4LOUD

Structure of the e148q mutant of clc-ec1 deltanc construct in the absence of halide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
211
Chain Sequence
b'DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter ClcA
publication title A fluoride interloper in a CLC-type Cl /H+ antiporter
rcsb
source organism Escherichia coli
molecule tags Membrane protein, tranport protein
total genus 49
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4louD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4louD01
4JGJA 1A4KB 5L7XL 4UDTB 2PXYD 2A6KA 5E99L 2J8UE 4RGNB 1ZS8B 1CK0H 2QSTA 4KVCL 5FA4A 1LGVA 2A9NH 2ADJB 1MEXH 2VTFA 2J7LA 2JIXD 3KPSD 5DO2D 4ZUVB 1IGJA 3S3SA 6FABL 1B4JL 4TSBH 4U1MB 2DKMA 4HUVB 4PP1D 3CPLA 3RTQA 4Y4HD 2VLKD 1BIIA 4E0RB 2D7TH 2E3VA 3LVEA 1AXSA 5EPMA 3JV4A 4TUOA 5JW4R 3ZHLA 3HZVA 2APFA 2R4SH 5KSUA 1QKZH 1JE6A 2J8UF 5CIPA 1LK3L 4Z76A 2C26A 2PF6A 3HC4H 1MRCH 1TZIB 2FGWL 3RWFB 4XBPA 5C0FB 1P7HL 4MNQE 1RUML 2DWDB 1KIPA 3X3FL 3RZCD 1M05B 3QRGL 1CZ8H 3WEXA 1XCTB 3NN8A 2BVQA 4HZAA 4NFDA 4NP4H 4JDZA 2VKWA 1I3UA 2Y9RT 3WNPA 3L9RB 3G5XB 4K55A 4XPTH 2L0DA 4PRBB 2BVOA 4QCIB 5I1DB 2FEEI 1UXWB 2AJVH 4WFEE 2GQHA 1G7LA 2A74A 1B88A 2I07A 5DHYA 5CILL 2ADFH 5LJYH 4OCRL 2BERA 4K71B 3GMMB 5E5MB 4AMKH 1ZT1A 1VEOA 1V3JA 43CAA 4JHZA 4J23A 4WCYH 3ZT5A 1T5XB 2PXYC 1T1ZA 3V6FA 2WUBL 3QA3B 1LEIB 3TH3T 4LCUA 3GSOA 1CDCA 1A7OH 2OQJB 1G7JA 4ONOA 5DO2C 4Y19D 1F11A 4P2QA 2ZUQB 4JM4L 5K93A 3EBAA 1U8HA 2DICA 4KC3B 4X7SH 3N9GL 2YD6A 4JRXB 5E24E 1PZ5A 3CX2A 4Y4HC 5EU3A 4GKNB 4M1GH 5GS0L 2XWBA 5I15H 4ELME 4NKIL 1BIHA 4FQHA 3RX5A 1NCAL 3Q1SL 1KSRA 4NZRL 4ZFOL 4PJCF 3D39A 3LKQB 3P4OA 4P4RB 3SJVA 3E3QC 1WK0A 3O8XD 3PABB 4XXCC 1MUJB 4HIIA 3RZCC 3L5XH 1WICA 4BA8A 4TNVK 2CPCA 4OCLC 1OD7A 1NUDA 4NKDB 5IVZA 1T22B 1K2DB 2BY1A 4HS3B 3REVA 1KN2L 4H88H 3ILPB 4ELMF 1QQDA 3WIHL 1NBVH 2HT3D 4NJ9H 5IQ9B 2AEIT 1OAYH 3MREA 4BZ1H 3MRCA 2DJ4A 4XWGH 3PP3K 1OW0C 4RBPK 1G9NH 3ZE1E 2OP4L 4CBPA 4BFIB 3TBWB 3B9KA 4JQVC 2V7HA 3U1SL 4PLJD 5CS7A 2VLRE 1VPOH 1C16B 5IJVB 4KKBC 5E6IB 5CKAA 5E99H 3S9DB 2BVEA 4RGOH 3SHSA 4KPHL 3WUWB 4JM2D 3QXDB 2ITCA 2XRAH 2W60B 1K5NB 3QUXC 6FABH 4YHIB 2IAMA 4TOYL 3ZE1F 4J4PA 1QYGL 4L4VD 5ACZB 4P23D 1S78D 1YNLL 4TVPD 2GJ6A 4AL8H 1JGDA 4OJFL 2J2ZA 4RX4A 5JHDB 4KKNA 5IB1A 3FB7A 1DL7H 1ORSA 4MD4B 3HC0B 1G9NC 3O6KH 2YD1A 3LRSA 3DVGA 3UBXB 3MV9E 1UKSA 4PJFA 4LK4A 2ZUWA 3HRZA 1TQCB 1MREH 3TBSA 4UBDD 3GKWH 3TA3A 1I8KB 1DBAL 3L3DA 4ZSOB 2NY2D 1XR8B 1U92B 3PF2A 4ESKA 5IROC 3U0TA 3D0VB 3QG6A 3QRGH 2Z8VC 3OKMB 4WUKL 2Q76A 5DJ6A 5CEYB 5HBBA 1NPUA 4NQCA 3WS6A 4KRNA 1QA9B 2Y7QA 5T3ZE 1KN4H 3D85A 4JEGB 3VXUE 3PL6A 3VG0L 5GS0D 4TVPH 3UXFA 2ICWA 2XNAB 3MLWH 1Z3GH 4HJ0D 3O6FB 2IH3B 4HV8A 2GTZA 4FFZL 4HLZH 3ZYIA 2AABH 5HHOE 1N2RA 4NFBA 1E4XI 5I1AA 4ZMAT 3L3KB 3KPLB 2BSED 3GSXA 1L0XA 4IRZL 1AGCB 2C4FT 5F89A 2NZ9D 1K6QH 3SBWC 1HOCB 1E4XL 5E2UH 1YYLH 2NXZB 2JF1A 4LCWE 3JVGC 4R8WL 2CXKA 1CDYA 2VR9A 2OI9B 2OMNA 4O58H 3X13A 4F15C 2I9LA 3HG1A 3N9GH 3FT2A 1S78C 2YKLL 5AZEH 1KOAA 3H0TB 4LKXA 4H8WL 3BP6B 4PLNC 1YUHA 4GXUN 2AJUL 4X0KA 1EXUB 2AK4B 4UIMA 3O2WH 3QIWA 2CGRH 3WFHB 3EZ8A 3OKEB 4TUJB 5C6WH 2AJSL 3HNTL 3K1DA 4KQ3L 4LARL 3DO7B 2GI7A 1OP3H 1FVEA 4LPUA 2NW2A 2NY4B 2W9DH 1A6WL 1W72B 5I73B 2X70B 3QEUA 4I0PD 1IVLA 3K8LA 1KACB 2GSGB 3KPOB 3TJEH 1OSZB 4JFEA 1OARH 4OCYH 4X8XA 4K7PX 3LEYL 3ULSA 3MLXL 4KDVA 1JWMA 5TPWH 4P2QE 3WIHH 3U0PB 3HZMA 3QDGB 1QEWB 1YN7A 4MNHA 2V2WB 3IFPA 5GS0C 1OWWA 1YY9D 5D1ZB 4PD4J 4ZTOL 4HJ0C 4I5BB 5D7LD 5B39B 4ZAKD 4BSWA 5F88A 2BNQE 4DZ8A 3PWPD 1AD9B 1ITBB 2QQKL 1OF2B 4BUGA 4EOWL 4XNMB 3BWAA 1T2XA 3EOTH 4I0CC 3QDJA 2NZ9C 4M6NL 2CLVA 4GW5B 1CE1L 2YS4A 3VFWA 4OF3A 4KPHH 4OLYH 4WIQA 4O51A 3UTSB 4AG4L 4NQEE 4RFOH 2KZ1B 3GHBL 2W91A 1J10A 4Y2OA 4GG8B 3O41B 4F9LC 2PKDA 4GAGH 1TZHB 5JDSA 4Y1AB 4X83A 4L8BA 2HFFA 1U41A 3QO0A 3QZWA 5K9QI 2GJZA 4PGDB 2VLJB 5CJOH 2PCPB 2P8PA 1QSEB 2D03L 1FO0L 4CJ0A 1BFVH 4ZUSB 5IW1B 4PB0L 2YD4A 2XA3A 3SN6N 1F13A 4HLZG 4JZOA 3M45A 3GO1L 2F54A 4PJDA 4OUUA 4OZFB 5FA3A 1V5JA 3T1WA 4JGUA 3O3DB 1GH7A 2ESVA 4I0PC 5ETUA 1XF1A 3BE1L 1F4HA 1MFCL 2VITB 4PRIB 5AZ2L 5HD8D 1NEUA 1IKFL 4D8PB 3LKOA 4WHCA 1PY4A 5JO5B 1SMAA 2WW8A 4HHAB 5F7FA 1T5WB 4U1SB 2Y36L 3MUGB 3BKYL 1B90A 1WT5A 3GMPA 3GSWA 1YY9C 4YPJA 5L2JB 1HI6B 4IRZH 1XGYL 3VWKB 2E9JA 4IRSA 1U58A 3F6LA 2ZUTA 3LKNB 5TFSH 3DUSA 2ZUUA 1IQWL 1NJ9A 3V79C 1H15A 2NY3B 4L3ED 5C08D 4UZGA 3SDCB 2X7LB 3RVWD 5M95B 4LHUD 3TPKA 5D7SL 4PREA 4CRPA 1FG9C 3WNNA 4J12A 5IMLB 3MRRB 2L7UA 3C8HA 2YKLH 2LAGB 1S7UA 2R56H 3B5GA 4H8WH 2GTWA 3RBGA 1N6VA 3AUVA 1WZ1L 2AJUH 3U7YL 1KCRL 4F9PC 3KYMB 3CJJA 3MCKA 3CFBB 5I8CA 2NTFA 3MV8D 4KQ3H 1RMFH 2EYSB 1WLHA 3QHFL 2A6DA 2ZCKL 3FAWA 4F7CB 2JCCE 5B3NA 1U8NB 4O2FA 5IHZA 2BOCB 4B0MM 3RGHA 1NL0H 4NN6B 5DRZB 4ERSL 3VD9A 4GQ9H 2ZCLL 4EDWL 1QBLH 3LEYH 1IQDB 3GJFH 2C1PB 5HD8C 1ZT7A 4X7TB 5ISZA 1JPST 1JNLL 3SE8L 5AEAA 4CKVX 4NRXA 4H8WC 3QUYB 1BVLB 4QOKE 1RHHA 5CBEB 4OZIB 2JCCF 4ZTOH 1T0NB 1JF5A 1EJ6A 3H6JA 4I48A 3SE4C 4KHTL 1YYML 5SWSD 2CRZA 4L3AA 4ODXA 3RVXD 2QQKH 5K33A 3HNSL 5F7NC 5F7EH 1NAMA 4C56D 3MC0A 4P5TB 1NUFA 3FFCA 3OXRA 1MLCA 4P3WA 4XC3H 2X40A 1FCGA 4AG4H 1DLHB 4HC1A 3RVWC 5TDNA 3BPLC 4L4TA 3BW9A 4HBQA 4Z6AT 4JHBA 1KPUB 4L8DA 1QO3B 5SWZA 4U6XA 3TVMC 3S98A 3CSYA 4BH8A 3UPCA 4ONHA 4PPTA 1MY5A 5F3HB 5L8JB 3K7UA 1ZHLB 1ZLWH 1FO0H 5MERA 1DQQB 2AJ3A 2GFBA 3ECBB 4PB0H 5EO1A 1KPVA 1TCRA 1NFDF 1HINL 3PJSA 1A9BB 3C60C 1WAAF 2CKBL 4UNVA 4N0UA 3AB0C 1OAXL 4BJLA 3JV6A 5IKCB 5EBWA 1HKLH 1CWVA 5E9DB 2F8XC 2ATKA 2CLZB 2BFVL 1MFCH 4GUPA 4M4RA 4W6WB 3QWRD 5AZ2H 3V0WL 5DSCA 3KAAA 1M6OB 4GRWE 3G5VB 1F58L 4ZO8A 4GKSB 1P7QD 4UAOC 2B4CL 5D9SB 2EEBA 2VIRB 1TITA 2ZWLT 5KSAC 1QFUL 1NQBA 1EFXA 3GDBA 1XF5B 2RHEA 4RDQG 2AERT 4P4KA 3WFCL 3I75B 1TZGL 2EDOA 4LEXL 4G42A 3K3QA 3W5NA 1QR4A 3SGJA 1PW3A 4WI9A 1RUAH 5L9DL 4Z18A 3WHXB 1MQ8A 1S7TA 4U7MA 2F54E 4WO4B 1FFOA 2YD2A 2VAAA 3DVFA 4GRWF 2V17H 3PWNA 3OAZH 1EJOH 3BZ4B 4OGYH 2JIXA 3FO9A 3WDIA 4XCNB 3QEHA 5IW3A 1G0YR 1SJEB 1VFOA 1QD0A 4LHUG 4Y4HA 2VLKA 5IVXA 3FT3A 5LKNA 2NTSP 2H1PL 1G0DA 2YMXL 3BFOA 3TT3L 4FMKA 4WU7B 5KVDL 3C8KA 4M3KB 2I25N 4D0BA 5FA4B 2ORBL 2MPAH 2ZCKH 1IGJB 3BPCA 3TO4C 4PJHA 3K2UL 5CEZL 3RZCA 3CPLB 3RTQB 2HRPL 3STLA 1AHWC 1J0HA 3OAUH 1BIIB 5T3XD 3TPUA 3UJIH 5EPMB 1AXSB 3RWIA 4MA7H 5J8OA 3QJHA 3JV4B 4TUOB 3QG7L 3ISWA 5DUBA 4MQSB 4NNPH 5DT1L 5D7KD 5JOFA 3OKNA 1RIVH 5F1SA 3HZVB 3S36L 4ODSH 5KSUB 5CIPB 4Z76B 1VERA 4LLVA 3VFNB 1JWUA 4R0LC 4JGMA 1OW0A 4XBPB 1QFOA 1T20A 1JTTA 1KIPB 2NR6D 4KTDH 3WEXB 1FLTX 4JJHA 4U3CA 3NN8B 2BVQB 2WWKO 5MI0C 4JDZB 4Y5VB 4HPOL 5F70A 5EDXA 1L9NA 4ODUA 3INUL 2YRLA 4QTIL 5F7LB 3A6CH 2BVOB 4WTZG 5K9QG 5LAXB 4MJID 5T3XH 4HPYH 3VD5A 1DFBL 3OWEA 1G7LB 4EIGB 2A74B 5F7UA 4Y19A 2I07B 1DUZA 5DHYB 2ICEA 1H0DA 1CLOH 3O0RL 1F97A 2R4RL 5EUKA 3CCHA 1ZT1B 3ET9F 2WZPD 2E7BA 43CAB 1ETZB 3RWCA 2ZG3A 3NGBB 3RL2A 1BF2A 2AQ1A 4D9QD 1T1ZB 3V6FB 4HMCA 4M1CD 3KHQA 1NKOA 5C9JA 2NY0B 4M03A 3ARDD 3L7EA 5IROA 2XWJA 4LCUB 1HINH 1VDGA 3ARUA 3GSOB 1MOEA 4H1LH 5JIHA 3SKMA 1G7JB 1AGBA 1F11B 1I85C 3O8XA 1FH5L 1U8HB 4BZ2L 4D0CA 1PZ5B 2DM2A 2YUWA 5DTFA 5EU3B 3MOAL 2BFVH 4G7VL 1MJ7H 2XWBB 4I0KA 1VACA 2AEQL 5DEFA 3CC5B 4GT7A 4L4TE 3ESUF 1F58H 4FQHB 5T1KA 3PP4H 4MX7A 3D39B 2DLFL 3P4OB 1EZVY 3SJVB 1KYOK 4KZEL 5C3TA 4PJEE 1TZGH 4HIIB 1Q0YH 2C3XA 4DUXA 5HXMA 5CZVL 1CLYH 1EBAA 1TENA 3LPFA 2BK8A 3K74B 5IVZB 1EMTL 5CEZD 4WUUB 5DJDA 3SBWA 3QDAA 1HZHL 3REVB 4ZTPL 1QQDB 4KK5C 4JM2A 4S2SA 3MREB 3T1FA 3MRCB 5I19L 5H8DA 1AJ7H 5CLTA 3RGVD 4NRZA 1P2CA 3VRJA 4L4VA 3B9KB 4P23A 4PJEF 2V7HB 1MRDL 5DMIH 2DQDH 4XP5H 1JCKA 2H1PH 5DR5L 3IKKA 3V5HA 4KHXH 2DQHL 2J5LC 4DVRL 4XP1H 2ITCB 4M1CC 2ORBH 1EAJA 1IL1B 4J2XA 2IAMB 3K2UH 4MGXA 3S3JA 5CEZH 4JY4A 4K94H 2Y6SD 5F7KC 4YHPA 1TNMA 2GJ6B 1FNEA 1UQSA 1MCOH 1JGDB 1QSFD 2ZJSL 3EOBA 4RAVA 4XCFL 1TJIL 3QI9D 4LP5A 3FB7B 5KS9A 1ORSB 1B6DA 3SDDD 3CU1A 4AK1A 5DT1H 3LRSB 3DVGB 3FONA 3U4BH 4PJFB 5E8DL 5GRJL 4JLRA 3HRZB 4JO4L 4N9OB 1JGEB 3TBSB 1RUKL 4J3WA 4X9IA 3TA3B 5FKAA 3L3DB 4ZUTA 2FIKA 1BFSA 1KPRA 3U0TB 3HE7C 1QHOA 1PKOA 4ZFOA 1NCNA 2Q76B 4OFPA 3U30B 4ZD3L 1SBSH 5DJ6B 1Q8MA 1Q0XL 5AD0B 2VDQH 1KCVL 12E8H 5F7HA 4NQCB 2IFGA 4KTEL 3W39A 1NAKL 3RJQB 3MNWA 5JOPD 1YEHL 2Y7QB 3OJ2C 4LSSL 4K94C 4QTIH 5DMYA 2V5RA 5DD5L 1JFQH 3CZJA 4DKAA 4H1LG 2DL9A 2LVEA 3DUHA 3PL6B 2JB5H 1I8LC 1YMMD 5JW3L 3OAZK 2CUHA 3DI2B 1HCVA 3HMXL 4P2RE 4HV8B 4FQ2H 2GTZB 4OGXH 3ARBD 3MRMA 2OYPA 3S96A 1VHPA 1NMBH 4IOIA 3WIHA 5I1AB 3ZYJA 3RGVC 1IGTA 3BP7A 3GSXB 2R4RH 3SQOH 3MLRL 5I9QC 4YXKL 3NAAL 4U1GC 5F89B 4NC1C 4RMRA 1MCLA 1CFSA 2RCSL 2PTTA 4LIQL 4V1DE 2DM4A 2FYYA 4CGTA 5T1LD 3RY6A 5ADOH 5F21B 4P49A 1EEYA 2OBGA 3MUJA 3CLFH 5BV7H 3X13B 2P48B 1Z9OA 5L8KB 3HG1B 2P7TA 4BZ2H 5EZLA 4LKXB 4Z7UE 1SEBB 2GT9B 1BHGA 1YUHB 3QI9C 4X0KB 5I8KL 2AEQH 4UIMB 3QIWB 4PRPE 1Q9KA 5IFAL 1UZ8A 1JK8A 1A21A 3X11A 2OCFD 1II4E 2A77L 4FQCH 4NM8L 3VGDA 2R23B 3WUZA 1NSNH 1FVEB 1YEKH 2NW2B 4ZQKA 1X5KA 3OAYH 3HC3H 4UB0H 3V6OC 2YUZA 3QEUB 4ZAKA 4M62L 4JFEB 3PWPA 4Z7UF 4PTTA 1I1YA 4UNTA 3UC0H 5BV7C 3ULSB 1N4XL 2L7JA 1HZHH 1DQDL 1JWMB 4JDTL 2LU4A 4P3DA 3GMNA 4JR9H 3H3KA 3HZMB 2DI8A 1YN7B 1H3WM 4MNHB 4DVBA 3IFPB 5I19H 3JXAA 1CBVL 4I77H 3ARBC 2DM3A 1OM3H 4BSWB 5F88B 1DBJH 4DZ8B 3U82B 1T1YA 3FO0L 3MUY1 3BWAB 2UVEA 3QDJB 2CIIA 4ZFGH 1RAMA 2XY1A 2WV3A 3VFWB 4YXLH 2W9EL 4O51B 2DQHH 4PV8A 2AXGA 4GH7B 3PGDA 2XG5A 5C0BD 2DN7A 5I1IH 5C92A 2X4TA 3P0GB 1UACH 2ZJSH 4L8BB 2HFFB 4RWHA 3QO0B 3QZWB 2GJZB 3FRPG 5EWIL 2P8PB 5KTEH 4BSVA 4FTVB 2OXHA 5GRJH 3BUTA 1Z9LA 4JO4H 3R1GL 3SKNA 1RUKH 4R7DA 1PJ9A 4M00A 4E9LA 4JZOB 4H0HB 2F54B 3OJDA 4OUUB 4PJDB 5T5NF 2IH1B 3NIFE 5FA3B 1G9MH 4HS8L 4F8QA 3CXHJ 4PLOB 4HEME 4OCWL 4RMQA 4G5ZL 2ESVB 4IEFB 5ETUB 2H45A 4Z78A 5I74C 3P77A 5JXEC 3T0XA 5JW4N 4M5ZL 3LKOB 3W81A 4PJGE 3PXHA 5C08A 3O6MH 3LZFL 2NX5E 4LHUA 1DANT 2EDHA 4GFTB 5J11B 2OLDA 3QCTH 3HMXH 3GJFA 1JN6A 3NIFF 4NM4H 5D2LA 3RPIA 4GXVL 3GMPB 3GSWB 3F5WA 3RX8A 2IEPA 4GRLD 3QT2A 2F5AH 3G9AB 1AR1C 5E7BA 4IRSB 4UT9L 1U58B 3R06A 5MEPA 4HFWB 2AS5M 1O5DT 1L6XA 3DUSB 1G9MC 2VO5A 1NJ9B 2RCSH 4LIQH 2DWEB 5HYQA 2VQ1A 2W92A 4FQ1L 4PJGF 2M2DA 4J3VA 5I1EL 2R0KH 3MV8A 3SCMD 1TDQA 3HB3D 4U6VH 4WHDA 3TCLA 4PYHA 1KTKE 3T2NL 2VDLH 4F80A 3C2AH 1BX2A 5I76A 1URLA 5FUCC 2LE9A 4FQJH 3T2OA 2DMBA 1S7UB 3MACH 2GTWB 3UYRL 5CSGA 1A7RL 3N1GC 5I8KH 3GI8L 2D7PA 3MFFB 5J6HA 1L0YA 1TTFA 4YHML 4IMKA 4XNXL 1AO7E 1EA9C 3MCKB 5I8CB 2NTFB 3P2TA 1MFDL 3S88L 1G6RL 1RJCA 1QPPA 3RIFK 1E6OL 4OQTL 2A6DB 4KUCF 4O2FB 1FO0A 5IHZB 2VERN 5JA9A 1QSZA 2HJKB 2ZCHL 2D7NA 2QADB 1YEEL 5SWSA 4G80A 2VDRL 2UZIL 4WHTA 3WCYA 1LE5A 3OV6A 3KJ4C 1ZT7B 3DGGB 5ISZB 5D7IA 4JDTH 4KXZI 2P8MA 1IZKA 2VLMD 5J0BA 1NDGA 4NRXB 2AV1B 1U8LA 3WHE1 4JN2A 4X6FA 2NXYC 5EBMA 5EO0B 1RHHB 1UCBH 5LXGL 1JPGB 3GSUA 4UDUA 4I48B 5GHWL 1JPSL 4ODXB 1NCDL 4Q9RL 3F7YA 4A6YL 1NAMB 3FFCB 3OXRB 5ELIA 1FVCA 1TTGA 2VXVH 5TDNB 3SCMC 2EC9U 5I75C 3BW9B 3LV3A 1P84J 4L8DB 1G84A 1RY7B 1AHWA 3HI6L 5JIIA 5SWZB 4U6XB 2FJFA 4O2EA 1C5BH 2IANE 4XH2A 5D5MA 3CSYB 4BH8B 2CSPA 4ONHB 3JZ7A 3QWRA 2VLLA 1GGIL 1P7QA 5MERB 3QPQD 1JMZA 2GFBB 4R0LA 4DTGL 5EO1B 1QNZL 1KPVB 1R0AH 4NDMA 1TCRB 1ED3A 2XYCA 3LCYA 1UT9A 1UZ6E 4NWUL 3PJSB 1FN4A 4TSCL 3UTZA 4N68A 4HS8H 2BX5A 4N0UB 2Z0BA 4G9FE 4HMEA 4EI5D 4NQVA 1J0JA 5EBWB 3UO1H 3UJTH 2ATKB 4RA0C 3EYOB 4JFFD 4AH2A 3BUYA 1GYAA 2UZYB 5DSCB 4M5ZH 1JIBA 4FFVD 5HGBB 1XF4A 2V9TA 4TYUA 4LSRL 5I1CH 1UZ6F 1EFXB 2E8ZA 3DOSA 4P4KB 1KCUH 1W8NA 3VXOA 4GXVH 5F71A 1OT1A 4G42B 1RZGA 1MI5D 1RURL 2A1WL 3KWWA 4UT9H 1S7TB 4KRMB 1FFOB 2PXYB 4Z7VA 1F8TL 3KPQA 5IFHL 1CGWA 4IHOA 3QH3A 3PWNB 5I1EH 1EIBA 3HRPA 2JIXB 2P24A 4V2BA 4PJBA 1FZOA 1I85A 5JTWA 1CE6A 3QEHB 3BVNA 2HKHH 5CD3B 4Y4HB 2VLKB 3AMLA 5IVXB 2YPVL 3FT3B 4NBYB 5BCAA 1F4AA 3TJHD 3MLVH 5D72L 3GI8H 4JG1L 3DVIA 2UWEA 3C8KB 3VDBA 4D0BB 1FGNH 3IFOA 3S88H 3QPQC 1QRND 1R3IL 3UPAA 2V5SA 2VOTA 3BPCB 1XGPA 4PJHB 2IQ9H 2CXGA 1F4XL 3RZCB 4JFDD 5H35B 4WFFD 1Z2KA 4YFLF 2E9IA 2ZUYA 4EI5C 3TPUB 3ARQA 3K4AA 3RAJL 2XOTA 3QJHB 2CKBA 3HR6A 5DUBB 3C9NA 5JOFB 3OKNB 1WFTA 4X98A 4HUXA 1JHKH 5F96H 1RZKH 2CIKA 4FFVC 5C2BH 3TFKC 4LLVB 1MFAH 1JWUB 4HAGA 4JQXC 3SDAD 4AEHL 1U8KA 4MJIA 1T20B 1M7IA 4XX1E 3QHZH 2XFXB 3BAEH 3MRGA 3TWCH 5LXGH 1CGSH 4QXGH 5DFWH 5DUML 4KXZH 3K1KC 4PG2C 5HPMA 4O4YH 1NANI 3MZGB 3VRLE 3W2DL 4OCXH 4U3HA 4ODUB 3OXSA 5ENWA 5D1QD 4OUOA 3VRIB 1IC4L 3ARDA 4GQPH 3FRUB 1QLEL 4PJAA 3S4SA 4UTBL 4R4BA 1Q9OB 1BGXH 4BSJA 3I6LD 2V5TA 4Y19B 1L7TL 1QSVA 4U1KA 1RZKC 2WUCH 3HI6H 5DFVC 1H0DB 4YUEH 5EUKB 1XGQB 4YFEA 5KVFL 3RIAK 3CCHB 3SKOA 3U0WH 4ZDHA 4WWKC 3TJHC 3RL2B 1J86A 1GGIH 1U0QA 4WI5A 3VFMA 5DMGD 5C9JB 1QNZH 2GEEA 4FQLL 3L7EB 4HWNA 2XWJB 2G75A 3EFFA 4TSCH 3SKMB 3VFTA 1QFPA 1AGBB 1HILA 1AD0A 2DF3A 4LDEB 4DKFL 1UGNA 3O8XB 1AQDA 4WFHE 5KJRL 2E27L 4LPWA 4D0CB 2WLZA 3BEWA 4JFXA 5DTFB 5HDQL 5DQDL 3UAJD 2H9GA 3LIZL 1VACB 5DEFB 1OPGL 1MCHA 3H9ZA 3OTTA 4LDLB 5DRXA 3M07A 3O4OB 3CX5J 1BWMA 2JJSC 1EGJL 3RNQA 3RDTC 1CFQA 3D2UA 1BZ9A 3RGVA 5H37H 5EOQH 1NFKA 1CFTA 1BZ7A 3FN0L 3ARFA 4G6KL 1RURH 5DJAA 2Z31D 4HKZA 5DJDB 4M6ML 3RU8L 1WZKA 3S7GA 4EN3D 1D6EA 1TLKA 2DQUL 2OTWA 5IFHH 4X9BA 1RZFL 4QXTA 1S7VA 5FGCB 1GL4B 1IBGH 1QFWI 4JM2B 3T1FB 1DEDA 2P47B 4TQEH 3O11A 2P43B 3UYOD 4J6RH 4LFHD 4WHYH 1QRKA 4NRZB 1D5IL 1P2CB 3VRJB 1G7QA 3QCUL 4L4VB 4P23B 5FYLD 1CGVA 1PBYA 3D3VD 1QSFA 1A6VL 1ACYL 5CLWA 3QI9A 1YMHA 3SDDA 3SGKC 4QHKJ 4OZGB 3V5HB 4YDIL 4MVBD 9CGTA 2D0HA 4NKOA 3KVQA 2NY2B 1R3IH 5D6DA 4KJPC 4R2GD 3PDOB 3V6OA 2F19L 4JY4B 4UMGA 3RWEB 2V7NA 2ZPKL 4XP4L 4YHPB 4RAVB 1FNEB 1UQSB 3EOBB 3HI5H 2VNCA 5KS9B 1I75A 2Z93A 3RNKA 1KB5H 1NBYA 3FONB 5HI3C 1A14H 4JLRB 3F7QA 2B1HL 1EVTC 5FKAB 3BPNC 3LEVL 4N8VG 1X6LA 2Z8WC 4ZUTB 5HYSA 5DWUH 2FIKB 5FYLH 3WKMH 2F8VA 1KPRB 3CVHL 1MAJA 1ZLSL 3ARBA 3IJYB 4ZFOB 4DN3H 5F3BA 3PNWA 2UWEE 3PHQA 4C54A 5IESH 4HIXH 3MNWB 2Z31C 15C8L 3P4NA 2AKRA 4OZ4A 5C0RL 4EN3C 5T1LA 3JTTA 4LCIL 4WW2F 3T0EE 5GS2H 3MLYL 1ZVYA 4PJ9D 4JE4B 4LCYA 4B7LA 4UTBH 2EIZA 3MRMB 3O4LE 4H26A 3S96B 2X09A 4IOIB 4LRIA 2VWEC 2I24N 1MY7A 3QEQD 3BP7B 1JNJA 4PJ8D 1G7IA 2UWEF 1H3VA 1A7PH 5JW4Q 3LKRA 2ILLA 1CIDA 2BRQA 2J12B 1CFSB 3GMLA 2D0GA 2FYYB 3ZDZF 4F8TA 3SDXE 2I5YL 2JE8A 1J1XL 2Z91B 3OPZH 4MVBC 1BQLH 5IMMA 3L3GA 1CLZH 3GFUA 5H37G 1EEYB 3V4VL 4R2GC 5ADPH 1EO8H 3C6SA 3BZEA 4LU5H 5JHLH 5EZLB 4PJ5D 4KTYA 5EU6E 3TO2A 3VXSE 2HWZL 4XVSH 2X9WA 1WBXA 5CSZA 1OPGH 4JKKA 1Q9KB 4PJAE 1UZ8B 5BZDA 1JK8B 3K80A 3X11B 4N0FA 1VSCA 2QV2A 1MFEH 3ZZ1A 1E27A 3SDXF 1EGJH 4JPKH 4WHYG 3SOBH 3W0WA 3MYZA 5ALCH 4ZQKB 4YHLH 2Y5EA 1GAFL 4XNZC 4ZAKB 2BSTA 4OBRA 5JIPA 1DBBL 1OL0A 5FUZH 2Q7YA 3PWPB 3T0VA 4PTTB 1I1YB 4OT1H 3WL9A 4M6MH 5TQ0L 4ZXBA 5GIRA 5KVGH 3RU8H 3TT1H 5DJYA 2DQUH 4PJAF 4P3DB 3GMNB 1LO4H 3GBLA 2YSSB 1WTGT 4NN5B 4DVBB 3DIFA 2LV4A 1J7VR 5BOPA 4PJ9C 5ALBL 1D5IH 3BESR 2AQ2A 5SWQA 1QFWH 3HMXA 1T83C 4N9GA 1A3RL 1HH6A 4PJ8C 3GM8A 1FPTH 5EZIL 3RQ3A 2CIIB 2R0LH 4MZ2A 2G60L 3RI5K 2JB6B 4PV8B 1SM3L 4BUHA 2AXGB 3PGDB 1L7IL 3GSNL 1BBDL 4RRPA 3BMWA 1OP9A 2X4TB 2ZPKH 1CGUA 3VXMD 4Z7OE 1GPOH 4Q97A 5CZXD 4BSVB 1DVFC 3T0DA 3SKNB 4R7DB 2B1HH 3T3MF 2DIAA 5FHBL 4P99A 2RFXA 3KJ6L 1ZLSH 3UTTD 4GRLA 3KNBA 2C3VB 4XMPL 1A5FL 3P77B 3ROOB 4S1QH 2UY7A 15C8H 1BAFH 4OD2A 3R4DA 4ZPVA 4L3EB 3SEPA 5C08B 3GIVA 1RIUH 5C0RH 2WBJD 1KC5H 3OKOA 4GG6E 4LHUB 3OF6D 4UT6H 3GJFB 5MENE 1JN6B 5D2LB 3RPIB 1U2HA 3F5WB 4RISL 5GZND 3N0PB 2OSLA 3AGVA 1X5ZA 4A2MA 2UV3A 2BY3A 4U0QB 3MLZL 3EFDH 2KH2B 3R06B 5MEPB 4CAGA 2AEPL 2BSSB 2H32H 3ARED 1BQHA 2ZZUT 3KHOA 3LH2L 5BW7C 4DGVL 5JUEL 1E4WL 5HYQB 1VGEH 2VQ1B 1MELA 3SY0A 3MV8B 2I5YH 3TCLB 1VENA 4GG6F 1X5FA 2EDTA 2P44B 3AB0B 1BX2B 1TPXB 1X5IA 4NIKB 3GUTA 4XP9L 4QRTB 4YNYA 3OSKA 4JCMA 3WIFA 4DW2H 4UAOB 5J6HB 3VA6A 5CZXC 2LVCA 3ZLQC 1NCWH 4EXPX 3N85H 4FOMA 3TM6A 1FO0B 1X5YA 2X6MA 3ZDYF 4XVJH 3STZA 2AJXL 4KU1A 1GAFH 3NMEA 1AGEA 4OLZH 5SWSB 2N4IA 4R26H 4G80B 4MAUL 4NQDD 4WHTB 4XVTL 3FO1B 4FZEL 1WF5A 1LE5B 4C4KO 4C56B 1WGOA 3MPCA 1E4KA 5D7IB 3W11D 1T1WB 2P8MB 4MJ4A 4DZBA 2DJSA 4NN7B 1NDGB 4XZUA 1PSKH 3UBXI 1U8LB 4JN2B 4X6FB 1V8HA 1MCBA 5EBMB 5HVFB 2W0LA 2XTJD 2X4SA 3VXPA 1MH5A 1BMGA 1H3GA 4UDUB 4F58L 4TUKH 5GZNC 5IK3A 4U6YA 2EICA 2QHRL 3V7MA 2YD5A 2P5ED 1RPQA 4QWWC 5F44A 3W0WE 2WNGA 3AREC 3LPGA 4O02L 1F2QA 3P0YH 1QVOA 5JORB 4RGNC 4MXWH 4XAKD 1YEJH 3GSNH 5EOCL 1UEMA 3LV3B 2AGJL 3FZUD 5I18L 1AHWB 1FYTD 1YJDH 2FJFB 2XICA 4O2EB 4XH2B 3DXAD 5LWYH 5D5MB 4JRXD 4NT6A 4JFFA 3QFJD 2OS7A 1X44A 4L5FH 3A6OA 2VLLB 8FABA 2ATPA 3EJYD 2BHZA 1NEZG 1P7QB 1A7QL 4JQXA 2X4PB 4R0LB 2XXCB 4G8GE 1UYWH 4NDMB 1ED3B 4F37F 3ZYOA 4ZOBA 1FN4B 2YOCA 3IKCA 3UTZB 3MXWL 4FQXD 5BO1L 1WVZA 4Y5YA 5MI0B 3DV4A 3PV6A 1G6RA 1FAKT 4NQVB 3I9GL 4ETYA 4OQTA 1MI5A 5IEKA 1A5FH 1Q38A 4AH2B 5D93C 2Y72A 7CGTA 2DQEH 1D3CA 1CR9H 5CSBA 3DYMA 1XF4B 1QBBA 5TF0A 1T04A 3V52H 3W11C 5HDOA 5C71A 4L1HA 2VUOA 3OJMB 5E8NA 1XGTA 3VXOB 1BZQK 4FFWC 3VMOA 2XTJC 1RZGB 1SQ2N 4XTRD 1S5HA 5AUMA 3KWWB 2AEPH 4HCRL 3AM8C 4K71C 4I4WB 4Z7VB 4PS4H 4U1HA 4XPHL 3KPQB 3RVUD 1KTLA 4IHOB 1IAII 5GSVA 4U7KA 2JELH 3ZL4L 4XC1H 4GRMB 1QRNA 2P24B 1H9VA 4A6YA 4PJBB 1F4YH 1FZOB 5D2NE 1KLUA 5IQ7L 1CE6B 4XNYH 2EYTA 1C5DA 4HXAH 4JFDA 3BVNB 1J1PL 1IAIL 4S1SH 4GJTB 4HGMA 3GKZA 2H2SC 4X6CE 5F8RC 1I7UA 2ZUQC 5F1IA 4NO3A 2VDNH 3MLTA 5GISH 3O3BA 4RAUA 2N7BA 1UWEL 3EJYC 2JJSA 3IFOB 2O5YL 3HI1A 5B4MD 3SDAA 4KVNL 4X6DE 5FKPB 1RULL 3VCLA 4QXUL 3UZQA 1XGPB 5DRNA 1KT2A 1BQSA 4ZUWA 5DLMH 4FQXC 2EXYC 1MJJA 3NH7L 1EVUA 2WAHA 4GMSL 5GJTL 4NNXA 3H9SE 4G3YL 3EYUL 3P4MA 4X6CF 2CKBB 3DSNA 4XVTH 3MV7D 3C9NB 4FZEH 4X98B 5D1QA 4HUXB 4M7LH 2CIKB 4E41D 3OGOE 1KBGH 1GGYA 4X9GA 1WUNT 2EE6A 5I0DA 3SDYL 1MWAL 1U8KB 4MJIB 4Q6IC 4X6DF 1M7IB 4ODVH 4LLAA 5HTSA 1BWWA 4JY5H 3O6FD 4TSAH 2CDGA 1V7NH 4ZO6A 1N59A 5HHXL 4ALAH 1OQXA 3VI4E 1I8IA 1L6ZA 4XRCA 1U8IA 3B8SA 2RBLA 2GJJA 5ENWB 2X4QA 3CDGA 2ADGA 4KROD 4PJ7A 4RWYH 1TVBB 2J5LB 1NKRA 5E6IC 3B9DA 3ARDB 2WMPA 2QSQA 5DGRA 1AGDA 3S4SB 4R4BB 4D2NA 1YEDA 3MSPA 3JWDL 3C5JA 4U1KB 1PEWA 1WTLA 3OL2A 2D3VA 5IGXH 3KPPA 3QXAA 1U3HD 2DBLL 5BS0E 4MQ7A 4P48A 3SKOB 5A3ID 1AY1L 5DD6A 4ZDHB 2WINA 4CDHA 4CNIA 5FDWA 1C7TA 3FQWA 2I9TA 5IUSA 4BQ6A 3VGAB 5MHSE 3ALXA 1IARB 1PLGH 3VFMB 4NO2A 5T1MA 2G75B 5B4MC 4AY0A 3EFFB 3VFTB 1HILB 1AD0B 5BO1H 1T0PB 1AQDB 4DGYH 5EH1A 2XIDA 3BEWB 1VESA 3MJ9L 4JFXB 3LSOA 5T1DH 5C6TH 4EQ3A 4NUGL 2HYMA 2H9GB 2Z31A 4JO1L 4XPGH 2CJUL 5DRXB 3DX8A 3S6CA 3GK8H 3V4PL 4EN3A 2C5DC 1IAOA 1C5CL 1S9YA 5A40E 4JB9H 5KAQF 1FBIL 3RNQB 1RU9H 2W0KA 1CFQB 4QRRD 4MCYA 4UQ2A 4M4PA 1BZ9B 3RGVB 3AS1A 1CFTB 3O6FC 1NCCL 5I9QB 2BRRL 2VXSH 3D3VA 4U1GB 4YLQT 5DJAB 3VD3A 2X10A 2CH8A 4HKZB 4MS8D 1PG7H 4K3HA 2R29L 3BRDA 1D6EB 1Y6KR 2OTWB 3BP4A 3FHQA 2J6EL 4KROC 4HJGA 4QXTB 1S7VB 2EDEA 4JRYD 1W72H 4L3CA 3O11B 2NXZC 2GY5A 3HAEA 1SJXA 4OKDA 3HFMH 5TE6L 5IQ7H 2DQIL 2APVA 3P3YA 2HKFL 3ARXA 3HPJA 3MODH 4GAYB 5C07D 1UM4L 5DS8A 4R4NC 2HT4C 2OI9C 1QSFB 4YO0A 2JJVA 1XIWD 3QI9B 1U3HC 1YMHB 2PYED 1N6QH 1ZANH 4H25A 3SDDB 4DKEH 1VKXA 1P5UA 3TP4A 4NHCH 4ODHL 4ZFFA 5I71C 1UWXH 2OL3L 1UWEH 3L5HA 4S0SD 1INEL 4NKOB 3LQAL 2CD0A 1CU4H 5E56A 3CFKA 4BQ8A 5JQHC 1YNKL 3UBXG 2V7NB 3NH7H 2NY4C 1YECL 4GMSH 2A0LD 4Z5RA 4JFZH 3ZDXE 2Z93B 4JHWL 4JQIL 3RNKB 4DUWA 2I27N 5BQ7A 3VGBA 4PRID 5BMFH 3V2AR 1INDL 2PTUA 4J3XA 2YHGA 2BMKA 4MB4A 2AJZA 3CSGA 5HYSB 5TE4L 1KFAH 3EO9L 1YMMB 4LRNL 4PJ9A 3P9MA 1I9RL 3FN9A 3ARBB 1JNNL 1RFDL 5F3BB 1EGJA 1KB9J 3PNWB 5D1ZC 3S37L 2OR9H 3PHQB 3QEQA 2EE3A 5DC0A 4LVOB 4PJ8A 3OZ9L 3ZDXF 5HYFA 1FHGA 1LWRA 3MCG1 3CDFA 3P4NB 4MS8C 1OTUD 1T89C 2AKRB 4OZ4B 1N6UA 4OZFH 4OSUH 1DQML 3AS0A 5T1LB 3JTTB 4HGWB 4ZNCD 5A2IH 4LCYB 1UJTA 2EIZB 4H26B 3MRBA 4Y2DA 4N0YL 3CFCH 4YWGL 1CF8L 5TE7H 5K9OA 2W65A 3R8BB 1G7IB 5CZKA 4PJ5A 1T7YA 4GKZA 4M6OH 1U93A 3IJHA 3WLBA 3KGRA 3LKRB 1AY1H 1NDMA 4MNQD 3OR6A 1XIWC 4LHJB 4F57L 3GMLB 3CU7A 3PGFL 4U0RC 1MVUA 5J3HC 1JMXA 2X1QA 5IMMB 3L3GB 2APTA 5LGHL 1DSFL 4NCDA 1A1NA 4ENED 3GBMH 3OHXA 3C6SB 3FOLA 1N0XH 1PFCA 3BZEB 4NYLA 3DYOA 1J0IA 4MNGE 5I74B 1FCCA 4PJIA 2R15A 3EDEA 1FNAA 4WFED 4JO1H 5DDHA 5CSZB 1WBXB 1DBML 1Z0MA 3ABZA 3OBAA 4R96A 4F7MA 5BZDB 2YN3A 4N0FB 3LOWA 3QQ3B 1E27B 2Y07L 1U3YA 3IXTA 4NJAH 1SYSA 3H7BA 1HIMH 4PB9H 5HVHC 3TIDA 4G6MH 5E08H 4WI3A 2BSTB 4JDVA 2O61A 2XWTA 3CVHA 1LP9E 4LF3A 2Q7YB 1G7HA 2OR8A 3WL9B 1MJUL 5GIRB 1JJUA 4OZGF 2R29H 3VWKC 1Q72L 1AXIB 4NWTH 5B39G 2J6EH 3KLHD 1OTUC 5T3ZL 3S35H 5J7CC 5F9JA 4Y4KA 1X9QA 1J8KA 2OTPA 4Z0XA 4CADA 1RZ7L 3DIFB 5C0BB 3I50L 5DI8B 2DQIH 4AM0A 2OXGA 1NEZA 3V5KA 5SWQB 1XFPA 1ZLVK 3VXMA 4N9GB 1HH6B 3EO1A 3CZFA 1LP9F 4CW1A 3FT4A 3OX8A 4R97C 1B2WL 1IEBB 1NH6A 1I7RA 1WITA 2EDJA 3WFBL 1AI1H 1Q9WA 5CEXA 3NZ8A 3UJJL 4WFGE 3I3DA 1BVZA 3UTTA 1ZLUH 4ENEC 1SYVA 5T5FL 4HXBL 3P11L 4KDTC 1YEIH 4ZOEA 4NN6C 5JXAL 3BO8A 4OZFG 2ZNWA 4X6EA 1NFIA 2C9AA 1INDH 5GGTL 2YA2A 4C57C 2OTUA 1J12A 2WBJA 3LB6D 2VLRD 5ANME 5EUOE 2VH5H 4M7KH 1RZJL 1YQ2A 2RFXB 4PRAA 3P0VH 4UV4L 3VXTA 1UENA 2F58L 5DC9B 3AMKA 3NCFB 3HE6D 2DTMH 4X7EC 4GRLB 3KNBB 1JZ2A 4OV5A 2FL5A 1N0LA 3FL7A 4Z95L 2A73A 3AREA 1S3KH 3CXHK 4OD2B 4ZPVB 3MA7A 3CH8A 3GIVB 3O2VH 1DQMH 3OKOB 3SCMB 2MHAA 3KYKH 4P5TC 3KLHC 1LO2H 4OLXL 2XT1B 1KJMA 5EUOF 3HLAA 2EDBA 3MV9D 5DK3A 3LS4L 2OSLB 4YWGH 5TQ2L 2Y23A 3DJ9A 1CICD 3KS0H 4DOHE 3VW3L 2Z35A 3WFEL 1ADQH 1B9ZA 1BQHB 4IDLA 2BOBA 1GOFA 4CMHB 1S8DA 4HKJA 4WEBL 4A2LA 2R9HD 3PGFH 1PDKA 3SY0B 1MSPA 2VQTA 4IRJD 1B0WA 4ZYKA 5HJ3A 2JJTC 4J3OC 2PETA 2GITA 3UEZA 2VMFA 4XCCL 3IS0X 3AAZA 5T3ZD 3V6BR 2HVKB 3GUTB 3VXUD 2B5IB 3GSNA 4YNYB 2VDKH 3WIFB 5HHOD 3CXDH 3O2DH 1I7TA 1JGVL 5JOEA 2FX8L 3KR3L 3DHJA 4OF8A 2IBZY 3LB6C 4X7FC 4R7NA 3X12A 1OQOA 1UA6H 1CI5A 4M7JH 3STZB 4PGZA 4LLMA 2VAJA 2XKNA 1AGEB 3EJJX 4LSPL 1P4LA 4LCWD 4WTXA 5C86A 3ESVF 2HLFC 2P5EA 4X99B 5TJWK 4K7FA 2EDDA 3OB8A 1Q72H 3N50A 4ONFH 4DZBB 1I4FA 3UMTA 4JVUA 4XZUB 1SEQH 2YUXA 1T1XA 2N7AA 4PGJA 3GB7B 3P30L 3EDDA 1RZ7H 5F1OB 3MRNA 4WENB 3VXPB 3CVIL 1MH5B 5D71H 5DA4A 1M71A 3GHEL 2R1XA 1FYTA 3NTCL 5FGBC 3MJGX 5IK3B 3O6LH 3DXAA 4JHAH 4U1NA 5CIPH 3EOAA 3RJDA 2HJFA 4MQTB 1UC6A 3QFJA 1LHZA 4JN1H 3V8CA 3P9LA 3TH2T 1B2WH 3P9WB 3UZEA 2EH8H 3T8XA 1H8SA 1QVOB 3IDMA 3UTPE 5DGQA 1DBKL 1YEFL 5ESQA 4GMTL 2E6QA 1H3PL 1RJYA 1KEML 3H9HA 4FQXA 3U4EB 1EV2E 5CP3A 5D8JH 2ICWI 2VXQH 4P2QD 4EI5B 3HA0A 4XVUD 1JRHI 4L8SA 2RB8A 3G9VA 5B38A 4NT6B 3RA7L 3RTQC 4JFFB 3T65A 3PXJA 5JXAH 3ZKND 8FABB 5GRUL 2ATPB 1P84K 3J7HA 3ZYZA 1RJLA 2KPNA 2OJZL 2A2QT 2PYFA 2BNQD 1JRHL 4GLRI 1Q1JH 4HGKC 4GO6B 4NGHL 1IILE 3IKCB 1RZJH 2XKUA 5IVOA 1B4RA 1FNGA 4Y5YB 3DV4B 2NY6D 3D6GA 3PV6B 1G6RB 4LSVH 1W8OA 3GZKA 4NQED 1MI5B 4JFOA 4KAQH 4U49A 5IEKB 1MHEB 4P9ML 1QUNA 1R24A 5I1GL 1KJ3L 2CR3A 4HFUH 1N3NA 2XQBL 1T04B 1WIUA 2XZAH 1FL3B 1MIEH 4MXQC 3R8QA 4FS0A 4OLXH 3WFZA 1PX4A 1UKQA 5E8NB 1W2KT 1XGTB 4HF5H 3WKNA 3BIBX 4QRPE 5CGYD 5A2FA 2JKXA 1J05B 1S5HB 4AJ0A 5AUMB 4K3DL 3IU3A 1EHLL 2DQJL 1C08A 1RZJC 32C2A 4PRHE 3KG5A 3OKLB 4UIKL 4U1HB 4WEBH 1KTLB 1FNSL 5GSVB 5FYJH 5K9JL 5DHVA 1QRNB 4I18A 5FYKH 1UG9A 3QULA 2EXWC 1KLUB 4XCCH 2EYTB 4JFDB 3SKUD 2PW1A 5I1KH 1GJIA 2R8SL 4XVUC 1I7UB 4NO3B 4RX4D 3O9WD 3I2CL 3MLTB 1D5MA 5I8EA 3MV7A 1MCQA 3O3BB 4RAUB 5D1XD 1U8OA 5MEOA 2COQA 4E41A 3HI1B 4MLSA 3SDAB 4HSQA 3BKML 5KANG 3VCLB 1P9MA 1F90L 3QWQB 5DRNB 3C5ZD 1KT2B 4MCZA 3VH8A 4ZUWB 4FZ8H 5FGRA 3FTGA 1MJJB 1JHTA 3CMOH 4WJ5A 2NY6C 4NNXB 2WWMC 1FDLH 4LLYA 5GS1A 3TEUA 3IDNA 4L29A 3MA9H 5ILTL 5D1QB 1IFHL 3BH9A 3D85D 2CDFA 4OFYD 3P30H 1T2QH 4HDIA 1H8NA 3DROA 3EAKA 3PHSA 1RHFA 2CDGB 2FCBA 4P2OD 1C1EH 1UJ3C 1N59B 2AJYL 3GHEH 3BKJL 3RUGA 2YA0A 4K7PL 1I8IB 1U3HA 2CKNA 5CGYC 2QLVB 5J6GA 4XRCB 1U8IB 1BECA 2WM0A 3G6AB 5JQ6L 3CDGB 3F8UB 5DUPL 2ADGB 4LOUC 4PJ7B 1S9XA 2Q6WA 5EIIA 4JFHE 3DX6A 1DBKH 5F1KC 4HCRA 5GGUA 1YEFH 3I85A 1AGDB 1H3PH 3WLWC 1KEMH 1YEDB 3BD3A 3FKUS 1BFTA 3C5JB 4S1DC 5FO8A 1CTOA 3KPPB 4OQ1A 5CKGA 3QXAB 2J88L 4J4PC 4MQ7B 4X80L 5GJSL 3RPKA 3NOIA 4X4MA 4QOKD 4WVRA 4TRPL 2WINB 5DD6B 4CNIB 3UTQA 5DZOA 3FQWB 5GRUH 2I9TB 1WBYA 2G2RB 3BPNB 3GSQB 1VCAA 5DVKA 3ZT7A 4N0RA 4NO2B 5T1MB 1ZXQA 2EZ0C 1JRHH 5JNYA 3TA3C 1GGTA 4QRRA 1KLGA 4LPTA 5IT2L 2IG2H 5IEHA 1XR9A 3NCCB 2HN7A 5CWSA 4XMLH 3QDHA 4GLRH 3LSOB 2BDNL 2Z31B 4P9MH 4PJXE 3V7AG 1H3UA 1A6UH 4OCNC 3DX8B 5I1GH 1QFWM 1KENL 3B3IB 3WS6C 4M7ZC 3IFLL 4EN3B 4Y0GA 1IAOB 1S9YB 3U9PL 4I2XE 2DLHA 1KB5B 4UINH 2R0ZL 3KXFE 4KMTL 3HUJB 4MCYB 3SO3B 3X3GL 4FFYL 1ZHBA 3CX5K 5C07A 3VDAA 1A6PA 3D3VB 1MWAA 4UTAL 4K3DH 3TBTA 2PYEA 4B53A 3QCVL 3L7FA 1CYGA 4PJXF 3OQ3B 2BHYA 4UIKH 3MGAA 3BP4B 1FNSH 4G6JL 4HJGB 3MX0A 5CINH 1WC7B 2AQ3A 4FQQA 4L3CB 3WNOA 2FATL 2DQTH 4OLUL 4YAQA 3MNZA 4R2GB 5HI5D 4LCCC 3HAEB 2DDQL 1SMOA 4JAMA 5CBAA 5C0GA 3I3BA 1MLBB 1OAZL 3QRFM 5DS8B 3GRWL 5SV3A 1IGCL 4H25B 4P5KA 3LHPH 1DEEA 1VKXB 2FHBA 4ZFFB 3U7AA 3WXVH 2AW2A 1F45A 1FG2A 2EDQA 3TYGH 3CFKB 1F90H 4N8CL 4YDLC 3JSSA 4XNZB 2J8UA 1KJVB 3QB7C 1R5WB 2FX9H 5IM7A 2BNRE 4Z5RB 3DMMA 2Y06H 1D9KA 1A7NL 5IW6A 3OKDA 2EH7H 5BQ7B 3HR5A 2VDOL 4MYWB 3NCJL 2O5XL 4OB5H 1MHHA 2IPUG 2BMKB 4KJYA 2AJZB 4GRWH 3MJ9A 4U6HA 1IFHH 3WXWL 4P9HH 4WU5A 3FOMA 5IBTH 2AI0L 4RIRA 1MPAH 1R5VA 4PJ9B 5HHPA 1FIGL 5KW9L 3P9MB 2J8HA 4KKLC 2YRPA 2B39A 1ACZA 3MV7E 4JFPA 5E2TL 2AJYH 5J56B 3QEQB 2BXZA 3PDGA 4PJ8B 5F6IC 3T4YA 5DJ0B 4N0CD 4MNQA 4W6YB 1LO0L 2Y1VA 3NA4A 5FF6A 5TH2B 3HNVL 1FL5A 5CJQL 3FQXA 2Y5TA 3C5SA 3MRBB 2J6EA 4KV5E 1IGFH 3FFDA 2XN9E 5K9OB 2W65B 3QYCA 1LDPL 2RR3A 4P9HC 4PJ5B 4GKZB 4X80H 1U93B 3WLBB 1NDMB 3OR6B 5IP4A 1WCQA 1RI8A 4FN0A 4YBQD 3ZT6A 3MR9A 5HGDA 2BJMH 1CDBA 1MVUB 3QUZD 4LDOB 3MXVH 2R0WH 1UB6A 2HRLA 5JZ7D 4TTDD 1JYVA 3RIFF 5HHME 1KCKA 2OL3A 1KCSH 1ZTXH 3OHXB 4AZ8A 3FOLB 4KV5F 4PJCA 4NYLB 4XP6L 4PJIB 4XNUL 4CVXA 5GSRB 5DDHB 2G9HA 1CD1A 4JPVL 1KTDA 4R96B 1KENH 4F7MB 4EUPH 4X5WB 4JZNA 3IFLH 4N90E 5L88L 3U9PH 4YE4L 5KN5A 1JGLL 3L5IA 3IXTB 2GYSA 5CUSH 1P7KA 1MIML 1SYSB 3H7BB 5DD0L 5FB8A 1VFBA 5INCA 4ELMA 5J11C 1TETL 4JG0L 4AEIL 4JDVB 2XWTB 1WT5C 5LBSH 4HZLA 3CVHB 4U4BA 5EA0L 1G7HB 4KRPD 3HKFA 3QCVH 1I3GH 2XI9A 4HUUA 4JKPL 1JPFA 1VFAA 2X41A 4LLUA 5E7FA 4G6JH 4YDVA 1YA5A 5F9JB 2O5ZL 4X8JA 1MJ8H 2FATH 3DVNA 5LQBH 3QEGH 5HDLA 4H0IA 3LD8C 4L4TD 1DLFH 4P2CG 5GGRA 3BRFA 4U2YA 5KSBE 1OAZH 4I1NB 4UU9B 1NEZB 3V5KB 4FQPA 1CDGA 1FE8L 3VXMB 3EO1B 1A47A 4CW1B 1PZUB 3WFDL 1PAMA 1YPZB 4CMMB 2RJMA 1I7RB 4AIZA 2F53E 1CXLA 4PUBL 4YBQC 3BXNA 1Q9WB 5E2VH 2H32B 5CEXB 3NABH 2VLRA 3HPLB 3QNXA 3IFNL 3QUZC 4X9FA 5IR1A 3QZWG 1INQA 3SE9L 2H8PA 2FBJL 4JPWL 5JZ7C 4R6UA 2R2BA 4TTDC 3UTTB 1SYVB 4FQIL 2QQNH 3TNNA 4Q0XL 4QT5A 3HE6A 1T03L 1FORH 3ES6A 5KSBF 1NAMH 5DA0B 3B9VA 1A1OA 2FEDD 2VC2L 1A7NH 2QADC 2KQNA 4X6EB 5DJ2A 1NFIB 2Q1EA 2B1AL 2OTUB 5C0AA 2DD8L 5L0QC 2WBJB 5ITBL 4FXGA 4X9HA 1NCBL 1W0VA 1JZ8A 4HKBA 35C8H 4OF6A 3VXTB 5KW9H 3G6JE 3VE0A 4EBQL 3RL1A 1I3RA 1FC1A 4I3SL 2I60L 4OV5B 2FL5B 1CICA 1ND0A 2A73B 5EN2A 3AREB 3CFEA 4E5XA 4LPVA 5C09E 2J4WH 3G04A 4C55A 2MHAB 5GRZA 5CJQH 4IRJA 1Q94A 5FO7A 2EDXA 1KJMB 1FNFA 3RP1A 3WN5C 3HLAB 3G6DL 5I30H 4F7PA 3G6JF 4HQQL 3AROA 1YEGL 4XPFH 3VXUA 4OFKA 3W5MA 4RQQA 3Q0HA 3BSZH 2Z35B 3DSFH 4EUPG 1N8ZA 2G5BA 2BOBB 1S8DB 1IC5L 5HHOA 4HKJB 2AXFA 5FUOL 1I1CA 5DD3H 5J12B 3VWJD 2IGFH 1F3DH 1OAUH 2B8OT 5HJ3B 2OK0L 5FUCE 4BH7B 2GITB 3S5LG 5I8OL 2ZNXA 2QKIA 1JBJA 3AAZB 1AQKL 3IDXL 4R4FH 3U6RA 2MQCA 1GSMA 3GSNB 3QWOA 4LCWA 5D93B 3DWTA 4P2RD 4NQDB 4ETQA 5K9KB 1TJGH 1A22B 2FEDC 4JPVH 3J8F7 4XBEL 2D7MA 3AY4C 1J8HE 1I7TB 5IWLA 4QRSA 5L88H 2FJHA 4Q2ZA 5C7XL 4R7NB 3X12B 3LAFA 5DD0H 4V1DD 5GGTA 2OJEB 2XTJB 3WS3A 3H42L 4LLMB 2JK5A 1U6AL 4M1DL 2XKNB 2XQYG 2CDEA 2NCMA 4LMQE 4AEIH 4P4KC 1P4LB 5CJXC 1ZK9A 5EA0H 2A83A 4UILH 1N64L 2P5EB 1EEUA 4XHJC 3SGJC 2D0FA 2IPTL 1I4FB 4YHKH 4R90L 4PJCE 1T1XB 5AWNH 4LHQB 5DD1H 4LPXA 3MRNB 4OZHE 4PRPD 5BRZA 1AFVH 2HH0L 3U7WH 4AYFA 1M71B 1MQKH 2R1XB 3BOVA 1FYTB 1DN2A 1I9EA 2KL6A 3DXAB 4PP1C 4U1NB 2WQRA 3EOAB 5C0ND 2HJFB 1FGVL 1A3LL 3QFJB 3RIAF 2VKXA 3P9LB 3L3HA 2EDYA 3NACL 4MD0A 1BVKA 1K3ZA 2K3TA 3HTLX 4XCYA 4F37K 5E2JA 2BNQA 1CFVH 2FB4H 1R3LA 5ESQB 4RFEA 3U83A 2QR0A 4O5LL 1K4CA 1RJYB 3H9HB 4FQXB 4WV1A 3ZTNL 4OZHF 1KELL 3DBXA 4Z0BH 1FV1B 4L8SB 4NQEA 1NGQH 4M5YH 3T65B 4OTXH 2D4DA 1A2YA 1C12A 1RJLB 2FHCA 1OSPH 2NQCA 2YK1L 4DAGH 2PYFB 3MRJA 5T1KD 1YQVH 4D9LH 4Q6IB 2VZVA 2ZKHL 2VDMH 1HHGA 4O9HL 4TTGA 4I3RL 3BP5A 5BVJA 1UJ3A 1FNGB 4C58B 4ORZC 3MRFA 1NMAL 3BGAA 1DQLL 2EECA 1BLNB 3V95A 1QBML 25C8L 1DE4A 1F00I 4HWBL 2B0SL 4JFOB 2I60H 3ULUE 1IAIM 3CDYA 1R24B 2N56A 3GNML 2DS4A 3BWUC 5L7XH 2FH6A 4MJ6A 1GOGA 1N3NB 4EVNA 1PQZA 1MHCA 4KVCH 5E95B 5I66A 2FR4A 2MOVA 3G6DH 1EAPA 4RMSA 2K7QA 1B4JH 5EU7E 1CN4A 1N5YL 4HQQH 1YEGH 1HDMB 4UT7L 1QLFA 3T2QA 5C0AE 3IU3B 4GSDL 4ONGL 4Y4FD 1C08B 4J7RA 3O9WA 5JLZA 3ULUF 5C0NC 5I2IA 3MUHL 3MBED 3NFPA 4R9HA 5D1XA 1OP5K 5FUOH 1PKQE 4OF5A 5IHUL 5DHVB 1GGBL 1OGTA 4JJ5A 1LK3H 1KG0A 1U8PA 4I18B 3QULB 2FGWH 4P5MA 5FFLA 3C5ZA 2WWKT 1HSBA 2QQLL 2D4FA 3S97C 1AQKH 1RUMH 2PW1B 3IDXH 3MCLL 3X3FH 2NX5D 2BY2A 1U9KA 3MRQA 3O8XC 3O3EA 4IS6A 1D5MB 5I8EB 1G7PA 3MV7B 2Q86B 4ZS7L 1HH9A 1U8OB 5MEOB 4E41B 4IDJL 4Z7WE 3O4OC 1LO3L 3STBA 4OFYA 2HT3C 5IG7A 3QJFA 4MCZB 3VH8B 3FTGB 3KYNA 2R2HB 2BSRA 2EDKA 1JHTB 4P2OA 4PBWD 4WJ5B 1FRGL 3AS3A 3RBSA 4LLYB 5CILH 5GS1B 4CU8A 4FG6D 3QFDA 1YN6A 3IDNB 4OCRH 5EG6C 1IT9L 2JCCA 4L29B 3MOBL 4PLJC 4NC2B 5EZJA 3M17A 4KKCD 4KROB 3ILQD 3LS5L 3O3AA 1BD2E 4R3SA 3BEVA 4NO5A 4Z7WF 3TN0A 5J9PB 1REIA 2WUBH 2CDFB 3GJEA 4HDIB 4LCCA 4LVEA 2FD6L 1UFUA 4JM2C 3BPOC 1AO7D 2HH0H 4YHNA 2DIJA 3RUGB 5FXCH 1NGZA 5T33L 1BOGA 1U3HB 3QIBD 4JM4H 2WIIA 3BN3B 5J6GB 2FWOA 4P23C 4HBCL 3CLEL 1A3LH 4QOKA 5FV2A 4Y4FC 4YIQA 2GK2A 5I71B 2Q6WB 1S9XB 4N8PA 5GS0H 5EIIB 4YFLI 4NKIH 3DX6B 1P69B 1NCAH 2YXMA 5ICXB 3Q1SH 3MGOA 4NZRH 4YK4C 5GGUB 1OHQA 4UBDC 1F6FB 5CCKL 5I1LA 2NY2C 4HS6B 4KFZC 1NC4D 3KPRA 1NFDA 1QPXA 4GW4A 2H3NA 4UUJA 1WAAA 3AS2A 3EGSA 1HSAA 3UTQB 1WBYB 4C83A 1F3RB 3WJLA 4G9DA 5BRZE 4EI6A 4NUJA 1KN2H 2W59A 2VE6A 1AC0A 5JNYB 2ZKHH 3IRZA 4WY7L 4QRRB 1FIEA 1KLGB 4I3RH 3VFGL 1WJ3A 5IEHB 1XR9B 1UM6L 4XPAL 2OP4H 2HN7B 5CWSB 3BKCL 3FB6A 5J06A 3U1SH 1SJHA 4FG6C 1T2JA 5HY9A 4KKCC 5EZOL 5F9DC 3ILQC 2IAND 3IAQA 5T5NG 1IGYA 2YN5A 4JRYB 3UYPA 3U48A 4QTHA 2F5BL 4ODWA 3VGEA 3ULVL 4D9RE 2PUQT 2LU7A 4X4XA 2QSCL 4WNQA 4TOYH 1ZHBB 5C07B 1QYGH 2MFNA 2YD7A 1JTOA 1YNLH 1UCTA 1XIWB 3QIBC 4OJFH 2PYEB 3ZKXB 1LQSR 3B6SA 3L7FB 2C3GA 4G9FD 4U0RB 4GBXD 4FQQB 3RI5F 2NY1D 2LTQB 5D96B 7FABL 4OF0A 1DBAH 3RY6C 3PIQA 4NQSB 2XY2A 4B7IA 4JAMB 5CBAB 5C0GB 4OD1L 3MCLH 2AVGA 4WUKH 3VMPA 3NZHL 4P5KB 1DEEB 1BJ1J 4ZS7H 4WI8A 4I3GA 3OKYA 3HHRB 4IDJH 5ID1A 5JR1L 4PP2A 2DQGL 1FG2B 1LO3H 3Q6GL 3VG0H 4NZTL 3VG9C 5HVHB 4U1IA 2J8UB 2W0PA 4FFZH 3LQZA 1FRGH 2Q8AL 3VXRE 2Q87A 3VFPB 1TCMA 4APQA 4ZAKC 5IW6B 3OKDB 3HR5B 1GCFA 1MHHB 1RQ5A 1LNUA 2GUOA 4KJYB 1HE7A 1UXSA 4U6HB 1CL7L 4Q9BA 3E8UL 1E4XH 3FOMB 4WU5B 4XBGA 4RIRB 1R5VB 5HHPB 4AENA 4EUPA 3M8OL 1JHLL 4R8WH 4NN5C 1LK2A 3UPRA 4YJZL 4QF1A 4OM0L 5T33H 5CHNA 2NY7L 3T4YB 1WZMA 5ESAA 4HBCH 4R97B 4MNQB 3S5LA 3HZKA 2DM7A 4NO0D 1CXEA 3MV11 5FF6B 3G5YA 5L2KD 1FL5B 1KB9K 1AKJD 3QUZA 3FQXB 2AJSH 2W0FA 2Y5TB 3GSVA 3HNTH 2CMRL 3FQTA 4LARH 2NY1C 4KJWD 2VWEE 43C9A 4DN4L 2IBGA 3C5SB 3HN3A 4LSTL 3FFDB 4K23L 5C0DA 5E6YA 3WO3B 4HG4J 1A6WH 4MB5A 5H94A 3SKJL 2XACC 1FSKB 3ARWA 3GMOA 3F65A 3MR9B 3GRWA 3MLXH 5HGDB 1TVHA 2X9YA 3CSBA 5SX5H 1MRFL 3QDMA 3LKPA 2OL3B 4XPAH 3MRIA 4PJCB 4PFEA 3VJ6A 2KQMA 4YQXL 1KLFA 4IM8A 5HHNA 4CVXB 2G9HB 1CD1B 4AEEA 1KTDB 4EOWH 2FBOJ 1PVHA 2WIMA 4L9LA 4UV7L 4GAJL 3B5HA 3RRQA 1ZE3C 5HHVL 1CIUA 1JV5B 4M6NH 1CE1H 3A6BL 3KPRE 5EU5A 2OZ4L 3WN5A 5KN5B 1NFDE 5DZLA 1P7KB 2FX7L 5FB8B 1VFBB 3GHBH 5INCB 4ELMB 4WDIA 1WAAE 1S7QA 4PY8I 1GXEA 2FZ3A 4EJ1C 1NGWA 4ZUVA 5E5UB 4HZLB 1FVDA 1K8DA 3LDBC 1MF2L 1HEZA 4HUUB 5KZCD 4PJEA 1JPFB 4E0RA 4LLUB 4WFHD 3QNZA 4YDVB 2D03H 3QPXL 3DVNB 2DB8A 3GO1H 5F72S 5GGRB 2X2YA 1OP3K 1K8IA 1TPXC 1GOHA 4M9OA 2DWDA 5AYQA 1UEYA 4YPGA 1IAKB 3BE1H 3EDFA 3AY4A 3DURA 2DQCL 1IKFH 4AIZB 3BXNB 3L9RA 1WWBX 5JR1H 4IMKC 3TBVA 2YPLE 3FQNA 2ERJB 2VLRB 3QNXB 4P3CL 4KWUA 5IR1B 1INQB 4NZTH 4DKDC 2H8PB 2HJLA 2A9ML 4NPYB 4QCIA 1QOKA 3TNNB 2Y36H 4CL7A 3BKYH 3HE6B 3N1MC 5CJXA 3T4AA 1UXWA 4B41A 5MP6L 1A1OB 2VYRE 4PRNA 3EDJA 1OCWL 4QXWA 1XGYH 3Q5TA 5DJ2B 3RVXC 5FYJU 3VI3E 5D6CA 1IQWH 1T7WA 3FAXA 3DTXA 4FXGB 1RUQL 5FYKU 1W0VB 4HKBB 4OLWL 4U6TA 4NN7C 3GIZL 1JTPA 3VE0B 1HKFA 1U8JA 5D7SH 3MV9B 3RL1B 1I3RB 4OM0H 1CGXA 1CICB 3NCYP 5EORL 5EN2B 1EO7A 1WZ1H 3RY4A 3U7YH 1KCRH 1N7ML 2A6KB 8CGTA 1IC7L 4DK6A 3VI3F 3RFZC 3VWJA 3G04B 3BYYA 1F4WL 1CS6A 4IRJB 1Q94B 5FO7B 3QHFH 2X44D 3LMJL 4U31A 1RVFL 4F7PB 3OB0H 4NOFA 3VXUB 5GGQL 2W1NA 4P4RA 4RQQB 3WDHA 1OGAE 4NKMA 4ERSH 1N8ZB 4P2RA 2G5BB 4CN6A 3EIFA 2ZCLH 1X5JA 5M94B 5HHOB 4EDWH 3MV01 1XH3A 2AXFB 1L0QA 4N5ED 4KJQD 3D9AL 4NKDA 1T22A 5A2LH 5C0CE 1FL6A 3SE8H 1JNLH 5EB9A 4Z8FL 4HS3A 3ZKSD 5CD5D 2QKIB 3DLQR 4V1DA 3U6RB 4HWEL 2M26A 1X5HA 3T0ED 3QWOB 2VQUA 4LCWB 4PV9A 4KHTH 1WFNA 4K3EL 1YYMH 3SGDI 4ETQB 4PGEA 3WDJA 2B2XL 4Q6YA 3O4LD 2R2CA 3PQYE 3HNSH 2FJHB 4Q2ZB 1IEHA 4Z7UA 4TNWK 4PRPA 3WS3B 4CVZA 2BNUA 1RZIA 2CDEB 1X3DA 1AH1A 2A83B 1CXFA 5J89A 4Z7NE 4ZOAA 2YWZA 3QDME 4FHBD 4KMLB 2XZCL 2CO6B 2K1MA 4MD4A 4YX2L 5EU6D 5C0IA 1TJHL 3AFLA 3QPXH 3VXSD 1R6VA 1QZ1A 5I1JL 4IOFD 4PLKD 4HKXA 2A6IA 2A6JA 4DQOL 4RFNC 4OIIL 4BK5A 1U92A 2CKBH 4P2QB 1OLLA 5EFIA 4YR6A 4HULB 3FMGL 1OAXH 4H5SA 5DEZA 3ARPA 3H3BC 1NLDL 4Z7NF 4RGNE 3V0WH 3L3HB 4DEPB 4MD0B 1BVKB 2JJUA 4XCYB 3K81A 1JI1A 2XA8L 2BNQB 3GJFK 4KJQC 1R3LB 4RFEB 2B4CH 2QR0B 1XT5A 1PG7X 5HVWA 2A9MH 5SX5K 4WV1B 1JI2A 1QFUH 3DBXB 2NY6B 3H3PL 3WFCH 1UVQA 4LEXH 2XNAA 2NR6C 4NQEB 5JPMA 1JGUL 4KZDL 1Y6NR 3A67L 3IS1X 1OCWH 1A2YB 3NFSL 5E5RB 4AQ1B 5L9DH 4TVSa 1C12B 3CIQA 4D0DA 3MRJB 4G6FD 1HHGB 1RUPL 2HTLD 3BP5B 5BVJB 2JLLA 1UJ3B 3D2UD 2VRAA 3MRFB 4NZDA 5E00A 1DE4B 3FB5A 1FAIL 5C70A 2NYYD 2B4CC 3ARFD 4Y4FA 1KIQA 2ADIA 5EORH 5L6YL 3C08L 1G1YA 5KVEL 1JPTL 2YMXH 4MJ6B 5TF1L 1E6JL 3MBEA 3TT3H 3GI9L 3ORJA 1IC7H 1XMWA 4OLVL 4EVNB 3V5DA 1PQZB 1MHCB 5KVDH 3MJ8A 1ZLWK 2ZSWA 2C3HA 2FR4B 2XZQL 1WWWX 2IFFL 3ARDC 1EAPB 4IOFC 1V7ML 4PJGA 4M02A 2WLYA 1QLFB 2NX5A 2HRPH 3DRQA 3WSQL 3O9WB 1R3HA 5IB1B 4TULL 3GMQA 2CRMA 1NBZA 2IADA 5IB5A 3QG7H 3NFPB 5D1XB 4DK3A 3F7VA 3NCEB 3S36H 1OGTB 4Q74A 4JJ5B 1KG0B 3VGAC 1HQ4A 1A6TA 4P5MB 3C5ZB 3N06B 1HSBB 2AXJA 4NZUL 3VA2C 4MD5A 3QG6B 1MVFA 2BVYA 4K9EL 1U8QA 1R5IA 2JJWA 4HWEH 5SX4I 4NNYA 3QAZB 5JMOC 4IS6B 4UI2A 5MEND 4K3EH 3OMZA 4HPOH 1G7PB 4M7ZB 2E7CA 1F6AA 1HH9B 3INUH 2VUYA 2R2EA 1OF2A 4GOSA 3D85B 1JZ4A 4XAWL 5IG7B 2ICWB 2RQ8A 3KYNB 2BSRB 1DFBH 3ARGD 1AO7A 1KXTB 4P2OB 1QLRA 1N2RB 1P4BL 3IB4A 2CK0L 3IU4L 3H9YA 3QIBA 3QFDB 3O0RH 3WD5L 2JCCB 1TZHA 2NYYC 5DMKA 5EZJB 1S7WA 3ARFC 5IHBA 3M17B 3BIAX 4Y1AA 3O3AB 4HWBA 4HUMB 4R3SB 4YX2H 5AAMA 3BEVB 4NO5B 3GJEB 3VDCA 4LCCB 3V6ZA 3QISA 4LSDA 5AYUL 1WEJL 3EYSL 2IMNA 4XNQA 4YHNB 4PYGA 1NC4A 1NGZB 1BOGB 1FH5H 4Q58C 2I9LB 2WIIB 3WV0A 2Y6SC 2FWOB 1D5BA 3FT2B 4JVPA 4QOKB 4C59B 4KGJA 3MOAH 3S4SG 1NLDH 4YIQB 3UZVB 4G7VH 2IPKA 3SDDC 3TZVD 1HWGB 3MGOB 4D8PA 4PTUA 4RA3A 4YDLB 2C3WA 5LVEA 2DLFH 5I1LB 5D6DC 3H3PH 4KZEH 5JHDE 1NFDB 4GW4B 2H3NB 4DFIA 5CZVH 4UUJB 1LEGA 4DGIL 3EGSB 1HSAB 1EMTH 5C2UB 4XWOD 1LO5A 4C83B 3WYRA 4G9DB 4EI6B 4NUJB 5EOCJ 4ZTPH 4ZSOE 2IANA 2VE6B 4HIHA 3NPSC 3BN9D 5CJ8A 5J4MA 2ARJA 3W0WD 3NFNA 3S34L 4ZNEE 4XPBL 3ARGC 2AK1L 5F6IB 5C0JA 1MRDH 1SJHB 2VN7A 3IRPX 3V9FA 3KLAA 4OCSL 5HGAA 4LVOC 4BQ9A 5HY9B 4ZXBD 2FO1A 1JPTH 5DR5H 5FCUL 4G9FA 4S1RL 4LBEA 3H7LA 4GBXA 1IGYB 2CLVB 4MXVE 4F7TA 4QTHB 5DVNA 4DVRH 1CK0L 2XZQH 2IFFH 4GRWB 1MEXL 4WNQB 2XZZA 4G8GD 3T0WA 4F7CA 2KBGA 3JWNC 4LRIC 4TSBL 5JDSB 4XCFH 3B6SB 1TJIH 3L6FA 1YY8A 4MDIA 1MCNA 2D7TL 4TN9A 3PE9A 5E8DH 4YHYB 4KI5E 4MXVF 3PIQB 3BH8A 2R4SL 1QKZL 4YEEA 3HC4L 4ZG1A 2E9BA 5CJ5A 5F97E 2EO9A 1HNGA 3B5TA 5F9AC 3L5JA 5HGGS 4ZD3H 2CK2A 2RIKA 1Q0XH 1CZ8L 1KCVH 1WCBA 2AK4E 2H26A 3Q2CA 4NP4L 4KTEH 1NAKH 5E4IA 4FXKA 1YEHH 4LSSH 5ID1B 5SX4H 2H2PD 3ARVA 4KI5F 5DD5H 1NCTA 3BN9C 5JW3H 1EO5A 1BFOA 4GXUM 2V9RA 4ZPTA 1DLHA 3O45A 4JFYA 3LQZB 4YDKL 5HGHA 3IU4H 3Q6FA 5HYSG 2AJVL 2LQRA 2ED9A 3BI9X 4APQB 1FP5A 1S9WA 3WD5H 3MLRH 2ADFL 4LQFL 4YXKH 3NAAH 4LLWA 4NO0A 5LCVL 3QSKB 1LNUB 2GUOB 4YEFA 1UXSB 1H15B 1CXKA 4K2UL 4ZXBC 4AMKL 2C4XA 5L2KA 3QDGE 1AKJA 4XBGB 4WCYL 3LD8B 4AENB 2PR4L 5AYUH 4EUPB 1WEJH 3BHBA 5EBLA 1LK2B 4PREB 3E2HB 3UPRB 4QF1B 4XB7A 4M61A 5CHNB 1A7OL 1TFHA 4M43L 1A3QA 3EDKA 5ESAB 5HYEA 3S5LB 3HZKB 5IMKA 1UADC 3G5YB 3UTSE 4M1GL 5IFAH 3H9SD 4WTWA 5I15L 3QUZB 4YH6A 2A77H 2W0FB 3GSVB 4NM8H 3FQTB 4MB3A 5HSFA 5C0DB 4Y1AE 3CFJA 1GGCL 3R0MA 5H94B 1XF5A 4QNPE 4M62H 4DGIH 4JKWA 3L5XL 5KBNC 1QSEE 3MLUL 4QY8A 5L0QB 3GMOB 1N4XH 1DQDH 5INDA 3VGGA 3WJJC 1HCFX 4WO4A 3QDMB 5I16A 2CUIA 1NBVL 4NJ9L 4HUWA 3S34H 1OAYL 5GZOD 1UH3A 3MRIB 1CBVH 4XPBH 4XWGL 3VJ6B 1G9NL 2Z92A 4GRLC 4KRPB 4QNPF 1B6UA 3FO0H 2Q3AA 4L9LB 1VPOL 5IF0A 1IKNC 5BS0D 2LU3A 1MLCB 5EU5B 3WN5B 2W9EH 3R0NA 4WU7A 4RGOL 1MFBL 3HB3C 3CGTA 3BD5A 4L4TB 4WDIB 4UOW1 3QUML 5MHSD 1S7QB 2BVUA 2XRAL 2FZ3B 1NGWB 2VABA 1FVDB 1K8DB 4U05A 4ZUUA 1HEZB 5GRYA 4AL8L 3C09C 4PJEB 3RKPA 5EWIH 3QNZB 4M8QA 1DL7L 4CMHC 3ARYA 2AJ3B 3PWVA 3O6KL 3R1GH 2V6HA 5A2JH 1KXVC 1VADA 1MREL 1GZQA 1YDPA 4NFCA 3GKWL 3VFNA 1DTUA 1K8IB 2FGZA 3OAYK 3JV6B 4OCWH 4LGRB 4G5ZH 1T3FA 4XI5D 4YPGB 2B5IC 1UB5A 3GGWA 4RRPG 4GUPB 3DURB 4LVHB 4Y5VA 1P6FA 1T7XA 4CN4A 3TBVB 4FMFA 3FQNB 1J88A 3LZFH 2VB5A 1X5AA 2C1OA 1KN4L 2HJLB 5DVMA 3ZSTA 5F9WC 4ZFZA 4TVPL 2ARWA 5LAXA 4YDKH 3T4AB 5GZOC 3MLWL 1Z3GL 2AABL 4PRNB 4LQFH 5LCVH 1Z6JT 5IBLD 5D6CB 2VAAB 4K2UH 4KKBD 2FEEL 3B2UD 3DTXB 3X17A 2DYPD 4FQ1H 1ETZA 1E4KC 1K6QL 4OZIE 2PR4H 3FO9B 3T2NH 5E2UL 1YYLL 1U8JB 5J57B 3QUXD 3VGHA 4WW2A 2OZ4A 1ONQA 4M43H 4E42A 4O58L 5F8QC 3B9EA 4U33A 3UYRH 2IWGA 3CSPA 1A7RH 1J87A 5AZEL 1HN1A 4YHMH 4XNXH 2E7MA 3VWJB 2Z4QA 3CC5A 3O2WL 1MFDH 2CGRL 1G6RH 2NNAA 2YRZA 1E6OH 1BQHG 4OQTH 4OZIF 5ICYA 1BBJA 3MLSL 1T7VA 3MRDA 2YA1A 3T0EA 3STLB 1GGCH 4MA1C 5L2KE 2ZCHH 1VEMA 2W9DL 4C4KT 4NKMB 1YEEH 4HEPG 4P2RB 4XI5C 3RWIB 2VDRH 3O4LA 2UZIH 3VFSA 3MLUH 1XH3B 3TJEL 2ZUXA 5ERWA 1BOYA 1OARL 4OCYL 3UP1A 1FL6B 4WUUA 1BREA 1R3KA 5TPWL 1MCCA 3ULVE 4V1DB 3KS0J 3SDXA 3QXTA 5E9DE 4Y5YC 4PV9B 4XCEA 5GHWH 5HI4D 1JPSH 4PGEB 1NCDH 4Q9RH 4FA8A 3U4AA 5AG8A 4NRYA 2V2TA 4A6YH 3N1QC 4PG9A 5IBLC 2BC4A 5EU6A 3TBYA 3EOTL 4Z7UB 3B2UC 3VXSA 4UNUA 1I1AD 1MFBH 3FQUA 4OLYL 4PRPB 4CVZB 5DQ9A 2BNUB 3QUMH 3ULVF 4RFOL 1RZIB 2P4AB 2X4RA 1MAML 1DUZB 4Z77A 2CRIA 2ICEB 1IL1A 4GAGL 4AQOA 5I6XC 4OI8A 4P2YA 2MCG1 5IB2A 3PV7A 3N1FC 3RWCB 5KAQG 2X9XA 3JV5A 5C0IB 5CJOL 4DTGH 1JNHA 3NIGE 1BFVL 1JGEA 4HKXB 4NWUH 2A6IB 2A6JB 5EFIB 3EYVA 4YR6B 4H5SB 1AE6L 3IAPA 5B8CA 5AD0A 2HFEA 3DV6A 3LQMA 3IF1A 5T1KB 2R39A 2ZP0T 3NIDE 4MX7B 1KGCE 4LSRH 3NIGF 3SDAC 3JUZA 1UVQB 2X1XR 5CAYB 5JPMB 2FHFA 3LN5A 2A1WH 5FDYA 5HI4C 3HZYA 4EQ2A 1I9IL 4D0DB 1F8TH 5D1QC 5TFSL 5DJXA 3NIDF 1BJ1H 1S7SA 4S2SB 3KLSA 3B8YA 3BPOB 2E7HA 1I1AC 3NCYS 3DPBA 1HQRA 5E00B 3FB5B 4JREB 4Y4FB 1KIQB 2ADIB 5KOVC 4WFGD 2YPVH 3ZTJH 4P46D 5D72H 2R56L 3MBEB 4JG1H 1SEBA 3V5DB 2GT9A 4YK4B 3MJ8B 2ZSWB 4HIEA 4HH8A 5ICZA 1DZBA 5DMGC 4PJGB 2R23A 1RMFL 1F4XH 3MLSH 4OI7A 3MRKA 3T77A 4GG6A 3S8WA 3Q48A 2NX5B 1KIRA 3DRQB 1KV3A 3QBTB 5MENA 1R3HB 1FQ9C 1KCLA 2ZG1A 3GMQB 4ZO7A 3RAJH 1NBZB 1NL0L 2IADB 5IB5B 4GQ9L 3U9UA 3F7VB 3UAJC 1T80A 3F62A 1QBLL 4MLIA 4ODTL 1JWSA 3BX7C 3U79A 4AEHH 1HQ4B 1A6TB 5E1AA 4OM1L 2AP2A 4MD5B 3ARGA 4NZJA 1U8QB 1R5IB 4MMZC 4NNYB 5DUMH 3W2DH 1I3VA 2VL5A 1XF2A 1ZA3A 1JZ5A 3W39B 4S0TD 3L3JA 1F6AB 3EKCA 1QACA 4WGWB 3ZDZE 1ZT4A 2R2EB 3D39E 3HAEH 1IC4H 5F7EL 3V7AE 5FV1L 5FYJE 3SJVE 1NANH 1FFPA 5DEGA 4XC3L 2F9BT 1QLEH 1AO7B 5FYKE 1QLRB 5EC1A 1MAMH 1L7TH 3SO3C 3LY6A 3QIBB 2J3SA 1IGTB 4WUUE 1BM3L 2E7LA 5KVFH 5DHXB 5DMKB 1S7WB 2E6JA 2ITDA 5FM4A 5F6HJ 2Q3ZA 2PTTB 3F7RA 1S7RA 4P46C 3LN4A 3T04D 4X4ZA 3TZVA 1WWCA 4FQLH 4FTVA 4WI2A 3V6ZB 4XNQB 4Y2DD 1NC4B 4OV6F 3MQIA 4DKFH 5ABDE 2IH1A 5TGBA 2P7TB 5KJRH 2E27H 1D5BB 4LVNB 1AE6H 5HDQH 1NBQA 5DQDH 1HKLL 2IPKB 3LIZH 1D7FA 5JPNA 1U2CA 4PTUB 2E6PA 1PGRB 3VG9B 3GMRA 4Y8AA 2HT2D 2Q20A 2GJ6E 3PUCA 4QLRA 4AIXA 3ZTJG 1LEGB 3FN0H 4G6KH 1MCKA 4PJFE 1LO5B 1CDHA 1DN0A 2SEBA 4NKQB 1I9IH 4RCAA 3LRGA 1RUAL 2IANB 4HFWA 4HIHB 3MRLA 3OG6B 1A4JA 1RZFH 4I8DA 2ARJB 2DKSA 2DWEA 2V17L 1HYRC 3NFNB 4XGZA 1EJOL 4BZYA 4OGYL 3UTPD 5BOZG 4G8GA 3QCUH 4NQCE 5C0JB 2ICWJ 3IGAA 3TVMD 3KLAB 1A6VH 1T1YB 1ACYH 5HGAB 2P46B 4LFHG 4G9FB 4PJFF 4LBEB 4GBXB 4YDIH 1H3TA 3T3ME 3K2MC 4F3FA 4F7TB 2NY1B 4S11A 3MFFA 4Y4KD 1BP3B 1MNUL 4M93C 3F58L 4MSWA 4JKLA 2F19H 1HHJA 1OAQL 2MPAL 3C60D 1I8MA 4Y2DC 4XP4H 2EEAA 3ALPA 2RAMA 3L6FB 4HJJL 1YY8B 2HJKA 3QIUD 5E4EC 4MDIB 3HAEG 3OAUL 1ZVSA 1A9EA 3UJIL 3WJJA 4MA7L 5IFJA 4NNPL 4ODTH 1RIVL 3LEVH 2BXYA 2X1WL 4P57A 3BH8B 1U42A 3DGGA 4ODSL 3OJDB 2I26N 4YHZL 3CVHH 5B21A