4LO1C

Ha17-ha33-gal
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
144
structure length
144
Chain Sequence
VERTFLPNGNYNIKSIFSGSLYLNPVSKSLTFSNESSANNQKWNVEYMAENRCFKISNVAEPNKYLSYDNFGFISLDSLSNRCYWFPIKIAVNTYIMLSLNKVNELDYAWDIYDTNENILSQPLLLLPNFDIYNSNQMFKLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HA-33
publication title Structure of a Bimodular Botulinum Neurotoxin Complex Provides Insights into Its Oral Toxicity.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Protein transport
total genus 32
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2013-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4lo1C00
3WINA 1DZCA 2LIEA 4KBBA 1DFCA 1IHKA 2VXRA 4LO3C 1R8NA 2D22A 4XFUA 3SNVA 4QBVA 1IT0A 1ISZA 4X37A 4HA2A 3FJ8A 3HMYA 1RMLA 4LO0A 1DFQA 1RZOB 2DRYA 2UUSA 3IM6A 4I4QA 3P6IA 5FZUA 1PZZA 4J2XA 3WO3A 1BFCA 2XOAA 4GAFA 1WBAA 3AZWA 2AQZA 1E0OA 1JLXA 1Q1UA 3LTQA 1FN0A 2NM1A 1T4QA 1DIWA 3VEQA 1IJTA 1AF9A 4WBCA 2DREA 3FGMA 3BA4A 3WO2A 1K5UA 1G9AA 1ITBA 1TTUA 1M2TB 2FFVA 1FGAA 4P0KA 3BTAA 2KH2A 1G9DA 3VT2A 1HIBA 3FUQA 5GAQA 1AVXB 1ONKB 4I8MA 1YBIA 2E4MA 3BRFA 3ILAA 3V79C 1V6WA 1PUMB 1FV2A 3NJ5A 3F1RA 3OGFA 1R8OA 3O4CA 2D20A 1Z4SA 3JRRA 1FMMS 4QKRA 4L4HA 3VWCA 2FO1A 4G9NA 2D1ZA 1G82A 3AH1A 1D0HA 4TLPA 3WA1A 4A7ZA 3BB2A 2FGFA 3H6RB 1BFFA 3RMXA 1V6XA 4G6MA 4D8HA 2Y9FA 5JLVA 2I1BA 3FJ9A 4LO8B 4AN6A 1QQLA 3CRIA 3AJ6A 1I1EA 2WRYA 3FJJA 3MPPG 4IZEA 1FMZA 2KLLA 4D0TA 5BOWA 4QC4A 4ZFUB 4ISQA 5E24E 4EB2B 3N7LA 4IY8A 3WMUA 2Q3NB 3BAUA 3V0BA 3CA4A 3AH4A 1TWMA 4L4IA 2YUGA 3Q7YA 1G9BA 1TFMB 1RY7A 1NZKA 3FJEA 1BARA 1S0LA 5DUYA 2VSAA 4GAIA 1TOOA 3CA1A 3V0AB 1P63A 1W3AA 1Q04A 5I1BA 4I4SA 4IYBA 3NBEA 2BEAA 3IM7A 3KMVA 1AFCA 1BA7A 3A23A 4F34A 2GZBA 3ZX7A 3S8KA 3O4OA 3V0AA 1MC9A 3BAHA 3FFZA 4KEJA 4LO7B 3OJMA 4EEEB 4ZLBB 1MD6A 2D24A 2ERMA 4I4OA 3HOMA 3AJ5A 3NBNA 3RTJB 4Z8SB 3AKIA 4OWKA 1W3GA 2QYIB 1IILA 1HKNA 3RSJA 4EFQA 4J2KA 3CQAA 2X2TA 2HZ9A 4LO3A 2AFGA 4A7KA 4EKXB 2ZQNA 3FJIA 4LO7C 5EHAA 2MIBA 1PWAA 4X39A 4GP0A 1JT3A 5B2HA 1DLLA 1QXMA 4JAWA 4JRAA 7I1BA 4DENA 3IM5A 3VSFA 1EPWA 1HWNB 2Q9XA 1CVSA 5BXTA 1AVWB 1DQOA 3O44A 5BVPI 3BAOA 2KI6B 3CAHA 5BP5C 1EVTA 2HW9A 3WINC 3E8LC 1ISXA 1TP0A 4XKIA 4EFRA 4ISRA 1AVUA 1V6VA 4Q9PA 4I4XA 2DS0A 4JKQA 5D63A 5DSSB 1BFBA 2NVHA 3B9UA 3C9ZA 4EFPA 2F8XC 3I2XA 3N7MA 1WD4A 2QN4A 1FWVA 1BLAA 2AXMA 4H9WA 2RG9B 1SR4C 3AZVA 4OWLA 2RSTA 3O4BA 4G1RA 2LIQA 4JKXB 1JT5A 4HR6C 4Q91A 1NUNA 3VUOA 3FJDA 1ISWA 2Z49A 1UPSA 4YOLA 4QO3A 3UJ4A 2MC2A 1ISVA 2Y9GA 1S0DA 9ILBA 1RG8A 3A22A 3RTIB 1FV3A 1HCDA 3A07A 3FJHA 3N0KA 3OJVA 5BQUC 2D44A 3ZXDA 3UD8A 1PUUB 3UD7A 3BADA 2KKIA 3HSMA 4I37A 4LO2C 3O4AA 3FJFA 1TWEA 1XZZA 2FFUA 1JY0A 4IY9A 1FWUA 3O3QA 1WD3A 3P6JA 2M49A 21BIA 3H6RA 2IWTB 4LO1A 5FZYA 1GGPB 1S0GA 4I1EA 3Q7WA 4R6UB 4FGFA 4GP3A 1Z2VA 1SZ6B 2GO2A 3CA3A 1KNMA 2NYYA 3R4SA 2BFHA 5HPZA 4XFTA 4ZBVB 4I7IA 4G9MA 3LLPA 4IZXA 1WBCA 2F2FA 4I4YA 1AXMA 3BA5A 5D62A 4HJJA 3BRDA 4IHZA 2ET2A 4QD2C 1BFGA 1S0BA 1YXWA 3BAQA 2P23A 1L2HA 4IQPA 1YTOA 3AKGA 1JT4A 5G00A 4XFSA 4P0JA 2D7IA 3OJ2A 4X38A 4JP0A 8I1BA 1QQKA 1Z0HA 3QR5A 4GOVA 1S0FA 1BASA 1FQ9A 1IOBA 4QALA 3CRHA 2K8RA 2NTDA 3UD9A 1ILR1 3N7KA 2FDBM 4KEIA 4ZGRB 4I1BA 2D7RA 3EF2A 3T8SA 4IONA 5FNWA 4OWJA 3PMEA 1OQLB 4ENDA 4X3AA 3HALA 3HBWA 4USOA 3NBCA 41BIA 4J2YA 4ZFWB 1N4KA 1A8DA 3ZXGA 1V6UA 1CE7B 4I0YA 3N7JA 4ZKTB 2D23A 2P39A 2R9KB 2VU9A 1YF8B 1J0SA 4JPZA 1JLYA 4KC3A 1W3FA 5FNXA 1EV2A 5BP5A 2IHOA 1JTCA 4DCKC 3P53A 4P0LA 3OBTA 1XYFA 3UJ0A 5BXRA 3AKHA 1Q03A 5FZZA 1HWOB 2ZR1B 3FJBA 3NBDA 4OEFA 4PC4A 3MALA 4A7YA 1JT7A 4Q9GA 5F8SA 4H04A 4JQ0A 3PHZA 5JMCA 5EG6C 4AN7B 3AKFA 2DRZA 1M16A 3OBRA 1SR4A 3CRGA 2VUAA 3PUBA 4LO0C 3OGGA 1BLDA 4P6AA 3CA0A 6I1BA 3FUOA 3HN1A 4J2SA 4I3NA 2VLCA 4J23B 3WO4A 4F83A 2K4AB 2MLLB 4ZFYB 1I1BA 4I4PA 5BQUA 1HWMB 5DZUA 1ISYA 2AAIB 1HCEA 4LO2A 3H6SE 3FJCA 3ZC9A 1G9CA 1VCLA 4CJMA 3BAVA 1S0CA 2E4MC 2J3PA 3D7WB 3O5WB 1IRPA 5DVHA 3W9TA 3BA7A 3POKA 2KI4A 3K1XA 3JUTA 2Y9WC 4KEKA 1S0EA 3UDAA 3V0BB 3O49A 4Z9WB 3F62B 1DZDA 1K5VA 4I96A 3AH2A 1XHBA 4QD2B 4OEGA 4OUJA 2HWMA 3VT1A 3FJKA 4OW4A 5F8WA 2Z48A 5EC5A 3VT0A 3Q7XA 4I4VA 3IAGC 4G6JA 3S8JA 2ZQOA 4GOYA 4I2SA 3BX1C 3VSZA 3BAGA 4USPA 4II0A 3FJAA 1DQGA 4LO1C 1EYLA 4QBCA 3TC2A 4DEPA 3IIRA 2D43A 2ESUA 1T9FA 4ZOTA 4D0ZA 5BXPA 1F31A 2NZ9A 5F90A 4I4RA 1XG6A 31BIA 4ZA3B 3QYDA 1HWPB 3I29B 1DJSB 1PC8B 3O4DA 2VXTI 3CU1B 3ZC8A 3BRGC 3WMVA 3H6QA 2Y9XE 5D61A 2NP0A 2WBCA 2F2FC 1JQZA 4QKSA 1AVAC 2K43A 3CA5A 1II4A 1TIEA 5BXSA 4I4UA 3I2AA 4FVVA 4I6IA 3CA6A 2X2SA 2HWAA 2BEBA 3PG0A 2VSEA 3A21A 2L5XA 4OEEA 3R4UA 1YYNA 1ABRB 2RQ9A 3RMYA 5F8YA 1IRAX
chains in the Genus database with same CATH superfamily
3WINA 1DZCA 2LIEA 4KBBA 1DFCA 1IHKA 2VXRA 4LO3C 1R8NA 2D22A 4XFUA 3SNVA 4QBVA 1IT0A 1ISZA 4X37A 4HA2A 3FJ8A 3HMYA 1RMLA 4LO0A 1DFQA 1RZOB 2DRYA 2UUSA 3IM6A 4I4QA 3P6IA 5FZUA 1PZZA 4J2XA 3WO3A 1BFCA 2XOAA 4GAFA 1WBAA 3AZWA 2AQZA 1E0OA 1JLXA 1Q1UA 3LTQA 1FN0A 2NM1A 1T4QA 1DIWA 3VEQA 1IJTA 1AF9A 4WBCA 2DREA 3FGMA 3BA4A 3WO2A 1K5UA 1G9AA 1ITBA 1TTUA 1M2TB 2FFVA 1FGAA 4P0KA 3BTAA 2KH2A 1G9DA 3VT2A 1HIBA 3FUQA 5GAQA 1AVXB 1ONKB 4I8MA 1YBIA 2E4MA 3BRFA 3ILAA 3V79C 1V6WA 1PUMB 1FV2A 3NJ5A 3F1RA 3OGFA 1R8OA 3O4CA 2D20A 1Z4SA 3JRRA 1FMMS 4QKRA 4L4HA 3VWCA 2FO1A 4G9NA 2D1ZA 1G82A 3AH1A 1D0HA 4TLPA 3WA1A 4A7ZA 3BB2A 2FGFA 3H6RB 1BFFA 3RMXA 1V6XA 4G6MA 4D8HA 2Y9FA 5JLVA 2I1BA 3FJ9A 4LO8B 4AN6A 1QQLA 3CRIA 3AJ6A 1I1EA 2WRYA 3FJJA 3MPPG 4IZEA 1FMZA 2KLLA 4D0TA 5BOWA 4QC4A 4ZFUB 4ISQA 5E24E 4EB2B 3N7LA 4IY8A 3WMUA 2Q3NB 3BAUA 3V0BA 3CA4A 3AH4A 1TWMA 4L4IA 2YUGA 3Q7YA 1G9BA 1TFMB 1RY7A 1NZKA 3FJEA 1BARA 1S0LA 5DUYA 2VSAA 4GAIA 1TOOA 3CA1A 3V0AB 1P63A 1W3AA 1Q04A 5I1BA 4I4SA 4H75A 4IYBA 3NBEA 2BEAA 3IM7A 3KMVA 1AFCA 1BA7A 3A23A 4F34A 2GZBA 3ZX7A 3S8KA 3O4OA 3V0AA 1MC9A 3BAHA 3FFZA 4KEJA 4LO7B 3OJMA 4EEEB 4ZLBB 1MD6A 2D24A 2ERMA 4I4OA 3HOMA 3AJ5A 3NBNA 3RTJB 4Z8SB 3AKIA 4OWKA 1W3GA 2QYIB 1IILA 1HKNA 3RSJA 4EFQA 4J2KA 3CQAA 2X2TA 2HZ9A 4LO3A 2AFGA 4A7KA 4EKXB 4MZHA 2ZQNA 3FJIA 4LO7C 5EHAA 2MIBA 1PWAA 4X39A 4GP0A 1JT3A 5B2HA 1DLLA 1QXMA 4JAWA 4JRAA 7I1BA 4DENA 3IM5A 3VSFA 1EPWA 1HWNB 2Q9XA 1CVSA 5BXTA 1AVWB 1DQOA 3O44A 5BVPI 3BAOA 2KI6B 3CAHA 5BP5C 1EVTA 2HW9A 3WINC 3E8LC 1ISXA 1TP0A 4XKIA 4EFRA 4ISRA 1AVUA 1V6VA 4Q9PA 4I4XA 2DS0A 4JKQA 5D63A 5DSSB 1BFBA 2NVHA 3B9UA 3C9ZA 4EFPA 2F8XC 3I2XA 3N7MA 1WD4A 2QN4A 1FWVA 1BLAA 2AXMA 4H9WA 2RG9B 1SR4C 3AZVA 4OWLA 2RSTA 3O4BA 4G1RA 2LIQA 4JKXB 1JT5A 4HR6C 4Q91A 1NUNA 3VUOA 3FJDA 1ISWA 2Z49A 1UPSA 4YOLA 4QO3A 3UJ4A 2MC2A 1ISVA 2Y9GA 1S0DA 9ILBA 1RG8A 3A22A 4MZGB 3RTIB 1FV3A 1HCDA 3A07A 3FJHA 3N0KA 3OJVA 5BQUC 2D44A 3ZXDA 3UD8A 1PUUB 3UD7A 3BADA 2KKIA 3HSMA 4I37A 4LO2C 3O4AA 3FJFA 1TWEA 1XZZA 2FFUA 1JY0A 4IY9A 1FWUA 3O3QA 1WD3A 3P6JA 2M49A 21BIA 3H6RA 2IWTB 4LO1A 5FZYA 1GGPB 1S0GA 4I1EA 3Q7WA 4R6UB 4FGFA 4GP3A 1Z2VA 1SZ6B 2GO2A 3CA3A 1KNMA 2NYYA 3R4SA 2BFHA 5HPZA 4XFTA 4ZBVB 4I7IA 4G9MA 3LLPA 4IZXA 1WBCA 2F2FA 4I4YA 1AXMA 3BA5A 5D62A 4HJJA 3BRDA 4IHZA 2ET2A 4QD2C 1BFGA 1S0BA 1YXWA 3BAQA 2P23A 1L2HA 4IQPA 1YTOA 3AKGA 1JT4A 5G00A 4XFSA 4P0JA 2D7IA 3OJ2A 4X38A 4JP0A 8I1BA 1QQKA 1Z0HA 3QR5A 4GOVA 1S0FA 1BASA 1FQ9A 1IOBA 4QALA 3CRHA 2K8RA 2NTDA 3UD9A 1ILR1 3N7KA 2FDBM 4KEIA 4ZGRB 4I1BA 2D7RA 3EF2A 3T8SA 4IONA 5FNWA 4OWJA 3PMEA 1OQLB 4ENDA 4X3AA 3HALA 3HBWA 4USOA 3NBCA 41BIA 4J2YA 4ZFWB 1N4KA 1A8DA 3ZXGA 1V6UA 1CE7B 4I0YA 3N7JA 4ZKTB 2D23A 2P39A 2R9KB 2VU9A 1YF8B 1J0SA 4JPZA 1JLYA 4KC3A 1W3FA 4UY4A 5FNXA 1EV2A 2NS2A 5BP5A 2IHOA 1JTCA 4DCKC 3P53A 4P0LA 3OBTA 1XYFA 3UJ0A 5BXRA 3AKHA 1Q03A 5FZZA 1HWOB 2ZR1B 3FJBA 3NBDA 4OEFA 4PC4A 3MALA 4A7YA 1JT7A 4Q9GA 5F8SA 4H04A 4JQ0A 3PHZA 5JMCA 5EG6C 4AN7B 3AKFA 2DRZA 1M16A 3OBRA 1SR4A 3CRGA 2VUAA 3PUBA 4LO0C 3OGGA 1BLDA 4P6AA 3CA0A 6I1BA 3FUOA 3HN1A 4J2SA 4I3NA 2VLCA 4J23B 3WO4A 4F83A 2K4AB 2MLLB 4ZFYB 1I1BA 4I4PA 5BQUA 1HWMB 5DZUA 1ISYA 2AAIB 1HCEA 4LO2A 3H6SE 3FJCA 3ZC9A 1G9CA 1VCLA 4CJMA 3BAVA 1S0CA 2E4MC 2J3PA 3D7WB 3O5WB 1IRPA 5DVHA 3W9TA 3BA7A 3POKA 2KI4A 3K1XA 3JUTA 2Y9WC 4KEKA 1S0EA 3UDAA 3V0BB 3O49A 4Z9WB 3F62B 1DZDA 1K5VA 4I96A 3AH2A 1XHBA 4QD2B 4OEGA 4OUJA 2HWMA 3VT1A 3FJKA 4OW4A 5F8WA 2Z48A 5EC5A 3VT0A 3Q7XA 4I4VA 3IAGC 4G6JA 3S8JA 2ZQOA 4GOYA 4I2SA 3BX1C 3VSZA 3BAGA 4USPA 4II0A 3FJAA 1DQGA 4LO1C 1EYLA 4QBCA 3TC2A 4DEPA 3IIRA 2D43A 2ESUA 4MZFB 1T9FA 4ZOTA 4D0ZA 5BXPA 1F31A 2NZ9A 5F90A 4I4RA 1XG6A 31BIA 4ZA3B 3QYDA 1HWPB 3I29B 1DJSB 1PC8B 3O4DA 2VXTI 3CU1B 3ZC8A 3BRGC 3WMVA 3H6QA 2Y9XE 5D61A 2NP0A 2WBCA 2F2FC 1JQZA 4QKSA 1AVAC 2K43A 3CA5A 1II4A 1TIEA 5BXSA 4I4UA 3I2AA 4FVVA 4I6IA 3CA6A 2X2SA 2HWAA 2BEBA 3PG0A 2VSEA 3A21A 2L5XA 4OEEA 3R4UA 1YYNA 1ABRB 2RQ9A 3RMYA 5F8YA 1IRAX
chains in the Genus database with same CATH topology
3WINA 1DZCA 2LIEA 4KBBA 1DFCA 1IHKA 2VXRA 4LO3C 1R8NA 2D22A 4XFUA 3SNVA 4QBVA 1IT0A 1ISZA 4X37A 4HA2A 3FJ8A 3HMYA 1RMLA 4LO0A 1DFQA 1RZOB 2DRYA 2UUSA 3IM6A 4I4QA 3P6IA 5FZUA 1PZZA 4J2XA 3WO3A 1BFCA 2XOAA 4GAFA 1WBAA 3AZWA 2AQZA 1E0OA 1JLXA 1Q1UA 3LTQA 1FN0A 2NM1A 1T4QA 1DIWA 3VEQA 1IJTA 1AF9A 4WBCA 2DREA 3FGMA 3BA4A 3WO2A 1K5UA 1G9AA 1ITBA 1TTUA 1M2TB 2FFVA 1FGAA 4P0KA 3BTAA 2KH2A 1G9DA 3VT2A 1HIBA 3FUQA 5GAQA 1AVXB 1ONKB 4I8MA 1YBIA 2E4MA 3BRFA 3ILAA 3V79C 1V6WA 1PUMB 1FV2A 3NJ5A 3F1RA 3OGFA 1R8OA 3O4CA 2D20A 1Z4SA 3JRRA 1FMMS 4QKRA 4L4HA 3VWCA 2FO1A 4G9NA 2D1ZA 1G82A 3AH1A 1D0HA 4TLPA 3WA1A 4A7ZA 3BB2A 2FGFA 3H6RB 1BFFA 3RMXA 1V6XA 4G6MA 4D8HA 2Y9FA 5JLVA 2I1BA 3FJ9A 4LO8B 4AN6A 1QQLA 3CRIA 3AJ6A 1I1EA 2WRYA 3FJJA 3MPPG 4IZEA 1FMZA 2KLLA 4D0TA 5BOWA 4QC4A 4ZFUB 4ISQA 5E24E 4EB2B 3N7LA 4IY8A 3WMUA 2Q3NB 3BAUA 3V0BA 3CA4A 3AH4A 1TWMA 4L4IA 2YUGA 3Q7YA 1G9BA 1TFMB 1RY7A 1NZKA 3FJEA 1BARA 1S0LA 5DUYA 2VSAA 4GAIA 1TOOA 3CA1A 3V0AB 1P63A 1W3AA 1Q04A 5I1BA 4I4SA 4H75A 4IYBA 3NBEA 2BEAA 3IM7A 3KMVA 1AFCA 1BA7A 3A23A 4F34A 2GZBA 3ZX7A 3S8KA 3O4OA 3V0AA 1MC9A 3BAHA 3FFZA 4KEJA 4LO7B 3OJMA 4EEEB 4ZLBB 1MD6A 2D24A 2ERMA 4I4OA 3HOMA 3AJ5A 3NBNA 3RTJB 4Z8SB 3AKIA 4OWKA 1W3GA 2QYIB 1IILA 1HKNA 3RSJA 4EFQA 4J2KA 3CQAA 2X2TA 2HZ9A 4LO3A 2AFGA 4A7KA 4EKXB 4MZHA 2ZQNA 3FJIA 4LO7C 5EHAA 2MIBA 1PWAA 4X39A 4GP0A 1JT3A 5B2HA 1DLLA 1QXMA 4JAWA 4JRAA 7I1BA 4DENA 3IM5A 3VSFA 1EPWA 1HWNB 2Q9XA 1CVSA 5BXTA 1AVWB 1DQOA 3O44A 5BVPI 3BAOA 2KI6B 3CAHA 5BP5C 1EVTA 2HW9A 3WINC 3E8LC 1ISXA 1TP0A 4XKIA 4EFRA 4ISRA 1AVUA 1V6VA 4Q9PA 4I4XA 2DS0A 4JKQA 5D63A 5DSSB 1BFBA 2NVHA 3B9UA 3C9ZA 4EFPA 2F8XC 3I2XA 3N7MA 1WD4A 2QN4A 1FWVA 1BLAA 2AXMA 4H9WA 2RG9B 1SR4C 3AZVA 4OWLA 2RSTA 3O4BA 4G1RA 2LIQA 4JKXB 1JT5A 4HR6C 4Q91A 1NUNA 3VUOA 3FJDA 1ISWA 2Z49A 1UPSA 4YOLA 4QO3A 3UJ4A 2MC2A 1ISVA 2Y9GA 1S0DA 9ILBA 1RG8A 3A22A 4MZGB 3RTIB 1FV3A 1HCDA 3A07A 3FJHA 3N0KA 3OJVA 5BQUC 2D44A 3ZXDA 3UD8A 1PUUB 3UD7A 3BADA 2KKIA 3HSMA 4I37A 4LO2C 3O4AA 3FJFA 1TWEA 1XZZA 2FFUA 1JY0A 4IY9A 1FWUA 3O3QA 1WD3A 3P6JA 2M49A 21BIA 3H6RA 2IWTB 4LO1A 5FZYA 1GGPB 1S0GA 4I1EA 3Q7WA 4R6UB 4FGFA 4GP3A 1Z2VA 1SZ6B 2GO2A 3CA3A 1KNMA 2NYYA 3R4SA 2BFHA 5HPZA 4XFTA 4ZBVB 4I7IA 4G9MA 3LLPA 4IZXA 1WBCA 2F2FA 4I4YA 1AXMA 3BA5A 5D62A 4HJJA 3BRDA 4IHZA 2ET2A 4QD2C 1BFGA 1S0BA 1YXWA 3BAQA 2P23A 1L2HA 4IQPA 1YTOA 3AKGA 1JT4A 5G00A 4XFSA 4P0JA 2D7IA 3OJ2A 4X38A 4JP0A 8I1BA 1QQKA 1Z0HA 3QR5A 4GOVA 1S0FA 1BASA 1FQ9A 1IOBA 4QALA 3CRHA 2K8RA 2NTDA 3UD9A 1ILR1 3N7KA 2FDBM 4KEIA 4ZGRB 4I1BA 2D7RA 3EF2A 3T8SA 4IONA 5FNWA 4OWJA 3PMEA 1OQLB 4ENDA 4X3AA 3HALA 3HBWA 4USOA 3NBCA 41BIA 4J2YA 4ZFWB 1N4KA 1A8DA 3ZXGA 1V6UA 1CE7B 4I0YA 3N7JA 4ZKTB 2D23A 2P39A 2R9KB 2VU9A 1YF8B 1J0SA 4JPZA 1JLYA 4KC3A 1W3FA 4UY4A 5FNXA 1EV2A 2NS2A 5BP5A 2IHOA 1JTCA 4DCKC 3P53A 4P0LA 3OBTA 1XYFA 3UJ0A 5BXRA 3AKHA 1Q03A 5FZZA 1HWOB 2ZR1B 3FJBA 3NBDA 4OEFA 4PC4A 3MALA 4A7YA 1JT7A 4Q9GA 5F8SA 4H04A 4JQ0A 3PHZA 5JMCA 5EG6C 4AN7B 3AKFA 2DRZA 1M16A 3OBRA 1SR4A 3CRGA 2VUAA 3PUBA 4LO0C 3OGGA 1BLDA 4P6AA 3CA0A 6I1BA 3FUOA 3HN1A 4J2SA 4I3NA 2VLCA 4J23B 3WO4A 4F83A 2K4AB 2MLLB 4ZFYB 1I1BA 4I4PA 5BQUA 1HWMB 5DZUA 1ISYA 2AAIB 1HCEA 4LO2A 3H6SE 3FJCA 3ZC9A 1G9CA 1VCLA 4CJMA 3BAVA 1S0CA 2E4MC 2J3PA 3D7WB 3O5WB 1IRPA 5DVHA 3W9TA 3BA7A 3POKA 2KI4A 3K1XA 3JUTA 2Y9WC 4KEKA 1S0EA 3UDAA 3V0BB 3O49A 4Z9WB 3F62B 1DZDA 1K5VA 4I96A 3AH2A 1XHBA 4QD2B 4OEGA 4OUJA 2HWMA 3VT1A 3FJKA 4OW4A 5F8WA 2Z48A 5EC5A 3VT0A 3Q7XA 4I4VA 3IAGC 4G6JA 3S8JA 2ZQOA 4GOYA 4I2SA 3BX1C 3VSZA 3BAGA 4USPA 4II0A 3FJAA 1DQGA 4LO1C 1EYLA 4QBCA 3TC2A 4DEPA 3IIRA 2D43A 2ESUA 4MZFB 1T9FA 4ZOTA 4D0ZA 5BXPA 1F31A 2NZ9A 5F90A 4I4RA 1XG6A 31BIA 4ZA3B 3QYDA 1HWPB 3I29B 1DJSB 1PC8B 3O4DA 2VXTI 3CU1B 3ZC8A 3BRGC 3WMVA 3H6QA 2Y9XE 5D61A 2NP0A 2WBCA 2F2FC 1JQZA 4QKSA 1AVAC 2K43A 3CA5A 1II4A 1TIEA 5BXSA 4I4UA 3I2AA 4FVVA 4I6IA 3CA6A 2X2SA 2HWAA 2BEBA 3PG0A 2VSEA 3A21A 2L5XA 4OEEA 3R4UA 1YYNA 1ABRB 2RQ9A 3RMYA 5F8YA 1IRAX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WIN A;  1DZC A;  2LIE A;  4KBB A;  1DFC A;  1IHK A;  2VXR A;  4LO3 C;  1R8N A;  2D22 A;  4XFU A;  3SNV A;  4QBV A;  1IT0 A;  1ISZ A;  4X37 A;  4HA2 A;  3FJ8 A;  3HMY A;  1RML A;  4LO0 A;  1DFQ A;  1RZO B;  2DRY A;  2UUS A;  3IM6 A;  4I4Q A;  3P6I A;  5FZU A;  1PZZ A;  4J2X A;  3WO3 A;  1BFC A;  2XOA A;  4GAF A;  1WBA A;  3AZW A;  2AQZ A;  1E0O A;  1JLX A;  1Q1U A;  3LTQ A;  1FN0 A;  2NM1 A;  1T4Q A;  1DIW A;  3VEQ A;  1IJT A;  1AF9 A;  4WBC A;  2DRE A;  3FGM A;  3BA4 A;  3WO2 A;  1K5U A;  1G9A A;  1ITB A;  1TTU A;  1M2T B;  2FFV A;  1FGA A;  4P0K A;  3BTA A;  2KH2 A;  1G9D A;  3VT2 A;  1HIB A;  3FUQ A;  5GAQ A;  1AVX B;  1ONK B;  4I8M A;  1YBI A;  2E4M A;  3BRF A;  3ILA A;  3V79 C;  1V6W A;  1PUM B;  1FV2 A;  3NJ5 A;  3F1R A;  3OGF A;  1R8O A;  3O4C A;  2D20 A;  1Z4S A;  3JRR A;  1FMM S;  4QKR A;  4L4H A;  3VWC A;  2FO1 A;  4G9N A;  2D1Z A;  1G82 A;  3AH1 A;  1D0H A;  4TLP A;  3WA1 A;  4A7Z A;  3BB2 A;  2FGF A;  3H6R B;  1BFF A;  3RMX A;  1V6X A;  4G6M A;  4D8H A;  2Y9F A;  5JLV A;  2I1B A;  3FJ9 A;  4LO8 B;  4AN6 A;  1QQL A;  3CRI A;  3AJ6 A;  1I1E A;  2WRY A;  3FJJ A;  3MPP G;  4IZE A;  1FMZ A;  2KLL A;  4D0T A;  5BOW A;  4QC4 A;  4ZFU B;  4ISQ A;  5E24 E;  4EB2 B;  3N7L A;  4IY8 A;  3WMU A;  2Q3N B;  3BAU A;  3V0B A;  3CA4 A;  3AH4 A;  1TWM A;  4L4I A;  2YUG A;  3Q7Y A;  1G9B A;  1TFM B;  1RY7 A;  1NZK A;  3FJE A;  1BAR A;  1S0L A;  5DUY A;  2VSA A;  4GAI A;  1TOO A;  3CA1 A;  3V0A B;  1P63 A;  1W3A A;  1Q04 A;  5I1B A;  4I4S A;  4IYB A;  3NBE A;  2BEA A;  3IM7 A;  3KMV A;  1AFC A;  1BA7 A;  3A23 A;  4F34 A;  2GZB A;  3ZX7 A;  3S8K A;  3O4O A;  3V0A A;  1MC9 A;  3BAH A;  3FFZ A;  4KEJ A;  4LO7 B;  3OJM A;  4EEE B;  4ZLB B;  1MD6 A;  2D24 A;  2ERM A;  4I4O A;  3HOM A;  3AJ5 A;  3NBN A;  3RTJ B;  4Z8S B;  3AKI A;  4OWK A;  1W3G A;  2QYI B;  1IIL A;  1HKN A;  3RSJ A;  4EFQ A;  4J2K A;  3CQA A;  2X2T A;  2HZ9 A;  4LO3 A;  2AFG A;  4A7K A;  4EKX B;  2ZQN A;  3FJI A;  4LO7 C;  5EHA A;  2MIB A;  1PWA A;  4X39 A;  4GP0 A;  1JT3 A;  5B2H A;  1DLL A;  1QXM A;  4JAW A;  4JRA A;  7I1B A;  4DEN A;  3IM5 A;  3VSF A;  1EPW A;  1HWN B;  2Q9X A;  1CVS A;  5BXT A;  1AVW B;  1DQO A;  3O44 A;  5BVP I;  3BAO A;  2KI6 B;  3CAH A;  5BP5 C;  1EVT A;  2HW9 A;  3WIN C;  3E8L C;  1ISX A;  1TP0 A;  4XKI A;  4EFR A;  4ISR A;  1AVU A;  1V6V A;  4Q9P A;  4I4X A;  2DS0 A;  4JKQ A;  5D63 A;  5DSS B;  1BFB A;  2NVH A;  3B9U A;  3C9Z A;  4EFP A;  2F8X C;  3I2X A;  3N7M A;  1WD4 A;  2QN4 A;  1FWV A;  1BLA A;  2AXM A;  4H9W A;  2RG9 B;  1SR4 C;  3AZV A;  4OWL A;  2RST A;  3O4B A;  4G1R A;  2LIQ A;  4JKX B;  1JT5 A;  4HR6 C;  4Q91 A;  1NUN A;  3VUO A;  3FJD A;  1ISW A;  2Z49 A;  1UPS A;  4YOL A;  4QO3 A;  3UJ4 A;  2MC2 A;  1ISV A;  2Y9G A;  1S0D A;  9ILB A;  1RG8 A;  3A22 A;  3RTI B;  1FV3 A;  1HCD A;  3A07 A;  3FJH A;  3N0K A;  3OJV A;  5BQU C;  2D44 A;  3ZXD A;  3UD8 A;  1PUU B;  3UD7 A;  3BAD A;  2KKI A;  3HSM A;  4I37 A;  4LO2 C;  3O4A A;  3FJF A;  1TWE A;  1XZZ A;  2FFU A;  1JY0 A;  4IY9 A;  1FWU A;  3O3Q A;  1WD3 A;  3P6J A;  2M49 A;  21BI A;  3H6R A;  2IWT B;  4LO1 A;  5FZY A;  1GGP B;  1S0G A;  4I1E A;  3Q7W A;  4R6U B;  4FGF A;  4GP3 A;  1Z2V A;  1SZ6 B;  2GO2 A;  3CA3 A;  1KNM A;  2NYY A;  3R4S A;  2BFH A;  5HPZ A;  4XFT A;  4ZBV B;  4I7I A;  4G9M A;  3LLP A;  4IZX A;  1WBC A;  2F2F A;  4I4Y A;  1AXM A;  3BA5 A;  5D62 A;  4HJJ A;  3BRD A;  4IHZ A;  2ET2 A;  4QD2 C;  1BFG A;  1S0B A;  1YXW A;  3BAQ A;  2P23 A;  1L2H A;  4IQP A;  1YTO A;  3AKG A;  1JT4 A;  5G00 A;  4XFS A;  4P0J A;  2D7I A;  3OJ2 A;  4X38 A;  4JP0 A;  8I1B A;  1QQK A;  1Z0H A;  3QR5 A;  4GOV A;  1S0F A;  1BAS A;  1FQ9 A;  1IOB A;  4QAL A;  3CRH A;  2K8R A;  2NTD A;  3UD9 A;  1ILR 1;  3N7K A;  2FDB M;  4KEI A;  4ZGR B;  4I1B A;  2D7R A;  3EF2 A;  3T8S A;  4ION A;  5FNW A;  4OWJ A;  3PME A;  1OQL B;  4END A;  4X3A A;  3HAL A;  3HBW A;  4USO A;  3NBC A;  41BI A;  4J2Y A;  4ZFW B;  1N4K A;  1A8D A;  3ZXG A;  1V6U A;  1CE7 B;  4I0Y A;  3N7J A;  4ZKT B;  2D23 A;  2P39 A;  2R9K B;  2VU9 A;  1YF8 B;  1J0S A;  4JPZ A;  1JLY A;  4KC3 A;  1W3F A;  5FNX A;  1EV2 A;  5BP5 A;  2IHO A;  1JTC A;  4DCK C;  3P53 A;  4P0L A;  3OBT A;  1XYF A;  3UJ0 A;  5BXR A;  3AKH A;  1Q03 A;  5FZZ A;  1HWO B;  2ZR1 B;  3FJB A;  3NBD A;  4OEF A;  4PC4 A;  3MAL A;  4A7Y A;  1JT7 A;  4Q9G A;  5F8S A;  4H04 A;  4JQ0 A;  3PHZ A;  5JMC A;  5EG6 C;  4AN7 B;  3AKF A;  2DRZ A;  1M16 A;  3OBR A;  1SR4 A;  3CRG A;  2VUA A;  3PUB A;  4LO0 C;  3OGG A;  1BLD A;  4P6A A;  3CA0 A;  6I1B A;  3FUO A;  3HN1 A;  4J2S A;  4I3N A;  2VLC A;  4J23 B;  3WO4 A;  4F83 A;  2K4A B;  2MLL B;  4ZFY B;  1I1B A;  4I4P A;  5BQU A;  1HWM B;  5DZU A;  1ISY A;  2AAI B;  1HCE A;  4LO2 A;  3H6S E;  3FJC A;  3ZC9 A;  1G9C A;  1VCL A;  4CJM A;  3BAV A;  1S0C A;  2E4M C;  2J3P A;  3D7W B;  3O5W B;  1IRP A;  5DVH A;  3W9T A;  3BA7 A;  3POK A;  2KI4 A;  3K1X A;  3JUT A;  2Y9W C;  4KEK A;  1S0E A;  3UDA A;  3V0B B;  3O49 A;  4Z9W B;  3F62 B;  1DZD A;  1K5V A;  4I96 A;  3AH2 A;  1XHB A;  4QD2 B;  4OEG A;  4OUJ A;  2HWM A;  3VT1 A;  3FJK A;  4OW4 A;  5F8W A;  2Z48 A;  5EC5 A;  3VT0 A;  3Q7X A;  4I4V A;  3IAG C;  4G6J A;  3S8J A;  2ZQO A;  4GOY A;  4I2S A;  3BX1 C;  3VSZ A;  3BAG A;  4USP A;  4II0 A;  3FJA A;  1DQG A;  4LO1 C;  1EYL A;  4QBC A;  3TC2 A;  4DEP A;  3IIR A;  2D43 A;  2ESU A;  1T9F A;  4ZOT A;  4D0Z A;  5BXP A;  1F31 A;  2NZ9 A;  5F90 A;  4I4R A;  1XG6 A;  31BI A;  4ZA3 B;  3QYD A;  1HWP B;  3I29 B;  1DJS B;  1PC8 B;  3O4D A;  2VXT I;  3CU1 B;  3ZC8 A;  3BRG C;  3WMV A;  3H6Q A;  2Y9X E;  5D61 A;  2NP0 A;  2WBC A;  2F2F C;  1JQZ A;  4QKS A;  1AVA C;  2K43 A;  3CA5 A;  1II4 A;  1TIE A;  5BXS A;  4I4U A;  3I2A A;  4FVV A;  4I6I A;  3CA6 A;  2X2S A;  2HWA A;  2BEB A;  3PG0 A;  2VSE A;  3A21 A;  2L5X A;  4OEE A;  3R4U A;  1YYN A;  1ABR B;  2RQ9 A;  3RMY A;  5F8Y A;  1IRA X; 
#chains in the Genus database with same CATH topology
 3WIN A;  1DZC A;  2LIE A;  4KBB A;  1DFC A;  1IHK A;  2VXR A;  4LO3 C;  1R8N A;  2D22 A;  4XFU A;  3SNV A;  4QBV A;  1IT0 A;  1ISZ A;  4X37 A;  4HA2 A;  3FJ8 A;  3HMY A;  1RML A;  4LO0 A;  1DFQ A;  1RZO B;  2DRY A;  2UUS A;  3IM6 A;  4I4Q A;  3P6I A;  5FZU A;  1PZZ A;  4J2X A;  3WO3 A;  1BFC A;  2XOA A;  4GAF A;  1WBA A;  3AZW A;  2AQZ A;  1E0O A;  1JLX A;  1Q1U A;  3LTQ A;  1FN0 A;  2NM1 A;  1T4Q A;  1DIW A;  3VEQ A;  1IJT A;  1AF9 A;  4WBC A;  2DRE A;  3FGM A;  3BA4 A;  3WO2 A;  1K5U A;  1G9A A;  1ITB A;  1TTU A;  1M2T B;  2FFV A;  1FGA A;  4P0K A;  3BTA A;  2KH2 A;  1G9D A;  3VT2 A;  1HIB A;  3FUQ A;  5GAQ A;  1AVX B;  1ONK B;  4I8M A;  1YBI A;  2E4M A;  3BRF A;  3ILA A;  3V79 C;  1V6W A;  1PUM B;  1FV2 A;  3NJ5 A;  3F1R A;  3OGF A;  1R8O A;  3O4C A;  2D20 A;  1Z4S A;  3JRR A;  1FMM S;  4QKR A;  4L4H A;  3VWC A;  2FO1 A;  4G9N A;  2D1Z A;  1G82 A;  3AH1 A;  1D0H A;  4TLP A;  3WA1 A;  4A7Z A;  3BB2 A;  2FGF A;  3H6R B;  1BFF A;  3RMX A;  1V6X A;  4G6M A;  4D8H A;  2Y9F A;  5JLV A;  2I1B A;  3FJ9 A;  4LO8 B;  4AN6 A;  1QQL A;  3CRI A;  3AJ6 A;  1I1E A;  2WRY A;  3FJJ A;  3MPP G;  4IZE A;  1FMZ A;  2KLL A;  4D0T A;  5BOW A;  4QC4 A;  4ZFU B;  4ISQ A;  5E24 E;  4EB2 B;  3N7L A;  4IY8 A;  3WMU A;  2Q3N B;  3BAU A;  3V0B A;  3CA4 A;  3AH4 A;  1TWM A;  4L4I A;  2YUG A;  3Q7Y A;  1G9B A;  1TFM B;  1RY7 A;  1NZK A;  3FJE A;  1BAR A;  1S0L A;  5DUY A;  2VSA A;  4GAI A;  1TOO A;  3CA1 A;  3V0A B;  1P63 A;  1W3A A;  1Q04 A;  5I1B A;  4I4S A;  4H75 A;  4IYB A;  3NBE A;  2BEA A;  3IM7 A;  3KMV A;  1AFC A;  1BA7 A;  3A23 A;  4F34 A;  2GZB A;  3ZX7 A;  3S8K A;  3O4O A;  3V0A A;  1MC9 A;  3BAH A;  3FFZ A;  4KEJ A;  4LO7 B;  3OJM A;  4EEE B;  4ZLB B;  1MD6 A;  2D24 A;  2ERM A;  4I4O A;  3HOM A;  3AJ5 A;  3NBN A;  3RTJ B;  4Z8S B;  3AKI A;  4OWK A;  1W3G A;  2QYI B;  1IIL A;  1HKN A;  3RSJ A;  4EFQ A;  4J2K A;  3CQA A;  2X2T A;  2HZ9 A;  4LO3 A;  2AFG A;  4A7K A;  4EKX B;  4MZH A;  2ZQN A;  3FJI A;  4LO7 C;  5EHA A;  2MIB A;  1PWA A;  4X39 A;  4GP0 A;  1JT3 A;  5B2H A;  1DLL A;  1QXM A;  4JAW A;  4JRA A;  7I1B A;  4DEN A;  3IM5 A;  3VSF A;  1EPW A;  1HWN B;  2Q9X A;  1CVS A;  5BXT A;  1AVW B;  1DQO A;  3O44 A;  5BVP I;  3BAO A;  2KI6 B;  3CAH A;  5BP5 C;  1EVT A;  2HW9 A;  3WIN C;  3E8L C;  1ISX A;  1TP0 A;  4XKI A;  4EFR A;  4ISR A;  1AVU A;  1V6V A;  4Q9P A;  4I4X A;  2DS0 A;  4JKQ A;  5D63 A;  5DSS B;  1BFB A;  2NVH A;  3B9U A;  3C9Z A;  4EFP A;  2F8X C;  3I2X A;  3N7M A;  1WD4 A;  2QN4 A;  1FWV A;  1BLA A;  2AXM A;  4H9W A;  2RG9 B;  1SR4 C;  3AZV A;  4OWL A;  2RST A;  3O4B A;  4G1R A;  2LIQ A;  4JKX B;  1JT5 A;  4HR6 C;  4Q91 A;  1NUN A;  3VUO A;  3FJD A;  1ISW A;  2Z49 A;  1UPS A;  4YOL A;  4QO3 A;  3UJ4 A;  2MC2 A;  1ISV A;  2Y9G A;  1S0D A;  9ILB A;  1RG8 A;  3A22 A;  4MZG B;  3RTI B;  1FV3 A;  1HCD A;  3A07 A;  3FJH A;  3N0K A;  3OJV A;  5BQU C;  2D44 A;  3ZXD A;  3UD8 A;  1PUU B;  3UD7 A;  3BAD A;  2KKI A;  3HSM A;  4I37 A;  4LO2 C;  3O4A A;  3FJF A;  1TWE A;  1XZZ A;  2FFU A;  1JY0 A;  4IY9 A;  1FWU A;  3O3Q A;  1WD3 A;  3P6J A;  2M49 A;  21BI A;  3H6R A;  2IWT B;  4LO1 A;  5FZY A;  1GGP B;  1S0G A;  4I1E A;  3Q7W A;  4R6U B;  4FGF A;  4GP3 A;  1Z2V A;  1SZ6 B;  2GO2 A;  3CA3 A;  1KNM A;  2NYY A;  3R4S A;  2BFH A;  5HPZ A;  4XFT A;  4ZBV B;  4I7I A;  4G9M A;  3LLP A;  4IZX A;  1WBC A;  2F2F A;  4I4Y A;  1AXM A;  3BA5 A;  5D62 A;  4HJJ A;  3BRD A;  4IHZ A;  2ET2 A;  4QD2 C;  1BFG A;  1S0B A;  1YXW A;  3BAQ A;  2P23 A;  1L2H A;  4IQP A;  1YTO A;  3AKG A;  1JT4 A;  5G00 A;  4XFS A;  4P0J A;  2D7I A;  3OJ2 A;  4X38 A;  4JP0 A;  8I1B A;  1QQK A;  1Z0H A;  3QR5 A;  4GOV A;  1S0F A;  1BAS A;  1FQ9 A;  1IOB A;  4QAL A;  3CRH A;  2K8R A;  2NTD A;  3UD9 A;  1ILR 1;  3N7K A;  2FDB M;  4KEI A;  4ZGR B;  4I1B A;  2D7R A;  3EF2 A;  3T8S A;  4ION A;  5FNW A;  4OWJ A;  3PME A;  1OQL B;  4END A;  4X3A A;  3HAL A;  3HBW A;  4USO A;  3NBC A;  41BI A;  4J2Y A;  4ZFW B;  1N4K A;  1A8D A;  3ZXG A;  1V6U A;  1CE7 B;  4I0Y A;  3N7J A;  4ZKT B;  2D23 A;  2P39 A;  2R9K B;  2VU9 A;  1YF8 B;  1J0S A;  4JPZ A;  1JLY A;  4KC3 A;  1W3F A;  4UY4 A;  5FNX A;  1EV2 A;  2NS2 A;  5BP5 A;  2IHO A;  1JTC A;  4DCK C;  3P53 A;  4P0L A;  3OBT A;  1XYF A;  3UJ0 A;  5BXR A;  3AKH A;  1Q03 A;  5FZZ A;  1HWO B;  2ZR1 B;  3FJB A;  3NBD A;  4OEF A;  4PC4 A;  3MAL A;  4A7Y A;  1JT7 A;  4Q9G A;  5F8S A;  4H04 A;  4JQ0 A;  3PHZ A;  5JMC A;  5EG6 C;  4AN7 B;  3AKF A;  2DRZ A;  1M16 A;  3OBR A;  1SR4 A;  3CRG A;  2VUA A;  3PUB A;  4LO0 C;  3OGG A;  1BLD A;  4P6A A;  3CA0 A;  6I1B A;  3FUO A;  3HN1 A;  4J2S A;  4I3N A;  2VLC A;  4J23 B;  3WO4 A;  4F83 A;  2K4A B;  2MLL B;  4ZFY B;  1I1B A;  4I4P A;  5BQU A;  1HWM B;  5DZU A;  1ISY A;  2AAI B;  1HCE A;  4LO2 A;  3H6S E;  3FJC A;  3ZC9 A;  1G9C A;  1VCL A;  4CJM A;  3BAV A;  1S0C A;  2E4M C;  2J3P A;  3D7W B;  3O5W B;  1IRP A;  5DVH A;  3W9T A;  3BA7 A;  3POK A;  2KI4 A;  3K1X A;  3JUT A;  2Y9W C;  4KEK A;  1S0E A;  3UDA A;  3V0B B;  3O49 A;  4Z9W B;  3F62 B;  1DZD A;  1K5V A;  4I96 A;  3AH2 A;  1XHB A;  4QD2 B;  4OEG A;  4OUJ A;  2HWM A;  3VT1 A;  3FJK A;  4OW4 A;  5F8W A;  2Z48 A;  5EC5 A;  3VT0 A;  3Q7X A;  4I4V A;  3IAG C;  4G6J A;  3S8J A;  2ZQO A;  4GOY A;  4I2S A;  3BX1 C;  3VSZ A;  3BAG A;  4USP A;  4II0 A;  3FJA A;  1DQG A;  4LO1 C;  1EYL A;  4QBC A;  3TC2 A;  4DEP A;  3IIR A;  2D43 A;  2ESU A;  4MZF B;  1T9F A;  4ZOT A;  4D0Z A;  5BXP A;  1F31 A;  2NZ9 A;  5F90 A;  4I4R A;  1XG6 A;  31BI A;  4ZA3 B;  3QYD A;  1HWP B;  3I29 B;  1DJS B;  1PC8 B;  3O4D A;  2VXT I;  3CU1 B;  3ZC8 A;  3BRG C;  3WMV A;  3H6Q A;  2Y9X E;  5D61 A;  2NP0 A;  2WBC A;  2F2F C;  1JQZ A;  4QKS A;  1AVA C;  2K43 A;  3CA5 A;  1II4 A;  1TIE A;  5BXS A;  4I4U A;  3I2A A;  4FVV A;  4I6I A;  3CA6 A;  2X2S A;  2HWA A;  2BEB A;  3PG0 A;  2VSE A;  3A21 A;  2L5X A;  4OEE A;  3R4U A;  1YYN A;  1ABR B;  2RQ9 A;  3RMY A;  5F8Y A;  1IRA X; 
#chains in the Genus database with same CATH homology
 3WIN A;  1DZC A;  2LIE A;  4KBB A;  1DFC A;  1IHK A;  2VXR A;  4LO3 C;  1R8N A;  2D22 A;  4XFU A;  3SNV A;  4QBV A;  1IT0 A;  1ISZ A;  4X37 A;  4HA2 A;  3FJ8 A;  3HMY A;  1RML A;  4LO0 A;  1DFQ A;  1RZO B;  2DRY A;  2UUS A;  3IM6 A;  4I4Q A;  3P6I A;  5FZU A;  1PZZ A;  4J2X A;  3WO3 A;  1BFC A;  2XOA A;  4GAF A;  1WBA A;  3AZW A;  2AQZ A;  1E0O A;  1JLX A;  1Q1U A;  3LTQ A;  1FN0 A;  2NM1 A;  1T4Q A;  1DIW A;  3VEQ A;  1IJT A;  1AF9 A;  4WBC A;  2DRE A;  3FGM A;  3BA4 A;  3WO2 A;  1K5U A;  1G9A A;  1ITB A;  1TTU A;  1M2T B;  2FFV A;  1FGA A;  4P0K A;  3BTA A;  2KH2 A;  1G9D A;  3VT2 A;  1HIB A;  3FUQ A;  5GAQ A;  1AVX B;  1ONK B;  4I8M A;  1YBI A;  2E4M A;  3BRF A;  3ILA A;  3V79 C;  1V6W A;  1PUM B;  1FV2 A;  3NJ5 A;  3F1R A;  3OGF A;  1R8O A;  3O4C A;  2D20 A;  1Z4S A;  3JRR A;  1FMM S;  4QKR A;  4L4H A;  3VWC A;  2FO1 A;  4G9N A;  2D1Z A;  1G82 A;  3AH1 A;  1D0H A;  4TLP A;  3WA1 A;  4A7Z A;  3BB2 A;  2FGF A;  3H6R B;  1BFF A;  3RMX A;  1V6X A;  4G6M A;  4D8H A;  2Y9F A;  5JLV A;  2I1B A;  3FJ9 A;  4LO8 B;  4AN6 A;  1QQL A;  3CRI A;  3AJ6 A;  1I1E A;  2WRY A;  3FJJ A;  3MPP G;  4IZE A;  1FMZ A;  2KLL A;  4D0T A;  5BOW A;  4QC4 A;  4ZFU B;  4ISQ A;  5E24 E;  4EB2 B;  3N7L A;  4IY8 A;  3WMU A;  2Q3N B;  3BAU A;  3V0B A;  3CA4 A;  3AH4 A;  1TWM A;  4L4I A;  2YUG A;  3Q7Y A;  1G9B A;  1TFM B;  1RY7 A;  1NZK A;  3FJE A;  1BAR A;  1S0L A;  5DUY A;  2VSA A;  4GAI A;  1TOO A;  3CA1 A;  3V0A B;  1P63 A;  1W3A A;  1Q04 A;  5I1B A;  4I4S A;  4H75 A;  4IYB A;  3NBE A;  2BEA A;  3IM7 A;  3KMV A;  1AFC A;  1BA7 A;  3A23 A;  4F34 A;  2GZB A;  3ZX7 A;  3S8K A;  3O4O A;  3V0A A;  1MC9 A;  3BAH A;  3FFZ A;  4KEJ A;  4LO7 B;  3OJM A;  4EEE B;  4ZLB B;  1MD6 A;  2D24 A;  2ERM A;  4I4O A;  3HOM A;  3AJ5 A;  3NBN A;  3RTJ B;  4Z8S B;  3AKI A;  4OWK A;  1W3G A;  2QYI B;  1IIL A;  1HKN A;  3RSJ A;  4EFQ A;  4J2K A;  3CQA A;  2X2T A;  2HZ9 A;  4LO3 A;  2AFG A;  4A7K A;  4EKX B;  4MZH A;  2ZQN A;  3FJI A;  4LO7 C;  5EHA A;  2MIB A;  1PWA A;  4X39 A;  4GP0 A;  1JT3 A;  5B2H A;  1DLL A;  1QXM A;  4JAW A;  4JRA A;  7I1B A;  4DEN A;  3IM5 A;  3VSF A;  1EPW A;  1HWN B;  2Q9X A;  1CVS A;  5BXT A;  1AVW B;  1DQO A;  3O44 A;  5BVP I;  3BAO A;  2KI6 B;  3CAH A;  5BP5 C;  1EVT A;  2HW9 A;  3WIN C;  3E8L C;  1ISX A;  1TP0 A;  4XKI A;  4EFR A;  4ISR A;  1AVU A;  1V6V A;  4Q9P A;  4I4X A;  2DS0 A;  4JKQ A;  5D63 A;  5DSS B;  1BFB A;  2NVH A;  3B9U A;  3C9Z A;  4EFP A;  2F8X C;  3I2X A;  3N7M A;  1WD4 A;  2QN4 A;  1FWV A;  1BLA A;  2AXM A;  4H9W A;  2RG9 B;  1SR4 C;  3AZV A;  4OWL A;  2RST A;  3O4B A;  4G1R A;  2LIQ A;  4JKX B;  1JT5 A;  4HR6 C;  4Q91 A;  1NUN A;  3VUO A;  3FJD A;  1ISW A;  2Z49 A;  1UPS A;  4YOL A;  4QO3 A;  3UJ4 A;  2MC2 A;  1ISV A;  2Y9G A;  1S0D A;  9ILB A;  1RG8 A;  3A22 A;  4MZG B;  3RTI B;  1FV3 A;  1HCD A;  3A07 A;  3FJH A;  3N0K A;  3OJV A;  5BQU C;  2D44 A;  3ZXD A;  3UD8 A;  1PUU B;  3UD7 A;  3BAD A;  2KKI A;  3HSM A;  4I37 A;  4LO2 C;  3O4A A;  3FJF A;  1TWE A;  1XZZ A;  2FFU A;  1JY0 A;  4IY9 A;  1FWU A;  3O3Q A;  1WD3 A;  3P6J A;  2M49 A;  21BI A;  3H6R A;  2IWT B;  4LO1 A;  5FZY A;  1GGP B;  1S0G A;  4I1E A;  3Q7W A;  4R6U B;  4FGF A;  4GP3 A;  1Z2V A;  1SZ6 B;  2GO2 A;  3CA3 A;  1KNM A;  2NYY A;  3R4S A;  2BFH A;  5HPZ A;  4XFT A;  4ZBV B;  4I7I A;  4G9M A;  3LLP A;  4IZX A;  1WBC A;  2F2F A;  4I4Y A;  1AXM A;  3BA5 A;  5D62 A;  4HJJ A;  3BRD A;  4IHZ A;  2ET2 A;  4QD2 C;  1BFG A;  1S0B A;  1YXW A;  3BAQ A;  2P23 A;  1L2H A;  4IQP A;  1YTO A;  3AKG A;  1JT4 A;  5G00 A;  4XFS A;  4P0J A;  2D7I A;  3OJ2 A;  4X38 A;  4JP0 A;  8I1B A;  1QQK A;  1Z0H A;  3QR5 A;  4GOV A;  1S0F A;  1BAS A;  1FQ9 A;  1IOB A;  4QAL A;  3CRH A;  2K8R A;  2NTD A;  3UD9 A;  1ILR 1;  3N7K A;  2FDB M;  4KEI A;  4ZGR B;  4I1B A;  2D7R A;  3EF2 A;  3T8S A;  4ION A;  5FNW A;  4OWJ A;  3PME A;  1OQL B;  4END A;  4X3A A;  3HAL A;  3HBW A;  4USO A;  3NBC A;  41BI A;  4J2Y A;  4ZFW B;  1N4K A;  1A8D A;  3ZXG A;  1V6U A;  1CE7 B;  4I0Y A;  3N7J A;  4ZKT B;  2D23 A;  2P39 A;  2R9K B;  2VU9 A;  1YF8 B;  1J0S A;  4JPZ A;  1JLY A;  4KC3 A;  1W3F A;  4UY4 A;  5FNX A;  1EV2 A;  2NS2 A;  5BP5 A;  2IHO A;  1JTC A;  4DCK C;  3P53 A;  4P0L A;  3OBT A;  1XYF A;  3UJ0 A;  5BXR A;  3AKH A;  1Q03 A;  5FZZ A;  1HWO B;  2ZR1 B;  3FJB A;  3NBD A;  4OEF A;  4PC4 A;  3MAL A;  4A7Y A;  1JT7 A;  4Q9G A;  5F8S A;  4H04 A;  4JQ0 A;  3PHZ A;  5JMC A;  5EG6 C;  4AN7 B;  3AKF A;  2DRZ A;  1M16 A;  3OBR A;  1SR4 A;  3CRG A;  2VUA A;  3PUB A;  4LO0 C;  3OGG A;  1BLD A;  4P6A A;  3CA0 A;  6I1B A;  3FUO A;  3HN1 A;  4J2S A;  4I3N A;  2VLC A;  4J23 B;  3WO4 A;  4F83 A;  2K4A B;  2MLL B;  4ZFY B;  1I1B A;  4I4P A;  5BQU A;  1HWM B;  5DZU A;  1ISY A;  2AAI B;  1HCE A;  4LO2 A;  3H6S E;  3FJC A;  3ZC9 A;  1G9C A;  1VCL A;  4CJM A;  3BAV A;  1S0C A;  2E4M C;  2J3P A;  3D7W B;  3O5W B;  1IRP A;  5DVH A;  3W9T A;  3BA7 A;  3POK A;  2KI4 A;  3K1X A;  3JUT A;  2Y9W C;  4KEK A;  1S0E A;  3UDA A;  3V0B B;  3O49 A;  4Z9W B;  3F62 B;  1DZD A;  1K5V A;  4I96 A;  3AH2 A;  1XHB A;  4QD2 B;  4OEG A;  4OUJ A;  2HWM A;  3VT1 A;  3FJK A;  4OW4 A;  5F8W A;  2Z48 A;  5EC5 A;  3VT0 A;  3Q7X A;  4I4V A;  3IAG C;  4G6J A;  3S8J A;  2ZQO A;  4GOY A;  4I2S A;  3BX1 C;  3VSZ A;  3BAG A;  4USP A;  4II0 A;  3FJA A;  1DQG A;  4LO1 C;  1EYL A;  4QBC A;  3TC2 A;  4DEP A;  3IIR A;  2D43 A;  2ESU A;  4MZF B;  1T9F A;  4ZOT A;  4D0Z A;  5BXP A;  1F31 A;  2NZ9 A;  5F90 A;  4I4R A;  1XG6 A;  31BI A;  4ZA3 B;  3QYD A;  1HWP B;  3I29 B;  1DJS B;  1PC8 B;  3O4D A;  2VXT I;  3CU1 B;  3ZC8 A;  3BRG C;  3WMV A;  3H6Q A;  2Y9X E;  5D61 A;  2NP0 A;  2WBC A;  2F2F C;  1JQZ A;  4QKS A;  1AVA C;  2K43 A;  3CA5 A;  1II4 A;  1TIE A;  5BXS A;  4I4U A;  3I2A A;  4FVV A;  4I6I A;  3CA6 A;  2X2S A;  2HWA A;  2BEB A;  3PG0 A;  2VSE A;  3A21 A;  2L5X A;  4OEE A;  3R4U A;  1YYN A;  1ABR B;  2RQ9 A;  3RMY A;  5F8Y A;  1IRA X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...