JBJA 4A3MG 1PV4A 4JI1Q 1PHJA 2ZTEA 3HOUH 2IX1A 1VQAA 4A3DG 4L5SA 4IOAA 3I4MH 3F8TA 1QVCA 4OO1I 1JJCB 2JEAI 2Z6KA 1EWIA 1NTGA 1RIPA 1V9PA 5M3MG 4A3BH 4DAMA 1TXYA 3CMEA 3S2HH 1VQ4A 3FKIH 4B3SQ 2VNUD 2JA5G 4GLVB 4YCWA 1HR0Q 1A63A 2PI2A 4APVA 3JC66 1CKMA 3HOYG 2CWPA 4JI6Q 4GKJQ 2R93G 1J6QA 1LYLA 5AJ3Q 3I55A 2UXDQ 3RN5A 4DR5L 5JJIA 2ZTDA 4B3RL 3UDXA 1N32L 3J81j 3E0EA 4A3MH 3HKZE 1PH4A 2R6GA 1HNZQ 2VW9A 5C4JH 4K0KL 4DUYQ 3HOZG 3UE0A 3F1ZA 5IP9G 1YJ9A 4LF4Q 4IPHA 1SN8A 1Q7YC 1X54A 4AQYQ 4POGA 1E1TA 2VY3A 4DR2Q 3WWVA 2I0QA 3NBHB 4UY8C 4OX9L 1I3QH 1WI5A 3PIOA 1JMCA 4XTCS 2VUMG 2AMCB 4KLKA 3OW2A 1K73C 1JB7A 1EYGA 3HOYH 1N33Q 1EOVA 1I94Q 2L15A 5FJ8H 1K8AC 2Z0SA 4HIMA 1HNXL 4LF8Q 1T9HA 3RLOA 4GOPA 2DGYA 4BY7H 1X3FA 2IHFA 4X64L 4JI0L 4JI7Q 2UXCL 3LGJA 4GN4B 1HZCA 1YZ6A 2JK8A 4DR3Q 4DR6L 1UE6A 2N49A 3HOZH 4JI8L 1IBKQ 2Z6KC 1PFSA 4QIWE 3CCQA 3I7FA 4P71A 1IXRA 2KBNA 1NY4A 1Q8KA 1WJJA 2ZM6L 2ID0A 2VUMH 3JAMc 4X66Q 1N34Q 2Q2HA 2F4VL 1J5EQ 3PO3H 1YBYA 3UDFA 5JEAG 1W3SA 4NXNQ 1Y1WH 4DNIA 2IY5B 3TEHB 1VQOA 3KDFA 4DV5Q 4JI2Q 4AH6A 1YHQA 3IRBA 3OTOQ 4OONA 2WB1E 3RNUA 3J7ZC 3KF6A 1A0IA 4UPAA 5M5WH 1CKNB 3OYYA 3GO5A 3K80C 5HY6A 3JAMi 2A8VA 4A3CH 2WAQG 1X3EA 4GKKL 1ASYA 2OTLA 2IHEA 2YTXA 3ULJA 1PVOA 4R1JA 4GNXB 1JE5A 4JCVE 4YWKA 3FP9A 2JA7G 3S16H 1H95A 4LFCL 3S1RH 3HFZB 1LM0A 3HOVH 3BZKA 2VQFQ 3DM3A 4YWMA 4JYAL 3EIVA 2CCZA 2B63G 1XPRA 1BKBA 4IPGA 3J80i 4HJ8A 1IBML 2OTJA 1FJGL 1JT8A 5GAHC 2VS1A 2MFIA 3UE1A 2QA4A 2KHJA 5LMUL 3CMAA 2UU9L 4A3EG 1QUQB 1TWAH 4BA1I 2ALYB 2UXBQ 4A3GG 4MNOA 5C0XG 1VQ9A 1W2BA 2F3IA 1YITA 3S15H 4DK3C 1VQ7A 5FLXc 2IX0A 3U50C 1VQEA 4KHPQ 2NZOA 2NVQH 5ELOA 3J81c 3S17H 2PNHA 1VQJA 1Z9FA 3W5OA 4A3IH 3GTKH 4BBRH 4LF9L 3PUVA 4MZ9A 3HOUG 2AHOB 3PUXA 3K81C 3PSIA 3I4MG 2RCNA 3CP0A 1QZHA 3G48A 4A3BG 5C4XH 4LF5Q 4NXML 3J7A5 3HKSA 1TWCH 2N78A 4HJ7A 1BVSA 1WYDA 3FKIG 4DV6Q 1N36Q 3U4ZA 1VQ8A 1OXSC 2NVYH 4LUVA 4R4IA 4AIMA 4HJ9A 3S1NH 3S1QH 4DV3L 1IBLL 3F2CA 3KOJA 3RR5A 4LF6L 5M3FH 4POFA 1XNRL 2A19A 5H1SE 3CCEA 1L1OC 1GKHA 1L2FA 1YEZA 2D0OA 2MQHA 2N8NA 5FLMH 1X9NA 1E7ZA 1PH9A 1Q12A 1UE5A 4B3ML 4LFBQ 4IFDI 1Q86C 5LMNL 1GD7A 4JOIC 1HR0W 3A5ZB 2MNAA 3M4QA 4IOCA 2C35B 2VL6A 3G6EA 4TVAB 1EFWA 4WJ3M 1OXXK 1NE3A 2BA1A 4DV7Q 3PGZA 4LUOA 4YWLA 1AE3A 4R4QA 4DUZQ 1E22A 2Y0SE 4JG2A 4LF7L 5HGQA 1PH8A 4AYBG 1MIUA 4EQ5A 2R7ZG 4JBKA 2K5VA 2GVAA 2K75A 4MTNA 5GROA 4C3JH 2AWOA 4JI3L 5FJ8G 3U58A 4IFDJ 4DR7L 4BY7G 3I2ZA 1YNXA 2ASBA 4KHZA 5IYBH 4A3FH 4IPDA 1E1OA 2JA8G 1VQCA 1HZ9A 2LSSA 3NELA 3W1GA 1YI2A 2NVTH 2UUAL 4YY3L 5IT9c 4X6AH 3FHWA 3CCRA 4LW1A 1L0WA 4GN5A 3M9BA 2JA6H 3H3VI 1CKOA 1EUJA 2HIXA 4C2MH 1CSQA 1MJEA 1CKNA 2KCTA 2WP8J 3ER0A 4B3TL 4DR5Q 2PQAB 4B3RQ 4LF4L 4HIOA 1VQ6A 4ALPA 1N32Q 2UUCL 2OQ0A 4JI4L 3PO3G 2R7ZH 4HJ5A 4DR2L 4GNXA 1Y1WG 4DV2L 3BZCA 1WFQA 1TWFH 1G291 1KIXA 2KENA 4NB3A 4X62L 2D62A 1QVFA 2JA8H 3PIPA 1N33L 4OX9Q 2XTIA 4O2DA 3PUWA 4R4CA 3TS2A 2E5LL 4L5TA 1PH7A 4LF8L 1E24A 1VQKA 2NZHA 4GS3A 4BBSG 4A3CG 5C44G 1HNWL 4HIKA 1QUQA 2K14A 2RHSB 4PG3A 3S14H 4DV1L 4LNQA 3K7AH 3CC2A 5BR8L 3T1HL 1G51A 5C0XI 4GLXA 3HKZG 4JI0Q 2ZJRA 2UXCQ 2JQOA 1YVCA 1KQSA 2UUBQ 4A3KH 4DR6Q 1XMQL 1FGUA 1PYBA 2LXJA 3HOVG 3RZOH 1Y1VH 4O0AA 1XTDA 3CCLA
chains in the Genus database with same CATH superfamily
1BCPC 3L9AX 1F9RA 1SYFA 1X32A 2OWOA 3URYA 3E9HA 2B63B 2F4VQ 2NN6H 1XMOL 1L0XB 2F52A 1PFNA 1SMXA 2F0TA 2DNEA 2CW0C 5EAYA 3M4OH 4JV5L 3MEFA 2I5MX 1BOSA 1EWCA 1LTAD 2MO1A 4A3IG 2CQAA 2OXPA 4R4OA 4BBRG 1XNQL 4YCVA 1HQMC 1X56A 1HTPA 2YTYA 1K0SA 5IP7H 3HOUB 4DPGA 3OHXC 1I6VC 4DAPA 4TQUS 3EQLC 3ITPA 4I7AA 4WRDA 3G4SA 1H9MA 4QL5A 1Q82C 1SJED 3AYHB 4X65L 5M3FG 2AWNA 4JYAQ 5IYDH 2JA9A 3L0OA 2L12A 3D31A 1CFMA 1YHBA 1BUVT 4KKUA 2NYZD 3GTJH 2UU9Q 4NPSA 3CCVA 2VQEL 1TWGH 2SNMA 1A6XA 4RMFA 3T1YL 5ELNA 2EXDA 3MXNB 1IL8A 3I72A 4A76A 3L3OC 2QILA 3JAML 1IW7C 1VQFA 3PUYA 3CU7A 3I4NH 1D7QA 3TP8A 1S5BD 1U5KA 4AYBB 3GTLH 2R7ZB 5IYBG 4A3FG 1EIFA 4NXMQ 1SNCA 1FYCA 2NVXH 2D9UA 2B2WC 5K5PA 2F0SA 2JA6G 1VQ5A 4OWWB 5J1ZA 4C3HH 1NJIC 5IGBA 4OGQC 3ERQA 3T13A 5ELBA 1KTKA 3CCMA 5L37A 2AQ3B 2EY2A 3PO2H 4WJ4A 4P72A 4UP9A 2NZ1D 1MI2A 3NENA 1C9OA 1OXVA 3K8AA 4B3SL 2L5TA 4QMGA 4JVZA 2CKZB 4G7HC 4XIGS 1Y8NB 1EYDA 2AKWB 3EVQA 5DM73 1IYUA 1VQIA 2RCFA 1V43A 1G91A 4JI3Q 1HNZL 3MTSA 2I07B 4DR7Q 1RTNA 1A8VA 4TSSA 2XSCA 3MFGA 4HMJA 2WINB 1DD2A 1SE3A 4YY3Q 1LT3D 1H9JA 1Y1VG 1UE1A 3LWUA 1HFGA 4Y52H 3VYSA 3S16B 1LABA 1I94L 4L5QA 4JC0A 3TBIB 1ILPA 4JI4Q 1X6OA 1N9WA 1PRTB 1XPUA 4K8JA 1CHPD 1U0LA 4TKOB 4JI7L 4J15A 1BCPF 1I4RA 2HQEA 1G6PA 1GUSA 1IBKL 4X64Q 1WTWA 3NWSA 2K7VA 4P74A 4HTHA 2E5LQ 1ZYRC 3I4OA 3RLNA 4XQJA 3C3LA 3BVZA 4C3IG 4MHEA 2ZJPA 1NMGA 1I6HH 3E0JA 1NR4A 3OIQA 3T1HQ 1KXLA 4DV5L 1BQQT 1K0RA 1C4QA 4QY7A 4ABNA 3CPWA 1UUPA 3CF5A 2KEEA 4DV0L 2JJQA 1PZID 2L1BA 3NEMA 3WDNA 3CCUA 2SEBD 4L6TB 1F77A 1DCZA 1PTOH 4Q5VA 1AFPA 1VQMA 2EDGA 2F0HA 3GTPB 2R92B 1KL9A 3F2UA 1S40A 2LXKA 1B3AA 3L2PA 1C7YA 1I4PA 2Q2UA 1J8IA 2WB1G 4N8FA 2KEDA 4PZ8A 1ENCA 1B7YB 2EIFA 3Q0AA 5EBCA 3GTMH 2K5DA 3MHBA 4RG1A 3C1FA 4KKSA 1II3A 1EIYB 2K5NA 3ZJYC 4LAAA 1QVGA 2H5XA 2RHQB 3A74A 5M9OA 5C3EB 1T5EA 1TIID 2ES2A 3S9WA 2XNAC 4DV6L 5JJKA 1Y69U 2M2LA 2HHHL 1OXTA 3AFQA 2B63H 2HCIA 1KD1C 3PF4A 1CUKA 1S72A 3KF6B 2NB0A 2PW5A 1DOKA 1GXDC 3HG9A 3SE0A 3T56B 5C3XA 4DR1Q 1O78A 3TS0A 1PYSB 4B3MQ 1GVPA 3VR4A 2N3SA 1Q3LA 1L1OB 2VZAA 2CQOA 5JJLA 4HEDA 1WCMG 1EQQA 1SLJA 5KNBA 3GD7A 2K4KA 1PV4A 3AU7A 2CHBD 4RWSC 1WTVA 1PHJA 5JAVA 1QILA 3HOUH 1STHA 5M3MG 3C46A 2A73B 1JWUD 4G57A 4K14A 1R4QB 2JA5G 4FXKC 1TWHB 1YNJC 3EROA 2EYFA 2PI2A 4APVA 5IGEA 1CKMA 1BBXC 3HOYG 4GKJQ 3I55A 4IUVA 3KK7A 3RN5A 1I4XA 1ZEQX 1EL0A 1N32L 3J81j 3HKZE 3K0YA 2K05A 3NTHA 2MJ8A 2R6GA 4H44C 4QCLA 5C4JH 2X69A 4LF4Q 2A6EC 4DU9A 4POGA 2F0OA 1Q90A 5T1IA 4N9TA 4DF7A 3NBHB 4OX9L 1EY5A 1WI5A 3PIOA 4R8NA 2BDNA 1JMCA 5COYA 2AMCB 4KLKA 1JB7A 3HOYH 3A55A 2L15A 2R61A 3H09A 4HIMA 1SFOB 4DK0A 2PPBC 4ZQ3A 4FF1A 3LGJA 4GN4B 4DR3Q 1S5DD 2N49A 5HURA 2B2VA 3NP8A 2Z6KC 5I9OA 1DJRD 4C1NI 4X66Q 1N34Q 1PFBA 2F4VL 1PTOD 3NXWA 2PZTA 1W3SA 3QG1A 2EPBA 4CJ0B 3KBXA 2KOLA 4DNIA 4PMBA 1HTLD 1BCPB 2QF7A 4I7ZC 5KNDA 1RTOA 5M5WH 4A3CH 3JAMi 1S4ZA 1FGBD 2Z1CA 5DM63 4UHVA 3FP9A 2JA7G 3S16H 3S1RH 1HRJA 3HFZB 1LM0A 1IYVA 1STNA 4JYAL 1L0YB 2R3ZA 3EIVA 4F7XA 1XPRA 3HOXB 2MFIA 3UE1A 2UU9L 3CMAA 1B50A 4A3EG 4XQQA 1QUQB 2BE5D 3Q22A 1VQ9A 1F2YA 2F3IA 4J6HA 1PLFA 1VQ7A 5FLXc 3QO2A 4O1NA 5C4ZA 2PNRC 5D65A 3U50C 1VQEA 4KHPQ 2NVQH 2B8FA 1CT1D 1X3QA 2QKIC 3PUVA 5K36H 3P75A 2RCNA 4FNFA 3IKJA 4X3KA 1EQTA 4NXML 4KV6A 3HKSA 5D3DA 1IKLA 2XVSA 1EY9A 3SHLA 4KD4A 4LUVA 4R4IA 3S1NH 4KY6A 4DV3L 3RR5A 1SDFA 5DAUA 4LF6L 2SDFA 3Q24A 1X9NA 2F0UA 1Q12A 5JVH3 1EOTA 2F3WA 1GD7A 2R93B 3K5OA 1HR0W 2MNAA 1WTXA 1JC7A 2VL6A 3G6EA 1EFWA 1A3UA 1NE3A 4M8AA 3PGZA 2AQ2B 3BYYB 4J8QA 2FMCA 5EBDA 1TS3A 5BN3A 3HZXA 5KYLA 1MIUA 2K5VA 4MTNA 5GROA 4KN7C 2B2TC 5C5LA 4JI3L 5FJ8G 4DR7L 1HQRD 3I2ZA 4H0LC 2JA8G 4IPDA 1Y1WB 1HZ9A 3W1GA 3CHBD 3D4DA 4YY3L 5IT9c 1WTHA 1UAPA 2KVMA 4CDDC 1RCVD 1D5MC 2KHSA 4GN5A 3M9BA 4CBVA 5KIXA 2K6AA 1EUJA 2HIXA 5BN5A 1HXYD 3GTGB 2OQ0A 4JI4L 3PO3G 4DR2L 3BZCA 1WFQA 1G291 1OO9B 2KENA 1KIXA 2Q8TA 2JA8H 3MC0B 1PZKD 3PUWA 2E5LL 1PH7A 2EY1A 1EEFD 5ELDA 3K5LA 5C44G 2PO4A 4PG3A 2EZVA 3T1HL 3HKZG 2JQOA 4ZKBB 1YVCA 4F8MA 5CGKA 3RZOH 1SNPA 5KNCA 3NQTA 1G2TA 4A3IB 4N8X1 1QB5D 3GTKB 4BBRB 1VQDA 3NE5B 3R3OA 2ZM6Q 5EPLA 5HGTA 4H7BA 2F3VA 2O2LD 1MHWC 4DV0Q 5C44H 1S5FD 1TS5A 1PRTD 1Q81C 1YNND 4A3GB 4GNXC 4KJOA 4JK1C 1STYA 1FL0A 2E75C 5J22A 4OO1H 1UE7A 2ZXOA 1YHAA 3I91A 3MXUA 2MHVA 2I5HA 1ENAA 3NUCA 3I4MB 4DKAC 1MGSA 4A3BB 1A15A 5IE8A 5CV6A 3FKIB 4B9XA 4IQZA 1SFOH 2KHIA 1SNDA 5FLMG 4RGTA 3DXJC 4C3JB 3F2DA 5LL6S 4GZYC 2NVTB 4RFBA 3D3RA 3MEHA 3UDIA 1BBWA 1MSGA 2F0LA 5FO7B 2EYLA 3A7AB 1HH2P 4LF9Q 3M7GA 3ICEA 3P20A 2HHHQ 5EKIA 1O7ZA 1A3VA 3OMCA 4DR1L 2CH4W 3W3AA 3VYRA 1HPCA 2X6GA 1JOKA 2VXWA 4DAYB 2HT1A 1Q8IA 1PDQA 5EJWA 2ZTCA 3M85A 3H15A 2F0VA 2TSSA 2EVBA 3PIO3 5LMNQ 2QDBA 2PQEA 1AE2A 1MKHA 1KRSA 2D5DA 2J7ZA 3HOXH 2DUDA 2N55A 4YIJA 3FPPA 4RHSA 2GVBA 4GKJL 2E2IH 1VQHA 2G5DA 3WOEA 4DGZA 3ULLA 3KF8B 3A5UA 1BF4A 4IZ8A 3BVGA 5GADC 3TP5A 1K3RA 4BBSB 3I70A 2FFKB 5FLXL 4XT3B 4PZ7A 2UUAQ 1SNQA 2IWHA 3SR1A 5E3FA 3R8BA 4A3KG 1AW7A 5EKKA 4OWXB 2FMMA 1GM5A 3CXCA 4PMWA 1KRTA 2UUCQ 4CKCA 2NN6G 3K7UC 1LTGD 2CFMA 2F0QA 1ZXTA 3KLSA 3BDLA 3MA2B 3DHQA 4DV2Q 4EX5A 3EBEA 1HJPA 4DR3L 3SEBA 2KCNA 4ME5A 4X62Q 1SAPA 1EQVA 2RDFA 3S15B 4IFDG 1LTLA 2R93H 2QEJC 1TU2B 4X66L 3S24A 1N34L 3BU2A 3S17B 3PUZA 4BY1B 5IP7G 1DZ1A 2I46A 3P1HA 4DV1Q 2QCPX 2MUYA 4KN4C 4RCOA 1Q1BA 4QIWB 1LT6D 1CQFA 1K28A 2E2DC 2MO0A 5C4XB 3NPPA 3QJYA 3OPOA 2F0JA 5IYDG 2ENBA 3S1QB 2K28A 4IFDH 3HOWB 3KJOA 1Y8OB 2Q2IA 3MFYA 4BA2I 1VMCA 1MBYA 2WB1B 3PF5A 5IT9L 1H9SB 1TS4A 2IL8A 3GTGH 5IYCG 5CBEE 3H0GG 3TDQA 1PH2A 3VDYA 4KMUC 2Z4IA 5GQOA 3MWYW 2ATWA 1V1QA 3Q8DA 4YHHQ 3EA6A 3PCOB 3HP3A 4KTAA 3AEVA 3I4NG 1STBA 1Q1EA 4IPCA 5CMDA 4A3JG 2BCOA 2EJMA 4HMIA 4DR4L 4KHPL 4NKLA 3H3VH 1AN8A 1CTMA 4NMZA 1EYAA 4JI5L 4C3HG 1BXTA 5IYCH 1HZBA 4L5RC 3H0GH 1B53A 4LFAQ 3PO2G 3HRZC 5M5YB 1FVIA 4S3SA 3DLLA 1S3OA 3A8JE 4AYBE 3KDFB 4A3JH 1EIHA 2JN4A 4XYOA 5IWAL 2LKVA 2GA4B 1I50B 1YJNA 2NBFA 4DV3Q 5J39A 1JJ2A 4LF6Q 5EGTA 4HSPA 1A3TA 4UP8A 2XWBB 1HZAA 1IYJB 5C0XH 4A3GH 1MJCA 2MGSA 1JR0D 4K5VA 3UDGA 2TMPA 1Z47A 1CQVA 4JBJA 3E3XA 1UEAB 5IOCA 4RHRA 2IX1A 3U9SA 5A2QE 3I4MH 1JJCB 2JEAI 3PQIA 1V9PA 2ICIA 4A3BH 3BDCA 4DAMA 3CMEA 3S2HH 1CHQD 1KDCA 3FKIH 4FF3A 2Y0SB 5IGDA 3FPUB 2RDGA 2CWPA 3MXPA 4JI6Q 1J6QA 1LYLA 1MSHA 2UXDQ 1CK1A 3UDXA 1VF7A 1PH4A 1NUCA 2VW9A 4K0KL 4M1UB 3CQZB 3HOZG 4QB4A 3F1ZA 2FINB 4MTKA 1GUWA 1SN8A 1X54A 4DR2Q 3WWVA 1I3QH 1TVXA 4XTCS 2VUMG 2IPKD 4KY5A 3OW2A 2K03A 4IUQA 1S5CD 4C56C 1HNXL 3RLOA 3HEJA 4GOPA 2DGYA 1SE2A 1YZ6A 3HOZH 1DYQA 4K5WA 2RVLA 3NTKA 1EIGA 3I7FA 1TY2A 1IXRA 3OIPA 1WJJA 1KLUD 3TP6A 2ZM6L 2ID0A 4CDEC 2VUMH 5C5MA 1J5EQ 3UDFA 5JEAG 2RA4A 3D6CA 2HUGA 4A93B 3S1MB 1O80A 5CV7A 1YHQA 3GV6A 3J81E 2WACA 3D4RA 4OONA 5JJZA 3RNUA 3J7ZC 1X3PA 2EE1A 3KF6A 2J0TD 1F2MA 4UPAA 3GO5A 3K80C 2A8VA 4BS9A 2OTLA 1O7LA 2YTXA 4GNXB 5JEAH 2LY7A 1H95A 4EQOA 3OMGA 4PQXA 3BZKA 2VQFQ 3Q6SA 2B63G 2OTJA 4TRDA 1E0BA 2VS1A 1SJHD 5A35A 2RKSA 1R9TB 4BA1I 4ID6A 2F03A 2OF1A 1W2BA 3S15H 5F2DA 3H6MA 4KKTA 2G9DA 3K57A 2NZOA 5ELOA 3S17H 1Z9FA 3V05A 3W5OA 4LF9L 3HOUG 4MZ9A 3PUXA 1KNEA 4XXEA 4A3MB 1CZGA 1VMPA 5DEHA 5C4XH 4XYQA 2PW7A 4LF5Q 3J7A5 5I4DA 2N78A 4A3DB 2A68D 1WYDA 1V1PB 4F88A 3U4ZA 3A56A 3NBHA 1RF2D 4HJ9A 3S1QH 2YU9B 1TR5A 4FVMA 2C5CA 3F2CA 4Q0FA 5IIFA 1L2FA 4U68A 4OIJA 1DM0B 2CH4A 2Q8RE 3NBIA 5LMNL 3M4QA 3OWEB 5FK9C 4WJ3M 1KNAA 1RKNA 4DV7Q 1SSOA 2H1EA 4LUOA 1AE3A 4R4QA 3MAQA 3ND8A 4RKBA 2G9HD 4RGMA 2F0GA 3N6RA 5HGQA 4N9PA 4QF4A 4AYBG 1PH8A 2R7ZG 5CC4A 2AWOA 3GTOB 1J9OA 2SNSA 2B2UA 3GV3A 2F0MA 1JWMD 1VDZA 1E1OA 3NELA 1YI2A 2K04A 2KECA 2N88A 2UUAL 4X6AH 3C2PA 2F0FA 4LW1A 3T4AC 2KUMA 1M4VA 2WP8J 4DR5Q 1PTOC 3J80E 1JQYD 4HIOA 4ALPA 1VQ6A 2IX3A 2UUCL 1EFID 2R7ZH 3KUPA 1K83B 4DV2L 5LL6X 3SXHA 4V190 1JB3A 4F87A 4X62L 1LTBD 2D62A 2J4XA 1H9RA 4ZRZA 4L5TA 4LF8L 3RZDB 4IN3A 1SNMA 4GS3A 4A3CG 1QUQA 2K14A 2RHSB 3BZDB 5ISRA 4DV1L 1ENFA 4GLXA 3A8IE 2PZWA 4JI0Q 2UXCQ 2WAQB 1D5ZC 2K01A 4DR6Q 4ULLA 4O0AA 3U9OA 1XTDA 3RMHA 1SE8A 1U4LA 1XWEA 2PMZB 1X65A 2PMZE 2E2HB 2BE5C 3HGBA 3I3CA 2A6ED 2KCMA 4OL7A 2A69D 3S2DB 4IUPA 1TWCB 2B29A 1QZGA 1HFNA 4NDXA 2NVYB 2WFWA 5KEEA 1BO0A 1WOCA 1B70B 4WORA 3CQZH 4JOIA 3WOFA 4YHHL 4IJHA 2Q8IB 1OTCA 2BH2A 5K36G 2OT2A 1EY6A 2B8GA 1IHZA 2Z8LA 1AEXA 2GN5A 2CWAA 5AFWA 1PH3A 5CBAE 2Z9HA 4LFCQ 2P5ZX 1QJOA 2MP1A 4DR4Q 4QGUA 3AFPA 1IBMQ 4B08A 2ZT9C 2F0EA 4LFAL 2I5LX 4JI5Q 1JCKB 1SYDA 3SGIA 3KYHC 4A4IA 2A1AA 2E8GA 3AMUA 1GHKA 3NTIA 5D3IB 3CC4A 4BXXH 1STAA 4X3UA 2R92G 1C0AA 4DXFA 1ESRA 3CRKC 2IJ0A 1RHPA 4PZ6A 5IWAQ 4A93H 1KDBA 1EY4A 3S1MH 1B9MA 3ULPA 1U4MA 5E4WC 4FP5D 1WTQA 1UEBA 4BY7B 2HDMA 1TKWB 2KQ3A 3GTPH 2QDLA 2R7DA 2R92H 1AZQA 4QJFA 1NBWA 5ELCA 2ZXRA 2A6HD 3K58A 4DK6C 2IT1A 1LLRD 4OXPA 1LT4D 2DNCA 1X3GA 1VQGA 1EZ8A 1EEID 3AQQA 4JI6L 1C8CA 1EY8A 1R9TH 1C48A 4JPBW 2UXDL 1FR3A 1GHJA 2K5HA 4P75A 3CW2C 3R2TA 5C3EH 4G7OC 3D0FA 1GJXA 1R4PB 5ELFA 1ONLA 1ASZA 1PXUA 3STBD 1A62A 1PH5A 4K0KQ 4QQBX 4DA2A 1RD9D 4NW2A 3M4OB 1STGA 3J7YW 4B3TQ 4A3DH 3HOVB 1D6EC 2HCCA 3A54A 3KLWA 3FVQA 4ME3A 2EY5A 5FOBB 4UP7A 2YU9H 1PRTC 1OXUA 1YNNC 2JYOA 1XPOA 1HNXQ 1W6JA 1A2TA 2JEBI 2OQKA 1JOOA 2KJXA 2AUJD 3FDTA 4EQPA 4I65A 1SR3A 1B4OA 1VS0A 4OO1G 1QCBD 1J5EL 2V1CC 3UI2A 3GTJB 3G7LA 2JE6I 1HUNA 1D8LA 3CRLC 5IP9H 2EYHA 3U4VA 5BR8Q 4LFBL 1TWHH 3DM1A 1Y14B 2HIVA 5IY0A 2DJGC 3GTOH 3OSOA 3DWPA 1PH6A 4OHJA 1BBUA 3A0JA 3W2DA 3M7NA 1BR9A 1V1OA 5FLXE 3EJIA 1WD0A 5M3FB 1WVLA 1SMYD 4CDCC 4DV4Q 4LMQD 2K50A 3B6YA 4MN3A 2VQFL 1IZ6A 2K32A 3DWQA 2NWGA 1P8LA 1K83H 2K5QA 4IALA 4XQNA 1E2ZA 3PV0A 3W1BA 2F0KA 1ESFA 4GOPC 2EYPA 1P16A 4A75A 3RZDH 4A3FB 5I2YA 5I6YA 2JXMB 3TSSA 3LNNA 3TN2A 4V0BA 5G3LD 4CGYB 3K0XA 2JA6B 1GO3E 1SYEA 2PQAA 4R4TA 5GAEC 4LF5L 5JPMC 4IUTA 4H02A 2D2CC 1SBBB 2R7FA 3ONAB 5NUCA 4DFAA 3HOXG 1G6ZA 1F2ZA 2L0CA 1PH1A 2OEOA 5IODA 3SVMA 3CCJA 2E2HH 1CZWA 1E2WA 3E9IA 1GUNA 5EPKA 3S2DH 1YIJA 4J1MA 3QOJA 5IT9E 3CKIB 2K52A 1PZJD 3GDEA 2NN6I 4K8IA 1N8RC 3VR6A 5GAGC 3I56A 3K6OA 2CVRA 4DV7L 3J81i 1BNZA 4KI0A 2RDHA 3K7AB 1B8AA 2YTVA 1UWVA 2WIIB 1RODA 2BOSA 1XXGA 4JI1Q 4EQNA 4OELB 4IOAA 1Y1VB 3BVMA 5E4XA 2FHTA 4K5XA 1RIPA 2Z6KA 3KLSX 3GQBA 1I6HB 1HHVA 1VQ4A 1RJTA 4GLVB 3I90A 4YCWA 1HR0Q 1A63A 5LHY1 3JC66 4R8IA 1HUMA 2R93G 5AJ3Q 5JJIA 3JAME 4DR5L 2ZTDA 1PRTF 3KBGA 3E0EA 3BS1A 4Y7NB 1QOHA 4DUYQ 3UE0A 1YJ9A 2A74C 2EYMA 3D8GA 4H13C 1H9SA 4AQYQ 1E1TA 4C3IB 4K6DA 2I0QA 1DONA 5CYUA 4L8JA 4ZKCB 1K73C 1EYGA 1Y8PB 1CA6A 1ICFB 1ET9A 4LF8Q 1T9HA 4BY7H 3R2IA 1X3FA 4JI0L 1PFMA 2UXCL 1EY7A 3C1EA 2NTTA 4DR6L 1GOZA 2AUKA 5C3WA 4JI8L 2ZXPA 4B9WA 3V96A 3GTMB 3KLRA 4QIWE 3DMUA 3MXNA 4O42A 2IW3A 5FKAC 2F0IA 3VYUA 1Y1WH 2B2UC 2IY5B 3KDFA 3IRBA 3QIAA 3OTOQ 3FMCA 1AZPA 2WB1E 1NR2A 1A0IA 1CKNB 3OYYA 1QWYA 1ASYA 4BWGB 1PVOA 1DOLA 5JVG3 3VA7A 4LFCL 3HOVH 4HCSA 3DM3A 4C1NK 4YWMA 4KY7A 1BKBA 1KDAA 3J80i 1NCVA 4HJ8A 1LT5D 1IBML 5M5XB 1FJGL 4K6LA 5GAHC 1BCPD 1LO5D 2KHJA 2B2VC 2KCCA 3I73A 5FO8B 3M3YB 2UXBQ 4A3GG 5C0XG 5CV4A 3VR5A 1YITA 4DK3C 2F0PA 2B2TA 2L11A 4EVOA 4JW0A 3J81c 2CW0D 2F0NA 3OWFA 4CDFC 4DN4M 2EYOA 4A3IH 3GTKH 4BBRH 2E2JB 1WCMB 3PSIA 3K81C 3I4MG 1QZHA 4A3BG 5JPNC 5C4JB 1KAAA 3FKIG 1F9SA 1GUOA 2WV6D 2Z6BA 1OXSC 5M3MB 4AIMA 3N52A 1QNKA 2B2YA 4KJNA 4C3JG 5M3FH 4POFA 3LWEA 2JA5B 4WJWA 1GKHA 2N8NA 2MQHA 1PH9A 1E7ZA 2WKDA 1UE5A 3HOYB 1Q86C 3K5MA 3PMFA 4JOIC 4LK1C 4IOCA 3V2TA 1OXXK 1SYGA 2O4XA 2BA1A 4OIKA 1D1IA 4FXGC 1JWSD 1W6KA 4DUZQ 4X3TA 2Y0SE 3GTQB 4EQ5A 2K75A 1D1KA 4C3JH 2F0WA 4UAIA 4IFDJ 1IW7D 1A2UA 1YNXA 4KHZA 5IYBH 4A3FH 3BYTB 2NVTH 4RGOS 3FHWA 4ILWA 4KK7A 2JA6H 1CKOA 3BG3A 2DN8A 1MJEA 1CSQA 4B3TL 2F4IA 4RKLA 1B44D 4B3RQ 4CKBA 5M5WB 2AQ1B 4HJ5A 4GNXA 2B39A 2M9VA 1LTSD 3PIPA 1N33L 3S1RB 2XTIA 4O2DA 4E6IA 4R4CA 3X3NA 1SYCA 4PV1C 1E24A 1VQKA 4BBSG 5I9PA 4G7ZC 3AB9A 4HIKA 3DUZA 3NHHA 2HD3A 3H3VC 4LNQA 3K7AH 5BR8L 1G51A 1WTRA 4X3SA 4MIUA 1KQSA 5I2XA 1Y1VH 1I4HA 2NVQB 2XRSD 3CD6A 2JA7B 4NXNL 2YYZA 4XT1B 3J80c 4JI2L 4U673 1KC8C 4UDUC 1G8ZD 2EJFC 4HJAA 5DNFA 2Q2TA 4PMCA 1V1PA 4JBMA 3TRZA 4BBSH 5C0XJ 1MD2D 4G4KA 4ZK9B 4P73A 4DV4L 4A3EB 1LTTD 1NNXA 2K5WA 3S1NB 1L1OA 1VQBA 2A5HA 2PYKA 4BY1G 1EU3A 1HCZA 4Y7NH 3CAMA 4HR7B 1ZYRD 4HAEA 4C3IH 5C4XG 2B3GA 2A68C 3TREA 1KHIA 4GKKQ 3G71A 3SK8A 3CPFA 1DOMA 2L9HA 3SK5A 2EYJA 5JOBA 2RQXA 4A3LG 1QE6A 2O5IC 3BJUA 1VCIA 1FD7D 1Q46A 3HOWG 1LACA 1EZ6A 4ZYSA 1AH9A 1I5FA 4BY1H 4GOPB 1VQNA 4IUNA 5A2QL 5LMUQ 5KRUA 1B2TA 3ND9A 3RD4A 4XDXA 2RF4A 1EU4A 1ET6A 1TQOA 2YV5A 1D5XC 4A3LH 1LUZA 3T53B 3HOWH 5KGUA 4RGNA 1H9KA 1CSPA 3ERSX 3VA5A 1EWHA 4L63B 1N36L 2BH8A 4CJ2C 4FYDA 3GP7A 2MPMA 1JE4A 2K33A 3VR2A 2JA8B 1IBLQ 4RH6A 5E1FA 1XJVA 1K9MC 1KAWA 4JI1L 3I4LA 4YCUA 3RLFA 2XGTA 2V4DA 3TQYA 3DEPA 1XNRQ 2WKCA 3K5NA 2JSOA 3CCSA 5DLQE 1PMRA 3ZYYX 4DNRB 5CV5A 3RN2A 4FF4A 3IFDA 4RCNA 3PO3B 1HR0L 5M5XH 2C9OA 3RZOB 4LJZC 1ZKOA 2E76C 4OEMB 5AJ3L 3F2BA 4LF7Q 1NMFA 1VQPA 5I6WA 3M3YH 3RUZA 1M90C 3IL8A 5IGCA 4HIDA 4DUYL 5M5YH 1DXMA 1YJWA 3J7AF 3A7LA 5C44B 4FDBA 4K2KA 4AQYL 4IJLA 3QB3A 5IGFA 5JEAJ 1SRUA 2X6LA 1FNVA 2E2JH 1WCMH 2VB2X 3HKZB 3J81L 1I50H 4K2LA 3T51B 1JJGA 2A69C 2QEXA 4EGVA 4ZAIA 2Y0SG 1K8OA 5M3MH 4GLAC 3QR8A 1CA5A 4IURA 2JA5H 2QGQA 1TWAB 3MXGA 3L7ZC 1YNJD 1PA6A 2WAQE 3J7AV 3EFXD 4DNTB 4QUCA 1EQRA 4JI8Q 4QUFA 2EQSA 2LFNA 1IL2A 1HNWQ 1I4QA 2UUBL 3DEOA 3FRPB 1X55A 3KFUA 3VYTA 4GN3B 3GTQH 2BA0A 3OTOL 3SK4A 5E7NA 1XMQQ 4NP5A 4ZLTF 2PI2E 1SROA 1Z7TA 2NTSA 1WTPA 3QWNA 1B9NA 1D2BA 2B2WA 1M1KC 3M4PA 1XMOQ 1VQLA 5D14A 3X3MA 4BXXG 4JBWA 1ICWA 1E3PA 1S5ED 2DY7A 4WFN3 1SXTA 4JV5Q 1K8GA 2ZJQA 5CV8A 1XNQQ 1RDPD 4A93G 1O7YA 1TT2A 3DWAA 3VR3A 1XX8A 3EN2A 5KYIA 2UXBL 1FJGQ 4IO9A 3KJPA 1WTOA 4OWTB 1O7IA 1U9RA 2NUCA 4X65Q 3OW7A 2E2IB 2A6HC 5J3BA 2O5JC 4C2MB 4HCEA 3NSWA 2VQEQ 4FO2A 1Z6HA 1DGSA 2JA7H 3T1YQ 5LMNW 1TWFB 1F9QA 2HQLA 3HS0C 5TSSA 1SEBD 2FXQA 1PYWD 4LUZA 5C3EG 2BDOA 3J80L 4A3EH 2DJFC 1K3BC 3CC7A 2RSOA 4CHTB 4LWCA 3STBC 2D0PA 3IFTA 4R9WA 4FF2A 3S14B 1V8QA 2OCEA 3I8ZA 1RL2A 5FO9B 2JP1A 4DUZL 4A3MG 2ZTEA 3TZUA 1PTOF 4A3KB 1VQAA 1STEA 4IUUA 4L5SA 4A3DG 3F8TA 1QVCA 4DXGA 3PIP3 4OO1I 1JOQA 1EWIA 1NTGA 1TXYA 2LMCB 4HSVA 4B3SQ 2VNUD 4FXDA 1LTID 5C4HA 4DAVA 1CM9A 3SK6A 4ODGA 1AP0A 4B3RL 1SE4A 4A3MH 3D4WA 2F0DA 1HNZQ 4Z9CB 4KD3A 3TMEA 5IP9G 2L55A 2RBMA 4IPHA 1JORA 1Q7YC 3MVVA 2VY3A 4UY8C 1XYIA 4KHVA 1ILQA 1I4GA 1GUTA 2B2YC 3P7JA 1VF5C 3QOLA 1N33Q 1EOVA 3LX0A 1I94Q 5FJ8H 1K8AC 2XWJB 2Z0SA 1SMYC 2IHFA 5C6AA 4X64L 4JI7Q 1B1ZA 5CV9A 1HZCA 2JK8A 1SNOA 1UE6A 4DK1A 1IBKQ 1TWGB 1PFSA 3FEWX 3CCQA 5EQ0A 2K1BA 4P71A 2KBNA 1NY4A 1Q8KA 3NQIA 1EYCA 3JAMc 3H0GB 4ZUJA 2Q2HA 2L4NA 3PO3H 1YBYA 4NXNQ 1E2VA 1CI3M 3TEHB 3I4NB 1VQOA 3R93A 4DV5Q 4JI2Q 4AH6A 1K8MA 3GTLB 4A3JB 4DAYA 2NVXB 3D6WA 2XIWA 1BDOA 3H94A 1U4PA 5HY6A 4C3HB 2WAQG 1X3EA 4GKKL 5EKLA 2IHEA 1LV9A 3ULJA 4R1JA 1JE5A 3PO2B 4JCVE 4YWKA 1QNUA 4ZUIA 2CCZA 2E74C 2PCFB 4IPGA 4P2CB 4HN7A 1JT8A 2QW7A 1GUGA 2QA4A 3KF8A 3IAYA 5LMUL 1FNWA 1TWAH 2ALYB 4MNOA 3S2HB 1TS2A 2IX0A 3G6JB 3E5SA 1LTRD 1HA6A 2PNHA 1VQJA 2EOTA 1F2LA 2LS01 1QG7A 4RAUC 4ZCKA 2AHOB 3TP7A 3CP0A 3G48A 2XRQD 1T5XD 5BN4A 1TWCH 4HJ7A 1BVSA 4DV6Q 4PNYA 1N36Q 1VQ8A 2NVYH 3M4YA 1IBLL 3MZ5A 3OOCA 1I3QB 1EY0A 3KOJA 1U4RA 1XNRL 2A19A 5H1SE 3CCEA 1L1OC 2D0OA 3SDZA 1YEZA 3NK9A 2XN9C 5FLMH 5T1GA 1B3QA 4B3ML 4LFBQ 2DY8A 4IFDI 3A5ZB 4CKEA 2C35B 1KLGD 4TVAB 2RSNA 3H91A 1XTCD 4YWLA 3E6ZX 2KA7A 3HOZB 4CJ1B 2SOBA 1E22A 4JG2A 4LF7L 3Q23A 4JBKA 2GVAA 5IGGA 3U58A 1KABA 2VUMB 1IKMA 1SYBA 2H4OA 3A8KE 1NSNS 4BY7G 2ASBA 3K59A 1VQCA 2LSSA 3CCRA 1F9PA 1L0WA 3BDOA 3H3VI 4C2MH 1CKNA 1FNUA 1PTOB 2KCTA 3ER0A 2PQAB 4LF4L 2M00A 5ELEA 1N32Q 5EPJA 2Z4HA 3T16A 1WD1A 1Y1WG 5CORA 2F1MA 2VB3X 1TWFH 3TZDA 1UNSA 2ICEC 1QVFA 4NB3A 1G2SA 4RA8A 2PZUA 4OX9Q 2FJ2A 1HA5A 3O13A 3TS2A 2EY6A 2NZHA 1HNWL 1ML0D 3S14H 2HDLA 1NAPA 1M8AA 3CC2A 2EXZA 3NWTA 5C0XI 5G3LF 2EJGC 5CR3A 2ZJRA 2UUBQ 4A3KH 1JICA 1XMQL 1FGUA 1PYBA 2LXJA 3HOVG 1TY0A 3CCLA
chains in the Genus database with same CATH topology
1SE8A 3CD6A 4NXNL 1X65A 1VQDA 2ZM6Q 2PMZE 2OWOA 2YYZA 3E9HA 3J80c 2F4VQ 4JI2L 2KCMA 1KC8C 4HJAA 4JBMA 4DV0Q 3TRZA 5C44H 2Q2TA 4BBSH 1XMOL 5C0XJ 2F52A 2B29A 4P73A 4DV4L 1SMXA 1QZGA 1Q81C 2WFWA 3M4OH 5EAYA 1L1OA 1VQBA 4JV5L 3MEFA 4GNXC 2I5MX 1WOCA 4BY1G 2MO1A 4Y7NH 4A3IG 4R4OA 4BBRG 1B70B 4YHHL 3CQZH 3CAMA 4JOIA 1FL0A 4IJHA 4YCVA 1OTCA 2BH2A 5K36G 1UE7A 1X56A 1YHAA 4C3IH 5C4XG 2B3GA 2YTYA 3TREA 1KHIA 5IP7H 4GKKQ 3G71A 4DPGA 3CPFA 2GN5A 2I5HA 4TQUS 4DKAC 2CWAA 1PH3A 4A3LG 3G4SA 5IE8A 4QL5A 3BJUA 1Q82C 1VCIA 4LFCQ 1Q46A 3HOWG 3AYHB 4X65L 5M3FG 2AWNA 4JYAQ 1SFOH 5IYDH 4DR4Q 2JA9A 3L0OA 2KHIA 3AFPA 4QGUA 1IBMQ 3D31A 1AH9A 5FLMG 1I5FA 1YHBA 2I5LX 4LFAL 4JI5Q 4BY1H 4GOPB 1VQNA 3GTJH 3F2DA 5LMUQ 2UU9Q 4NPSA 3SGIA 3CCVA 3KYHC 4A4IA 2VQEL 2A1AA 2E8GA 2RF4A 1TWGH 3CC4A 4BXXH 4RMFA 3T1YL 5ELNA 2R92G 1C0AA 3UDIA 1BBWA 2YV5A 2EXDA 3MXNB 4A3LH 1LUZA 1HH2P 4LF9Q 4A76A 3ICEA 2HHHQ 3HOWH 4PZ6A 5IWAQ 3I4NH 1CSPA 1VQFA 3ERSX 3PUYA 4A93H 3S1MH 1D7QA 1N36L 1U5KA 2BH8A 4DR1L 3GTLH 3ULPA 5IYBG 4A3FG 1EIFA 4NXMQ 2NVXH 4DAYB 2HT1A 1UEBA 1IBLQ 2JA6G 1VQ5A 1XJVA 4OWWB 1K9MC 1KAWA 4JI1L 4YCUA 3RLFA 3TQYA 2XGTA 4C3HH 1NJIC 2R7DA 1XNRQ 3GTPH 2R92H 2ZTCA 3M85A 4QJFA 3H15A 1NBWA 3CCMA 3CCSA 5DLQE 3PO2H 4WJ4A 4P72A 4UP9A 4DK6C 5LMNQ 2IT1A 3NENA 1C9OA 1OXVA 3K8AA 3RN2A 4B3SL 1AE2A 4OXPA 1MKHA 1KRSA 1VQGA 1X3GA 3HOXH 2DUDA 1HR0L 2CKZB 5M5XH 3AQQA 4XIGS 2GVBA 4JI6L 2AKWB 4GKJL 2E2IH 1VQHA 5AJ3L 3F2BA 1R9TH 1NMFA 1VQPA 4LF7Q 2UXDL 3ULLA 1M90C 3KF8B 3A5UA 3M3YH 1VQIA 2K5HA 1V43A 4P75A 3CW2C 4JI3Q 1HNZL 5C3EH 3D0FA 5GADC 4DUYL 4HIDA 5M5YH 1XNQL 4DR7Q 1YJWA 1K3RA 1A8VA 4FDBA 4AQYL 4IJLA 1ASZA 3STBD 1PH5A 1A62A 4PZ7A 1SRUA 5JEAJ 4YY3Q 4A3KG 2E2JH 2UUAQ 4K0KQ 1WCMH 1Y1VG 4OWXB 1UE1A 1I50H 1GM5A 4Y52H 4B3TQ 3CXCA 4PMWA 4A3DH 1I94L 1JJGA 4L5QA 1KRTA 4JC0A 2QEXA 2UUCQ 2Y0SG 3KLWA 4ME3A 1X6OA 4JI4Q 1N9WA 2NN6G 3K7UC 4GLAC 5M3MH 2CFMA 1XPUA 1U0LA 4UP7A 2YU9H 4DV2Q 4JI7L 1OXUA 1XPOA 4EX5A 3EBEA 1HJPA 4J15A 4DR3L 1HNXQ 2JA5H 2QGQA 1G6PA 4X62Q 4X64Q 1IBKL 2JEBI 3L7ZC 4IFDG 2OQKA 1PA6A 2WAQE 4P74A 1LTLA 2R93H 2E5LQ 1EQRA 4JI8Q 3I4OA 1SR3A 2EQSA 1VS0A 4X66L 3RLNA 3S24A 3BU2A 1N34L 1IL2A 1J5EL 4OO1G 2V1CC 1HNWQ 3PUZA 5IP7G 2UUBL 2JE6I 2ZJPA 1D8LA 1NMGA 1I6HH 4DV1Q 5IP9H 1X55A 3KFUA 3U4VA 5BR8Q 1Q1BA 3T1HQ 4LFBL 1KXLA 4DV5L 1K0RA 1TWHH 4GN3B 3GTQH 1Y14B 2BA0A 2MO0A 3OTOL 4QY7A 2HIVA 5IY0A 5E7NA 1XMQQ 3CPWA 3GTOH 5IYDG 1PH6A 2PI2E 1BBUA 3A0JA 3CF5A 3M7NA 1SROA 4DV0L 3KJOA 2JJQA 2Q2IA 3NEMA 4BA2I 3CCUA 1M1KC 3M4PA 1XMOQ 1VQLA 3PF5A 4BXXG 4DV4Q 4JBWA 2K50A 1E3PA 3B6YA 3GTGH 5IYCG 2VQFL 1IZ6A 1VQMA 3H0GG 1PH2A 4JV5Q 3VDYA 1K8GA 5GQOA 2ATWA 1V1QA 2ZJQA 1P8LA 1K83H 3Q8DA 1XNQQ 1KL9A 4YHHQ 3PCOB 3AEVA 3I4NG 4A93G 1S40A 2LXKA 1Q1EA 3EN2A 4IPCA 2UXBL 1C7YA 3L2PA 3PV0A 3W1BA 4A3JG 2Q2UA 1FJGQ 2WB1G 4PZ8A 4IO9A 3KJPA 1B7YB 2EIFA 4GOPC 4DR4L 1P16A 3GTMH 4A75A 3RZDH 4KHPL 4OWTB 4RG1A 1O7IA 3H3VH 4QQBX 4JI5L 1EIYB 4X65Q 5IYCH 1HZBA 2K5NA 5J3BA 3H0GH 3K0XA 3ZJYC 4L5RC 1GO3E 4LFAQ 2H5XA 2PQAA 2RHQB 4R4TA 1QVGA 3PO2G 3A74A 5GAEC 4LF5L 2VQEQ 4H02A 2ES2A 1FVIA 1DGSA 2R7FA 4DV6L 3DLLA 5JJKA 1S3OA 3HOXG 4AYBE 3KDFB 4A3JH 2JA7H 3T1YQ 1PH1A 2HHHL 5IWAL 5LMNW 1OXTA 3AFQA 3CCJA 2E2HH 2HQLA 2B63H 3E9IA 1YJNA 1KD1C 3PF4A 4DV3Q 3S2DH 1CUKA 1S72A 1YIJA 2FXQA 1JJ2A 3KF6B 4LUZA 4LF6Q 5C3EG 2K52A 4A3EH 3CC7A 3GDEA 4UP8A 2NN6I 4DR1Q 1HZAA 1IYJB 1N8RC 4LWCA 3STBC 3TS0A 4A3GH 1MJCA 1PYSB 2D0PA 5GAGC 3I56A 1GVPA 4DV7L 4B3MQ 3J81i 2N3SA 2VZAA 1L1OB 2CQOA 3UDGA 4KI0A 2OCEA 1B8AA 1WCMG 1EQQA 1SLJA 5JJLA 1RL2A 2YTVA 4DUZL 1UWVA 3GD7A 1Z47A 2K4KA 4JBJA 4A3MG 1PV4A 4JI1Q 1PHJA 2ZTEA 3HOUH 2IX1A 1VQAA 4A3DG 4L5SA 4IOAA 3I4MH 3F8TA 1QVCA 4OO1I 1JJCB 2JEAI 2Z6KA 1EWIA 1NTGA 1RIPA 1V9PA 5M3MG 4A3BH 4DAMA 1TXYA 3CMEA 3S2HH 1VQ4A 3FKIH 4B3SQ 2VNUD 2JA5G 4GLVB 4YCWA 1HR0Q 1A63A 2PI2A 4APVA 3JC66 1CKMA 3HOYG 2CWPA 4JI6Q 4GKJQ 2R93G 1J6QA 1LYLA 5AJ3Q 3I55A 2UXDQ 3RN5A 4DR5L 5JJIA 2ZTDA 4B3RL 3UDXA 1N32L 3J81j 3E0EA 4A3MH 3HKZE 1PH4A 2R6GA 1HNZQ 2VW9A 5C4JH 4K0KL 4DUYQ 3HOZG 3UE0A 3F1ZA 5IP9G 1YJ9A 4LF4Q 4IPHA 1SN8A 1Q7YC 1X54A 4AQYQ 4POGA 1E1TA 2VY3A 4DR2Q 3WWVA 2I0QA 3NBHB 4UY8C 4OX9L 1I3QH 1WI5A 3PIOA 1JMCA 4XTCS 2VUMG 2AMCB 4KLKA 3OW2A 1K73C 1JB7A 1EYGA 3HOYH 1N33Q 1EOVA 1I94Q 2L15A 5FJ8H 1K8AC 2Z0SA 4HIMA 1HNXL 4LF8Q 1T9HA 3RLOA 4GOPA 2DGYA 4BY7H 1X3FA 2IHFA 4X64L 4JI0L 4JI7Q 2UXCL 3LGJA 4GN4B 1HZCA 1YZ6A 2JK8A 4DR3Q 4DR6L 1UE6A 2N49A 3HOZH 4JI8L 1IBKQ 2Z6KC 1PFSA 4QIWE 3CCQA 3I7FA 4P71A 1IXRA 2KBNA 1NY4A 1Q8KA 1WJJA 2ZM6L 2ID0A 2VUMH 3JAMc 4X66Q 1N34Q 2Q2HA 2F4VL 1J5EQ 3PO3H 1YBYA 3UDFA 5JEAG 1W3SA 4NXNQ 1Y1WH 4DNIA 2IY5B 3TEHB 1VQOA 3KDFA 4DV5Q 4JI2Q 4AH6A 1YHQA 3IRBA 3OTOQ 4OONA 2WB1E 3RNUA 3J7ZC 3KF6A 1A0IA 4UPAA 5M5WH 1CKNB 3OYYA 3GO5A 3K80C 5HY6A 3JAMi 2A8VA 4A3CH 2WAQG 1X3EA 4GKKL 1ASYA 2OTLA 2IHEA 2YTXA 3ULJA 1PVOA 4R1JA 4GNXB 1JE5A 4JCVE 4YWKA 3FP9A 2JA7G 3S16H 1H95A 4LFCL 3S1RH 3HFZB 1LM0A 3HOVH 3BZKA 2VQFQ 3DM3A 4YWMA 4JYAL 3EIVA 2CCZA 2B63G 1XPRA 1BKBA 4IPGA 3J80i 4HJ8A 1IBML 2OTJA 1FJGL 1JT8A 5GAHC 2VS1A 2MFIA 3UE1A 2QA4A 2KHJA 5LMUL 3CMAA 2UU9L 4A3EG 1QUQB 1TWAH 4BA1I 2ALYB 2UXBQ 4A3GG 4MNOA 5C0XG 1VQ9A 1W2BA 2F3IA 1YITA 3S15H 4DK3C 1VQ7A 5FLXc 2IX0A 3U50C 1VQEA 4KHPQ 2NZOA 2NVQH 5ELOA 3J81c 3S17H 2PNHA 1VQJA 1Z9FA 3W5OA 4A3IH 3GTKH 4BBRH 4LF9L 3PUVA 4MZ9A 3HOUG 2AHOB 3PUXA 3K81C 3PSIA 3I4MG 2RCNA 3CP0A 1QZHA 3G48A 4A3BG 5C4XH 4LF5Q 4NXML 3J7A5 3HKSA 1TWCH 2N78A 4HJ7A 1BVSA 1WYDA 3FKIG 4DV6Q 1N36Q 3U4ZA 1VQ8A 1OXSC 2NVYH 4LUVA 4R4IA 4AIMA 4HJ9A 3S1NH 3S1QH 4DV3L 1IBLL 3F2CA 3KOJA 3RR5A 4LF6L 5M3FH 4POFA 1XNRL 2A19A 5H1SE 3CCEA 1L1OC 1GKHA 1L2FA 1YEZA 2D0OA 2MQHA 2N8NA 5FLMH 1X9NA 1E7ZA 1PH9A 1Q12A 1UE5A 4B3ML 4LFBQ 4IFDI 1Q86C 5LMNL 1GD7A 4JOIC 1HR0W 3A5ZB 2MNAA 3M4QA 4IOCA 2C35B 2VL6A 3G6EA 4TVAB 1EFWA 4WJ3M 1OXXK 1NE3A 2BA1A 4DV7Q 3PGZA 4LUOA 4YWLA 1AE3A 4R4QA 4DUZQ 1E22A 2Y0SE 4JG2A 4LF7L 5HGQA 1PH8A 4AYBG 1MIUA 4EQ5A 2R7ZG 4JBKA 2K5VA 2GVAA 2K75A 4MTNA 5GROA 4C3JH 2AWOA 4JI3L 5FJ8G 3U58A 4IFDJ 4DR7L 4BY7G 3I2ZA 1YNXA 2ASBA 4KHZA 5IYBH 4A3FH 4IPDA 1E1OA 2JA8G 1VQCA 1HZ9A 2LSSA 3NELA 3W1GA 1YI2A 2NVTH 2UUAL 4YY3L 5IT9c 4X6AH 3FHWA 3CCRA 4LW1A 1L0WA 4GN5A 3M9BA 2JA6H 3H3VI 1CKOA 1EUJA 2HIXA 4C2MH 1CSQA 1MJEA 1CKNA 2KCTA 2WP8J 3ER0A 4B3TL 4DR5Q 2PQAB 4B3RQ 4LF4L 4HIOA 1VQ6A 4ALPA 1N32Q 2UUCL 2OQ0A 4JI4L 3PO3G 2R7ZH 4HJ5A 4DR2L 4GNXA 1Y1WG 4DV2L 3BZCA 1WFQA 1TWFH 1G291 1KIXA 2KENA 4NB3A 4X62L 2D62A 1QVFA 2JA8H 3PIPA 1N33L 4OX9Q 2XTIA 4O2DA 3PUWA 4R4CA 3TS2A 2E5LL 4L5TA 1PH7A 4LF8L 1E24A 1VQKA 2NZHA 4GS3A 4BBSG 4A3CG 5C44G 1HNWL 4HIKA 1QUQA 2K14A 2RHSB 4PG3A 3S14H 4DV1L 4LNQA 3K7AH 3CC2A 5BR8L 3T1HL 1G51A 5C0XI 4GLXA 3HKZG 4JI0Q 2ZJRA 2UXCQ 2JQOA 1YVCA 1KQSA 2UUBQ 4A3KH 4DR6Q 1XMQL 1FGUA 1PYBA 2LXJA 3HOVG 3RZOH 1Y1VH 4O0AA 1XTDA 3CCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SE8 A;  3CD6 A;  4NXN L;  1X65 A;  1VQD A;  2ZM6 Q;  2PMZ E;  2OWO A;  2YYZ A;  3E9H A;  3J80 c;  2F4V Q;  4JI2 L;  2KCM A;  1KC8 C;  4HJA A;  4JBM A;  4DV0 Q;  3TRZ A;  5C44 H;  2Q2T A;  4BBS H;  1XMO L;  5C0X J;  2F52 A;  2B29 A;  4P73 A;  4DV4 L;  1SMX A;  1QZG A;  1Q81 C;  2WFW A;  3M4O H;  5EAY A;  1L1O A;  1VQB A;  4JV5 L;  3MEF A;  4GNX C;  2I5M X;  1WOC A;  4BY1 G;  2MO1 A;  4Y7N H;  4A3I G;  4R4O A;  4BBR G;  1B70 B;  4YHH L;  3CQZ H;  3CAM A;  4JOI A;  1FL0 A;  4IJH A;  4YCV A;  1OTC A;  2BH2 A;  5K36 G;  1UE7 A;  1X56 A;  1YHA A;  4C3I H;  5C4X G;  2B3G A;  2YTY A;  3TRE A;  1KHI A;  5IP7 H;  4GKK Q;  3G71 A;  4DPG A;  3CPF A;  2GN5 A;  2I5H A;  4TQU S;  4DKA C;  2CWA A;  1PH3 A;  4A3L G;  3G4S A;  5IE8 A;  4QL5 A;  3BJU A;  1Q82 C;  1VCI A;  4LFC Q;  1Q46 A;  3HOW G;  3AYH B;  4X65 L;  5M3F G;  2AWN A;  4JYA Q;  1SFO H;  5IYD H;  4DR4 Q;  2JA9 A;  3L0O A;  2KHI A;  3AFP A;  4QGU A;  1IBM Q;  3D31 A;  1AH9 A;  5FLM G;  1I5F A;  1YHB A;  2I5L X;  4LFA L;  4JI5 Q;  4BY1 H;  4GOP B;  1VQN A;  3GTJ H;  3F2D A;  5LMU Q;  2UU9 Q;  4NPS A;  3SGI A;  3CCV A;  3KYH C;  4A4I A;  2VQE L;  2A1A A;  2E8G A;  2RF4 A;  1TWG H;  3CC4 A;  4BXX H;  4RMF A;  3T1Y L;  5ELN A;  2R92 G;  1C0A A;  3UDI A;  1BBW A;  2YV5 A;  2EXD A;  3MXN B;  4A3L H;  1LUZ A;  1HH2 P;  4LF9 Q;  4A76 A;  3ICE A;  2HHH Q;  3HOW H;  4PZ6 A;  5IWA Q;  3I4N H;  1CSP A;  1VQF A;  3ERS X;  3PUY A;  4A93 H;  3S1M H;  1D7Q A;  1N36 L;  1U5K A;  2BH8 A;  4DR1 L;  3GTL H;  3ULP A;  5IYB G;  4A3F G;  1EIF A;  4NXM Q;  2NVX H;  4DAY B;  2HT1 A;  1UEB A;  1IBL Q;  2JA6 G;  1VQ5 A;  1XJV A;  4OWW B;  1K9M C;  1KAW A;  4JI1 L;  4YCU A;  3RLF A;  3TQY A;  2XGT A;  4C3H H;  1NJI C;  2R7D A;  1XNR Q;  3GTP H;  2R92 H;  2ZTC A;  3M85 A;  4QJF A;  3H15 A;  1NBW A;  3CCM A;  3CCS A;  5DLQ E;  3PO2 H;  4WJ4 A;  4P72 A;  4UP9 A;  4DK6 C;  5LMN Q;  2IT1 A;  3NEN A;  1C9O A;  1OXV A;  3K8A A;  3RN2 A;  4B3S L;  1AE2 A;  4OXP A;  1MKH A;  1KRS A;  1VQG A;  1X3G A;  3HOX H;  2DUD A;  1HR0 L;  2CKZ B;  5M5X H;  3AQQ A;  4XIG S;  2GVB A;  4JI6 L;  2AKW B;  4GKJ L;  2E2I H;  1VQH A;  5AJ3 L;  3F2B A;  1R9T H;  1NMF A;  1VQP A;  4LF7 Q;  2UXD L;  3ULL A;  1M90 C;  3KF8 B;  3A5U A;  3M3Y H;  1VQI A;  2K5H A;  1V43 A;  4P75 A;  3CW2 C;  4JI3 Q;  1HNZ L;  5C3E H;  3D0F A;  5GAD C;  4DUY L;  4HID A;  5M5Y H;  1XNQ L;  4DR7 Q;  1YJW A;  1K3R A;  1A8V A;  4FDB A;  4AQY L;  4IJL A;  1ASZ A;  3STB D;  1PH5 A;  1A62 A;  4PZ7 A;  1SRU A;  5JEA J;  4YY3 Q;  4A3K G;  2E2J H;  2UUA Q;  4K0K Q;  1WCM H;  1Y1V G;  4OWX B;  1UE1 A;  1I50 H;  1GM5 A;  4Y52 H;  4B3T Q;  3CXC A;  4PMW A;  4A3D H;  1I94 L;  1JJG A;  4L5Q A;  1KRT A;  4JC0 A;  2QEX A;  2UUC Q;  2Y0S G;  3KLW A;  4ME3 A;  1X6O A;  4JI4 Q;  1N9W A;  2NN6 G;  3K7U C;  4GLA C;  5M3M H;  2CFM A;  1XPU A;  1U0L A;  4UP7 A;  2YU9 H;  4DV2 Q;  4JI7 L;  1OXU A;  1XPO A;  4EX5 A;  3EBE A;  1HJP A;  4J15 A;  4DR3 L;  1HNX Q;  2JA5 H;  2QGQ A;  1G6P A;  4X62 Q;  4X64 Q;  1IBK L;  2JEB I;  3L7Z C;  4IFD G;  2OQK A;  1PA6 A;  2WAQ E;  4P74 A;  1LTL A;  2R93 H;  2E5L Q;  1EQR A;  4JI8 Q;  3I4O A;  1SR3 A;  2EQS A;  1VS0 A;  4X66 L;  3RLN A;  3S24 A;  3BU2 A;  1N34 L;  1IL2 A;  1J5E L;  4OO1 G;  2V1C C;  1HNW Q;  3PUZ A;  5IP7 G;  2UUB L;  2JE6 I;  2ZJP A;  1D8L A;  1NMG A;  1I6H H;  4DV1 Q;  5IP9 H;  1X55 A;  3KFU A;  3U4V A;  5BR8 Q;  1Q1B A;  3T1H Q;  4LFB L;  1KXL A;  4DV5 L;  1K0R A;  1TWH H;  4GN3 B;  3GTQ H;  1Y14 B;  2BA0 A;  2MO0 A;  3OTO L;  4QY7 A;  2HIV A;  5IY0 A;  5E7N A;  1XMQ Q;  3CPW A;  3GTO H;  5IYD G;  1PH6 A;  2PI2 E;  1BBU A;  3A0J A;  3CF5 A;  3M7N A;  1SRO A;  4DV0 L;  3KJO A;  2JJQ A;  2Q2I A;  3NEM A;  4BA2 I;  3CCU A;  1M1K C;  3M4P A;  1XMO Q;  1VQL A;  3PF5 A;  4BXX G;  4DV4 Q;  4JBW A;  2K50 A;  1E3P A;  3B6Y A;  3GTG H;  5IYC G;  2VQF L;  1IZ6 A;  1VQM A;  3H0G G;  1PH2 A;  4JV5 Q;  3VDY A;  1K8G A;  5GQO A;  2ATW A;  1V1Q A;  2ZJQ A;  1P8L A;  1K83 H;  3Q8D A;  1XNQ Q;  1KL9 A;  4YHH Q;  3PCO B;  3AEV A;  3I4N G;  4A93 G;  1S40 A;  2LXK A;  1Q1E A;  3EN2 A;  4IPC A;  2UXB L;  1C7Y A;  3L2P A;  3PV0 A;  3W1B A;  4A3J G;  2Q2U A;  1FJG Q;  2WB1 G;  4PZ8 A;  4IO9 A;  3KJP A;  1B7Y B;  2EIF A;  4GOP C;  4DR4 L;  1P16 A;  3GTM H;  4A75 A;  3RZD H;  4KHP L;  4OWT B;  4RG1 A;  1O7I A;  3H3V H;  4QQB X;  4JI5 L;  1EIY B;  4X65 Q;  5IYC H;  1HZB A;  2K5N A;  5J3B A;  3H0G H;  3K0X A;  3ZJY C;  4L5R C;  1GO3 E;  4LFA Q;  2H5X A;  2PQA A;  2RHQ B;  4R4T A;  1QVG A;  3PO2 G;  3A74 A;  5GAE C;  4LF5 L;  2VQE Q;  4H02 A;  2ES2 A;  1FVI A;  1DGS A;  2R7F A;  4DV6 L;  3DLL A;  5JJK A;  1S3O A;  3HOX G;  4AYB E;  3KDF B;  4A3J H;  2JA7 H;  3T1Y Q;  1PH1 A;  2HHH L;  5IWA L;  5LMN W;  1OXT A;  3AFQ A;  3CCJ A;  2E2H H;  2HQL A;  2B63 H;  3E9I A;  1YJN A;  1KD1 C;  3PF4 A;  4DV3 Q;  3S2D H;  1CUK A;  1S72 A;  1YIJ A;  2FXQ A;  1JJ2 A;  3KF6 B;  4LUZ A;  4LF6 Q;  5C3E G;  2K52 A;  4A3E H;  3CC7 A;  3GDE A;  4UP8 A;  2NN6 I;  4DR1 Q;  1HZA A;  1IYJ B;  1N8R C;  4LWC A;  3STB C;  3TS0 A;  4A3G H;  1MJC A;  1PYS B;  2D0P A;  5GAG C;  3I56 A;  1GVP A;  4DV7 L;  4B3M Q;  3J81 i;  2N3S A;  2VZA A;  1L1O B;  2CQO A;  3UDG A;  4KI0 A;  2OCE A;  1B8A A;  1WCM G;  1EQQ A;  1SLJ A;  5JJL A;  1RL2 A;  2YTV A;  4DUZ L;  1UWV A;  3GD7 A;  1Z47 A;  2K4K A;  4JBJ A;  4A3M G;  1PV4 A;  4JI1 Q;  1PHJ A;  2ZTE A;  3HOU H;  2IX1 A;  1VQA A;  4A3D G;  4L5S A;  4IOA A;  3I4M H;  3F8T A;  1QVC A;  4OO1 I;  1JJC B;  2JEA I;  2Z6K A;  1EWI A;  1NTG A;  1RIP A;  1V9P A;  5M3M G;  4A3B H;  4DAM A;  1TXY A;  3CME A;  3S2H H;  1VQ4 A;  3FKI H;  4B3S Q;  2VNU D;  2JA5 G;  4GLV B;  4YCW A;  1HR0 Q;  1A63 A;  2PI2 A;  4APV A;  3JC6 6;  1CKM A;  3HOY G;  2CWP A;  4JI6 Q;  4GKJ Q;  2R93 G;  1J6Q A;  1LYL A;  5AJ3 Q;  3I55 A;  2UXD Q;  3RN5 A;  4DR5 L;  5JJI A;  2ZTD A;  4B3R L;  3UDX A;  1N32 L;  3J81 j;  3E0E A;  4A3M H;  3HKZ E;  1PH4 A;  2R6G A;  1HNZ Q;  2VW9 A;  5C4J H;  4K0K L;  4DUY Q;  3HOZ G;  3UE0 A;  3F1Z A;  5IP9 G;  1YJ9 A;  4LF4 Q;  4IPH A;  1SN8 A;  1Q7Y C;  1X54 A;  4AQY Q;  4POG A;  1E1T A;  2VY3 A;  4DR2 Q;  3WWV A;  2I0Q A;  3NBH B;  4UY8 C;  4OX9 L;  1I3Q H;  1WI5 A;  3PIO A;  1JMC A;  4XTC S;  2VUM G;  2AMC B;  4KLK A;  3OW2 A;  1K73 C;  1JB7 A;  1EYG A;  3HOY H;  1N33 Q;  1EOV A;  1I94 Q;  2L15 A;  5FJ8 H;  1K8A C;  2Z0S A;  4HIM A;  1HNX L;  4LF8 Q;  1T9H A;  3RLO A;  4GOP A;  2DGY A;  4BY7 H;  1X3F A;  2IHF A;  4X64 L;  4JI0 L;  4JI7 Q;  2UXC L;  3LGJ A;  4GN4 B;  1HZC A;  1YZ6 A;  2JK8 A;  4DR3 Q;  4DR6 L;  1UE6 A;  2N49 A;  3HOZ H;  4JI8 L;  1IBK Q;  2Z6K C;  1PFS A;  4QIW E;  3CCQ A;  3I7F A;  4P71 A;  1IXR A;  2KBN A;  1NY4 A;  1Q8K A;  1WJJ A;  2ZM6 L;  2ID0 A;  2VUM H;  3JAM c;  4X66 Q;  1N34 Q;  2Q2H A;  2F4V L;  1J5E Q;  3PO3 H;  1YBY A;  3UDF A;  5JEA G;  1W3S A;  4NXN Q;  1Y1W H;  4DNI A;  2IY5 B;  3TEH B;  1VQO A;  3KDF A;  4DV5 Q;  4JI2 Q;  4AH6 A;  1YHQ A;  3IRB A;  3OTO Q;  4OON A;  2WB1 E;  3RNU A;  3J7Z C;  3KF6 A;  1A0I A;  4UPA A;  5M5W H;  1CKN B;  3OYY A;  3GO5 A;  3K80 C;  5HY6 A;  3JAM i;  2A8V A;  4A3C H;  2WAQ G;  1X3E A;  4GKK L;  1ASY A;  2OTL A;  2IHE A;  2YTX A;  3ULJ A;  1PVO A;  4R1J A;  4GNX B;  1JE5 A;  4JCV E;  4YWK A;  3FP9 A;  2JA7 G;  3S16 H;  1H95 A;  4LFC L;  3S1R H;  3HFZ B;  1LM0 A;  3HOV H;  3BZK A;  2VQF Q;  3DM3 A;  4YWM A;  4JYA L;  3EIV A;  2CCZ A;  2B63 G;  1XPR A;  1BKB A;  4IPG A;  3J80 i;  4HJ8 A;  1IBM L;  2OTJ A;  1FJG L;  1JT8 A;  5GAH C;  2VS1 A;  2MFI A;  3UE1 A;  2QA4 A;  2KHJ A;  5LMU L;  3CMA A;  2UU9 L;  4A3E G;  1QUQ B;  1TWA H;  4BA1 I;  2ALY B;  2UXB Q;  4A3G G;  4MNO A;  5C0X G;  1VQ9 A;  1W2B A;  2F3I A;  1YIT A;  3S15 H;  4DK3 C;  1VQ7 A;  5FLX c;  2IX0 A;  3U50 C;  1VQE A;  4KHP Q;  2NZO A;  2NVQ H;  5ELO A;  3J81 c;  3S17 H;  2PNH A;  1VQJ A;  1Z9F A;  3W5O A;  4A3I H;  3GTK H;  4BBR H;  4LF9 L;  3PUV A;  4MZ9 A;  3HOU G;  2AHO B;  3PUX A;  3K81 C;  3PSI A;  3I4M G;  2RCN A;  3CP0 A;  1QZH A;  3G48 A;  4A3B G;  5C4X H;  4LF5 Q;  4NXM L;  3J7A 5;  3HKS A;  1TWC H;  2N78 A;  4HJ7 A;  1BVS A;  1WYD A;  3FKI G;  4DV6 Q;  1N36 Q;  3U4Z A;  1VQ8 A;  1OXS C;  2NVY H;  4LUV A;  4R4I A;  4AIM A;  4HJ9 A;  3S1N H;  3S1Q H;  4DV3 L;  1IBL L;  3F2C A;  3KOJ A;  3RR5 A;  4LF6 L;  5M3F H;  4POF A;  1XNR L;  2A19 A;  5H1S E;  3CCE A;  1L1O C;  1GKH A;  1L2F A;  1YEZ A;  2D0O A;  2MQH A;  2N8N A;  5FLM H;  1X9N A;  1E7Z A;  1PH9 A;  1Q12 A;  1UE5 A;  4B3M L;  4LFB Q;  4IFD I;  1Q86 C;  5LMN L;  1GD7 A;  4JOI C;  1HR0 W;  3A5Z B;  2MNA A;  3M4Q A;  4IOC A;  2C35 B;  2VL6 A;  3G6E A;  4TVA B;  1EFW A;  4WJ3 M;  1OXX K;  1NE3 A;  2BA1 A;  4DV7 Q;  3PGZ A;  4LUO A;  4YWL A;  1AE3 A;  4R4Q A;  4DUZ Q;  1E22 A;  2Y0S E;  4JG2 A;  4LF7 L;  5HGQ A;  1PH8 A;  4AYB G;  1MIU A;  4EQ5 A;  2R7Z G;  4JBK A;  2K5V A;  2GVA A;  2K75 A;  4MTN A;  5GRO A;  4C3J H;  2AWO A;  4JI3 L;  5FJ8 G;  3U58 A;  4IFD J;  4DR7 L;  4BY7 G;  3I2Z A;  1YNX A;  2ASB A;  4KHZ A;  5IYB H;  4A3F H;  4IPD A;  1E1O A;  2JA8 G;  1VQC A;  1HZ9 A;  2LSS A;  3NEL A;  3W1G A;  1YI2 A;  2NVT H;  2UUA L;  4YY3 L;  5IT9 c;  4X6A H;  3FHW A;  3CCR A;  4LW1 A;  1L0W A;  4GN5 A;  3M9B A;  2JA6 H;  3H3V I;  1CKO A;  1EUJ A;  2HIX A;  4C2M H;  1CSQ A;  1MJE A;  1CKN A;  2KCT A;  2WP8 J;  3ER0 A;  4B3T L;  4DR5 Q;  2PQA B;  4B3R Q;  4LF4 L;  4HIO A;  1VQ6 A;  4ALP A;  1N32 Q;  2UUC L;  2OQ0 A;  4JI4 L;  3PO3 G;  2R7Z H;  4HJ5 A;  4DR2 L;  4GNX A;  1Y1W G;  4DV2 L;  3BZC A;  1WFQ A;  1TWF H;  1G29 1;  1KIX A;  2KEN A;  4NB3 A;  4X62 L;  2D62 A;  1QVF A;  2JA8 H;  3PIP A;  1N33 L;  4OX9 Q;  2XTI A;  4O2D A;  3PUW A;  4R4C A;  3TS2 A;  2E5L L;  4L5T A;  1PH7 A;  4LF8 L;  1E24 A;  1VQK A;  2NZH A;  4GS3 A;  4BBS G;  4A3C G;  5C44 G;  1HNW L;  4HIK A;  1QUQ A;  2K14 A;  2RHS B;  4PG3 A;  3S14 H;  4DV1 L;  4LNQ A;  3K7A H;  3CC2 A;  5BR8 L;  3T1H L;  1G51 A;  5C0X I;  4GLX A;  3HKZ G;  4JI0 Q;  2ZJR A;  2UXC Q;  2JQO A;  1YVC A;  1KQS A;  2UUB Q;  4A3K H;  4DR6 Q;  1XMQ L;  1FGU A;  1PYB A;  2LXJ A;  3HOV G;  3RZO H;  1Y1V H;  4O0A A;  1XTD A;  3CCL A; 
#chains in the Genus database with same CATH topology
 1BCP C;  3L9A X;  1F9R A;  1SYF A;  1X32 A;  2OWO A;  3URY A;  3E9H A;  2B63 B;  2F4V Q;  2NN6 H;  1XMO L;  1L0X B;  2F52 A;  1PFN A;  1SMX A;  2F0T A;  2DNE A;  2CW0 C;  5EAY A;  3M4O H;  4JV5 L;  3MEF A;  2I5M X;  1BOS A;  1EWC A;  1LTA D;  2MO1 A;  4A3I G;  2CQA A;  2OXP A;  4R4O A;  4BBR G;  1XNQ L;  4YCV A;  1HQM C;  1X56 A;  1HTP A;  2YTY A;  1K0S A;  5IP7 H;  3HOU B;  4DPG A;  3OHX C;  1I6V C;  4DAP A;  4TQU S;  3EQL C;  3ITP A;  4I7A A;  4WRD A;  3G4S A;  1H9M A;  4QL5 A;  1Q82 C;  1SJE D;  3AYH B;  4X65 L;  5M3F G;  2AWN A;  4JYA Q;  5IYD H;  2JA9 A;  3L0O A;  2L12 A;  3D31 A;  1CFM A;  1YHB A;  1BUV T;  4KKU A;  2NYZ D;  3GTJ H;  2UU9 Q;  4NPS A;  3CCV A;  2VQE L;  1TWG H;  2SNM A;  1A6X A;  4RMF A;  3T1Y L;  5ELN A;  2EXD A;  3MXN B;  1IL8 A;  3I72 A;  4A76 A;  3L3O C;  2QIL A;  3JAM L;  1IW7 C;  1VQF A;  3PUY A;  3CU7 A;  3I4N H;  1D7Q A;  3TP8 A;  1S5B D;  1U5K A;  4AYB B;  3GTL H;  2R7Z B;  5IYB G;  4A3F G;  1EIF A;  4NXM Q;  1SNC A;  1FYC A;  2NVX H;  2D9U A;  2B2W C;  5K5P A;  2F0S A;  2JA6 G;  1VQ5 A;  4OWW B;  5J1Z A;  4C3H H;  1NJI C;  5IGB A;  4OGQ C;  3ERQ A;  3T13 A;  5ELB A;  1KTK A;  3CCM A;  5L37 A;  2AQ3 B;  2EY2 A;  3PO2 H;  4WJ4 A;  4P72 A;  4UP9 A;  2NZ1 D;  1MI2 A;  3NEN A;  1C9O A;  1OXV A;  3K8A A;  4B3S L;  2L5T A;  4QMG A;  4JVZ A;  2CKZ B;  4G7H C;  4XIG S;  1Y8N B;  1EYD A;  2AKW B;  3EVQ A;  5DM7 3;  1IYU A;  1VQI A;  2RCF A;  1V43 A;  1G91 A;  4JI3 Q;  1HNZ L;  3MTS A;  2I07 B;  4DR7 Q;  1RTN A;  1A8V A;  4TSS A;  2XSC A;  3MFG A;  4HMJ A;  2WIN B;  1DD2 A;  1SE3 A;  4YY3 Q;  1LT3 D;  1H9J A;  1Y1V G;  1UE1 A;  3LWU A;  1HFG A;  4Y52 H;  3VYS A;  3S16 B;  1LAB A;  1I94 L;  4L5Q A;  4JC0 A;  3TBI B;  1ILP A;  4JI4 Q;  1X6O A;  1N9W A;  1PRT B;  1XPU A;  4K8J A;  1CHP D;  1U0L A;  4TKO B;  4JI7 L;  4J15 A;  1BCP F;  1I4R A;  2HQE A;  1G6P A;  1GUS A;  1IBK L;  4X64 Q;  1WTW A;  3NWS A;  2K7V A;  4P74 A;  4HTH A;  2E5L Q;  1ZYR C;  3I4O A;  3RLN A;  4XQJ A;  3C3L A;  3BVZ A;  4C3I G;  4MHE A;  2ZJP A;  1NMG A;  1I6H H;  3E0J A;  1NR4 A;  3OIQ A;  3T1H Q;  1KXL A;  4DV5 L;  1BQQ T;  1K0R A;  1C4Q A;  4QY7 A;  4ABN A;  3CPW A;  1UUP A;  3CF5 A;  2KEE A;  4DV0 L;  2JJQ A;  1PZI D;  2L1B A;  3NEM A;  3WDN A;  3CCU A;  2SEB D;  4L6T B;  1F77 A;  1DCZ A;  1PTO H;  4Q5V A;  1AFP A;  1VQM A;  2EDG A;  2F0H A;  3GTP B;  2R92 B;  1KL9 A;  3F2U A;  1S40 A;  2LXK A;  1B3A A;  3L2P A;  1C7Y A;  1I4P A;  2Q2U A;  1J8I A;  2WB1 G;  4N8F A;  2KED A;  4PZ8 A;  1ENC A;  1B7Y B;  2EIF A;  3Q0A A;  5EBC A;  3GTM H;  2K5D A;  3MHB A;  4RG1 A;  3C1F A;  4KKS A;  1II3 A;  1EIY B;  2K5N A;  3ZJY C;  4LAA A;  1QVG A;  2H5X A;  2RHQ B;  3A74 A;  5M9O A;  5C3E B;  1T5E A;  1TII D;  2ES2 A;  3S9W A;  2XNA C;  4DV6 L;  5JJK A;  1Y69 U;  2M2L A;  2HHH L;  1OXT A;  3AFQ A;  2B63 H;  2HCI A;  1KD1 C;  3PF4 A;  1CUK A;  1S72 A;  3KF6 B;  2NB0 A;  2PW5 A;  1DOK A;  1GXD C;  3HG9 A;  3SE0 A;  3T56 B;  5C3X A;  4DR1 Q;  1O78 A;  3TS0 A;  1PYS B;  4B3M Q;  1GVP A;  3VR4 A;  2N3S A;  1Q3L A;  1L1O B;  2VZA A;  2CQO A;  5JJL A;  4HED A;  1WCM G;  1EQQ A;  1SLJ A;  5KNB A;  3GD7 A;  2K4K A;  1PV4 A;  3AU7 A;  2CHB D;  4RWS C;  1WTV A;  1PHJ A;  5JAV A;  1QIL A;  3HOU H;  1STH A;  5M3M G;  3C46 A;  2A73 B;  1JWU D;  4G57 A;  4K14 A;  1R4Q B;  2JA5 G;  4FXK C;  1TWH B;  1YNJ C;  3ERO A;  2EYF A;  2PI2 A;  4APV A;  5IGE A;  1CKM A;  1BBX C;  3HOY G;  4GKJ Q;  3I55 A;  4IUV A;  3KK7 A;  3RN5 A;  1I4X A;  1ZEQ X;  1EL0 A;  1N32 L;  3J81 j;  3HKZ E;  3K0Y A;  2K05 A;  3NTH A;  2MJ8 A;  2R6G A;  4H44 C;  4QCL A;  5C4J H;  2X69 A;  4LF4 Q;  2A6E C;  4DU9 A;  4POG A;  2F0O A;  1Q90 A;  5T1I A;  4N9T A;  4DF7 A;  3NBH B;  4OX9 L;  1EY5 A;  1WI5 A;  3PIO A;  4R8N A;  2BDN A;  1JMC A;  5COY A;  2AMC B;  4KLK A;  1JB7 A;  3HOY H;  3A55 A;  2L15 A;  2R61 A;  3H09 A;  4HIM A;  1SFO B;  4DK0 A;  2PPB C;  4ZQ3 A;  4FF1 A;  3LGJ A;  4GN4 B;  4DR3 Q;  1S5D D;  2N49 A;  5HUR A;  2B2V A;  3NP8 A;  2Z6K C;  5I9O A;  1DJR D;  4C1N I;  4X66 Q;  1N34 Q;  1PFB A;  2F4V L;  1PTO D;  3NXW A;  2PZT A;  1W3S A;  3QG1 A;  2EPB A;  4CJ0 B;  3KBX A;  2KOL A;  4DNI A;  4PMB A;  1HTL D;  1BCP B;  2QF7 A;  4I7Z C;  5KND A;  1RTO A;  5M5W H;  4A3C H;  3JAM i;  1S4Z A;  1FGB D;  2Z1C A;  5DM6 3;  4UHV A;  3FP9 A;  2JA7 G;  3S16 H;  3S1R H;  1HRJ A;  3HFZ B;  1LM0 A;  1IYV A;  1STN A;  4JYA L;  1L0Y B;  2R3Z A;  3EIV A;  4F7X A;  1XPR A;  3HOX B;  2MFI A;  3UE1 A;  2UU9 L;  3CMA A;  1B50 A;  4A3E G;  4XQQ A;  1QUQ B;  2BE5 D;  3Q22 A;  1VQ9 A;  1F2Y A;  2F3I A;  4J6H A;  1PLF A;  1VQ7 A;  5FLX c;  3QO2 A;  4O1N A;  5C4Z A;  2PNR C;  5D65 A;  3U50 C;  1VQE A;  4KHP Q;  2NVQ H;  2B8F A;  1CT1 D;  1X3Q A;  2QKI C;  3PUV A;  5K36 H;  3P75 A;  2RCN A;  4FNF A;  3IKJ A;  4X3K A;  1EQT A;  4NXM L;  4KV6 A;  3HKS A;  5D3D A;  1IKL A;  2XVS A;  1EY9 A;  3SHL A;  4KD4 A;  4LUV A;  4R4I A;  3S1N H;  4KY6 A;  4DV3 L;  3RR5 A;  1SDF A;  5DAU A;  4LF6 L;  2SDF A;  3Q24 A;  1X9N A;  2F0U A;  1Q12 A;  5JVH 3;  1EOT A;  2F3W A;  1GD7 A;  2R93 B;  3K5O A;  1HR0 W;  2MNA A;  1WTX A;  1JC7 A;  2VL6 A;  3G6E A;  1EFW A;  1A3U A;  1NE3 A;  4M8A A;  3PGZ A;  2AQ2 B;  3BYY B;  4J8Q A;  2FMC A;  5EBD A;  1TS3 A;  5BN3 A;  3HZX A;  5KYL A;  1MIU A;  2K5V A;  4MTN A;  5GRO A;  4KN7 C;  2B2T C;  5C5L A;  4JI3 L;  5FJ8 G;  4DR7 L;  1HQR D;  3I2Z A;  4H0L C;  2JA8 G;  4IPD A;  1Y1W B;  1HZ9 A;  3W1G A;  3CHB D;  3D4D A;  4YY3 L;  5IT9 c;  1WTH A;  1UAP A;  2KVM A;  4CDD C;  1RCV D;  1D5M C;  2KHS A;  4GN5 A;  3M9B A;  4CBV A;  5KIX A;  2K6A A;  1EUJ A;  2HIX A;  5BN5 A;  1HXY D;  3GTG B;  2OQ0 A;  4JI4 L;  3PO3 G;  4DR2 L;  3BZC A;  1WFQ A;  1G29 1;  1OO9 B;  2KEN A;  1KIX A;  2Q8T A;  2JA8 H;  3MC0 B;  1PZK D;  3PUW A;  2E5L L;  1PH7 A;  2EY1 A;  1EEF D;  5ELD A;  3K5L A;  5C44 G;  2PO4 A;  4PG3 A;  2EZV A;  3T1H L;  3HKZ G;  2JQO A;  4ZKB B;  1YVC A;  4F8M A;  5CGK A;  3RZO H;  1SNP A;  5KNC A;  3NQT A;  1G2T A;  4A3I B;  4N8X 1;  1QB5 D;  3GTK B;  4BBR B;  1VQD A;  3NE5 B;  3R3O A;  2ZM6 Q;  5EPL A;  5HGT A;  4H7B A;  2F3V A;  2O2L D;  1MHW C;  4DV0 Q;  5C44 H;  1S5F D;  1TS5 A;  1PRT D;  1Q81 C;  1YNN D;  4A3G B;  4GNX C;  4KJO A;  4JK1 C;  1STY A;  1FL0 A;  2E75 C;  5J22 A;  4OO1 H;  1UE7 A;  2ZXO A;  1YHA A;  3I91 A;  3MXU A;  2MHV A;  2I5H A;  1ENA A;  3NUC A;  3I4M B;  4DKA C;  1MGS A;  4A3B B;  1A15 A;  5IE8 A;  5CV6 A;  3FKI B;  4B9X A;  4IQZ A;  1SFO H;  2KHI A;  1SND A;  5FLM G;  4RGT A;  3DXJ C;  4C3J B;  3F2D A;  5LL6 S;  4GZY C;  2NVT B;  4RFB A;  3D3R A;  3MEH A;  3UDI A;  1BBW A;  1MSG A;  2F0L A;  5FO7 B;  2EYL A;  3A7A B;  1HH2 P;  4LF9 Q;  3M7G A;  3ICE A;  3P20 A;  2HHH Q;  5EKI A;  1O7Z A;  1A3V A;  3OMC A;  4DR1 L;  2CH4 W;  3W3A A;  3VYR A;  1HPC A;  2X6G A;  1JOK A;  2VXW A;  4DAY B;  2HT1 A;  1Q8I A;  1PDQ A;  5EJW A;  2ZTC A;  3M85 A;  3H15 A;  2F0V A;  2TSS A;  2EVB A;  3PIO 3;  5LMN Q;  2QDB A;  2PQE A;  1AE2 A;  1MKH A;  1KRS A;  2D5D A;  2J7Z A;  3HOX H;  2DUD A;  2N55 A;  4YIJ A;  3FPP A;  4RHS A;  2GVB A;  4GKJ L;  2E2I H;  1VQH A;  2G5D A;  3WOE A;  4DGZ A;  3ULL A;  3KF8 B;  3A5U A;  1BF4 A;  4IZ8 A;  3BVG A;  5GAD C;  3TP5 A;  1K3R A;  4BBS B;  3I70 A;  2FFK B;  5FLX L;  4XT3 B;  4PZ7 A;  2UUA Q;  1SNQ A;  2IWH A;  3SR1 A;  5E3F A;  3R8B A;  4A3K G;  1AW7 A;  5EKK A;  4OWX B;  2FMM A;  1GM5 A;  3CXC A;  4PMW A;  1KRT A;  2UUC Q;  4CKC A;  2NN6 G;  3K7U C;  1LTG D;  2CFM A;  2F0Q A;  1ZXT A;  3KLS A;  3BDL A;  3MA2 B;  3DHQ A;  4DV2 Q;  4EX5 A;  3EBE A;  1HJP A;  4DR3 L;  3SEB A;  2KCN A;  4ME5 A;  4X62 Q;  1SAP A;  1EQV A;  2RDF A;  3S15 B;  4IFD G;  1LTL A;  2R93 H;  2QEJ C;  1TU2 B;  4X66 L;  3S24 A;  1N34 L;  3BU2 A;  3S17 B;  3PUZ A;  4BY1 B;  5IP7 G;  1DZ1 A;  2I46 A;  3P1H A;  4DV1 Q;  2QCP X;  2MUY A;  4KN4 C;  4RCO A;  1Q1B A;  4QIW B;  1LT6 D;  1CQF A;  1K28 A;  2E2D C;  2MO0 A;  5C4X B;  3NPP A;  3QJY A;  3OPO A;  2F0J A;  5IYD G;  2ENB A;  3S1Q B;  2K28 A;  4IFD H;  3HOW B;  3KJO A;  1Y8O B;  2Q2I A;  3MFY A;  4BA2 I;  1VMC A;  1MBY A;  2WB1 B;  3PF5 A;  5IT9 L;  1H9S B;  1TS4 A;  2IL8 A;  3GTG H;  5IYC G;  5CBE E;  3H0G G;  3TDQ A;  1PH2 A;  3VDY A;  4KMU C;  2Z4I A;  5GQO A;  3MWY W;  2ATW A;  1V1Q A;  3Q8D A;  4YHH Q;  3EA6 A;  3PCO B;  3HP3 A;  4KTA A;  3AEV A;  3I4N G;  1STB A;  1Q1E A;  4IPC A;  5CMD A;  4A3J G;  2BCO A;  2EJM A;  4HMI A;  4DR4 L;  4KHP L;  4NKL A;  3H3V H;  1AN8 A;  1CTM A;  4NMZ A;  1EYA A;  4JI5 L;  4C3H G;  1BXT A;  5IYC H;  1HZB A;  4L5R C;  3H0G H;  1B53 A;  4LFA Q;  3PO2 G;  3HRZ C;  5M5Y B;  1FVI A;  4S3S A;  3DLL A;  1S3O A;  3A8J E;  4AYB E;  3KDF B;  4A3J H;  1EIH A;  2JN4 A;  4XYO A;  5IWA L;  2LKV A;  2GA4 B;  1I50 B;  1YJN A;  2NBF A;  4DV3 Q;  5J39 A;  1JJ2 A;  4LF6 Q;  5EGT A;  4HSP A;  1A3T A;  4UP8 A;  2XWB B;  1HZA A;  1IYJ B;  5C0X H;  4A3G H;  1MJC A;  2MGS A;  1JR0 D;  4K5V A;  3UDG A;  2TMP A;  1Z47 A;  1CQV A;  4JBJ A;  3E3X A;  1UEA B;  5IOC A;  4RHR A;  2IX1 A;  3U9S A;  5A2Q E;  3I4M H;  1JJC B;  2JEA I;  3PQI A;  1V9P A;  2ICI A;  4A3B H;  3BDC A;  4DAM A;  3CME A;  3S2H H;  1CHQ D;  1KDC A;  3FKI H;  4FF3 A;  2Y0S B;  5IGD A;  3FPU B;  2RDG A;  2CWP A;  3MXP A;  4JI6 Q;  1J6Q A;  1LYL A;  1MSH A;  2UXD Q;  1CK1 A;  3UDX A;  1VF7 A;  1PH4 A;  1NUC A;  2VW9 A;  4K0K L;  4M1U B;  3CQZ B;  3HOZ G;  4QB4 A;  3F1Z A;  2FIN B;  4MTK A;  1GUW A;  1SN8 A;  1X54 A;  4DR2 Q;  3WWV A;  1I3Q H;  1TVX A;  4XTC S;  2VUM G;  2IPK D;  4KY5 A;  3OW2 A;  2K03 A;  4IUQ A;  1S5C D;  4C56 C;  1HNX L;  3RLO A;  3HEJ A;  4GOP A;  2DGY A;  1SE2 A;  1YZ6 A;  3HOZ H;  1DYQ A;  4K5W A;  2RVL A;  3NTK A;  1EIG A;  3I7F A;  1TY2 A;  1IXR A;  3OIP A;  1WJJ A;  1KLU D;  3TP6 A;  2ZM6 L;  2ID0 A;  4CDE C;  2VUM H;  5C5M A;  1J5E Q;  3UDF A;  5JEA G;  2RA4 A;  3D6C A;  2HUG A;  4A93 B;  3S1M B;  1O80 A;  5CV7 A;  1YHQ A;  3GV6 A;  3J81 E;  2WAC A;  3D4R A;  4OON A;  5JJZ A;  3RNU A;  3J7Z C;  1X3P A;  2EE1 A;  3KF6 A;  2J0T D;  1F2M A;  4UPA A;  3GO5 A;  3K80 C;  2A8V A;  4BS9 A;  2OTL A;  1O7L A;  2YTX A;  4GNX B;  5JEA H;  2LY7 A;  1H95 A;  4EQO A;  3OMG A;  4PQX A;  3BZK A;  2VQF Q;  3Q6S A;  2B63 G;  2OTJ A;  4TRD A;  1E0B A;  2VS1 A;  1SJH D;  5A35 A;  2RKS A;  1R9T B;  4BA1 I;  4ID6 A;  2F03 A;  2OF1 A;  1W2B A;  3S15 H;  5F2D A;  3H6M A;  4KKT A;  2G9D A;  3K57 A;  2NZO A;  5ELO A;  3S17 H;  1Z9F A;  3V05 A;  3W5O A;  4LF9 L;  3HOU G;  4MZ9 A;  3PUX A;  1KNE A;  4XXE A;  4A3M B;  1CZG A;  1VMP A;  5DEH A;  5C4X H;  4XYQ A;  2PW7 A;  4LF5 Q;  3J7A 5;  5I4D A;  2N78 A;  4A3D B;  2A68 D;  1WYD A;  1V1P B;  4F88 A;  3U4Z A;  3A56 A;  3NBH A;  1RF2 D;  4HJ9 A;  3S1Q H;  2YU9 B;  1TR5 A;  4FVM A;  2C5C A;  3F2C A;  4Q0F A;  5IIF A;  1L2F A;  4U68 A;  4OIJ A;  1DM0 B;  2CH4 A;  2Q8R E;  3NBI A;  5LMN L;  3M4Q A;  3OWE B;  5FK9 C;  4WJ3 M;  1KNA A;  1RKN A;  4DV7 Q;  1SSO A;  2H1E A;  4LUO A;  1AE3 A;  4R4Q A;  3MAQ A;  3ND8 A;  4RKB A;  2G9H D;  4RGM A;  2F0G A;  3N6R A;  5HGQ A;  4N9P A;  4QF4 A;  4AYB G;  1PH8 A;  2R7Z G;  5CC4 A;  2AWO A;  3GTO B;  1J9O A;  2SNS A;  2B2U A;  3GV3 A;  2F0M A;  1JWM D;  1VDZ A;  1E1O A;  3NEL A;  1YI2 A;  2K04 A;  2KEC A;  2N88 A;  2UUA L;  4X6A H;  3C2P A;  2F0F A;  4LW1 A;  3T4A C;  2KUM A;  1M4V A;  2WP8 J;  4DR5 Q;  1PTO C;  3J80 E;  1JQY D;  4HIO A;  4ALP A;  1VQ6 A;  2IX3 A;  2UUC L;  1EFI D;  2R7Z H;  3KUP A;  1K83 B;  4DV2 L;  5LL6 X;  3SXH A;  4V19 0;  1JB3 A;  4F87 A;  4X62 L;  1LTB D;  2D62 A;  2J4X A;  1H9R A;  4ZRZ A;  4L5T A;  4LF8 L;  3RZD B;  4IN3 A;  1SNM A;  4GS3 A;  4A3C G;  1QUQ A;  2K14 A;  2RHS B;  3BZD B;  5ISR A;  4DV1 L;  1ENF A;  4GLX A;  3A8I E;  2PZW A;  4JI0 Q;  2UXC Q;  2WAQ B;  1D5Z C;  2K01 A;  4DR6 Q;  4ULL A;  4O0A A;  3U9O A;  1XTD A;  3RMH A;  1SE8 A;  1U4L A;  1XWE A;  2PMZ B;  1X65 A;  2PMZ E;  2E2H B;  2BE5 C;  3HGB A;  3I3C A;  2A6E D;  2KCM A;  4OL7 A;  2A69 D;  3S2D B;  4IUP A;  1TWC B;  2B29 A;  1QZG A;  1HFN A;  4NDX A;  2NVY B;  2WFW A;  5KEE A;  1BO0 A;  1WOC A;  1B70 B;  4WOR A;  3CQZ H;  4JOI A;  3WOF A;  4YHH L;  4IJH A;  2Q8I B;  1OTC A;  2BH2 A;  5K36 G;  2OT2 A;  1EY6 A;  2B8G A;  1IHZ A;  2Z8L A;  1AEX A;  2GN5 A;  2CWA A;  5AFW A;  1PH3 A;  5CBA E;  2Z9H A;  4LFC Q;  2P5Z X;  1QJO A;  2MP1 A;  4DR4 Q;  4QGU A;  3AFP A;  1IBM Q;  4B08 A;  2ZT9 C;  2F0E A;  4LFA L;  2I5L X;  4JI5 Q;  1JCK B;  1SYD A;  3SGI A;  3KYH C;  4A4I A;  2A1A A;  2E8G A;  3AMU A;  1GHK A;  3NTI A;  5D3I B;  3CC4 A;  4BXX H;  1STA A;  4X3U A;  2R92 G;  1C0A A;  4DXF A;  1ESR A;  3CRK C;  2IJ0 A;  1RHP A;  4PZ6 A;  5IWA Q;  4A93 H;  1KDB A;  1EY4 A;  3S1M H;  1B9M A;  3ULP A;  1U4M A;  5E4W C;  4FP5 D;  1WTQ A;  1UEB A;  4BY7 B;  2HDM A;  1TKW B;  2KQ3 A;  3GTP H;  2QDL A;  2R7D A;  2R92 H;  1AZQ A;  4QJF A;  1NBW A;  5ELC A;  2ZXR A;  2A6H D;  3K58 A;  4DK6 C;  2IT1 A;  1LLR D;  4OXP A;  1LT4 D;  2DNC A;  1X3G A;  1VQG A;  1EZ8 A;  1EEI D;  3AQQ A;  4JI6 L;  1C8C A;  1EY8 A;  1R9T H;  1C48 A;  4JPB W;  2UXD L;  1FR3 A;  1GHJ A;  2K5H A;  4P75 A;  3CW2 C;  3R2T A;  5C3E H;  4G7O C;  3D0F A;  1GJX A;  1R4P B;  5ELF A;  1ONL A;  1ASZ A;  1PXU A;  3STB D;  1A62 A;  1PH5 A;  4K0K Q;  4QQB X;  4DA2 A;  1RD9 D;  4NW2 A;  3M4O B;  1STG A;  3J7Y W;  4B3T Q;  4A3D H;  3HOV B;  1D6E C;  2HCC A;  3A54 A;  3KLW A;  3FVQ A;  4ME3 A;  2EY5 A;  5FOB B;  4UP7 A;  2YU9 H;  1PRT C;  1OXU A;  1YNN C;  2JYO A;  1XPO A;  1HNX Q;  1W6J A;  1A2T A;  2JEB I;  2OQK A;  1JOO A;  2KJX A;  2AUJ D;  3FDT A;  4EQP A;  4I65 A;  1SR3 A;  1B4O A;  1VS0 A;  4OO1 G;  1QCB D;  1J5E L;  2V1C C;  3UI2 A;  3GTJ B;  3G7L A;  2JE6 I;  1HUN A;  1D8L A;  3CRL C;  5IP9 H;  2EYH A;  3U4V A;  5BR8 Q;  4LFB L;  1TWH H;  3DM1 A;  1Y14 B;  2HIV A;  5IY0 A;  2DJG C;  3GTO H;  3OSO A;  3DWP A;  1PH6 A;  4OHJ A;  1BBU A;  3A0J A;  3W2D A;  3M7N A;  1BR9 A;  1V1O A;  5FLX E;  3EJI A;  1WD0 A;  5M3F B;  1WVL A;  1SMY D;  4CDC C;  4DV4 Q;  4LMQ D;  2K50 A;  3B6Y A;  4MN3 A;  2VQF L;  1IZ6 A;  2K32 A;  3DWQ A;  2NWG A;  1P8L A;  1K83 H;  2K5Q A;  4IAL A;  4XQN A;  1E2Z A;  3PV0 A;  3W1B A;  2F0K A;  1ESF A;  4GOP C;  2EYP A;  1P16 A;  4A75 A;  3RZD H;  4A3F B;  5I2Y A;  5I6Y A;  2JXM B;  3TSS A;  3LNN A;  3TN2 A;  4V0B A;  5G3L D;  4CGY B;  3K0X A;  2JA6 B;  1GO3 E;  1SYE A;  2PQA A;  4R4T A;  5GAE C;  4LF5 L;  5JPM C;  4IUT A;  4H02 A;  2D2C C;  1SBB B;  2R7F A;  3ONA B;  5NUC A;  4DFA A;  3HOX G;  1G6Z A;  1F2Z A;  2L0C A;  1PH1 A;  2OEO A;  5IOD A;  3SVM A;  3CCJ A;  2E2H H;  1CZW A;  1E2W A;  3E9I A;  1GUN A;  5EPK A;  3S2D H;  1YIJ A;  4J1M A;  3QOJ A;  5IT9 E;  3CKI B;  2K52 A;  1PZJ D;  3GDE A;  2NN6 I;  4K8I A;  1N8R C;  3VR6 A;  5GAG C;  3I56 A;  3K6O A;  2CVR A;  4DV7 L;  3J81 i;  1BNZ A;  4KI0 A;  2RDH A;  3K7A B;  1B8A A;  2YTV A;  1UWV A;  2WII B;  1ROD A;  2BOS A;  1XXG A;  4JI1 Q;  4EQN A;  4OEL B;  4IOA A;  1Y1V B;  3BVM A;  5E4X A;  2FHT A;  4K5X A;  1RIP A;  2Z6K A;  3KLS X;  3GQB A;  1I6H B;  1HHV A;  1VQ4 A;  1RJT A;  4GLV B;  3I90 A;  4YCW A;  1HR0 Q;  1A63 A;  5LHY 1;  3JC6 6;  4R8I A;  1HUM A;  2R93 G;  5AJ3 Q;  5JJI A;  3JAM E;  4DR5 L;  2ZTD A;  1PRT F;  3KBG A;  3E0E A;  3BS1 A;  4Y7N B;  1QOH A;  4DUY Q;  3UE0 A;  1YJ9 A;  2A74 C;  2EYM A;  3D8G A;  4H13 C;  1H9S A;  4AQY Q;  1E1T A;  4C3I B;  4K6D A;  2I0Q A;  1DON A;  5CYU A;  4L8J A;  4ZKC B;  1K73 C;  1EYG A;  1Y8P B;  1CA6 A;  1ICF B;  1ET9 A;  4LF8 Q;  1T9H A;  4BY7 H;  3R2I A;  1X3F A;  4JI0 L;  1PFM A;  2UXC L;  1EY7 A;  3C1E A;  2NTT A;  4DR6 L;  1GOZ A;  2AUK A;  5C3W A;  4JI8 L;  2ZXP A;  4B9W A;  3V96 A;  3GTM B;  3KLR A;  4QIW E;  3DMU A;  3MXN A;  4O42 A;  2IW3 A;  5FKA C;  2F0I A;  3VYU A;  1Y1W H;  2B2U C;  2IY5 B;  3KDF A;  3IRB A;  3QIA A;  3OTO Q;  3FMC A;  1AZP A;  2WB1 E;  1NR2 A;  1A0I A;  1CKN B;  3OYY A;  1QWY A;  1ASY A;  4BWG B;  1PVO A;  1DOL A;  5JVG 3;  3VA7 A;  4LFC L;  3HOV H;  4HCS A;  3DM3 A;  4C1N K;  4YWM A;  4KY7 A;  1BKB A;  1KDA A;  3J80 i;  1NCV A;  4HJ8 A;  1LT5 D;  1IBM L;  5M5X B;  1FJG L;  4K6L A;  5GAH C;  1BCP D;  1LO5 D;  2KHJ A;  2B2V C;  2KCC A;  3I73 A;  5FO8 B;  3M3Y B;  2UXB Q;  4A3G G;  5C0X G;  5CV4 A;  3VR5 A;  1YIT A;  4DK3 C;  2F0P A;  2B2T A;  2L11 A;  4EVO A;  4JW0 A;  3J81 c;  2CW0 D;  2F0N A;  3OWF A;  4CDF C;  4DN4 M;  2EYO A;  4A3I H;  3GTK H;  4BBR H;  2E2J B;  1WCM B;  3PSI A;  3K81 C;  3I4M G;  1QZH A;  4A3B G;  5JPN C;  5C4J B;  1KAA A;  3FKI G;  1F9S A;  1GUO A;  2WV6 D;  2Z6B A;  1OXS C;  5M3M B;  4AIM A;  3N52 A;  1QNK A;  2B2Y A;  4KJN A;  4C3J G;  5M3F H;  4POF A;  3LWE A;  2JA5 B;  4WJW A;  1GKH A;  2N8N A;  2MQH A;  1PH9 A;  1E7Z A;  2WKD A;  1UE5 A;  3HOY B;  1Q86 C;  3K5M A;  3PMF A;  4JOI C;  4LK1 C;  4IOC A;  3V2T A;  1OXX K;  1SYG A;  2O4X A;  2BA1 A;  4OIK A;  1D1I A;  4FXG C;  1JWS D;  1W6K A;  4DUZ Q;  4X3T A;  2Y0S E;  3GTQ B;  4EQ5 A;  2K75 A;  1D1K A;  4C3J H;  2F0W A;  4UAI A;  4IFD J;  1IW7 D;  1A2U A;  1YNX A;  4KHZ A;  5IYB H;  4A3F H;  3BYT B;  2NVT H;  4RGO S;  3FHW A;  4ILW A;  4KK7 A;  2JA6 H;  1CKO A;  3BG3 A;  2DN8 A;  1MJE A;  1CSQ A;  4B3T L;  2F4I A;  4RKL A;  1B44 D;  4B3R Q;  4CKB A;  5M5W B;  2AQ1 B;  4HJ5 A;  4GNX A;  2B39 A;  2M9V A;  1LTS D;  3PIP A;  1N33 L;  3S1R B;  2XTI A;  4O2D A;  4E6I A;  4R4C A;  3X3N A;  1SYC A;  4PV1 C;  1E24 A;  1VQK A;  4BBS G;  5I9P A;  4G7Z C;  3AB9 A;  4HIK A;  3DUZ A;  3NHH A;  2HD3 A;  3H3V C;  4LNQ A;  3K7A H;  5BR8 L;  1G51 A;  1WTR A;  4X3S A;  4MIU A;  1KQS A;  5I2X A;  1Y1V H;  1I4H A;  2NVQ B;  2XRS D;  3CD6 A;  2JA7 B;  4NXN L;  2YYZ A;  4XT1 B;  3J80 c;  4JI2 L;  4U67 3;  1KC8 C;  4UDU C;  1G8Z D;  2EJF C;  4HJA A;  5DNF A;  2Q2T A;  4PMC A;  1V1P A;  4JBM A;  3TRZ A;  4BBS H;  5C0X J;  1MD2 D;  4G4K A;  4ZK9 B;  4P73 A;  4DV4 L;  4A3E B;  1LTT D;  1NNX A;  2K5W A;  3S1N B;  1L1O A;  1VQB A;  2A5H A;  2PYK A;  4BY1 G;  1EU3 A;  1HCZ A;  4Y7N H;  3CAM A;  4HR7 B;  1ZYR D;  4HAE A;  4C3I H;  5C4X G;  2B3G A;  2A68 C;  3TRE A;  1KHI A;  4GKK Q;  3G71 A;  3SK8 A;  3CPF A;  1DOM A;  2L9H A;  3SK5 A;  2EYJ A;  5JOB A;  2RQX A;  4A3L G;  1QE6 A;  2O5I C;  3BJU A;  1VCI A;  1FD7 D;  1Q46 A;  3HOW G;  1LAC A;  1EZ6 A;  4ZYS A;  1AH9 A;  1I5F A;  4BY1 H;  4GOP B;  1VQN A;  4IUN A;  5A2Q L;  5LMU Q;  5KRU A;  1B2T A;  3ND9 A;  3RD4 A;  4XDX A;  2RF4 A;  1EU4 A;  1ET6 A;  1TQO A;  2YV5 A;  1D5X C;  4A3L H;  1LUZ A;  3T53 B;  3HOW H;  5KGU A;  4RGN A;  1H9K A;  1CSP A;  3ERS X;  3VA5 A;  1EWH A;  4L63 B;  1N36 L;  2BH8 A;  4CJ2 C;  4FYD A;  3GP7 A;  2MPM A;  1JE4 A;  2K33 A;  3VR2 A;  2JA8 B;  1IBL Q;  4RH6 A;  5E1F A;  1XJV A;  1K9M C;  1KAW A;  4JI1 L;  3I4L A;  4YCU A;  3RLF A;  2XGT A;  2V4D A;  3TQY A;  3DEP A;  1XNR Q;  2WKC A;  3K5N A;  2JSO A;  3CCS A;  5DLQ E;  1PMR A;  3ZYY X;  4DNR B;  5CV5 A;  3RN2 A;  4FF4 A;  3IFD A;  4RCN A;  3PO3 B;  1HR0 L;  5M5X H;  2C9O A;  3RZO B;  4LJZ C;  1ZKO A;  2E76 C;  4OEM B;  5AJ3 L;  3F2B A;  4LF7 Q;  1NMF A;  1VQP A;  5I6W A;  3M3Y H;  3RUZ A;  1M90 C;  3IL8 A;  5IGC A;  4HID A;  4DUY L;  5M5Y H;  1DXM A;  1YJW A;  3J7A F;  3A7L A;  5C44 B;  4FDB A;  4K2K A;  4AQY L;  4IJL A;  3QB3 A;  5IGF A;  5JEA J;  1SRU A;  2X6L A;  1FNV A;  2E2J H;  1WCM H;  2VB2 X;  3HKZ B;  3J81 L;  1I50 H;  4K2L A;  3T51 B;  1JJG A;  2A69 C;  2QEX A;  4EGV A;  4ZAI A;  2Y0S G;  1K8O A;  5M3M H;  4GLA C;  3QR8 A;  1CA5 A;  4IUR A;  2JA5 H;  2QGQ A;  1TWA B;  3MXG A;  3L7Z C;  1YNJ D;  1PA6 A;  2WAQ E;  3J7A V;  3EFX D;  4DNT B;  4QUC A;  1EQR A;  4JI8 Q;  4QUF A;  2EQS A;  2LFN A;  1IL2 A;  1HNW Q;  1I4Q A;  2UUB L;  3DEO A;  3FRP B;  1X55 A;  3KFU A;  3VYT A;  4GN3 B;  3GTQ H;  2BA0 A;  3OTO L;  3SK4 A;  5E7N A;  1XMQ Q;  4NP5 A;  4ZLT F;  2PI2 E;  1SRO A;  1Z7T A;  2NTS A;  1WTP A;  3QWN A;  1B9N A;  1D2B A;  2B2W A;  1M1K C;  3M4P A;  1XMO Q;  1VQL A;  5D14 A;  3X3M A;  4BXX G;  4JBW A;  1ICW A;  1E3P A;  1S5E D;  2DY7 A;  4WFN 3;  1SXT A;  4JV5 Q;  1K8G A;  2ZJQ A;  5CV8 A;  1XNQ Q;  1RDP D;  4A93 G;  1O7Y A;  1TT2 A;  3DWA A;  3VR3 A;  1XX8 A;  3EN2 A;  5KYI A;  2UXB L;  1FJG Q;  4IO9 A;  3KJP A;  1WTO A;  4OWT B;  1O7I A;  1U9R A;  2NUC A;  4X65 Q;  3OW7 A;  2E2I B;  2A6H C;  5J3B A;  2O5J C;  4C2M B;  4HCE A;  3NSW A;  2VQE Q;  4FO2 A;  1Z6H A;  1DGS A;  2JA7 H;  3T1Y Q;  5LMN W;  1TWF B;  1F9Q A;  2HQL A;  3HS0 C;  5TSS A;  1SEB D;  2FXQ A;  1PYW D;  4LUZ A;  5C3E G;  2BDO A;  3J80 L;  4A3E H;  2DJF C;  1K3B C;  3CC7 A;  2RSO A;  4CHT B;  4LWC A;  3STB C;  2D0P A;  3IFT A;  4R9W A;  4FF2 A;  3S14 B;  1V8Q A;  2OCE A;  3I8Z A;  1RL2 A;  5FO9 B;  2JP1 A;  4DUZ L;  4A3M G;  2ZTE A;  3TZU A;  1PTO F;  4A3K B;  1VQA A;  1STE A;  4IUU A;  4L5S A;  4A3D G;  3F8T A;  1QVC A;  4DXG A;  3PIP 3;  4OO1 I;  1JOQ A;  1EWI A;  1NTG A;  1TXY A;  2LMC B;  4HSV A;  4B3S Q;  2VNU D;  4FXD A;  1LTI D;  5C4H A;  4DAV A;  1CM9 A;  3SK6 A;  4ODG A;  1AP0 A;  4B3R L;  1SE4 A;  4A3M H;  3D4W A;  2F0D A;  1HNZ Q;  4Z9C B;  4KD3 A;  3TME A;  5IP9 G;  2L55 A;  2RBM A;  4IPH A;  1JOR A;  1Q7Y C;  3MVV A;  2VY3 A;  4UY8 C;  1XYI A;  4KHV A;  1ILQ A;  1I4G A;  1GUT A;  2B2Y C;  3P7J A;  1VF5 C;  3QOL A;  1N33 Q;  1EOV A;  3LX0 A;  1I94 Q;  5FJ8 H;  1K8A C;  2XWJ B;  2Z0S A;  1SMY C;  2IHF A;  5C6A A;  4X64 L;  4JI7 Q;  1B1Z A;  5CV9 A;  1HZC A;  2JK8 A;  1SNO A;  1UE6 A;  4DK1 A;  1IBK Q;  1TWG B;  1PFS A;  3FEW X;  3CCQ A;  5EQ0 A;  2K1B A;  4P71 A;  2KBN A;  1NY4 A;  1Q8K A;  3NQI A;  1EYC A;  3JAM c;  3H0G B;  4ZUJ A;  2Q2H A;  2L4N A;  3PO3 H;  1YBY A;  4NXN Q;  1E2V A;  1CI3 M;  3TEH B;  3I4N B;  1VQO A;  3R93 A;  4DV5 Q;  4JI2 Q;  4AH6 A;  1K8M A;  3GTL B;  4A3J B;  4DAY A;  2NVX B;  3D6W A;  2XIW A;  1BDO A;  3H94 A;  1U4P A;  5HY6 A;  4C3H B;  2WAQ G;  1X3E A;  4GKK L;  5EKL A;  2IHE A;  1LV9 A;  3ULJ A;  4R1J A;  1JE5 A;  3PO2 B;  4JCV E;  4YWK A;  1QNU A;  4ZUI A;  2CCZ A;  2E74 C;  2PCF B;  4IPG A;  4P2C B;  4HN7 A;  1JT8 A;  2QW7 A;  1GUG A;  2QA4 A;  3KF8 A;  3IAY A;  5LMU L;  1FNW A;  1TWA H;  2ALY B;  4MNO A;  3S2H B;  1TS2 A;  2IX0 A;  3G6J B;  3E5S A;  1LTR D;  1HA6 A;  2PNH A;  1VQJ A;  2EOT A;  1F2L A;  2LS0 1;  1QG7 A;  4RAU C;  4ZCK A;  2AHO B;  3TP7 A;  3CP0 A;  3G48 A;  2XRQ D;  1T5X D;  5BN4 A;  1TWC H;  4HJ7 A;  1BVS A;  4DV6 Q;  4PNY A;  1N36 Q;  1VQ8 A;  2NVY H;  3M4Y A;  1IBL L;  3MZ5 A;  3OOC A;  1I3Q B;  1EY0 A;  3KOJ A;  1U4R A;  1XNR L;  2A19 A;  5H1S E;  3CCE A;  1L1O C;  2D0O A;  3SDZ A;  1YEZ A;  3NK9 A;  2XN9 C;  5FLM H;  5T1G A;  1B3Q A;  4B3M L;  4LFB Q;  2DY8 A;  4IFD I;  3A5Z B;  4CKE A;  2C35 B;  1KLG D;  4TVA B;  2RSN A;  3H91 A;  1XTC D;  4YWL A;  3E6Z X;  2KA7 A;  3HOZ B;  4CJ1 B;  2SOB A;  1E22 A;  4JG2 A;  4LF7 L;  3Q23 A;  4JBK A;  2GVA A;  5IGG A;  3U58 A;  1KAB A;  2VUM B;  1IKM A;  1SYB A;  2H4O A;  3A8K E;  1NSN S;  4BY7 G;  2ASB A;  3K59 A;  1VQC A;  2LSS A;  3CCR A;  1F9P A;  1L0W A;  3BDO A;  3H3V I;  4C2M H;  1CKN A;  1FNU A;  1PTO B;  2KCT A;  3ER0 A;  2PQA B;  4LF4 L;  2M00 A;  5ELE A;  1N32 Q;  5EPJ A;  2Z4H A;  3T16 A;  1WD1 A;  1Y1W G;  5COR A;  2F1M A;  2VB3 X;  1TWF H;  3TZD A;  1UNS A;  2ICE C;  1QVF A;  4NB3 A;  1G2S A;  4RA8 A;  2PZU A;  4OX9 Q;  2FJ2 A;  1HA5 A;  3O13 A;  3TS2 A;  2EY6 A;  2NZH A;  1HNW L;  1ML0 D;  3S14 H;  2HDL A;  1NAP A;  1M8A A;  3CC2 A;  2EXZ A;  3NWT A;  5C0X I;  5G3L F;  2EJG C;  5CR3 A;  2ZJR A;  2UUB Q;  4A3K H;  1JIC A;  1XMQ L;  1FGU A;  1PYB A;  2LXJ A;  3HOV G;  1TY0 A;  3CCL A; 
#chains in the Genus database with same CATH homology
 1SE8 A;  3CD6 A;  4NXN L;  1X65 A;  1VQD A;  2ZM6 Q;  2PMZ E;  2OWO A;  2YYZ A;  3E9H A;  3J80 c;  2F4V Q;  4JI2 L;  2KCM A;  1KC8 C;  4HJA A;  4JBM A;  4DV0 Q;  3TRZ A;  5C44 H;  2Q2T A;  4BBS H;  1XMO L;  5C0X J;  2F52 A;  2B29 A;  4P73 A;  4DV4 L;  1SMX A;  1QZG A;  1Q81 C;  2WFW A;  3M4O H;  5EAY A;  1L1O A;  1VQB A;  4JV5 L;  3MEF A;  4GNX C;  2I5M X;  1WOC A;  4BY1 G;  2MO1 A;  4Y7N H;  4A3I G;  4R4O A;  4BBR G;  1B70 B;  4YHH L;  3CQZ H;  3CAM A;  4JOI A;  1FL0 A;  4IJH A;  4YCV A;  1OTC A;  2BH2 A;  5K36 G;  1UE7 A;  1X56 A;  1YHA A;  4C3I H;  5C4X G;  2B3G A;  2YTY A;  3TRE A;  1KHI A;  5IP7 H;  4GKK Q;  3G71 A;  4DPG A;  3CPF A;  2GN5 A;  2I5H A;  4TQU S;  4DKA C;  2CWA A;  1PH3 A;  4A3L G;  3G4S A;  5IE8 A;  4QL5 A;  3BJU A;  1Q82 C;  1VCI A;  4LFC Q;  1Q46 A;  3HOW G;  3AYH B;  4X65 L;  5M3F G;  2AWN A;  4JYA Q;  1SFO H;  5IYD H;  4DR4 Q;  2JA9 A;  3L0O A;  2KHI A;  3AFP A;  4QGU A;  1IBM Q;  3D31 A;  1AH9 A;  5FLM G;  1I5F A;  1YHB A;  2I5L X;  4LFA L;  4JI5 Q;  4BY1 H;  4GOP B;  1VQN A;  3GTJ H;  3F2D A;  5LMU Q;  2UU9 Q;  4NPS A;  3SGI A;  3CCV A;  3KYH C;  4A4I A;  2VQE L;  2A1A A;  2E8G A;  2RF4 A;  1TWG H;  3CC4 A;  4BXX H;  4RMF A;  3T1Y L;  5ELN A;  2R92 G;  1C0A A;  3UDI A;  1BBW A;  2YV5 A;  2EXD A;  3MXN B;  4A3L H;  1LUZ A;  1HH2 P;  4LF9 Q;  4A76 A;  3ICE A;  2HHH Q;  3HOW H;  4PZ6 A;  5IWA Q;  3I4N H;  1CSP A;  1VQF A;  3ERS X;  3PUY A;  4A93 H;  3S1M H;  1D7Q A;  1N36 L;  1U5K A;  2BH8 A;  4DR1 L;  3GTL H;  3ULP A;  5IYB G;  4A3F G;  1EIF A;  4NXM Q;  2NVX H;  4DAY B;  2HT1 A;  1UEB A;  1IBL Q;  2JA6 G;  1VQ5 A;  1XJV A;  4OWW B;  1K9M C;  1KAW A;  4JI1 L;  4YCU A;  3RLF A;  3TQY A;  2XGT A;  4C3H H;  1NJI C;  2R7D A;  1XNR Q;  3GTP H;  2R92 H;  2ZTC A;  3M85 A;  4QJF A;  3H15 A;  1NBW A;  3CCM A;  3CCS A;  5DLQ E;  3PO2 H;  4WJ4 A;  4P72 A;  4UP9 A;  4DK6 C;  5LMN Q;  2IT1 A;  3NEN A;  1C9O A;  1OXV A;  3K8A A;  3RN2 A;  4B3S L;  1AE2 A;  4OXP A;  1MKH A;  1KRS A;  1VQG A;  1X3G A;  3HOX H;  2DUD A;  1HR0 L;  2CKZ B;  5M5X H;  3AQQ A;  4XIG S;  2GVB A;  4JI6 L;  2AKW B;  4GKJ L;  2E2I H;  1VQH A;  5AJ3 L;  3F2B A;  1R9T H;  1NMF A;  1VQP A;  4LF7 Q;  2UXD L;  3ULL A;  1M90 C;  3KF8 B;  3A5U A;  3M3Y H;  1VQI A;  2K5H A;  1V43 A;  4P75 A;  3CW2 C;  4JI3 Q;  1HNZ L;  5C3E H;  3D0F A;  5GAD C;  4DUY L;  4HID A;  5M5Y H;  1XNQ L;  4DR7 Q;  1YJW A;  1K3R A;  1A8V A;  4FDB A;  4AQY L;  4IJL A;  1ASZ A;  3STB D;  1PH5 A;  1A62 A;  4PZ7 A;  1SRU A;  5JEA J;  4YY3 Q;  4A3K G;  2E2J H;  2UUA Q;  4K0K Q;  1WCM H;  1Y1V G;  4OWX B;  1UE1 A;  1I50 H;  1GM5 A;  4Y52 H;  4B3T Q;  3CXC A;  4PMW A;  4A3D H;  1I94 L;  1JJG A;  4L5Q A;  1KRT A;  4JC0 A;  2QEX A;  2UUC Q;  2Y0S G;  3KLW A;  4ME3 A;  1X6O A;  4JI4 Q;  1N9W A;  2NN6 G;  3K7U C;  4GLA C;  5M3M H;  2CFM A;  1XPU A;  1U0L A;  4UP7 A;  2YU9 H;  4DV2 Q;  4JI7 L;  1OXU A;  1XPO A;  4EX5 A;  3EBE A;  1HJP A;  4J15 A;  4DR3 L;  1HNX Q;  2JA5 H;  2QGQ A;  1G6P A;  4X62 Q;  4X64 Q;  1IBK L;  2JEB I;  3L7Z C;  4IFD G;  2OQK A;  1PA6 A;  2WAQ E;  4P74 A;  1LTL A;  2R93 H;  2E5L Q;  1EQR A;  4JI8 Q;  3I4O A;  1SR3 A;  2EQS A;  1VS0 A;  4X66 L;  3RLN A;  3S24 A;  3BU2 A;  1N34 L;  1IL2 A;  1J5E L;  4OO1 G;  2V1C C;  1HNW Q;  3PUZ A;  5IP7 G;  2UUB L;  2JE6 I;  2ZJP A;  1D8L A;  1NMG A;  1I6H H;  4DV1 Q;  5IP9 H;  1X55 A;  3KFU A;  3U4V A;  5BR8 Q;  1Q1B A;  3T1H Q;  4LFB L;  1KXL A;  4DV5 L;  1K0R A;  1TWH H;  4GN3 B;  3GTQ H;  1Y14 B;  2BA0 A;  2MO0 A;  3OTO L;  4QY7 A;  2HIV A;  5IY0 A;  5E7N A;  1XMQ Q;  3CPW A;  3GTO H;  5IYD G;  1PH6 A;  2PI2 E;  1BBU A;  3A0J A;  3CF5 A;  3M7N A;  1SRO A;  4DV0 L;  3KJO A;  2JJQ A;  2Q2I A;  3NEM A;  4BA2 I;  3CCU A;  1M1K C;  3M4P A;  1XMO Q;  1VQL A;  3PF5 A;  4BXX G;  4DV4 Q;  4JBW A;  2K50 A;  1E3P A;  3B6Y A;  3GTG H;  5IYC G;  2VQF L;  1IZ6 A;  1VQM A;  3H0G G;  1PH2 A;  4JV5 Q;  3VDY A;  1K8G A;  5GQO A;  2ATW A;  1V1Q A;  2ZJQ A;  1P8L A;  1K83 H;  3Q8D A;  1XNQ Q;  1KL9 A;  4YHH Q;  3PCO B;  3AEV A;  3I4N G;  4A93 G;  1S40 A;  2LXK A;  1Q1E A;  3EN2 A;  4IPC A;  2UXB L;  1C7Y A;  3L2P A;  3PV0 A;  3W1B A;  4A3J G;  2Q2U A;  1FJG Q;  2WB1 G;  4PZ8 A;  4IO9 A;  3KJP A;  1B7Y B;  2EIF A;  4GOP C;  4DR4 L;  1P16 A;  3GTM H;  4A75 A;  3RZD H;  4KHP L;  4OWT B;  4RG1 A;  1O7I A;  3H3V H;  4QQB X;  4JI5 L;  1EIY B;  4X65 Q;  5IYC H;  1HZB A;  2K5N A;  5J3B A;  3H0G H;  3K0X A;  3ZJY C;  4L5R C;  1GO3 E;  4LFA Q;  2H5X A;  2PQA A;  2RHQ B;  4R4T A;  1QVG A;  3PO2 G;  3A74 A;  5GAE C;  4LF5 L;  2VQE Q;  4H02 A;  2ES2 A;  1FVI A;  1DGS A;  2R7F A;  4DV6 L;  3DLL A;  5JJK A;  1S3O A;  3HOX G;  4AYB E;  3KDF B;  4A3J H;  2JA7 H;  3T1Y Q;  1PH1 A;  2HHH L;  5IWA L;  5LMN W;  1OXT A;  3AFQ A;  3CCJ A;  2E2H H;  2HQL A;  2B63 H;  3E9I A;  1YJN A;  1KD1 C;  3PF4 A;  4DV3 Q;  3S2D H;  1CUK A;  1S72 A;  1YIJ A;  2FXQ A;  1JJ2 A;  3KF6 B;  4LUZ A;  4LF6 Q;  5C3E G;  2K52 A;  4A3E H;  3CC7 A;  3GDE A;  4UP8 A;  2NN6 I;  4DR1 Q;  1HZA A;  1IYJ B;  1N8R C;  4LWC A;  3STB C;  3TS0 A;  4A3G H;  1MJC A;  1PYS B;  2D0P A;  5GAG C;  3I56 A;  1GVP A;  4DV7 L;  4B3M Q;  3J81 i;  2N3S A;  2VZA A;  1L1O B;  2CQO A;  3UDG A;  4KI0 A;  2OCE A;  1B8A A;  1WCM G;  1EQQ A;  1SLJ A;  5JJL A;  1RL2 A;  2YTV A;  4DUZ L;  1UWV A;  3GD7 A;  1Z47 A;  2K4K A;  4JBJ A;  4A3M G;  1PV4 A;  4JI1 Q;  1PHJ A;  2ZTE A;  3HOU H;  2IX1 A;  1VQA A;  4A3D G;  4L5S A;  4IOA A;  3I4M H;  3F8T A;  1QVC A;  4OO1 I;  1JJC B;  2JEA I;  2Z6K A;  1EWI A;  1NTG A;  1RIP A;  1V9P A;  5M3M G;  4A3B H;  4DAM A;  1TXY A;  3CME A;  3S2H H;  1VQ4 A;  3FKI H;  4B3S Q;  2VNU D;  2JA5 G;  4GLV B;  4YCW A;  1HR0 Q;  1A63 A;  2PI2 A;  4APV A;  3JC6 6;  1CKM A;  3HOY G;  2CWP A;  4JI6 Q;  4GKJ Q;  2R93 G;  1J6Q A;  1LYL A;  5AJ3 Q;  3I55 A;  2UXD Q;  3RN5 A;  4DR5 L;  5JJI A;  2ZTD A;  4B3R L;  3UDX A;  1N32 L;  3J81 j;  3E0E A;  4A3M H;  3HKZ E;  1PH4 A;  2R6G A;  1HNZ Q;  2VW9 A;  5C4J H;  4K0K L;  4DUY Q;  3HOZ G;  3UE0 A;  3F1Z A;  5IP9 G;  1YJ9 A;  4LF4 Q;  4IPH A;  1SN8 A;  1Q7Y C;  1X54 A;  4AQY Q;  4POG A;  1E1T A;  2VY3 A;  4DR2 Q;  3WWV A;  2I0Q A;  3NBH B;  4UY8 C;  4OX9 L;  1I3Q H;  1WI5 A;  3PIO A;  1JMC A;  4XTC S;  2VUM G;  2AMC B;  4KLK A;  3OW2 A;  1K73 C;  1JB7 A;  1EYG A;  3HOY H;  1N33 Q;  1EOV A;  1I94 Q;  2L15 A;  5FJ8 H;  1K8A C;  2Z0S A;  4HIM A;  1HNX L;  4LF8 Q;  1T9H A;  3RLO A;  4GOP A;  2DGY A;  4BY7 H;  1X3F A;  2IHF A;  4X64 L;  4JI0 L;  4JI7 Q;  2UXC L;  3LGJ A;  4GN4 B;  1HZC A;  1YZ6 A;  2JK8 A;  4DR3 Q;  4DR6 L;  1UE6 A;  2N49 A;  3HOZ H;  4JI8 L;  1IBK Q;  2Z6K C;  1PFS A;  4QIW E;  3CCQ A;  3I7F A;  4P71 A;  1IXR A;  2KBN A;  1NY4 A;  1Q8K A;  1WJJ A;  2ZM6 L;  2ID0 A;  2VUM H;  3JAM c;  4X66 Q;  1N34 Q;  2Q2H A;  2F4V L;  1J5E Q;  3PO3 H;  1YBY A;  3UDF A;  5JEA G;  1W3S A;  4NXN Q;  1Y1W H;  4DNI A;  2IY5 B;  3TEH B;  1VQO A;  3KDF A;  4DV5 Q;  4JI2 Q;  4AH6 A;  1YHQ A;  3IRB A;  3OTO Q;  4OON A;  2WB1 E;  3RNU A;  3J7Z C;  3KF6 A;  1A0I A;  4UPA A;  5M5W H;  1CKN B;  3OYY A;  3GO5 A;  3K80 C;  5HY6 A;  3JAM i;  2A8V A;  4A3C H;  2WAQ G;  1X3E A;  4GKK L;  1ASY A;  2OTL A;  2IHE A;  2YTX A;  3ULJ A;  1PVO A;  4R1J A;  4GNX B;  1JE5 A;  4JCV E;  4YWK A;  3FP9 A;  2JA7 G;  3S16 H;  1H95 A;  4LFC L;  3S1R H;  3HFZ B;  1LM0 A;  3HOV H;  3BZK A;  2VQF Q;  3DM3 A;  4YWM A;  4JYA L;  3EIV A;  2CCZ A;  2B63 G;  1XPR A;  1BKB A;  4IPG A;  3J80 i;  4HJ8 A;  1IBM L;  2OTJ A;  1FJG L;  1JT8 A;  5GAH C;  2VS1 A;  2MFI A;  3UE1 A;  2QA4 A;  2KHJ A;  5LMU L;  3CMA A;  2UU9 L;  4A3E G;  1QUQ B;  1TWA H;  4BA1 I;  2ALY B;  2UXB Q;  4A3G G;  4MNO A;  5C0X G;  1VQ9 A;  1W2B A;  2F3I A;  1YIT A;  3S15 H;  4DK3 C;  1VQ7 A;  5FLX c;  2IX0 A;  3U50 C;  1VQE A;  4KHP Q;  2NZO A;  2NVQ H;  5ELO A;  3J81 c;  3S17 H;  2PNH A;  1VQJ A;  1Z9F A;  3W5O A;  4A3I H;  3GTK H;  4BBR H;  4LF9 L;  3PUV A;  4MZ9 A;  3HOU G;  2AHO B;  3PUX A;  3K81 C;  3PSI A;  3I4M G;  2RCN A;  3CP0 A;  1QZH A;  3G48 A;  4A3B G;  5C4X H;  4LF5 Q;  4NXM L;  3J7A 5;  3HKS A;  1TWC H;  2N78 A;  4HJ7 A;  1BVS A;  1WYD A;  3FKI G;  4DV6 Q;  1N36 Q;  3U4Z A;  1VQ8 A;  1OXS C;  2NVY H;  4LUV A;  4R4I A;  4AIM A;  4HJ9 A;  3S1N H;  3S1Q H;  4DV3 L;  1IBL L;  3F2C A;  3KOJ A;  3RR5 A;  4LF6 L;  5M3F H;  4POF A;  1XNR L;  2A19 A;  5H1S E;  3CCE A;  1L1O C;  1GKH A;  1L2F A;  1YEZ A;  2D0O A;  2MQH A;  2N8N A;  5FLM H;  1X9N A;  1E7Z A;  1PH9 A;  1Q12 A;  1UE5 A;  4B3M L;  4LFB Q;  4IFD I;  1Q86 C;  5LMN L;  1GD7 A;  4JOI C;  1HR0 W;  3A5Z B;  2MNA A;  3M4Q A;  4IOC A;  2C35 B;  2VL6 A;  3G6E A;  4TVA B;  1EFW A;  4WJ3 M;  1OXX K;  1NE3 A;  2BA1 A;  4DV7 Q;  3PGZ A;  4LUO A;  4YWL A;  1AE3 A;  4R4Q A;  4DUZ Q;  1E22 A;  2Y0S E;  4JG2 A;  4LF7 L;  5HGQ A;  1PH8 A;  4AYB G;  1MIU A;  4EQ5 A;  2R7Z G;  4JBK A;  2K5V A;  2GVA A;  2K75 A;  4MTN A;  5GRO A;  4C3J H;  2AWO A;  4JI3 L;  5FJ8 G;  3U58 A;  4IFD J;  4DR7 L;  4BY7 G;  3I2Z A;  1YNX A;  2ASB A;  4KHZ A;  5IYB H;  4A3F H;  4IPD A;  1E1O A;  2JA8 G;  1VQC A;  1HZ9 A;  2LSS A;  3NEL A;  3W1G A;  1YI2 A;  2NVT H;  2UUA L;  4YY3 L;  5IT9 c;  4X6A H;  3FHW A;  3CCR A;  4LW1 A;  1L0W A;  4GN5 A;  3M9B A;  2JA6 H;  3H3V I;  1CKO A;  1EUJ A;  2HIX A;  4C2M H;  1CSQ A;  1MJE A;  1CKN A;  2KCT A;  2WP8 J;  3ER0 A;  4B3T L;  4DR5 Q;  2PQA B;  4B3R Q;  4LF4 L;  4HIO A;  1VQ6 A;  4ALP A;  1N32 Q;  2UUC L;  2OQ0 A;  4JI4 L;  3PO3 G;  2R7Z H;  4HJ5 A;  4DR2 L;  4GNX A;  1Y1W G;  4DV2 L;  3BZC A;  1WFQ A;  1TWF H;  1G29 1;  1KIX A;  2KEN A;  4NB3 A;  4X62 L;  2D62 A;  1QVF A;  2JA8 H;  3PIP A;  1N33 L;  4OX9 Q;  2XTI A;  4O2D A;  3PUW A;  4R4C A;  3TS2 A;  2E5L L;  4L5T A;  1PH7 A;  4LF8 L;  1E24 A;  1VQK A;  2NZH A;  4GS3 A;  4BBS G;  4A3C G;  5C44 G;  1HNW L;  4HIK A;  1QUQ A;  2K14 A;  2RHS B;  4PG3 A;  3S14 H;  4DV1 L;  4LNQ A;  3K7A H;  3CC2 A;  5BR8 L;  3T1H L;  1G51 A;  5C0X I;  4GLX A;  3HKZ G;  4JI0 Q;  2ZJR A;  2UXC Q;  2JQO A;  1YVC A;  1KQS A;  2UUB Q;  4A3K H;  4DR6 Q;  1XMQ L;  1FGU A;  1PYB A;  2LXJ A;  3HOV G;  3RZO H;  1Y1V H;  4O0A A;  1XTD A;  3CCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...