4LO7C

Ha70(d3)-ha17-ha33
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
139
structure length
139
Chain Sequence
LPNGNYNIKSIFSGSLYLNPVSKSLTFSNESSANNQKWNVEYMAENRCFKISNVAEPNKYLSYDNFGFISLDSLSNRCYWFPIKIAVNTYIMLSLNKVNELDYAWDIYDTNENILSQPLLLLPNFDIYNSNQMFKLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HA-70
publication title Structure of a Bimodular Botulinum Neurotoxin Complex Provides Insights into Its Oral Toxicity.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Protein transport
total genus 33
structure length 139
sequence length 139
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4lo7C00
4ISRA 3ZXDA 2Y9GA 5DVHA 1TWEA 4F83A 3P6IA 2ET2A 1G9DA 2AQZA 1FN0A 3VUOA 3C9ZA 1ISWA 4XKIA 3R4SA 4EFRA 1JT3A 4ZLBB 1S0DA 3FJEA 4EEEB 4DCKC 1CVSA 2Q3NB 3FJDA 4I4RA 4ZBVB 1HIBA 1YTOA 3BAOA 2D20A 3VSZA 1WBAA 4HR6C 1DJSB 4I4SA 3EF2A 3CA5A 2AAIB 3JUTA 4GOVA 2HZ9A 4GP3A 4JP0A 1EPWA 3CA4A 4I96A 4X39A 5D62A 1KNMA 2DS0A 1DFQA 4QD2C 3NBDA 2MC2A 1AVXB 5I1BA 3A21A 3PG0A 3OGGA 1ISXA 3BA5A 3F1RA 2Y9WC 3BADA 3LLPA 1AVUA 3RMYA 3CRIA 1WD4A 5BOWA 1BLDA 3HOMA 3N7KA 4OEEA 2J3PA 1DQOA 2Z49A 4IZXA 4II0A 1BFFA 2FO1A 3A07A 2FFUA 3PHZA 3S8KA 3QYDA 5BXPA 3HSMA 3UD9A 3UD7A 3AJ5A 5EG6C 5EC5A 3NJ5A 1XZZA 1TOOA 3LTQA 4IYBA 2IHOA 4IZEA 4OW4A 1PUMB 2Q9XA 2YUGA 4IQPA 1S0GA 3O4AA 1DZCA 2DRYA 4X38A 4ZFYB 4XFUA 4ENDA 1K5VA 3AKHA 4AN6A 4G1RA 5GAQA 4LO7B 1XYFA 4HJJA 4J2YA 3Q7YA 2D1ZA 2ZR1B 2VSEA 3HN1A 5F8WA 3WMUA 4JQ0A 4IONA 1Z4SA 3WMVA 1A8DA 3CU1B 4A7KA 3P53A 3QR5A 1TIEA 4LO3A 3B9UA 2NP0A 4EFQA 1ISZA 1I1BA 4I4UA 1PZZA 2VSAA 5FZZA 1V6XA 4ZFUB 1M2TB 1BLAA 1NUNA 3IIRA 3O4OA 4QALA 1G9BA 3SNVA 4ZA3B 3Q7XA 1BFGA 1ISYA 5DUYA 1TTUA 4F34A 2F8XC 3CA0A 4G9MA 1XG6A 3CA1A 1R8NA 1W3GA 3VT1A 3CRHA 4QBCA 1SR4A 5BXRA 1BFBA 2KI6B 3FJKA 3H6QA 1QQKA 3RSJA 3FJFA 4ZGRB 3VT0A 3CA6A 1TP0A 5BQUC 2HW9A 1XHBA 2UUSA 3O49A 4IY8A 1UPSA 3VSFA 1IOBA 3V0BA 1JQZA 2KLLA 1FMMS 2DREA 3IM7A 5D63A 4OEFA 4QKSA 5JMCA 1IJTA 4I7IA 1E0OA 2KH2A 5HPZA 1AF9A 2FDBM 4I4XA 2BFHA 3OJ2A 4I1EA 2NVHA 1ITBA 5BQUA 1S0CA 2NZ9A 3FJHA 3MPPG 1ISVA 1EVTA 4USPA 4X3AA 4LO2C 3BAUA 5JLVA 4Z8SB 3N7MA 1DZDA 2I1BA 4L4IA 4QO3A 1YXWA 1RMLA 2IWTB 2K43A 1II4A 3I2XA 1DFCA 1G82A 4OWKA 1NZKA 4Q9GA 1WBCA 3RMXA 5FNWA 4EKXB 4J2KA 3OJMA 4I37A 3BAGA 3OBRA 5F90A 4LO2A 3N7LA 8I1BA 2Y9XE 5BP5C 1JLXA 1QQLA 3ZXGA 3V0AA 5EHAA 3VEQA 4D0TA 1Z2VA 2LIEA 3FUQA 1EV2A 1GGPB 3AZWA 4QBVA 4A7YA 4H9WA 4XFTA 4H04A 2MLLB 4G9NA 2D22A 3CA3A 2NTDA 1FGAA 4OEGA 4XFSA 2GZBA 4YOLA 5BXTA 5BP5A 1PUUB 3UDAA 2L5XA 4ISQA 3BA7A 1L2HA 4Q9PA 1HCEA 2E4MC 4L4HA 3O3QA 3F62B 3ZC9A 4G6JA 1JTCA 1SZ6B 3OGFA 1FWVA 2NYYA 3RTIB 3AKGA 4I8MA 1BA7A 1FWUA 1S0LA 1AVAC 4LO8B 1HWOB 1M16A 3ZX7A 9ILBA 4EB2B 5BXSA 1N4KA 1W3FA 2WRYA 3A22A 3FJ9A 4Q91A 3I2AA 5BVPI 2HWAA 4ZKTB 6I1BA 2P39A 1YBIA 3P6JA 5G00A 1Q04A 7I1BA 4I0YA 3VWCA 4LO1C 3AZVA 1QXMA 1CE7B 1RZOB 4I4YA 4KEIA 4D8HA 1D0HA 5DSSB 1J0SA 1FV3A 1HKNA 3FJAA 2VUAA 5FZYA 3PUBA 1Z0HA 4I4QA 3PMEA 31BIA 4P0KA 3AH1A 2NM1A 1G9AA 1RY7A 1MC9A 1JT5A 3ILAA 4HA2A 4LO1A 5DZUA 4P6AA 1BASA 1HWMB 4GAIA 4I3NA 1HCDA 1JY0A 4QD2B 3V0AB 3OJVA 5B2HA 3N7JA 3HBWA 4KEJA 3BRFA 3S8JA 4FGFA 3V79C 2M49A 3AH2A 3NBNA 1Q03A 1JT7A 4A7ZA 3CQAA 2X2TA 2ERMA 1MD6A 3BB2A 2Z48A 1VCLA 4KC3A 3O44A 5FZUA 3FGMA 1DLLA 4IY9A 3O4DA 4D0ZA 3FUOA 1TFMB 1IRPA 3AKFA 3WO3A 4LO0C 1P63A 1OQLB 3NBCA 4KEKA 3BRDA 1EYLA 3T8SA 1ABRB 2P23A 4TLPA 4EFPA 3HALA 3IM6A 1ONKB 2BEAA 1PWAA 4OWLA 1DIWA 1FQ9A 4WBCA 1G9CA 1I1EA 1W3AA 1T4QA 1FMZA 4R6UB 1FV2A 2D7IA 1F31A 3FJJA 3RTJB 4I1BA 4I6IA 4I4VA 4LO0A 1BARA 3KMVA 4OWJA 1ILR1 5E24E 3CRGA 2F2FC 2AFGA 2Y9FA 2MIBA 4FVVA 2ZQNA 3E8LC 3BAQA 4J2XA 3O4CA 3AKIA 3FJIA 3HMYA 2D44A 3H6RA 4JPZA 4GAFA 1TWMA 3BX1C 1T9FA 3VT2A 4KBBA 1AXMA 2D7RA 2RSTA 2D23A 2FFVA 2D43A 2RQ9A 2K8RA 3MALA 4OUJA 2ESUA 2X2SA 3O5WB 21BIA 2F2FA 4CJMA 2HWMA 3BRGC 1JLYA 1S0FA 1K5UA 1Q1UA 1AFCA 4Z9WB 3WO2A 4JKXB 4DEPA 3CAHA 4GOYA 2QN4A 1HWPB 4JAWA 5D61A 4J2SA 4ZFWB 1YF8B 3V0BB 1V6VA 3BA4A 2KKIA 3UJ4A 3FFZA 2AXMA 3AJ6A 4P0LA 41BIA 4J23B 1V6WA 3UD8A 2K4AB 2RG9B 3POKA 4G6MA 1IHKA 4LO3C 2E4MA 4ZOTA 4IHZA 1DQGA 4I2SA 2GO2A 2KI4A 2XOAA 4JKQA 4QC4A 3WINC 3IAGC 1IT0A 4QKRA 4JRAA 2FGFA 3Q7WA 2QYIB 1AVWB 1JT4A 3K1XA 3O4BA 4I4PA 2DRZA 1HWNB 1YYNA 3BAVA 3UJ0A 3FJBA 3JRRA 3WINA 4USOA 3TC2A 4P0JA 3I29B 5F8YA 1RG8A 1WD3A 3N0KA 3OBTA 3WA1A 3D7WB 3ZC8A 5F8SA 1BFCA 5FNXA 1IILA 1SR4C 2VU9A 4GP0A 2BEBA 4AN7B 1IRAX 2WBCA 3BAHA 2VXTI 2LIQA 1PC8B 2R9KB 1V6UA 3R4UA 3W9TA 1R8OA 4I4OA 4DENA 3H6RB 2D24A 2VLCA 2VXRA 4X37A 3NBEA 3FJCA 4LO7C 3A23A 3BTAA 1S0BA 2ZQOA 3H6SE 3WO4A 1S0EA 3IM5A 4PC4A 3AH4A 3FJ8A
chains in the Genus database with same CATH superfamily
4ISRA 3ZXDA 2Y9GA 5DVHA 1TWEA 4F83A 3P6IA 2ET2A 1G9DA 2AQZA 1FN0A 3VUOA 3C9ZA 1ISWA 4XKIA 3R4SA 4EFRA 1JT3A 4ZLBB 1S0DA 3FJEA 4EEEB 4DCKC 1CVSA 2Q3NB 3FJDA 4I4RA 4ZBVB 1HIBA 1YTOA 3BAOA 2D20A 3VSZA 1WBAA 4HR6C 1DJSB 4I4SA 3EF2A 3CA5A 2AAIB 3JUTA 4GOVA 2HZ9A 4GP3A 2NS2A 4MZGB 4JP0A 1EPWA 3CA4A 4I96A 4X39A 5D62A 1KNMA 2DS0A 1DFQA 4QD2C 3NBDA 2MC2A 1AVXB 5I1BA 3A21A 3PG0A 3OGGA 1ISXA 3BA5A 3F1RA 2Y9WC 3BADA 3LLPA 1AVUA 3RMYA 3CRIA 1WD4A 5BOWA 1BLDA 3HOMA 3N7KA 4OEEA 2J3PA 1DQOA 2Z49A 4IZXA 4II0A 1BFFA 2FO1A 3A07A 2FFUA 3PHZA 3S8KA 3QYDA 5BXPA 3HSMA 3UD9A 3UD7A 3AJ5A 5EG6C 5EC5A 3NJ5A 1XZZA 1TOOA 3LTQA 4IYBA 2IHOA 4IZEA 4OW4A 1PUMB 2Q9XA 2YUGA 4IQPA 1S0GA 3O4AA 1DZCA 2DRYA 4X38A 4ZFYB 4XFUA 4ENDA 1K5VA 3AKHA 4AN6A 4G1RA 5GAQA 4LO7B 1XYFA 4HJJA 4J2YA 3Q7YA 2D1ZA 2ZR1B 2VSEA 3HN1A 5F8WA 3WMUA 4JQ0A 4IONA 1Z4SA 3WMVA 1A8DA 3CU1B 4A7KA 3P53A 3QR5A 1TIEA 4LO3A 3B9UA 2NP0A 4EFQA 1ISZA 1I1BA 4I4UA 1PZZA 2VSAA 5FZZA 1V6XA 4ZFUB 1M2TB 1BLAA 1NUNA 3IIRA 3O4OA 4QALA 1G9BA 3SNVA 4ZA3B 3Q7XA 1BFGA 1ISYA 5DUYA 1TTUA 4F34A 2F8XC 3CA0A 4G9MA 1XG6A 3CA1A 1R8NA 1W3GA 3VT1A 3CRHA 4QBCA 1SR4A 5BXRA 1BFBA 2KI6B 3FJKA 3H6QA 1QQKA 3RSJA 3FJFA 4ZGRB 3VT0A 3CA6A 1TP0A 4MZHA 5BQUC 2HW9A 1XHBA 2UUSA 3O49A 4IY8A 1UPSA 3VSFA 1IOBA 3V0BA 1JQZA 2KLLA 1FMMS 2DREA 3IM7A 5D63A 4OEFA 4QKSA 5JMCA 1IJTA 4I7IA 1E0OA 2KH2A 5HPZA 1AF9A 2FDBM 4I4XA 2BFHA 3OJ2A 4I1EA 2NVHA 1ITBA 5BQUA 1S0CA 2NZ9A 3FJHA 3MPPG 1ISVA 1EVTA 4USPA 4X3AA 4LO2C 3BAUA 5JLVA 4Z8SB 3N7MA 1DZDA 2I1BA 4L4IA 4QO3A 1YXWA 1RMLA 2IWTB 2K43A 1II4A 3I2XA 1DFCA 1G82A 4OWKA 1NZKA 4Q9GA 1WBCA 3RMXA 5FNWA 4EKXB 4J2KA 3OJMA 4I37A 3BAGA 3OBRA 5F90A 4LO2A 3N7LA 8I1BA 2Y9XE 5BP5C 1JLXA 1QQLA 3ZXGA 3V0AA 5EHAA 3VEQA 4D0TA 1Z2VA 2LIEA 3FUQA 1EV2A 1GGPB 3AZWA 4QBVA 4A7YA 4H9WA 4XFTA 4H04A 2MLLB 4G9NA 4MZFB 2D22A 3CA3A 2NTDA 1FGAA 4OEGA 4XFSA 2GZBA 4YOLA 5BXTA 5BP5A 1PUUB 3UDAA 2L5XA 4ISQA 3BA7A 1L2HA 4Q9PA 1HCEA 2E4MC 4L4HA 3O3QA 3F62B 3ZC9A 4G6JA 1JTCA 1SZ6B 3OGFA 1FWVA 2NYYA 3RTIB 3AKGA 4I8MA 1BA7A 1FWUA 1S0LA 1AVAC 4LO8B 1HWOB 1M16A 3ZX7A 9ILBA 4EB2B 5BXSA 1N4KA 1W3FA 2WRYA 3A22A 3FJ9A 4UY4A 4Q91A 3I2AA 5BVPI 2HWAA 4ZKTB 6I1BA 2P39A 1YBIA 3P6JA 5G00A 1Q04A 7I1BA 4I0YA 3VWCA 4LO1C 3AZVA 1QXMA 1CE7B 1RZOB 4I4YA 4KEIA 4D8HA 1D0HA 5DSSB 1J0SA 1FV3A 1HKNA 3FJAA 2VUAA 5FZYA 3PUBA 1Z0HA 4I4QA 3PMEA 31BIA 4P0KA 3AH1A 2NM1A 1G9AA 1RY7A 1MC9A 1JT5A 3ILAA 4HA2A 4LO1A 5DZUA 4P6AA 1BASA 1HWMB 4GAIA 4I3NA 1HCDA 1JY0A 4QD2B 3V0AB 3OJVA 5B2HA 3N7JA 3HBWA 4KEJA 3BRFA 3S8JA 4FGFA 3V79C 2M49A 3AH2A 3NBNA 1Q03A 1JT7A 4A7ZA 3CQAA 2X2TA 2ERMA 1MD6A 3BB2A 2Z48A 1VCLA 4KC3A 3O44A 5FZUA 3FGMA 1DLLA 4IY9A 3O4DA 4D0ZA 3FUOA 1TFMB 1IRPA 3AKFA 4H75A 3WO3A 4LO0C 1P63A 1OQLB 3NBCA 4KEKA 3BRDA 1EYLA 3T8SA 1ABRB 2P23A 4TLPA 4EFPA 3HALA 3IM6A 1ONKB 2BEAA 1PWAA 4OWLA 1DIWA 1FQ9A 4WBCA 1G9CA 1I1EA 1W3AA 1T4QA 1FMZA 4R6UB 1FV2A 2D7IA 1F31A 3FJJA 3RTJB 4I1BA 4I6IA 4I4VA 4LO0A 1BARA 3KMVA 4OWJA 1ILR1 5E24E 3CRGA 2F2FC 2AFGA 2Y9FA 2MIBA 4FVVA 2ZQNA 3E8LC 3BAQA 4J2XA 3O4CA 3AKIA 3FJIA 3HMYA 2D44A 3H6RA 4JPZA 4GAFA 1TWMA 3BX1C 1T9FA 3VT2A 4KBBA 1AXMA 2D7RA 2RSTA 2D23A 2FFVA 2D43A 2RQ9A 2K8RA 3MALA 4OUJA 2ESUA 2X2SA 3O5WB 21BIA 2F2FA 4CJMA 2HWMA 3BRGC 1JLYA 1S0FA 1K5UA 1Q1UA 1AFCA 4Z9WB 3WO2A 4JKXB 4DEPA 3CAHA 4GOYA 2QN4A 1HWPB 4JAWA 5D61A 4J2SA 4ZFWB 1YF8B 3V0BB 1V6VA 3BA4A 2KKIA 3UJ4A 3FFZA 2AXMA 3AJ6A 4P0LA 41BIA 4J23B 1V6WA 3UD8A 2K4AB 2RG9B 3POKA 4G6MA 1IHKA 4LO3C 2E4MA 4ZOTA 4IHZA 1DQGA 4I2SA 2GO2A 2KI4A 2XOAA 4JKQA 4QC4A 3WINC 3IAGC 1IT0A 4QKRA 4JRAA 2FGFA 3Q7WA 2QYIB 1AVWB 1JT4A 3K1XA 3O4BA 4I4PA 2DRZA 1HWNB 1YYNA 3BAVA 3UJ0A 3FJBA 3JRRA 3WINA 4USOA 3TC2A 4P0JA 3I29B 5F8YA 1RG8A 1WD3A 3N0KA 3OBTA 3WA1A 3D7WB 3ZC8A 5F8SA 1BFCA 5FNXA 1IILA 1SR4C 2VU9A 4GP0A 2BEBA 4AN7B 1IRAX 2WBCA 3BAHA 2VXTI 2LIQA 1PC8B 2R9KB 1V6UA 3R4UA 3W9TA 1R8OA 4I4OA 4DENA 3H6RB 2D24A 2VLCA 2VXRA 4X37A 3NBEA 3FJCA 4LO7C 3A23A 3BTAA 1S0BA 2ZQOA 3H6SE 3WO4A 1S0EA 3IM5A 4PC4A 3AH4A 3FJ8A
chains in the Genus database with same CATH topology
4ISRA 3ZXDA 2Y9GA 5DVHA 1TWEA 4F83A 3P6IA 2ET2A 1G9DA 2AQZA 1FN0A 3VUOA 3C9ZA 1ISWA 4XKIA 3R4SA 4EFRA 1JT3A 4ZLBB 1S0DA 3FJEA 4EEEB 4DCKC 1CVSA 2Q3NB 3FJDA 4I4RA 4ZBVB 1HIBA 1YTOA 3BAOA 2D20A 3VSZA 1WBAA 4HR6C 1DJSB 4I4SA 3EF2A 3CA5A 2AAIB 3JUTA 4GOVA 2HZ9A 4GP3A 2NS2A 4MZGB 4JP0A 1EPWA 3CA4A 4I96A 4X39A 5D62A 1KNMA 2DS0A 1DFQA 4QD2C 3NBDA 2MC2A 1AVXB 5I1BA 3A21A 3PG0A 3OGGA 1ISXA 3BA5A 3F1RA 2Y9WC 3BADA 3LLPA 1AVUA 3RMYA 3CRIA 1WD4A 5BOWA 1BLDA 3HOMA 3N7KA 4OEEA 2J3PA 1DQOA 2Z49A 4IZXA 4II0A 1BFFA 2FO1A 3A07A 2FFUA 3PHZA 3S8KA 3QYDA 5BXPA 3HSMA 3UD9A 3UD7A 3AJ5A 5EG6C 5EC5A 3NJ5A 1XZZA 1TOOA 3LTQA 4IYBA 2IHOA 4IZEA 4OW4A 1PUMB 2Q9XA 2YUGA 4IQPA 1S0GA 3O4AA 1DZCA 2DRYA 4X38A 4ZFYB 4XFUA 4ENDA 1K5VA 3AKHA 4AN6A 4G1RA 5GAQA 4LO7B 1XYFA 4HJJA 4J2YA 3Q7YA 2D1ZA 2ZR1B 2VSEA 3HN1A 5F8WA 3WMUA 4JQ0A 4IONA 1Z4SA 3WMVA 1A8DA 3CU1B 4A7KA 3P53A 3QR5A 1TIEA 4LO3A 3B9UA 2NP0A 4EFQA 1ISZA 1I1BA 4I4UA 1PZZA 2VSAA 5FZZA 1V6XA 4ZFUB 1M2TB 1BLAA 1NUNA 3IIRA 3O4OA 4QALA 1G9BA 3SNVA 4ZA3B 3Q7XA 1BFGA 1ISYA 5DUYA 1TTUA 4F34A 2F8XC 3CA0A 4G9MA 1XG6A 3CA1A 1R8NA 1W3GA 3VT1A 3CRHA 4QBCA 1SR4A 5BXRA 1BFBA 2KI6B 3FJKA 3H6QA 1QQKA 3RSJA 3FJFA 4ZGRB 3VT0A 3CA6A 1TP0A 4MZHA 5BQUC 2HW9A 1XHBA 2UUSA 3O49A 4IY8A 1UPSA 3VSFA 1IOBA 3V0BA 1JQZA 2KLLA 1FMMS 2DREA 3IM7A 5D63A 4OEFA 4QKSA 5JMCA 1IJTA 4I7IA 1E0OA 2KH2A 5HPZA 1AF9A 2FDBM 4I4XA 2BFHA 3OJ2A 4I1EA 2NVHA 1ITBA 5BQUA 1S0CA 2NZ9A 3FJHA 3MPPG 1ISVA 1EVTA 4USPA 4X3AA 4LO2C 3BAUA 5JLVA 4Z8SB 3N7MA 1DZDA 2I1BA 4L4IA 4QO3A 1YXWA 1RMLA 2IWTB 2K43A 1II4A 3I2XA 1DFCA 1G82A 4OWKA 1NZKA 4Q9GA 1WBCA 3RMXA 5FNWA 4EKXB 4J2KA 3OJMA 4I37A 3BAGA 3OBRA 5F90A 4LO2A 3N7LA 8I1BA 2Y9XE 5BP5C 1JLXA 1QQLA 3ZXGA 3V0AA 5EHAA 3VEQA 4D0TA 1Z2VA 2LIEA 3FUQA 1EV2A 1GGPB 3AZWA 4QBVA 4A7YA 4H9WA 4XFTA 4H04A 2MLLB 4G9NA 4MZFB 2D22A 3CA3A 2NTDA 1FGAA 4OEGA 4XFSA 2GZBA 4YOLA 5BXTA 5BP5A 1PUUB 3UDAA 2L5XA 4ISQA 3BA7A 1L2HA 4Q9PA 1HCEA 2E4MC 4L4HA 3O3QA 3F62B 3ZC9A 4G6JA 1JTCA 1SZ6B 3OGFA 1FWVA 2NYYA 3RTIB 3AKGA 4I8MA 1BA7A 1FWUA 1S0LA 1AVAC 4LO8B 1HWOB 1M16A 3ZX7A 9ILBA 4EB2B 5BXSA 1N4KA 1W3FA 2WRYA 3A22A 3FJ9A 4UY4A 4Q91A 3I2AA 5BVPI 2HWAA 4ZKTB 6I1BA 2P39A 1YBIA 3P6JA 5G00A 1Q04A 7I1BA 4I0YA 3VWCA 4LO1C 3AZVA 1QXMA 1CE7B 1RZOB 4I4YA 4KEIA 4D8HA 1D0HA 5DSSB 1J0SA 1FV3A 1HKNA 3FJAA 2VUAA 5FZYA 3PUBA 1Z0HA 4I4QA 3PMEA 31BIA 4P0KA 3AH1A 2NM1A 1G9AA 1RY7A 1MC9A 1JT5A 3ILAA 4HA2A 4LO1A 5DZUA 4P6AA 1BASA 1HWMB 4GAIA 4I3NA 1HCDA 1JY0A 4QD2B 3V0AB 3OJVA 5B2HA 3N7JA 3HBWA 4KEJA 3BRFA 3S8JA 4FGFA 3V79C 2M49A 3AH2A 3NBNA 1Q03A 1JT7A 4A7ZA 3CQAA 2X2TA 2ERMA 1MD6A 3BB2A 2Z48A 1VCLA 4KC3A 3O44A 5FZUA 3FGMA 1DLLA 4IY9A 3O4DA 4D0ZA 3FUOA 1TFMB 1IRPA 3AKFA 4H75A 3WO3A 4LO0C 1P63A 1OQLB 3NBCA 4KEKA 3BRDA 1EYLA 3T8SA 1ABRB 2P23A 4TLPA 4EFPA 3HALA 3IM6A 1ONKB 2BEAA 1PWAA 4OWLA 1DIWA 1FQ9A 4WBCA 1G9CA 1I1EA 1W3AA 1T4QA 1FMZA 4R6UB 1FV2A 2D7IA 1F31A 3FJJA 3RTJB 4I1BA 4I6IA 4I4VA 4LO0A 1BARA 3KMVA 4OWJA 1ILR1 5E24E 3CRGA 2F2FC 2AFGA 2Y9FA 2MIBA 4FVVA 2ZQNA 3E8LC 3BAQA 4J2XA 3O4CA 3AKIA 3FJIA 3HMYA 2D44A 3H6RA 4JPZA 4GAFA 1TWMA 3BX1C 1T9FA 3VT2A 4KBBA 1AXMA 2D7RA 2RSTA 2D23A 2FFVA 2D43A 2RQ9A 2K8RA 3MALA 4OUJA 2ESUA 2X2SA 3O5WB 21BIA 2F2FA 4CJMA 2HWMA 3BRGC 1JLYA 1S0FA 1K5UA 1Q1UA 1AFCA 4Z9WB 3WO2A 4JKXB 4DEPA 3CAHA 4GOYA 2QN4A 1HWPB 4JAWA 5D61A 4J2SA 4ZFWB 1YF8B 3V0BB 1V6VA 3BA4A 2KKIA 3UJ4A 3FFZA 2AXMA 3AJ6A 4P0LA 41BIA 4J23B 1V6WA 3UD8A 2K4AB 2RG9B 3POKA 4G6MA 1IHKA 4LO3C 2E4MA 4ZOTA 4IHZA 1DQGA 4I2SA 2GO2A 2KI4A 2XOAA 4JKQA 4QC4A 3WINC 3IAGC 1IT0A 4QKRA 4JRAA 2FGFA 3Q7WA 2QYIB 1AVWB 1JT4A 3K1XA 3O4BA 4I4PA 2DRZA 1HWNB 1YYNA 3BAVA 3UJ0A 3FJBA 3JRRA 3WINA 4USOA 3TC2A 4P0JA 3I29B 5F8YA 1RG8A 1WD3A 3N0KA 3OBTA 3WA1A 3D7WB 3ZC8A 5F8SA 1BFCA 5FNXA 1IILA 1SR4C 2VU9A 4GP0A 2BEBA 4AN7B 1IRAX 2WBCA 3BAHA 2VXTI 2LIQA 1PC8B 2R9KB 1V6UA 3R4UA 3W9TA 1R8OA 4I4OA 4DENA 3H6RB 2D24A 2VLCA 2VXRA 4X37A 3NBEA 3FJCA 4LO7C 3A23A 3BTAA 1S0BA 2ZQOA 3H6SE 3WO4A 1S0EA 3IM5A 4PC4A 3AH4A 3FJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ISR A;  3ZXD A;  2Y9G A;  5DVH A;  1TWE A;  4F83 A;  3P6I A;  2ET2 A;  1G9D A;  2AQZ A;  1FN0 A;  3VUO A;  3C9Z A;  1ISW A;  4XKI A;  3R4S A;  4EFR A;  1JT3 A;  4ZLB B;  1S0D A;  3FJE A;  4EEE B;  4DCK C;  1CVS A;  2Q3N B;  3FJD A;  4I4R A;  4ZBV B;  1HIB A;  1YTO A;  3BAO A;  2D20 A;  3VSZ A;  1WBA A;  4HR6 C;  1DJS B;  4I4S A;  3EF2 A;  3CA5 A;  2AAI B;  3JUT A;  4GOV A;  2HZ9 A;  4GP3 A;  4JP0 A;  1EPW A;  3CA4 A;  4I96 A;  4X39 A;  5D62 A;  1KNM A;  2DS0 A;  1DFQ A;  4QD2 C;  3NBD A;  2MC2 A;  1AVX B;  5I1B A;  3A21 A;  3PG0 A;  3OGG A;  1ISX A;  3BA5 A;  3F1R A;  2Y9W C;  3BAD A;  3LLP A;  1AVU A;  3RMY A;  3CRI A;  1WD4 A;  5BOW A;  1BLD A;  3HOM A;  3N7K A;  4OEE A;  2J3P A;  1DQO A;  2Z49 A;  4IZX A;  4II0 A;  1BFF A;  2FO1 A;  3A07 A;  2FFU A;  3PHZ A;  3S8K A;  3QYD A;  5BXP A;  3HSM A;  3UD9 A;  3UD7 A;  3AJ5 A;  5EG6 C;  5EC5 A;  3NJ5 A;  1XZZ A;  1TOO A;  3LTQ A;  4IYB A;  2IHO A;  4IZE A;  4OW4 A;  1PUM B;  2Q9X A;  2YUG A;  4IQP A;  1S0G A;  3O4A A;  1DZC A;  2DRY A;  4X38 A;  4ZFY B;  4XFU A;  4END A;  1K5V A;  3AKH A;  4AN6 A;  4G1R A;  5GAQ A;  4LO7 B;  1XYF A;  4HJJ A;  4J2Y A;  3Q7Y A;  2D1Z A;  2ZR1 B;  2VSE A;  3HN1 A;  5F8W A;  3WMU A;  4JQ0 A;  4ION A;  1Z4S A;  3WMV A;  1A8D A;  3CU1 B;  4A7K A;  3P53 A;  3QR5 A;  1TIE A;  4LO3 A;  3B9U A;  2NP0 A;  4EFQ A;  1ISZ A;  1I1B A;  4I4U A;  1PZZ A;  2VSA A;  5FZZ A;  1V6X A;  4ZFU B;  1M2T B;  1BLA A;  1NUN A;  3IIR A;  3O4O A;  4QAL A;  1G9B A;  3SNV A;  4ZA3 B;  3Q7X A;  1BFG A;  1ISY A;  5DUY A;  1TTU A;  4F34 A;  2F8X C;  3CA0 A;  4G9M A;  1XG6 A;  3CA1 A;  1R8N A;  1W3G A;  3VT1 A;  3CRH A;  4QBC A;  1SR4 A;  5BXR A;  1BFB A;  2KI6 B;  3FJK A;  3H6Q A;  1QQK A;  3RSJ A;  3FJF A;  4ZGR B;  3VT0 A;  3CA6 A;  1TP0 A;  5BQU C;  2HW9 A;  1XHB A;  2UUS A;  3O49 A;  4IY8 A;  1UPS A;  3VSF A;  1IOB A;  3V0B A;  1JQZ A;  2KLL A;  1FMM S;  2DRE A;  3IM7 A;  5D63 A;  4OEF A;  4QKS A;  5JMC A;  1IJT A;  4I7I A;  1E0O A;  2KH2 A;  5HPZ A;  1AF9 A;  2FDB M;  4I4X A;  2BFH A;  3OJ2 A;  4I1E A;  2NVH A;  1ITB A;  5BQU A;  1S0C A;  2NZ9 A;  3FJH A;  3MPP G;  1ISV A;  1EVT A;  4USP A;  4X3A A;  4LO2 C;  3BAU A;  5JLV A;  4Z8S B;  3N7M A;  1DZD A;  2I1B A;  4L4I A;  4QO3 A;  1YXW A;  1RML A;  2IWT B;  2K43 A;  1II4 A;  3I2X A;  1DFC A;  1G82 A;  4OWK A;  1NZK A;  4Q9G A;  1WBC A;  3RMX A;  5FNW A;  4EKX B;  4J2K A;  3OJM A;  4I37 A;  3BAG A;  3OBR A;  5F90 A;  4LO2 A;  3N7L A;  8I1B A;  2Y9X E;  5BP5 C;  1JLX A;  1QQL A;  3ZXG A;  3V0A A;  5EHA A;  3VEQ A;  4D0T A;  1Z2V A;  2LIE A;  3FUQ A;  1EV2 A;  1GGP B;  3AZW A;  4QBV A;  4A7Y A;  4H9W A;  4XFT A;  4H04 A;  2MLL B;  4G9N A;  2D22 A;  3CA3 A;  2NTD A;  1FGA A;  4OEG A;  4XFS A;  2GZB A;  4YOL A;  5BXT A;  5BP5 A;  1PUU B;  3UDA A;  2L5X A;  4ISQ A;  3BA7 A;  1L2H A;  4Q9P A;  1HCE A;  2E4M C;  4L4H A;  3O3Q A;  3F62 B;  3ZC9 A;  4G6J A;  1JTC A;  1SZ6 B;  3OGF A;  1FWV A;  2NYY A;  3RTI B;  3AKG A;  4I8M A;  1BA7 A;  1FWU A;  1S0L A;  1AVA C;  4LO8 B;  1HWO B;  1M16 A;  3ZX7 A;  9ILB A;  4EB2 B;  5BXS A;  1N4K A;  1W3F A;  2WRY A;  3A22 A;  3FJ9 A;  4Q91 A;  3I2A A;  5BVP I;  2HWA A;  4ZKT B;  6I1B A;  2P39 A;  1YBI A;  3P6J A;  5G00 A;  1Q04 A;  7I1B A;  4I0Y A;  3VWC A;  4LO1 C;  3AZV A;  1QXM A;  1CE7 B;  1RZO B;  4I4Y A;  4KEI A;  4D8H A;  1D0H A;  5DSS B;  1J0S A;  1FV3 A;  1HKN A;  3FJA A;  2VUA A;  5FZY A;  3PUB A;  1Z0H A;  4I4Q A;  3PME A;  31BI A;  4P0K A;  3AH1 A;  2NM1 A;  1G9A A;  1RY7 A;  1MC9 A;  1JT5 A;  3ILA A;  4HA2 A;  4LO1 A;  5DZU A;  4P6A A;  1BAS A;  1HWM B;  4GAI A;  4I3N A;  1HCD A;  1JY0 A;  4QD2 B;  3V0A B;  3OJV A;  5B2H A;  3N7J A;  3HBW A;  4KEJ A;  3BRF A;  3S8J A;  4FGF A;  3V79 C;  2M49 A;  3AH2 A;  3NBN A;  1Q03 A;  1JT7 A;  4A7Z A;  3CQA A;  2X2T A;  2ERM A;  1MD6 A;  3BB2 A;  2Z48 A;  1VCL A;  4KC3 A;  3O44 A;  5FZU A;  3FGM A;  1DLL A;  4IY9 A;  3O4D A;  4D0Z A;  3FUO A;  1TFM B;  1IRP A;  3AKF A;  3WO3 A;  4LO0 C;  1P63 A;  1OQL B;  3NBC A;  4KEK A;  3BRD A;  1EYL A;  3T8S A;  1ABR B;  2P23 A;  4TLP A;  4EFP A;  3HAL A;  3IM6 A;  1ONK B;  2BEA A;  1PWA A;  4OWL A;  1DIW A;  1FQ9 A;  4WBC A;  1G9C A;  1I1E A;  1W3A A;  1T4Q A;  1FMZ A;  4R6U B;  1FV2 A;  2D7I A;  1F31 A;  3FJJ A;  3RTJ B;  4I1B A;  4I6I A;  4I4V A;  4LO0 A;  1BAR A;  3KMV A;  4OWJ A;  1ILR 1;  5E24 E;  3CRG A;  2F2F C;  2AFG A;  2Y9F A;  2MIB A;  4FVV A;  2ZQN A;  3E8L C;  3BAQ A;  4J2X A;  3O4C A;  3AKI A;  3FJI A;  3HMY A;  2D44 A;  3H6R A;  4JPZ A;  4GAF A;  1TWM A;  3BX1 C;  1T9F A;  3VT2 A;  4KBB A;  1AXM A;  2D7R A;  2RST A;  2D23 A;  2FFV A;  2D43 A;  2RQ9 A;  2K8R A;  3MAL A;  4OUJ A;  2ESU A;  2X2S A;  3O5W B;  21BI A;  2F2F A;  4CJM A;  2HWM A;  3BRG C;  1JLY A;  1S0F A;  1K5U A;  1Q1U A;  1AFC A;  4Z9W B;  3WO2 A;  4JKX B;  4DEP A;  3CAH A;  4GOY A;  2QN4 A;  1HWP B;  4JAW A;  5D61 A;  4J2S A;  4ZFW B;  1YF8 B;  3V0B B;  1V6V A;  3BA4 A;  2KKI A;  3UJ4 A;  3FFZ A;  2AXM A;  3AJ6 A;  4P0L A;  41BI A;  4J23 B;  1V6W A;  3UD8 A;  2K4A B;  2RG9 B;  3POK A;  4G6M A;  1IHK A;  4LO3 C;  2E4M A;  4ZOT A;  4IHZ A;  1DQG A;  4I2S A;  2GO2 A;  2KI4 A;  2XOA A;  4JKQ A;  4QC4 A;  3WIN C;  3IAG C;  1IT0 A;  4QKR A;  4JRA A;  2FGF A;  3Q7W A;  2QYI B;  1AVW B;  1JT4 A;  3K1X A;  3O4B A;  4I4P A;  2DRZ A;  1HWN B;  1YYN A;  3BAV A;  3UJ0 A;  3FJB A;  3JRR A;  3WIN A;  4USO A;  3TC2 A;  4P0J A;  3I29 B;  5F8Y A;  1RG8 A;  1WD3 A;  3N0K A;  3OBT A;  3WA1 A;  3D7W B;  3ZC8 A;  5F8S A;  1BFC A;  5FNX A;  1IIL A;  1SR4 C;  2VU9 A;  4GP0 A;  2BEB A;  4AN7 B;  1IRA X;  2WBC A;  3BAH A;  2VXT I;  2LIQ A;  1PC8 B;  2R9K B;  1V6U A;  3R4U A;  3W9T A;  1R8O A;  4I4O A;  4DEN A;  3H6R B;  2D24 A;  2VLC A;  2VXR A;  4X37 A;  3NBE A;  3FJC A;  4LO7 C;  3A23 A;  3BTA A;  1S0B A;  2ZQO A;  3H6S E;  3WO4 A;  1S0E A;  3IM5 A;  4PC4 A;  3AH4 A;  3FJ8 A; 
#chains in the Genus database with same CATH topology
 4ISR A;  3ZXD A;  2Y9G A;  5DVH A;  1TWE A;  4F83 A;  3P6I A;  2ET2 A;  1G9D A;  2AQZ A;  1FN0 A;  3VUO A;  3C9Z A;  1ISW A;  4XKI A;  3R4S A;  4EFR A;  1JT3 A;  4ZLB B;  1S0D A;  3FJE A;  4EEE B;  4DCK C;  1CVS A;  2Q3N B;  3FJD A;  4I4R A;  4ZBV B;  1HIB A;  1YTO A;  3BAO A;  2D20 A;  3VSZ A;  1WBA A;  4HR6 C;  1DJS B;  4I4S A;  3EF2 A;  3CA5 A;  2AAI B;  3JUT A;  4GOV A;  2HZ9 A;  4GP3 A;  2NS2 A;  4MZG B;  4JP0 A;  1EPW A;  3CA4 A;  4I96 A;  4X39 A;  5D62 A;  1KNM A;  2DS0 A;  1DFQ A;  4QD2 C;  3NBD A;  2MC2 A;  1AVX B;  5I1B A;  3A21 A;  3PG0 A;  3OGG A;  1ISX A;  3BA5 A;  3F1R A;  2Y9W C;  3BAD A;  3LLP A;  1AVU A;  3RMY A;  3CRI A;  1WD4 A;  5BOW A;  1BLD A;  3HOM A;  3N7K A;  4OEE A;  2J3P A;  1DQO A;  2Z49 A;  4IZX A;  4II0 A;  1BFF A;  2FO1 A;  3A07 A;  2FFU A;  3PHZ A;  3S8K A;  3QYD A;  5BXP A;  3HSM A;  3UD9 A;  3UD7 A;  3AJ5 A;  5EG6 C;  5EC5 A;  3NJ5 A;  1XZZ A;  1TOO A;  3LTQ A;  4IYB A;  2IHO A;  4IZE A;  4OW4 A;  1PUM B;  2Q9X A;  2YUG A;  4IQP A;  1S0G A;  3O4A A;  1DZC A;  2DRY A;  4X38 A;  4ZFY B;  4XFU A;  4END A;  1K5V A;  3AKH A;  4AN6 A;  4G1R A;  5GAQ A;  4LO7 B;  1XYF A;  4HJJ A;  4J2Y A;  3Q7Y A;  2D1Z A;  2ZR1 B;  2VSE A;  3HN1 A;  5F8W A;  3WMU A;  4JQ0 A;  4ION A;  1Z4S A;  3WMV A;  1A8D A;  3CU1 B;  4A7K A;  3P53 A;  3QR5 A;  1TIE A;  4LO3 A;  3B9U A;  2NP0 A;  4EFQ A;  1ISZ A;  1I1B A;  4I4U A;  1PZZ A;  2VSA A;  5FZZ A;  1V6X A;  4ZFU B;  1M2T B;  1BLA A;  1NUN A;  3IIR A;  3O4O A;  4QAL A;  1G9B A;  3SNV A;  4ZA3 B;  3Q7X A;  1BFG A;  1ISY A;  5DUY A;  1TTU A;  4F34 A;  2F8X C;  3CA0 A;  4G9M A;  1XG6 A;  3CA1 A;  1R8N A;  1W3G A;  3VT1 A;  3CRH A;  4QBC A;  1SR4 A;  5BXR A;  1BFB A;  2KI6 B;  3FJK A;  3H6Q A;  1QQK A;  3RSJ A;  3FJF A;  4ZGR B;  3VT0 A;  3CA6 A;  1TP0 A;  4MZH A;  5BQU C;  2HW9 A;  1XHB A;  2UUS A;  3O49 A;  4IY8 A;  1UPS A;  3VSF A;  1IOB A;  3V0B A;  1JQZ A;  2KLL A;  1FMM S;  2DRE A;  3IM7 A;  5D63 A;  4OEF A;  4QKS A;  5JMC A;  1IJT A;  4I7I A;  1E0O A;  2KH2 A;  5HPZ A;  1AF9 A;  2FDB M;  4I4X A;  2BFH A;  3OJ2 A;  4I1E A;  2NVH A;  1ITB A;  5BQU A;  1S0C A;  2NZ9 A;  3FJH A;  3MPP G;  1ISV A;  1EVT A;  4USP A;  4X3A A;  4LO2 C;  3BAU A;  5JLV A;  4Z8S B;  3N7M A;  1DZD A;  2I1B A;  4L4I A;  4QO3 A;  1YXW A;  1RML A;  2IWT B;  2K43 A;  1II4 A;  3I2X A;  1DFC A;  1G82 A;  4OWK A;  1NZK A;  4Q9G A;  1WBC A;  3RMX A;  5FNW A;  4EKX B;  4J2K A;  3OJM A;  4I37 A;  3BAG A;  3OBR A;  5F90 A;  4LO2 A;  3N7L A;  8I1B A;  2Y9X E;  5BP5 C;  1JLX A;  1QQL A;  3ZXG A;  3V0A A;  5EHA A;  3VEQ A;  4D0T A;  1Z2V A;  2LIE A;  3FUQ A;  1EV2 A;  1GGP B;  3AZW A;  4QBV A;  4A7Y A;  4H9W A;  4XFT A;  4H04 A;  2MLL B;  4G9N A;  4MZF B;  2D22 A;  3CA3 A;  2NTD A;  1FGA A;  4OEG A;  4XFS A;  2GZB A;  4YOL A;  5BXT A;  5BP5 A;  1PUU B;  3UDA A;  2L5X A;  4ISQ A;  3BA7 A;  1L2H A;  4Q9P A;  1HCE A;  2E4M C;  4L4H A;  3O3Q A;  3F62 B;  3ZC9 A;  4G6J A;  1JTC A;  1SZ6 B;  3OGF A;  1FWV A;  2NYY A;  3RTI B;  3AKG A;  4I8M A;  1BA7 A;  1FWU A;  1S0L A;  1AVA C;  4LO8 B;  1HWO B;  1M16 A;  3ZX7 A;  9ILB A;  4EB2 B;  5BXS A;  1N4K A;  1W3F A;  2WRY A;  3A22 A;  3FJ9 A;  4UY4 A;  4Q91 A;  3I2A A;  5BVP I;  2HWA A;  4ZKT B;  6I1B A;  2P39 A;  1YBI A;  3P6J A;  5G00 A;  1Q04 A;  7I1B A;  4I0Y A;  3VWC A;  4LO1 C;  3AZV A;  1QXM A;  1CE7 B;  1RZO B;  4I4Y A;  4KEI A;  4D8H A;  1D0H A;  5DSS B;  1J0S A;  1FV3 A;  1HKN A;  3FJA A;  2VUA A;  5FZY A;  3PUB A;  1Z0H A;  4I4Q A;  3PME A;  31BI A;  4P0K A;  3AH1 A;  2NM1 A;  1G9A A;  1RY7 A;  1MC9 A;  1JT5 A;  3ILA A;  4HA2 A;  4LO1 A;  5DZU A;  4P6A A;  1BAS A;  1HWM B;  4GAI A;  4I3N A;  1HCD A;  1JY0 A;  4QD2 B;  3V0A B;  3OJV A;  5B2H A;  3N7J A;  3HBW A;  4KEJ A;  3BRF A;  3S8J A;  4FGF A;  3V79 C;  2M49 A;  3AH2 A;  3NBN A;  1Q03 A;  1JT7 A;  4A7Z A;  3CQA A;  2X2T A;  2ERM A;  1MD6 A;  3BB2 A;  2Z48 A;  1VCL A;  4KC3 A;  3O44 A;  5FZU A;  3FGM A;  1DLL A;  4IY9 A;  3O4D A;  4D0Z A;  3FUO A;  1TFM B;  1IRP A;  3AKF A;  4H75 A;  3WO3 A;  4LO0 C;  1P63 A;  1OQL B;  3NBC A;  4KEK A;  3BRD A;  1EYL A;  3T8S A;  1ABR B;  2P23 A;  4TLP A;  4EFP A;  3HAL A;  3IM6 A;  1ONK B;  2BEA A;  1PWA A;  4OWL A;  1DIW A;  1FQ9 A;  4WBC A;  1G9C A;  1I1E A;  1W3A A;  1T4Q A;  1FMZ A;  4R6U B;  1FV2 A;  2D7I A;  1F31 A;  3FJJ A;  3RTJ B;  4I1B A;  4I6I A;  4I4V A;  4LO0 A;  1BAR A;  3KMV A;  4OWJ A;  1ILR 1;  5E24 E;  3CRG A;  2F2F C;  2AFG A;  2Y9F A;  2MIB A;  4FVV A;  2ZQN A;  3E8L C;  3BAQ A;  4J2X A;  3O4C A;  3AKI A;  3FJI A;  3HMY A;  2D44 A;  3H6R A;  4JPZ A;  4GAF A;  1TWM A;  3BX1 C;  1T9F A;  3VT2 A;  4KBB A;  1AXM A;  2D7R A;  2RST A;  2D23 A;  2FFV A;  2D43 A;  2RQ9 A;  2K8R A;  3MAL A;  4OUJ A;  2ESU A;  2X2S A;  3O5W B;  21BI A;  2F2F A;  4CJM A;  2HWM A;  3BRG C;  1JLY A;  1S0F A;  1K5U A;  1Q1U A;  1AFC A;  4Z9W B;  3WO2 A;  4JKX B;  4DEP A;  3CAH A;  4GOY A;  2QN4 A;  1HWP B;  4JAW A;  5D61 A;  4J2S A;  4ZFW B;  1YF8 B;  3V0B B;  1V6V A;  3BA4 A;  2KKI A;  3UJ4 A;  3FFZ A;  2AXM A;  3AJ6 A;  4P0L A;  41BI A;  4J23 B;  1V6W A;  3UD8 A;  2K4A B;  2RG9 B;  3POK A;  4G6M A;  1IHK A;  4LO3 C;  2E4M A;  4ZOT A;  4IHZ A;  1DQG A;  4I2S A;  2GO2 A;  2KI4 A;  2XOA A;  4JKQ A;  4QC4 A;  3WIN C;  3IAG C;  1IT0 A;  4QKR A;  4JRA A;  2FGF A;  3Q7W A;  2QYI B;  1AVW B;  1JT4 A;  3K1X A;  3O4B A;  4I4P A;  2DRZ A;  1HWN B;  1YYN A;  3BAV A;  3UJ0 A;  3FJB A;  3JRR A;  3WIN A;  4USO A;  3TC2 A;  4P0J A;  3I29 B;  5F8Y A;  1RG8 A;  1WD3 A;  3N0K A;  3OBT A;  3WA1 A;  3D7W B;  3ZC8 A;  5F8S A;  1BFC A;  5FNX A;  1IIL A;  1SR4 C;  2VU9 A;  4GP0 A;  2BEB A;  4AN7 B;  1IRA X;  2WBC A;  3BAH A;  2VXT I;  2LIQ A;  1PC8 B;  2R9K B;  1V6U A;  3R4U A;  3W9T A;  1R8O A;  4I4O A;  4DEN A;  3H6R B;  2D24 A;  2VLC A;  2VXR A;  4X37 A;  3NBE A;  3FJC A;  4LO7 C;  3A23 A;  3BTA A;  1S0B A;  2ZQO A;  3H6S E;  3WO4 A;  1S0E A;  3IM5 A;  4PC4 A;  3AH4 A;  3FJ8 A; 
#chains in the Genus database with same CATH homology
 4ISR A;  3ZXD A;  2Y9G A;  5DVH A;  1TWE A;  4F83 A;  3P6I A;  2ET2 A;  1G9D A;  2AQZ A;  1FN0 A;  3VUO A;  3C9Z A;  1ISW A;  4XKI A;  3R4S A;  4EFR A;  1JT3 A;  4ZLB B;  1S0D A;  3FJE A;  4EEE B;  4DCK C;  1CVS A;  2Q3N B;  3FJD A;  4I4R A;  4ZBV B;  1HIB A;  1YTO A;  3BAO A;  2D20 A;  3VSZ A;  1WBA A;  4HR6 C;  1DJS B;  4I4S A;  3EF2 A;  3CA5 A;  2AAI B;  3JUT A;  4GOV A;  2HZ9 A;  4GP3 A;  2NS2 A;  4MZG B;  4JP0 A;  1EPW A;  3CA4 A;  4I96 A;  4X39 A;  5D62 A;  1KNM A;  2DS0 A;  1DFQ A;  4QD2 C;  3NBD A;  2MC2 A;  1AVX B;  5I1B A;  3A21 A;  3PG0 A;  3OGG A;  1ISX A;  3BA5 A;  3F1R A;  2Y9W C;  3BAD A;  3LLP A;  1AVU A;  3RMY A;  3CRI A;  1WD4 A;  5BOW A;  1BLD A;  3HOM A;  3N7K A;  4OEE A;  2J3P A;  1DQO A;  2Z49 A;  4IZX A;  4II0 A;  1BFF A;  2FO1 A;  3A07 A;  2FFU A;  3PHZ A;  3S8K A;  3QYD A;  5BXP A;  3HSM A;  3UD9 A;  3UD7 A;  3AJ5 A;  5EG6 C;  5EC5 A;  3NJ5 A;  1XZZ A;  1TOO A;  3LTQ A;  4IYB A;  2IHO A;  4IZE A;  4OW4 A;  1PUM B;  2Q9X A;  2YUG A;  4IQP A;  1S0G A;  3O4A A;  1DZC A;  2DRY A;  4X38 A;  4ZFY B;  4XFU A;  4END A;  1K5V A;  3AKH A;  4AN6 A;  4G1R A;  5GAQ A;  4LO7 B;  1XYF A;  4HJJ A;  4J2Y A;  3Q7Y A;  2D1Z A;  2ZR1 B;  2VSE A;  3HN1 A;  5F8W A;  3WMU A;  4JQ0 A;  4ION A;  1Z4S A;  3WMV A;  1A8D A;  3CU1 B;  4A7K A;  3P53 A;  3QR5 A;  1TIE A;  4LO3 A;  3B9U A;  2NP0 A;  4EFQ A;  1ISZ A;  1I1B A;  4I4U A;  1PZZ A;  2VSA A;  5FZZ A;  1V6X A;  4ZFU B;  1M2T B;  1BLA A;  1NUN A;  3IIR A;  3O4O A;  4QAL A;  1G9B A;  3SNV A;  4ZA3 B;  3Q7X A;  1BFG A;  1ISY A;  5DUY A;  1TTU A;  4F34 A;  2F8X C;  3CA0 A;  4G9M A;  1XG6 A;  3CA1 A;  1R8N A;  1W3G A;  3VT1 A;  3CRH A;  4QBC A;  1SR4 A;  5BXR A;  1BFB A;  2KI6 B;  3FJK A;  3H6Q A;  1QQK A;  3RSJ A;  3FJF A;  4ZGR B;  3VT0 A;  3CA6 A;  1TP0 A;  4MZH A;  5BQU C;  2HW9 A;  1XHB A;  2UUS A;  3O49 A;  4IY8 A;  1UPS A;  3VSF A;  1IOB A;  3V0B A;  1JQZ A;  2KLL A;  1FMM S;  2DRE A;  3IM7 A;  5D63 A;  4OEF A;  4QKS A;  5JMC A;  1IJT A;  4I7I A;  1E0O A;  2KH2 A;  5HPZ A;  1AF9 A;  2FDB M;  4I4X A;  2BFH A;  3OJ2 A;  4I1E A;  2NVH A;  1ITB A;  5BQU A;  1S0C A;  2NZ9 A;  3FJH A;  3MPP G;  1ISV A;  1EVT A;  4USP A;  4X3A A;  4LO2 C;  3BAU A;  5JLV A;  4Z8S B;  3N7M A;  1DZD A;  2I1B A;  4L4I A;  4QO3 A;  1YXW A;  1RML A;  2IWT B;  2K43 A;  1II4 A;  3I2X A;  1DFC A;  1G82 A;  4OWK A;  1NZK A;  4Q9G A;  1WBC A;  3RMX A;  5FNW A;  4EKX B;  4J2K A;  3OJM A;  4I37 A;  3BAG A;  3OBR A;  5F90 A;  4LO2 A;  3N7L A;  8I1B A;  2Y9X E;  5BP5 C;  1JLX A;  1QQL A;  3ZXG A;  3V0A A;  5EHA A;  3VEQ A;  4D0T A;  1Z2V A;  2LIE A;  3FUQ A;  1EV2 A;  1GGP B;  3AZW A;  4QBV A;  4A7Y A;  4H9W A;  4XFT A;  4H04 A;  2MLL B;  4G9N A;  4MZF B;  2D22 A;  3CA3 A;  2NTD A;  1FGA A;  4OEG A;  4XFS A;  2GZB A;  4YOL A;  5BXT A;  5BP5 A;  1PUU B;  3UDA A;  2L5X A;  4ISQ A;  3BA7 A;  1L2H A;  4Q9P A;  1HCE A;  2E4M C;  4L4H A;  3O3Q A;  3F62 B;  3ZC9 A;  4G6J A;  1JTC A;  1SZ6 B;  3OGF A;  1FWV A;  2NYY A;  3RTI B;  3AKG A;  4I8M A;  1BA7 A;  1FWU A;  1S0L A;  1AVA C;  4LO8 B;  1HWO B;  1M16 A;  3ZX7 A;  9ILB A;  4EB2 B;  5BXS A;  1N4K A;  1W3F A;  2WRY A;  3A22 A;  3FJ9 A;  4UY4 A;  4Q91 A;  3I2A A;  5BVP I;  2HWA A;  4ZKT B;  6I1B A;  2P39 A;  1YBI A;  3P6J A;  5G00 A;  1Q04 A;  7I1B A;  4I0Y A;  3VWC A;  4LO1 C;  3AZV A;  1QXM A;  1CE7 B;  1RZO B;  4I4Y A;  4KEI A;  4D8H A;  1D0H A;  5DSS B;  1J0S A;  1FV3 A;  1HKN A;  3FJA A;  2VUA A;  5FZY A;  3PUB A;  1Z0H A;  4I4Q A;  3PME A;  31BI A;  4P0K A;  3AH1 A;  2NM1 A;  1G9A A;  1RY7 A;  1MC9 A;  1JT5 A;  3ILA A;  4HA2 A;  4LO1 A;  5DZU A;  4P6A A;  1BAS A;  1HWM B;  4GAI A;  4I3N A;  1HCD A;  1JY0 A;  4QD2 B;  3V0A B;  3OJV A;  5B2H A;  3N7J A;  3HBW A;  4KEJ A;  3BRF A;  3S8J A;  4FGF A;  3V79 C;  2M49 A;  3AH2 A;  3NBN A;  1Q03 A;  1JT7 A;  4A7Z A;  3CQA A;  2X2T A;  2ERM A;  1MD6 A;  3BB2 A;  2Z48 A;  1VCL A;  4KC3 A;  3O44 A;  5FZU A;  3FGM A;  1DLL A;  4IY9 A;  3O4D A;  4D0Z A;  3FUO A;  1TFM B;  1IRP A;  3AKF A;  4H75 A;  3WO3 A;  4LO0 C;  1P63 A;  1OQL B;  3NBC A;  4KEK A;  3BRD A;  1EYL A;  3T8S A;  1ABR B;  2P23 A;  4TLP A;  4EFP A;  3HAL A;  3IM6 A;  1ONK B;  2BEA A;  1PWA A;  4OWL A;  1DIW A;  1FQ9 A;  4WBC A;  1G9C A;  1I1E A;  1W3A A;  1T4Q A;  1FMZ A;  4R6U B;  1FV2 A;  2D7I A;  1F31 A;  3FJJ A;  3RTJ B;  4I1B A;  4I6I A;  4I4V A;  4LO0 A;  1BAR A;  3KMV A;  4OWJ A;  1ILR 1;  5E24 E;  3CRG A;  2F2F C;  2AFG A;  2Y9F A;  2MIB A;  4FVV A;  2ZQN A;  3E8L C;  3BAQ A;  4J2X A;  3O4C A;  3AKI A;  3FJI A;  3HMY A;  2D44 A;  3H6R A;  4JPZ A;  4GAF A;  1TWM A;  3BX1 C;  1T9F A;  3VT2 A;  4KBB A;  1AXM A;  2D7R A;  2RST A;  2D23 A;  2FFV A;  2D43 A;  2RQ9 A;  2K8R A;  3MAL A;  4OUJ A;  2ESU A;  2X2S A;  3O5W B;  21BI A;  2F2F A;  4CJM A;  2HWM A;  3BRG C;  1JLY A;  1S0F A;  1K5U A;  1Q1U A;  1AFC A;  4Z9W B;  3WO2 A;  4JKX B;  4DEP A;  3CAH A;  4GOY A;  2QN4 A;  1HWP B;  4JAW A;  5D61 A;  4J2S A;  4ZFW B;  1YF8 B;  3V0B B;  1V6V A;  3BA4 A;  2KKI A;  3UJ4 A;  3FFZ A;  2AXM A;  3AJ6 A;  4P0L A;  41BI A;  4J23 B;  1V6W A;  3UD8 A;  2K4A B;  2RG9 B;  3POK A;  4G6M A;  1IHK A;  4LO3 C;  2E4M A;  4ZOT A;  4IHZ A;  1DQG A;  4I2S A;  2GO2 A;  2KI4 A;  2XOA A;  4JKQ A;  4QC4 A;  3WIN C;  3IAG C;  1IT0 A;  4QKR A;  4JRA A;  2FGF A;  3Q7W A;  2QYI B;  1AVW B;  1JT4 A;  3K1X A;  3O4B A;  4I4P A;  2DRZ A;  1HWN B;  1YYN A;  3BAV A;  3UJ0 A;  3FJB A;  3JRR A;  3WIN A;  4USO A;  3TC2 A;  4P0J A;  3I29 B;  5F8Y A;  1RG8 A;  1WD3 A;  3N0K A;  3OBT A;  3WA1 A;  3D7W B;  3ZC8 A;  5F8S A;  1BFC A;  5FNX A;  1IIL A;  1SR4 C;  2VU9 A;  4GP0 A;  2BEB A;  4AN7 B;  1IRA X;  2WBC A;  3BAH A;  2VXT I;  2LIQ A;  1PC8 B;  2R9K B;  1V6U A;  3R4U A;  3W9T A;  1R8O A;  4I4O A;  4DEN A;  3H6R B;  2D24 A;  2VLC A;  2VXR A;  4X37 A;  3NBE A;  3FJC A;  4LO7 C;  3A23 A;  3BTA A;  1S0B A;  2ZQO A;  3H6S E;  3WO4 A;  1S0E A;  3IM5 A;  4PC4 A;  3AH4 A;  3FJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...