4LOUD

Structure of the e148q mutant of clc-ec1 deltanc construct in the absence of halide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter ClcA
publication title A fluoride interloper in a CLC-type Cl /H+ antiporter
rcsb
source organism Escherichia coli
molecule tags Membrane protein, tranport protein
total genus 49
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4louD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4louD01
1KB9K 5DS8A 1JF5A 2ICCA 1CIUA 2Y1VA 3MGOA 4GRWE 1KB5H 2K1MA 1F8TH 3WIHH 3UTQB 1G7LA 1CICA 3WS3A 3QZWA 3FQUB 4WI5A 3KDMA 5BRZA 1T0MB 2AKRB 1I7TB 5I8CB 4HXBH 3H2WA 4XT1C 4PLJC 4FN0A 4PG9B 5LXGL 3IT8D 3MRGA 4M7JH 4JM2C 1S7XA 4MXQD 1U8IA 1TQCC 4P23B 1NSNL 2ADGA 4NHCL 1AD0A 3CSBA 1MQ8A 4PJ8A 5CJXC 4F15B 4FQQB 3CVIL 1RK0B 4HBCL 4N68A 4S1DD 2BNRA 4Z7OF 2F5AL 4GKSA 1ED3A 2DWDB 4MD0B 1EVUA 3TYGH 4AH2B 4QHUB 3LKQA 2HRPH 1MCNA 1FL3B 3QIWA 3F7QA 1ZHBA 2AI0H 3UBXG 1WZMA 4NWTH 1I9JL 4ETQA 3IJYA 4PV8B 2AJSL 4OV6F 1YEDA 3PHOA 2ESVA 2QLVB 1A6TB 3P4OA 2GSGA 3PGDB 4LSUH 5HGHA 4CDGC 3S97C 1Z9SA 2UZIH 3W0WE 4QCIA 2ZUTA 1NLBL 5GGTL 2F74A 3SJVB 3DX7A 4ZQKB 4R4BA 2OR8A 3RPKA 4XP6H 5FHBH 2FSEB 4ZSOA 5I1KL 4LMQI 5F7DB 3EYSH 3MLSH 1XFPA 2R1WB 3MRCB 3CVHB 4PLJD 1Q94A 4MCZB 2HJFB 5I19H 4WUKH 3NCYP 1AGDB 4JM2D 4BSWA 4OGAC 5HGDA 3BPNC 3CVHL 1HHKB 3F7YA 4G43B 1LQSR 3MROA 4YPGB 1E28B 1MFAH 4YIQA 1RUQH 3QBTB 4XP5L 1BWMA 4DZBB 4WFFE 4GW5A 1F4XL 3VXPB 6FABH 1BP3B 1GL4B 3BEWB 4GT7A 4WDIA 3BPCA 4HSQA 2A73A 5T5NG 3MGTB 4CVZB 4U0RB 5D5MF 3C5ZC 3S7GA 4LCIH 1FL5B 3MRBA 2IH1B 4MB5A 4DN4L 1MRCH 1HXMA 4TN9A 3A6OA 4Z95H 2XKNA 1EO8L 5JDSA 1X5ZA 4LASH 4IMKC 3P30H 3T77A 2CIKA 3KPSD 2C9AA 3B2VH 4ELMF 4FFYH 2Q87A 4ACPA 5F8RC 3N1QC 4JE4B 3FN9A 1HSAB 4U2YA 5EU4A 2DWEB 5MENE 4MX7A 2B4CC 9CGTA 3VFOA 1QYGH 1RIVL 4HQQL 1RURL 4S1RL 3MCLH 4C83B 3BUTA 2XTJC 4LLMA 5FYLL 4TNVK 1BZ9B 4XVSL 5C0NC 2J88H 5TQ0L 3FZUC 4XPGL 4OGAD 3TBTA 4MQ7B 5CP3A 5HYQB 2BSSB 2H2SC 2ERJC 5SWZE 4D9LH 5CEXB 4L3ED 1ZV5A 4OLYL 2DQTH 3ARWA 5F96H 5CP7B 4OZFB 3T2OA 1QFWH 4JM2A 5IMOB 3VRIB 4U1NB 3QQ3B 1A6VH 2Q76B 5BQ7A 4GRMA 1JGVL 1XF2A 5EULV 1FAKT 3C5ZD 2I9LA 4LAJH 4PJIE 3IFPB 3RDTC 4PV9B 4QRQB 5CJXA 2B1HH 5JHDE 4AIZA 2J8UA 4CRPA 2DQIL 1QHPA 1EHLH 4NQSA 4JEGB 3SOBL 1W0WB 4DVRH 1DQDH 4QYOA 4YXKL 1LNUB 5FO7A 1CL7I 1NBYB 3FN0H 2PW1B 4NUJB 3P4MA 4TUJB 1FGVL 1I3GH 1KNOA 3FO1A 3ZO0A 4J2XA 1UGNA 4LCYB 4R96A 3OKKB 3SDXE 3I6LD 3KPSA 5LAXB 3HMXH 3RWDB 2XTJD 1SBSH 4QLRA 1YY8B 4XNXL 5C0ND 3FZUD 1OCWL 3G5VB 3FB6B 3S34H 4Y5XC 1KT2A 4C54A 3QUKB 5CLWA 5GS1B 1B6DA 5D7IF 5LWYH 2H2SD 3LIZL 4HWZA 1BGXH 4EBQL 4U1JB 2EYSB 4GO6B 1ZVSA 3O6FB 4L1HA 4FZ8H 3P0GB 1CDUA 4HUXA 2X44D 3R06B 5C2BH 2CIIB 3PXHA 5TQ2H 3STZB 2NY3B 3GMQB 2UY6A 3R0NA 1INQA 4UNVA 4JJHA 5JW4M 3RDTD 4TQEL 2FBJH 2Z93B 4DOHE 4L3EA 2ILLA 4MNGA 2NLJB 2R4RL 5GGUA 4OGXL 2G9HA 3RWCB 4ZPVA 1A4KA 3C5ZA 4X98A 1TFHA 4GLRI 2D31A 1PEWA 5KAQF 3HUJB 4LU5L 2ZCHH 5GZNC 1OGAE 4PRAA 4NQDE 4DCQB 2E7HA 3MXWH 4PJGA 1XIWC 2O5ZH 4N0RA 3V8CA 4IMLA 5FA3B 4WHTA 3MRHA 4AL8L 4QHMA 1MHHA 5CJOL 4I4WB 1MWAA 4IJ3B 3S4SG 4NM4L 4ZO6A 2HH0L 4W4NA 3DSFL 2OP4L 4G7VL 5E1AB 3PWPE 3JUYA 4HHAA 4M1GL 2DM2A 1TDQA 5ILTL 2IAND 3TCLB 5JO5A 1YECH 3ES6B 2F58H 4GJTB 4QEGA 3KPPB 5I1AB 5SX5H 2JK5B 4EI6B 1L7IH 1EUTA 5TFSL 4XPHH 3HC0A 1KJ3L 3R1GH 2E7CA 3ARTA 5AZEH 2Y07L 1CQYA 3FQWA 2E9BA 4H0IA 1PVHA 5TF1L 3VD5A 5DK2B 1GYAA 3K81A 1BHGA 4QNPE 5ETUB 5GJSL 3UZVB 3RDTA 4XH2B 3BDYL 1OSPH 4QF1A 4ZFZA 4NC1E 4KY1H 5E2WH 5GZND 3DX9A 5CMAB 5IG7B 1FV1B 4KHXH 4ZOAA 4ALAL 1V7NL 1BVKA 3K4AA 2FHCA 1HK6A 1AY1H 1XIWD 4JDTL 3H3PL 3PG2A 4WTZG 4NN6C 4F7MA 5T5FL 4UT6L 2P8MA 4I9WE 4U1MB 5B21A 3T1FB 2H9GA 1I9EA 3QWOA 1FG2A 2M1KA 4RMQA 3CLFL 5EIQA 4X9GA 2IPKA 5ADPL 5ACZB 3N1FC 12E8L 5B8CB 4WO4C 4WJ5B 2JB5H 2IQAB 2GUOB 4Y5XA 2VLME 5I73B 4XMPL 3O4LE 3DV6B 3UTSB 3LQAC 5IFAH 1TETL 3PIQA 4H25A 3RBGA 4XHQA 4Z7VA 1KCUL 1H3PH 3IJSA 2IANA 4OD1L 1C7SA 5D93B 3EFFB 1XR8B 1R0AL 5EN2B 4JZJB 1MCSA 3AS1A 3MLTB 4JRYB 5MEQA 5AUMB 5IEKA 5F89B 5JDJA 4O5LH 1J05A 5TGBA 2EIZB 3ZKXC 2DKUA 5EZIH 3HC3H 1A7OL 3OB0K 2MQ0A 4JFQB 4LSPH 4V2BA 4MXWH 3LKPA 4HIHB 3QCUL 4PJ9C 3P4LA 5ERWB 1R24B 1Y18A 4IM8A 3D18B 5D9SB 4MB4A 5J6HA 1QBAA 4MA7H 3SKJL 4JFXA 4FFVC 4KKNA 3MV01 4BH7B 1GGYA 5E2TH 1XIWA 2DYPB 3GEWB 1CFVH 1NCAH 4MA1B 5EBWB 3VWKB 3B9KB 4AT6B 4WO4D 3VFSB 2V2TB 1I8IA 5C09E 4RGOL 1ZLVH 1NQBA 3UJIL 3QWRD 4XVJH 1W8OA 4NKDB 1WBXA 4I0KA 2QSVA 2OL3H 4PTUB 3KYOB 4NQCE 4H8WH 4Q9QL 2YSSB 3AREC 4UT7H 2G75B 1QFHA 4KJYB 4M6OL 2Y5TA 4JG1H 2VABB 3UBXI 2NXZC 5DJ8B 4KTEH 3TVMB 3C60B 5D1QC 4U1LB 1KLUA 1FVEB 4OM1H 1GSMA 3H7LA 3EGSA 5D1XB 4DEPB 4S2SB 3O6KL 5IQ7H 2WINB 4PJ9D 4JRXE 1U36A 5C07D 2XWBA 1FORL 4P4RA 1ES0A 3PL6C 4X7CC 1JGDB 4NSKB 2A6JB 1HQRA 5LG1A 3DVGA 4X99B 5I1IH 3F7RA 4HK0A 1IC5H 2B2XL 3RPIB 1OM3L 3HMWL 4FFVD 3FO0H 4AEEA 2FDBP 2X1XR 3G5XB 5D7KE 3TN0B 2R69H 3JVGC 4LAQL 5ALCH 4Z7NF 1FNEB 4EN3B 2DQGL 4OIAA 4HEME 2XACC 1YEIH 2P42B 1UXSB 2A9MH 5GXBB 3Q6GL 5JORB 2ITDB 1I3UA 3SEPA 3NFPA 3MBEB 4FQ1L 4LOUC 2CKBA 2J8UF 4D9QE 2XZAH 3ARED 3PWJB 3VW3H 4WO4A 5ALBH 3AGVA 1J18A 1Z3GL 1T6WA 3F12A 2C7UB 3ROOA 1U8OA 2EYTA 1XR9B 4P46C 3VGAB 4GG8B 4S1QH 3QWRA 4HUNB 1D3CA 2NXZD 4LSVL 5JMOC 1OLLA 4B7IA 3V5HB 2AGJH 3GIVA 5D1QD 3S6CA 3MZTA 4XCNA 4L4VB 4PJ7F 4MJIE 1NEZG 4P9ML 1SEQL 2ZSVB 1MIEL 2KPNA 3RY4A 4KWUA 1NKOA 3PL6D 5C0AD 1HH9A 3IU3A 4JQIH 1A1NB 2I27N 5MI0B 4JFED 1F3JA 2ZKHL 4F58L 3V6ZB 1RUAL 4RNRA 2QSQA 5JW5A 4PJ9A 5C07A 5IR1A 4J6RH 3BD4A 1NCBH 3FMGH 2QR0B 3TBWA 4NQCB 4JHWL 3RA7L 5AD0B 4PYHA 2RB8A 3WFZA 2AJXL 3L3JA 4KV5E 1OAKH 2HA1A 3DGGA 5FUZL 4HUVB 1EH9A 4LOUD 4F2MB 2EKSA 1KULA 5IVXE 2VDPL 1UCBL 1WSST 1KJ2B 5I1GH 1SVCP 1WTLA 2KZ1B 4P46D 3RI5F 2DQDH 4YXHH 1N5AA 2A38A 3ZDZE 1KJ2L 1JMZA 5JMRA 4UUJA 3E6FB 3OZ9L 3AREA 4JVWA 1ZS8A 4DGVH 4PJGF 3PDGA 1MJ8H 1H8NA 3TJHC 2NY4B 1RFDH 3U46B 4UQ2B 1RZJH 5J9PA 1FVDA 2MFNA 5IHUL 5EFIA 4KQ4H 5D1QA 1U6AL 2GFBA 4AENA 5CZVH 1NMAL 3LQZB 2CLZB 4IOFC 2XKUA 3QXDB 5BS0D 4DGYL 3GJEB 4NN5B 2R2BA 4JDVB 2R1YA 3PL6A 3V6OE 5C0AA 3KR3H 3W5MA 3ILPA 4M00A 3BDBA 4GMTH 4JFEA 3S98A 3U30C 2CD0A 1N0XH 3MRRB 5C0IB 5SWSB 1CD8A 4AG4L 1HINL 4OQTL 5C08D 4FRWA 4MVBC 2ZUXA 2EEAA 5E8DL 4JO4H 2HT4C 3JVGA 4LRNL 3M8OL 3DGCR 3VFRB 4P2YA 2R56H 4PBVC 4Z8FL 1HEZB 3UJTL 1EGJH 2XXMB 2XPGB 1A7NH 1JGLH 4EXKA 3HZVB 2EO9A 1JGEB 3RZWA 1CD1B 5DEGB 2YC1B 5FDYA 2ENYA 5FB8B 1KUMA 5DYOB 3CU1A 3Q1SL 3HLAA 3TJHD 4P46A 1ADQA 5INCA 2GJ6E 1JZ7A 1QNZL 2Q8AH 1ZXQA 4NNPL 3BFOA 1X4XA 1L0YA 2FYYB 1A6ZB 2V5RA 3CFIC 5KTEH 4U1KA 2MSPA 1UVQB 1SVZA 3CFEB 4PTTA 2MKLC 2P8PA 4IOFD 5GS2D 5KG9A 2BY3A 4DVBB 1ONQA 4LSQH 4XNUL 1GIGL 2HWZH 1F58L 3AAZB 4KROC 2EH8H 5I16A 5E24E 3HPJB 4X7FC 5DK3A 3P77B 2YBRB 5JLZA 1FRGL 3EO1B 1GPOH 3KXFB 4NWUH 3EYQD 4JPWL 4Y19D 1DBKH 3QRGH 3CMOL 3NA9L 4MVBD 5H35B 3IXTA 3PUCA 5BS0A 2HT4D 5FYJL 3L3HB 4QRPD 3GMRB 3QFJB 3LEXA 2EDYA 2E5EA 3QT2A 3C8DA 4R7NB 2A1WL 2A77H 4IRZL 2GK0A 3F62A 4QHKI 5MHSD 1CXLA 1DQLL 4WW1B 5DVNA 2ATKB 4JY4A 4MJ5A 5C08A 4J1UA 1WIOA 3V5DB 3L5XH 4I5BB 4V1DD 2H32H 1KTKE 4X6CF 1C1EL 4ZXBC 1SJEA 2EDXA 3EKCA 4NPYA 1P4LA 5T1KD 4X80H 1U3ZA 5D6CA 1U8MA 4PY8J 1KC5H 4JO3L 2P49B 3BW9A 1A2YA 3LHPL 3C9NA 3SE4C 1NMBL 4IBLT 1HIML 1MJUL 4UTAL 3GSOA 1M6OB 2AABL 3GFUA 4I3SL 1KCRL 2DS4A 1CD9B 1I7ZB 4OBRA 2VISB 4KROD 4N1HB 4M8QB 4XP1L 4D0DA 3SBWC 3UZEA 3IKCA 5JXAH 1MHCB 1YJDC 3JBG7 1WAAE 1JN6B 1J9CT 4XMLL 4HDIB 2VZUA 2XI9A 1O0VA 4PJXB 1OL0A 2J7LA 3U9UB 4Y5VC 3HFML 3KJ6L 3JWNC 3BWAB 3C6SA 1U58A 1JUFB 2K7QA 1PG7W 5L9DH 4Y19A 2BHYA 2IPUK 4G6KH 4ODWA 3K0WA 2LV4A 3SO3B 3P73B 3LH2L 4QRPA 5C9JB 1T66C 1A22B 5JOEA 1S9YB 3OJVC 4PJHA 4ZXBD 5FV2A 2VDRL 5IM7A 5C8JB 1F4WL 4Q97A 1IAIM 3B5HA 3CFBA 1IAKA 1CGXA 2FCBA 1RJZA 2EDEA 5GGVH 3RNQB 4HUWB 3TZVB 2MTPA 4ZUSB 4OLVL 5DJCA 1YN6B 2NR6C 1QRNE 3W0WD 1SMOA 1BD2B 5I8KL 5T1KA 1LP9A 3PQYB 2HT3C 2ADFL 2BVYA 3MNZB 2FJHB 4DWHA 2BC4B 4MA3A 2APFA 2OBGA 5T1MB 3GJFK 4OD3L 4FQ2H 3T04D 5EOTB 1A5FL 3PHQA 4F8TA 4H1LA 1V8HA 1XAUA 3TP4A 4OZHA 1FN4A 5DZNA 2BHUA 1HI6B 5I2IB 1Z0MA 3QJFA 4M93B 3EYUH 3VFMA 4YNYB 1P6FA 4U3CA 4DTGH 5TE7L 1X5IA 2ARWA 4GRLB 1UA6L 3ULVE 2BOBB 3K2MC 2FGWL 1T66D 4WFFD 4KZEL 3SY0B 4I48A 4U7KA 1ZLUK 5KW9L 1YZZA 3W39A 1BPVA 4M7LL 5IOPB 4E0RA 1YNLL 4JANB 2W0KA 2YN5A 3ZT6A 1X5AA 1ZT7A 3EYFB 1Q9WB 5IGXL 2ZSWA 2XXCB 1FBIL 4ZXBA 1QFOA 2NR6D 4Q7DA 2P43B 3FB8A 1Y0LA 2HT3D 1D5ZA 1EO5A 4PGEB 3W82A 2X2YA 5I30L 2Z8WC 3RL1B 1CG9A 3O45A 3SE4A 4P3DA 1MPAH 1IAMA 3SCMB 2FLRT 4H20L 5MEND 1NAML 2NY2B 4KDVA 4NQEB 3W0WA 2DBJA 5FKAA 1TTGA 3SKMA 2FR4A 5CWSA 8FABB 1U8NA 1TZIA 3SBWA 4NT6A 4G6MH 4G9FB 2YWYA 1LE5B 2BDNH 1ETZA 4XPBL 1DBJH 1MAJA 3QJHA 4HK3N 2X4PA 1N5YH 4JN2B 3O8XC 2CUIA 4ZFFA 4WV1B 4Y5VA 4GKOA 1H8SA 1T7YA 1VFAB 1QRNB 4LQ1A 1YA5A 2ZOLB 3G6DL 4LLDA 1WLHA 1V3LA 5E4IA 2GYSA 3FL7A 1KPVB 2F54B 1YEGH 3UTTE 1NFKA 3QDJB 1MRDH 4LLUA 4LFHD 3BXNB 3FT3A 2UZXB 1GGCL 2VXUL 4LPUA 3MA9L 1A7PL 5I75C 3MUGB 2D7TL 2R0KL 7FABH 2BNQB 3UYOD 1I7UA 3U0TB 5C3LD 2G60L 3OAZH 1GRWA 2J2ZA 4JREB 2DM7A 1EEQA 3D0LA 2PTTB 2VAAA 3G9AB 5I71C 3RWFB 1S7SB 1IAOB 4HWBL 3VFVA 3N9GH 3EDFA 4PLNC 4JGUA 5MENA 3HNTH 3TPUA 3C8KB 4KI5E 2CK0H 4AEHH 4OF7A 4WGWB 5C0DB 4TOYL 3M45A 1UZ6E 3H8NA 4ONOA 3RIFF 1UWEL 5KVGH 1QVOB 1R5IB 1NBQA 5CP3H 4R26L 2DD8L 4P57B 3QQ4A 3UEZA 1OP3K 2QQNH 3Q3GB 2VH5L 1DDHB 3RTQB 1D5MB 5IMLB 1AE6L 3KPLA 3MREA 1QRKA 3TV3H 2YMXH 1I8LC 2GJZA 2GTWB 5KAQG 2W0LA 2IFFL 3QNXA 4XXDB 3NTCL 3GSWA 3WNOA 1SYVA 4QOKE 5CEYA 4PJIA 3KLHC 4U3HA 3SDCC 2ZJSL 1T2QL 1AXSA 2ZUQC 5CZXD 4CAGA 4OTXH 4PJCF 3B43A 4IRJB 5E8EB 4YEFA 5DRZA 4JFOB 5IT2L 2XWTB 3VXQA 1CLZL 3NACL 4HIEA 4RGMB 1KLFA 3NPSC 5HYJE 1JPSL 4DAGH 1IL1B 3QUMH 1BQLL 2J6EH 2P46B 3QB7C 4K7FB 3L5WA 1Z6JT 1AQKL 1OP5K 5IQ9B 3REWA 5L2KB 3SDXA 1YEHL 4K7PL 3CC5B 2SEBA 3NCJL 1UM4H 4N0UE 4YBLB 5DHVA 5AEAA 4YHLL 4MSWB 1MH5B 4LSRL 3OX8A 3GK8H 1IGCL 2MCPH 4LKCA 1HOCA 1J0KA 3HN3A 3NFSH 3TIDA 4YC2B 2Q7NA 5FCUH 3NGBB 2JJVA 5IROC 1YEKL 3CFJB 3ULUE 2HFGH 4ZNEE 3JWDL 5F97E 4ZG1A 1MI5D 4JM4L 3WHE1 1B90A 3NVQA 4ZUVB 3O3BA 3UO1H 1MJ7L 4AZ8A 3P40A 3KLHD 3SDCD 3JZ7A 4DFIA 4JKKA 4PRHE 1NGPL 2I9TA 3FN3A 1WFOA 3BD3A 4PJBB 3ZE1F 3BDXA 3OJMB 4YDJA 2X4UA 4HUUA 3M1BA 3P9WB 1OSZA 5CIPA 3C08L 1A6WH 4X7SL 4RAUB 4I9WD 4Q9BA 1RUML 2OX5A 4CN4A 4NP4L 3MR9B 5JNYA 1JRHH 4U7SA 2DIJA 2QTEA 3MLWL 4PJHF 3X3GL 2ZNWA 5A16A 5FK9A 4UTBL 4HMCA 1IGJB 2ZPKH 2J4WL 4XI5C 3K4DA 3WCYA 1LO2H 3JWOC 3O4LD 1E4XI 2VOTA 1FFRA 1OAZH 1A3LH 1RQ5A 4QOKB 4NM8H 2GSIA 5DQ9A 3EO0B 4K3EL 3GMLA 1M05B 5C1MB 1HHHB 1MUJA 1MFBL 1QBLH 3AXLB 2PN5A 3CH1B 2IG2H 3WFDL 3A6BL 3EOBA 1R3HB 1ZT4A 3WLWC 1YQ2A 3WO4B 3GHEH 4UZGA 2ICEB 5EOCH 2F8OA 1I8LA 1VDGA 5L88L 2HKHH 1MI5A 4OZHF 3DO7A 5BVJA 1QZ1A 1FZOA 3E8UL 5L2JA 4CVXA 1S9XA 1D6VL 3OKOA 3SDCA 5IB1B 1L6XA 3EDKA 1MVUB 4C4KO 3L1OH 1JTPA 3GJFB 4K7PX 1JTTA 4UB0H 5DD0H 4N0CC 1CBVH 4OF0A 3HI5L 5ESVB 1G7IA 3WN5C 5MEOB 1B4JL 4PGDB 4HJ0C 4DZ8A 4RQQB 1R3IL 3RWJB 4Z6AT 1EEUA 3B8YA 1NDGA 2UY7A 4XI5D 3MLXH 5C09D 5IIEA 2VDMH 2A0LC 2VLRB 1BFOA 4KMQA 3RWGA 7CGTA 1AXTH 1MAKA 3MFFB 3E3QC 1FO0B 3B9VA 3NZHH 3ZDXF 3BOVA 1JFQH 4XNQB 3TO4B 4F57H 1DQJB 2RR3A 1FO0L 5ANME 3LKOB 2NY6B 3IF1A 2FX8H 3ALPA 3O4LA 4FQCL 4PB0L 4OZGE 4RMUA 4CN1A 3G5YB 3HE6B 3WLWD 1MLBA 1XGTB 4G6AC 2CXGA 4NYLB 4KUZL 5IROA 1QR1B 4TSAL 1TCMA 4PLOB 4UAOC 3MRJB 4LP4A 1B2WH 5DURD 5IFJA 1BIIA 1D7FA 4R90H 3OF6D 4JRXD 4AQ1B 4XBPB 1KLGA 4OKVB 5HPMB 4WY7H 1RZ7L 1G6VK 3THMH 3PHSA 4PB9H 4N0CD 2DQEH 4LSTH 3HZMA 4F9LC 4R97C 1MSPA 1XGQB 5D7KD 4CADA 4XX1E 1IM9B 2W91A 3CFDA 3H9SE 1W0VB 3KLSA 2XT1B 3DUSB 2A0LD 1XT5A 1QSFE 1PEZA 4NJ9H 2YPKA 1JPTH 5DQDL 1MFDH 1N59B 2GY5A 2OYPA 3UBXB 3D0VA 4YHKH 1YMMB 3X12B 3V0WL 3QDHA 4UOW1 3T0WA 3K8LA 2O93L 5DRWA 4R8WH 2C1PB 3DPBA 4KQ3H 3GBNH 3BKJL 3DX8A 1JTOA 3LD8B 3BSZH 3GI9H 4G6AD 2X40A 2IPTL 4YHIB 3MRQA 1YQVH 3CDCA 1NUDA 5EU6B 1T1ZA 2XIDA 2P7TA 4G8GE 1R3KB 4HC1L 5DJDA 5JPNB 4ZTPH 4F7CA 4NCC2 5MERB 1XF1A 4HPOL 3QNYA 1LE9A 4ODXB 4JB9H 1UM5H 3AB0B 2AP2A 1JHKL 3H9ZA 3KWWB 3OF6A 4JRXA 4Y4HB 4WCYL 3V6OC 3KS0J 4UV4H 3MBXL 1TJGL 5BZWB 2H3NB 5LGHH 3LRHA 5ANMB 2R29L 3CXDH 4HH9A 4WRLA 3WN5A 1X7QB 4OZGB 1LK2B 4K9EC 2C1OA 3R0MA 5IESL 2C3VA 1UYWL 1Z5LA 4ONHB 3GRWL 2FX7H 3KNBB 4HZLA 43CAA 2V5SA 5DRNA 1OQOA 1RZIB 4NQVB 5GS0C 1IGTB 4OLZH 5HGAA 1I3RB 4ZYKB 5DGRA 3GSNA 5D7JB 3LQAH 1A21A 4M6NL 4PJDB 2R0LH 1M1SA 5GPRA 1MNUH 3BGFB 1V05A 4GKNB 4E41E 3JTTB 3WFEL 3WDHA 1UFUA 2D3VA 3CK0L 5FGSA 4CW1B 2WK2A 1SEBB 5CKAA 3GUTA 2F19L 3SDXF 4XMKH 3LZFL 3ZE0F 4YR6A 4HF5L 1P4BL 3OL2A 1FNFA 2R2HA 4NRZB 1T20B 5D2NE 1DSFH 5IVZB 2Y36L 3PGFL 4H26A 1NC2B 4LARH 1EEYB 2BVPB 1EZVY 4GG6A 5F7YC 4F9LA 3TBVB 4XBGB 3RNKA 4FXKA 1AD9B 5J12B 2O5YH 4JPVH 4EKXA 2A74B 2JIXB 2MHAB 3SN6N 3HB3C 3F6IA 5DD5H 4LGSB 3GSRA 4N5EC 3B83A 2JJSC 4IEFB 3QHZL 3F58L 1NGWB 4L29B 3V4VL 1A14L 5IBTL 2YKLL 5SX5K 1YPZE 2XG5A 3ARBB 4GUPB 4OFYD 5GS0D 2QKIA 3LMJL 3S35L 4IDJL 2A6DB 1TJHH 1DVFC 2EE3A 4N1CA 5JOFB 5I0ZA 1H3GA 2GJ6D 2I07A 1QO3B 3ALWA 4M8VA 2AJYH 4OF8A 4Q2ZA 2P1YA 2YK1L 4GW4B 5AWNH 2ID5A 3DRTB 1T4KB 1YY9C 5J6GA 1V3KA 4Z7QF 1CFTA 1FFPA 4HT1H 3MJ6A 5GS3A 4QO1A 4HJGA 3CCHB 1DUZB 4J7RA 1KB5B 2L7JA 3H42H 3O41B 2BSTB 2NX5B 3SGKC 5E6IC 1GHFH 3V6OA 1KB5L 2C3GA 1F8TL 5FUCC 3HB3D 3WIHL 3BYTA 2V17H 4N5ED 3UTZA 2OS7A 4LVEA 1S9VA 4M9OA 4N0FB 2N7BA 3N1GC 1BWWA 2W60B 3GIZH 1U8JB 5HHOD 4PGBB 5C0BB 4HXBL 5FYKE 3BZFA 4M7JL 2EDLA 2B5IC 1G7HB 2Y06H 1XF5A 1NAKH 1ROWA 1DVFD 3KPMB 1JF1B 3AUVA 5B38A 5KS9B 5FGCB 4QKXB 1WBYB 3EW3B 1FZMB 4ZUUA 4K3GA 1XGRB 1ZVYA 4HLJA 4OFYA 4YGAB 1NGYB 3O3AA 1YY9D 4JKLA 4Q0XH 3TYGL 4XGZB 3B3IB 1CT8B 3FAXA 1ADQH 2HRPL 5DMIH 2AI0L 2JCCB 4NWTL 1UM6H 2R23B 2VZTA 2GJ6A 3BGAA 4LSUL 5C0EA 3LQMA 1ORSB 4AM0A 2HFEA 1K8DB 2UZIL 1XCQB 1XEDA 4HKJA 4LLWB 4D94A 5FGBC 1YN7B 5EWIH 3E6HA 1NGXB 1KB9J 4JZOA 4XP6L 3EUUA 4ZO9A 5E6ID 4JAMA 5FHBL 3KPRE 1U8QA 1FNAA 3AC0A 4Z78B 2CO6B 1U2CA 1HQ4A 3EYSL 1UADC 1WICA 3MLSL 4KTDH 3WXVH 4J4PC 3ULVC 3S35X 4PJEB 1YUHB 3BZ4A 5I19L 4WUKL 3SO5A 1K3ZA 3EOAB 4LNVA 1TVBB 1QACA 2JJSA 1MFAL 3FONB 1RUQL 1X5JA 1YMHB 5HHOA 2ED8A 3D25A 3V6BR 3S36X 6FABL 1IGYB 1GZQB 3KLAA 4HK3J 5K9KB 1NDMB 3L6FA 5T1LB 1LD9A 3LRSA 3MRPB 3OXRB 4LCIL 1DVFA 3NCFB 1AHWB 1MRCL 5I66B 3QUZB 4Z95L 4BH8A 3FHAA 3BKYH 4QTIH 3DUUA 3CVIH 5CBAA 4X5LA 3DMMC 5DUPH 5HDBF 1H3TA 4LASL 3O3UN 3P30L 4L3CB 4JO2H 1F2XK 3HS0B 3B2VL 4M9PA 1X5XA 3GSQA 4DUWA 4FFYL 3T0AA 4F7TB 3DECA 3HI6H 1FFOA 5FYKL 3SKUD 1QYGL 2ZG1A 1UQSA 4J4PD 2MQCA 3MCLL 4OCXH 4P9HC 3ULVD 3C5SB 3LS5H 2GAZA 3VE0B 3OR7A 1J0YA 5HYSG 3F6LA 2XOTA 1I1RA 1EEZB 2J88L 3SGKA 2P5WB 3GSXA 3ZE2E 5E6IA 1IAII 1T5XA 5FIEA 1I1AC 4NN7B 1QBMH 3ZTJH 1G9MC 1YNTB 2VDKH 3V95A 5E8OA 4D9LL 1R3JB 3VXUE 2OM5A 2X4QB 1NBVL 3GB7B 2DQTL 2ZUWA 5F96L 3ARGB 1QFWL 1S7TA 2CH8A 5E2VH 1PZ5B 1A6VL 1EXUA 1UWXK 4Q6IC 1DP0A 4XTRC 1VFBA 1T5WA 5E5MA 3V5KB 4TYUA 2B7DT 2B1HL 2FH8A 3OXSB 4KGJA 4G8IA 3S96B 2WP3T 4XB7A 4XXCC 3DMMD 1P2CB 3SDDC 1EHLL 4ZOBA 1VERA 3BP4A 4DVRL 1DQDL 3D69A 4NKMB 5JPMA 1DEEB 3TYFB 4RRPG 3FN0L 3BVNA 1I3GL 3UAJC 1ZHKA 4RAVA 4L8CB 1MIMH 3GMOA 4LRIC 2X4SB 5FGBA 3QCTH 3HMXL 1T1YA 1XGYH 1SBSL 2AJVH 2YA1A 3P4NB 3UDWC 2OTUA 3S34L 4GRWH 3V6FB 1I1AD 1U92B 5IB4B 3QEQE 5CEZD 5JA8B 5LWYL 4R3SB 2YD2A 3EDJA 1CLCA 1BGXL 2Z4QA 2XN9B 4J4PA 2BNUB 3D9AH 3INUH 5DT1H 3B5TA 1BFTA 4ODBD 3ZSTA 4FZ8L 1EA9C 1R5WB 3I2CH 2W1NA 3VXSB 2LU4A 5C2BL 1EMTH 2CLVB 2D7NA 3VJ6B 4E42B 3O3DA 5TQ2L 1AGFA 1KEGH 1D6EB 2G2RA 3NH7H 5IF0A 4XTRD 3WEXB 4JY6B 1P1ZA 2FBJL 1RZGB 1J1XH 4KJQC 3VFPB 1JV5B 2AXJA 3VFUA 4WWKB 5CSZB 1NCWH 3SDDD 1CGSH 3QA3A 2VC2H 2NY1C 3FO9B 4PRIB 4GG6F 3QNZB 4PJAE 4QXGH 3QDMD 2BVQA 4HGWA 1QQDA 4O2FA 1H3UA 4BFBD 3RL2A 1KEMH 4KAQH 2ZCHL 4Y2DB 2ADIB 1BZQK 3QG6A 2XFXA 3WL9B 3DMMA 5HY9B 4KV5F 3MXWL 1T04B 4PD4K 3PDDA 4L5FH 1OTSC 5J0BA 1F6AA 1IC7H 3KYMB 3IDJB 3GSVA 4P2OC 2PYEB 1YJDH 4Z0XB 2FX9H 4JFDE 1BVLB 1NEZB 1R3LA 4FQHA 2EE6A 5J11C 1K2DA 5E03A 3QXAA 4XNZB 4EDWH 1MREH 3G6JE 5C0JB 3IETA 4UIKH 3X14A 5B39G 1YECL 4MS8C 1T6VN 2F58L 2WLYA 3ULUC 1AO7D 1I1AA 2X4TB 3BPLC 5D1ZB 2F5BH 1L7IL 3HR5B 4XPHL 4OV5A 4WEMB 5SX4H 3R1GL 4Y4KC 3NCEB 4ORGB 4PFEA 3MYJB 2PXYB 4KJQD 2XWJB 5I18H 2QEJA 5AZEL 1QLRB 1WEJH 1QSEB 2NY1D 2P5EE 4Q6IA 2LAGB 4RFNB 5TDOB 4YUEH 3FB7A 1OSPL 3SDAB 4KY1L 5HYJD 5E2WL 3W5NA 3X13A 4HIJB 1MQKH 4XXCA 3CSYA 3SDDA 3QEQB 3F7VA 1AY1L 1TQBC 1OTSD 3QDMA 4IOSD 4O2CB 4P2OD 5ID0B 1RIUH 1XF4A 5JW3H 4HV8B 3T09A 3U79A 2W9DL 4LRIA 3MMEB 5FYJU 4ZUTA 3FCTA 1FSKB 3EOYG 4MNQE 5JXEC 4MS8D 2JB5L 3UDWA 3IJHB 3CDYA 4HKXA 3ULUD 4G8EB 2E3VA 3GM8A 3WFCH 3LN4A 4TSBH 3RWIB 1PBYA 5IFAL 5M7QA 2BSRB 3MV9B 4M03A 4Y4KD 5DVOA 1FZJA 3CDGB 1T0PB 1H3PL 1VCAA 3MLZH 1F5WA 5DMYA 2VXSH 2WUCH 5C0CE 3O2VH 4PRHD 2APBA 4JKWA 4MDJA 1AO7A 4XP4H 5E1HB 4P5KA 3ELAT 4O5LL 4Z77B 1JPFA 4APQC 1GOHA 1BQHA 2BCKB 3HC3L 3KYAA 5EZIL 3ZTJG 2APWA 4IHOA 5DHYB 4LSPL 2GI7A 4MXWL 1A6UH 3VXTA 2Y07H 2OSLB 3IDYB 3D85D 4KKAC 4BSVA 5IW6A 1WBZB 5EU3B 4BK4A 3G6JB 4YHNB 1OVZA 3CZFA 4GMSH 3SE8H 5HYJA 1IT9H 4P4KB 4TVPE 3I75A 4MA7L 4YEEA 3FRUA 4G42B 1PSKH 1UEMA 2YWZA 2JELH 5E2TL 4Z7OE 5DHVH 3RUGB 3GMPB 1CFVL 4PR5B 1NCAL 5J1AB 5JXED 3M17A 5LKNA 4N0UA 4P2OA 3QUXB 2OL3B 1HILA 2HVKA 1FYHB 3KGRA 1IC1A 5CJQH 5BZDB 1L9NA 3H7BA 4XVJL 4YFEA 4LSDA 3HG1E 4Q9CA 5HHMB 2K7PA 3Q0HA 1KTRL 2OL3L 2RFXB 4H8WL 4UT7L 3MLYH 1PYWB 1UCTA 2PW2A 4OLXH 2CDGA 4JG1L 1KOAA 3FQUA 4EQ3A 4Y4KA 4OAWA 4APQD 4CN6A 4KTEL 5E8PB 3NCYS 3D3VE 4OM1L 5ICYB 1U93B 4PRHA 4ZD3H 4HMEA 5IQ7L 4KKAD 3QAZB 5CIPH 1Z9MA 2P8LB 1AGEB 1RK0A 3NN8B 5I1IL 1IC5L 1VACA 4LMQE 3FO0L 4MD0A 1YC7A 2R69L 3LKNB 5ALCL 3D85A 1Y6NR 2Y6SC 4YDVA 5D5ME 1FL3A 4XZUA 3IXAA 1WZLA 1YEIL 3DLQR 3OR6B 4L8BB 4WI4A 2DLIA 2A9ML 1MCQA 4NRXB 4WFHE 4K7PY 2GT9B 2VLJD 1LGVA 5EU5B 43C9A 2MKWA 5J56B 3WMSA 2XZAL 5JXEA 3VW3L 5ALBL 5D7LB 4ELME 1WCBA 3U0PB 3FQXB 5GS1C 4IS6B 5LBSH 4Z76B 3U83A 4OF6A 5KSUB 4S1QL 1G7MB 2HMIC 4ISVB 3BGMB 2AGJL 4HCRH 4OFIA 2JLLA 2IAMC 2VRAA 3A6CH 3WYRA 3BI9X 4Y8DC 1RY7B 5CINH 4F3FA 4APQA 4JQIL 1DQMH 3STLB 1RK1B 2Z92B 4MYWB 3VDCA 1G6RA 4XPAH 4HGKC 2OLDA 1OGTB 5K9OB 1CFSB 3MGTA 3ULVF 3QO1A 2EYRB 4J6RL 2Y6SD 1NCBL 3FMGL 4RDQF 5DJXA 2IH1A 3NCCB 1TITA 1XCTA 1LO5B 1NJ9B 1OAKL 2LVCA 1JPST 5I17B 3RBSA 4K23H 1UENA 2VR5A 4JFPB 4BM7A 3D39E 4CUCA 3W2DH 3ZYIA 5DJZB 5I1GL 1IEBA 5F6IB 5L8JB 3E1F1 2DQDL 4YXHL 4Y4FC 5DJ0B 4C56D 1AGCB 2HMID 2ICWA 2VLJA 5IWLC 1ZGLM 2IAMD 3L3KA 1CFQB 3L7EA 5DEFB 4NBYB 1TJIH 1FC2D 4LVOC 1MJ8L 4MQ7A 4Z7WA 5D7IE 5HYQA 1RFDL 3V8OA 4OFKA 5J3HC 2BSSA 4Z5RB 3H9HB 3OAZK 2P24B 1DE4B 1RZJL 4NNYA 2PO6B 1BJ1H 2H1PH 3CPLB 5BXFB 3HZYB 4KQ4L 5D2NC 1X6NA 5CZVL 1MJJA 2YPLB 3MFGB 4OZFA 2PNDA 5EUKA 3MV11 2VQTA 3AS2A 3QEHB 4X6EB 2W38A 3SKOB 4HJJH 1HWGB 1MIEH 3KR3L 4NO5A 4P49A 4PV9A 2YD5A 1H5BB 4GMTL 4NCC1 2AV7B 3LV3A 3L3GB 4LVNB 1N0XL 3EDEA 1UB5A 1T21B 4JO4L 4YFLI 1LNUA 3WIFB 4GOSA 4KGLA 2CUHA 4NBXB 1NBYA 4L9LC 3QXUA 2PW1A 2R56L 4NUJA 1YEFH 15C8H 2V7HA 3JWOH 2KH2B 3IDUA 2X10A 4Y4FD 1VSCA 3BRGC 3FTGB 1EGJL 3ZDYF 1PKQB 1A7NL 1JGLL 1LK3H 3HRZB 3G08B 4L4TE 5LAXA 3RWDA 5TDPB 4EVNB 3VH8A 4WUUE 2FRGP 4BUHA 5GS1A 5A2KH 1N8ZA 5J3HD 2HKFH 1FZKB 4C56A 3ME0A 2Q8AL 3BPOB 1IARB 4U1JA 4HS8L 4JFYA 5KTEL 4K94C 3B4NA 4MCYA 3R06A 3TESA 3T2NH 1JCKA 4LSQL 1LO0H 2HWZL 3GBMH 2D7MA 3I02B 2Q7YB 2EH8L 2W9LA 3KG5A 3V4UL 1GOFA 1Y6MR 3IDXH 4X7DC 4NWUL 3DBXB 4PY7A 3OKEA 1DBKL 3QRGL 2EECA 3RWCA 4JHZA 1WF5A 1Y6KR 5GISH 3WHXA 1MOEA 3IS0X 2PUQT 2A77L 1J5OH 1J8HE 4NIKB 2VITA 3G04B 4G6FB 5L6YH 1CE6B 1XH3B 3ZHLA 4DCQA 3FFCE 3L5XL 4D8PB 2DQFA 3B9KC 5FA3A 3MRNB 2QHRH 3BO8B 4I4WA 3GSNH 4PBWD 4X80L 1KC5L 4Y4FA 4LPTA 3UTSD 3QH3B 5IWLA 3MV7B 4M5YH 2YS4A 1MFNA 3I3BA 5E70A 1LEKB 2FEEL 2BNRE 5F6HJ 5DJAA 5A43C 4RCAA 3KPPA 5I1AA 2P48B 2D0HA 1RIHH 4N90E 2JK5A 4EI6A 4XC1H 1EFXD 2PCPB 1IZJA 5JXAL 5EDXA 3TVMC 2F53B 4X6FA 3C60C 3P2TA 5D2NA 1DFBH 3F65A 3GGWB 4HAFA 1CXHA 4RZCB 3PNWA 3ARXA 4MD5B 3VDAA 1LEIB 3ZHKA 3P9MB 4UOJA 3MOQA 4Y89A 5ETUA 1LDPH 1IM3B 2AXFB 1QFUH 3ZYZA 4ZSOE 1S8DB 4RBPK 5CMAA 5IG7A 1FV1A 4Y1AB 1VFUA 5L9DL 4G6KL 2DYPD 3J7HA 2X05A 1R5VA 1HYRC 1IGFH 1HCVA 3B9KD 5FKPB 2GITA 3KPQB 1A4JB 3B8SA 4U1MA 1IRAY 5D72H 5GSVB 1U91B 3T0EE 2W0PA 1IBGH 5GGVL 4PPTA 3SKNB 2DMBA 2GIYA 2FJGA 3BMWA 2O26U 3HE7C 4EI5C 3MSPA 1KIPB 4XNMB 5FOBB 4G9DA 2P4AB 4P48A 1BFVH 3UTSA 5ICXB 5IUSA 4LCCC 3TVMD 5E9DD 3C60D 3BWUC 5H94A 5DS8B 3VWJB 4FQ2L 3MGOB 3EFFA 5EN2A 4M3JA 4JZJA 1G7LB 3MLTA 1CICB 2K3TA 4I2XA 3WS3B 3QZWB 2E6PA 3KDMB 3M07A 3SE3C 5BRZB 1EFXA 2VO5A 3EYUL 5E0QA 3ZL4H 4W81A 4DTGL 4HS6A 3MRGB 3BQUC 2PKDA 1S7XB 5E8NB 4JFQA 1AD0B 4K9EH 1S7RA 4HIHA 1QPPA 5BW7C 3U7YH 2CRIA 4PJ8B 1LVEA 3QIUC 3RQ3A 5E94A 2BNRB 4FMKA 5KVFH 1ED3B 4XRCA 1BMGA 1KCKA 4NHUB 2DYPA 2EDRA 3SGEI 4X7TA 3KYNA 3MRFA 3QIWB 1ZHBB 3HE7D 1GC1C 5GS0H 4S0SD 3B9KA 3IJYB 4Z7NE 1A9EA 4EI5D 4J3UA 5ECJE 1JBJA 1YEDB 2ESVB 1U3YA 3P4OB 2GSGB 5HGHB 4ZOEA 1CDYA 4QCIB 2Z31C 3DX7B 3H9YA 3HR6A 4R4BB 4Z18A 1MPAL 1TIUA 3NCBB 4PTUA 3KYOA 4QHLB 5CSBA 5C7XH 2J8UE 2CKNA 3BAEH 1S9WA 4L4VD 2CRYA 3RU8H 4KJYA 4QTHA 1BOYA 2VABA 3S3SA 2N1KA 5HDOA 3B9EA 3TVMA 1Q94B 4G6ML 5E9DA 3C60A 4KHTH 2BDNL 3BQUD 2HVJB 4U1LA 3MPCA 4BSWB 5HGDB 1DBJL 1N5YL 5GGQH 4PJ7E 4BUGA 3RIAK 3F7YB 2D4DA 4TVSa 3NA4A 3MROB 4OT1H 4YIQB 1LO4H 1NUFA 3QIUD 4NSKA 4LDEB 4X99A 4U7MA 4Z7WF 5KZCD 2ZOKA 4WDIB 3BPCB 2A73B 1V3MA 3G5XA 5FUOH 5KSAC 4I77H 3CFCH 3MRBB 1H0DA 1YEGL 5GRVK 2I26N 3X3FH 4WVRA 1MRDL 4XC3H 1B0GB 4X4ZA 2FBOJ 2O61A 4RX4D 2ITDA 3IDMA 2Z31D 3T77B 4D0BB 2CIKB 4EOWH 2C4FT 5F3HB 7FABL 3K3QA 4L3EE 3HE7A 3MNVA 5IMMB 2XZZA 1KF9B 5CHNB 4EI5A 5DZOA 5EU4B 2C7UA 5F1SA 4MX7B 3D87B 3VFOB 4GG8A 5F7WC 1CFNA 4WU7A 3EJYD 5BVPH 5F88B 2ARJA 3ROLB 3N9GL 2VYRE 3HNTL 3QYCA 4L4VA 2CK0L 4AEHL 3TNMB 1CXFA 2YR3A 4PJGE 2ZSVA 1I8MA 2DB8A 4MDIA 4P99A 1T1WA 3SE3A 5KVGL 3CJJA 1NUGA 4AIOA 3MO1A 3O0RH 1SY6H 3BQUA 4JM2B 2QQNL 1PY4A 1SJHB 5BQ7B 4GRMB 2XKSA 1S7VA 2I9LB 5KSAD 3K8KA 4QXTB 5BW7A 3TV3L 2YMXL 2XTJE 2QR0A 3I84A 2XRAH 4AIZB 3QIUA 1TZHB 4UNUA 2J8UB 1DQTA 2X4NA 4FQJH 5A2JH 4NQSB 3MX0A 4FS0A 3TWCH 3U6RA 4E5XA 1PZUB 4OZIB 4UDUB 5FO7B 2MCG1 3P4MB 4OTXL 3FO1B 3I85A 3RX5A 3QUMB 5GHWH 2NQCA 4R96B 4RX4A 5FEBA 2Z31A 4OIIH 3HUJF 1BBJA 3KPSB 4DAGL 3QUML 2J6EL 2VXUH 2YA2A 4JFDD 4U1HA 4YAQA 5DMJB 1MFCH 1Q38A 4ZUWA 3V0VB 1UM4L 1KPRB 4HWZB 4KK5C 4WI2A 3U46A 2NY5H 1ZVSB 3GK8L 2MCPL 4NBZB 3T1WA 3MRMB 3NFSL 4TNWF 5EC2B 5BCAA 2CLZA 4GQPH 1INQB 5FCUL 3ULVH 2B1AH 3LN9A 3GJEA 5ITBL 4HFUH 4JDVA 2HFGL 4JGJA 4QXWA 4L3EB 4XPTH 3D2UB 5SWQB 4MNGB 1AP2A 4BKLB 5EIVA 5CJ8A 5GGUB 3UO1L 3MRRA 5C0IA 4NJAH 3L95B 1YEEH 4ZPVB 4XB8A 4PRBA 1A4KB 4X98B 5KSAA 4B50A 2D31B 3ISWA 1VKXA 4QWWC 2C5DC 1REIA 3VFRA 3WS6C 4PRAB 4PJAA 3T3MF 1HEZA 1G9EA 1NANH 2R2EA 5K9JH 1A6WL 2JF1A 4X4YA 4IMLB 5B38G 5KSVA 1M71B 1JGEA 1CD1A 1OAUH 1PAMA 2FH6A 3MRHB 4QHMB 1MHHB 5FB8A 4X6CE 5EBLB 3BP6A 1JRHL 1UKSA 5DYOA 4KH2A 1WC7B 2YD4A 4OFPA 2DJUA 4KK5D 4MNQD 1X9QA 3U36A 4HHAB 4DUVA 4RAHA 4NFBA 1F3DJ 2ZPKL 3HNVH 5JO5B 5DVMA 4H5SB 4MLIA 4JFDA 5FV1L 1LO2L 5GZOC 2DL9A 4P9HH 1XZ0B 1OAZL 2IBZY 1A3LL 2D4FA 2KL6A 4NFCA 4NM8L 4WGVB 2ED7A 3Q5TA 3HC0B 1YEHH 4XWOC 5AYUH 3N50A 1IZKA 2ZNXA 3HPJA 5C0CD 2YBRA 5CEZH 4UDTB 3EO1A 1G9MH 1QBLL 2WANA 4WW2C 3FQWB 2IG2L 3LKRB 2DMKA 2Z8VC 5H35A 4TTGA 5DRXA 3GHEL 3L3HA 3GMRA 3RDTB 5EOCL 4QWWD 5DA4A 1NMCB 4ZFZB 1AFVH 2HKHL 1AR2A 3DX9B 1Q9OB 5ENWB 4WW1A 1JMXA 1BVKB 2ATKA 2V7NB 4JM4H 4ELKA 1MELA 3L1OL 1UJ3C 4I5BA 4IIQC 4F7MB 4LHUG 4TVPD 1L0XA 4UB0L 3QXVA 5DD0L 2P8MB 4PS4H 1CBVL 3QWOB 1FG2B 4JCMA 4F7PB 2IPKB 4MJ6A 4NCDA 4OD2B 5I1JH 1ZHNA 3MLXL 3QHFH 5F7KC 4IRSB 1JHTA 4BQBA 5GZOD 1AXTL 2NY2C 5FA4A 3HG1D 5F7MC 3Q6FA 1MY5A 3NZHL 2VISA 2OZ4A 1C5DA 3PIQB 1JFQL 4MNQA 4XWOD 5IJVB 3EZ8A 3OHXB 4M8QA 4F57L 4Z7VB 1QLEH 1JHLH 3O2WH 2IANB 1MCEA 2FX8L 2J4WH 1W2KT 5MEQB 1U42A 4JJ5B 3SE9H 5I1CH 4HDIA 1DBBH 4PJXA 1I75A 4WV1C 1J05B 5TGBB 1UKQA 2VZ1A 3D3VD 3VG0H 1B2WL 5C0CA 5F7UA 3BWAA 4HXAH 3WDIA 4R90L 4PG2C 5L7XH 3LKPB 2H26B 3ARRA 4WY7L 3FFDB 2JTDA 3THML 3P73A 3A6BH 5D2LB 5C9JA 1XF3A 1Y18B 4PB9L 3KPOA 2L0DA 4R7DA 2DQEL 4LSTL 3WS6A 1JYVA 5J6HB 4JFXB 1P84J 5DC9B 3RNQA 4RMWA 2EEBA 1SBBA 4JHAH 2A2QT 5K93A 5FO8A 1I8IB 4NJ9L 2J8OA 2OJEA 4MHHG 4LCWB 2NY2D 4NQED 1JPTL 1PJ9A 4JLRA 1QA9A 1MFDL 2BXZA 4YHKL 5AYQA 5E6YA 4TNVF 3BZEB 4NZTH 4TPRH 3MNZA 3ZSSA 4O9HL 3ZMRA 2FIKB 4G9FD 1EK3A 5T1MA 3TT1H 4R8WL 4KQ3L 5EUOB 1FPTH 3GBNL 2CR6A 1TNMA 4KRPB 5J13C 3HG1A 2Y5TB 3BSZL 3GI9L 1C7TA 1NGZA 5TJWK 1IKNC 3BESR 3ULUH 4J3OC 4LVHC 1YQVL 4TUKH 4YNYA 1KLUB 4Y88A 4WW2A 4OBSA 5FHAH 3L5HA 3EGSB 5ESAA 5BV7C 2YD7A 4ZTPL 3RTQC 5IB2B 1NKRA 4WWID 4P4RB 1MCPH 1ES0B 1NFDB 3SY0A 5EO1A 2F54D 4JB9L 4WENB 1HQRB 3D3VA 3QDJD 1S7QB 5IOPA 2H8PB 4JANA 3MRDB 3V0AC 1JZ6A 3ZE2F 5H37H 4UV4L 1UJ3A 1A1MA 1IEAA 4NN6B 4IIQA 1B0RA 5LGHL 4B5EA 3CXDL 1JZ2A 4S1SH 1T3FA 4PJFB 5C0FB 5HVFB 1HNGA 4U1SB 5DXWA 2QADC 3NFPB 5D5MA 4WHYH 3FOLB 1S7UB 5F21B 1N2RB 4BQCA 2OK0H 2WIIB 4WO4B 2KKQA 2OR9H 4I3RH 4NQEA 3ROOB 5DLMH 1U8OB 4LDLB 2EYTB 5DUMH 3ARYA 2FX7L 4OLZL 1UH4A 2XG4A 3WUWA 4UT9L 1NPUA 4ELMA 2VDOH 3LPFA 4UILH 3LQAL 4NQTA 4G9FA 4XCNB 3VGEA 2R0LL 1A7RH 4YC2C 5HYSB 1MNUL 1AR1C 3RTQD 2HP4A 4JN2A 4LF3B 4PYGA 5I1EH 2QQLH 4MQTB 4MAYC 4WV1A 3IU3B 1DUYA 3ZKXB 1RJLB 2AV1B 5F8QC 4WHDA 4XMKL 4N8VA 4OLEA 3WJLC 2VZ3A 4PG2A 4W68A 4OLWH 2ZOLA 5I6XC 2C3HA 4RNRB 4NQXB 1G6RH 1DSFL 5C07B 3TBWB 4K8RC 3DYMA 1T83C 1Q72H 5CS7A 4LARL 2F54A 1UH3A 3QDJA 3L3JB 2O5YL 2QADD 4JPVL 3FQNB 4LKXB 2D0FA 2XTLA 3DGGB 1OB1A 2R0WH 3MUGA 5DD5L 1VHPA 3MXVH 4CL7A 4KRLB 2C3XA 4CNIB 2KBGA 4L4TD 4PJCE 1E27B 3KS0H 4LHQB 1IAOA 4RWYH 1RZKC 3VRLF 4UUJB 3ETBF 3DRQA 1TJHL 3AREB 1AR1D 1J11A 3BJLA 4OKDA 5C0DA 2AJYL 2OMNA 3CDFA 1IKNA 4MAYD 5AWNL 5J9PB 2X1PA 4RGNE 2Q8BH 4BFEA 3DIFA 1PKOA 1DL7H 4YHZH 3H3KA 3WFBH 4AENB 4P57A 1OF2A 2ADJA 4U1IA 4HT1L 3RTQA 2AW2A 5F1IB 4GW1B 3NMEA 2R2BB 4K8RD 3PL6B 5C0AB 4U31A 3ILPB 1A02N 3H42L 1TMCB 4JFEB 3CK0H 3QEUA 2A9NH 5F1KC 3TIEB 1GHFL 3VA2C 1HE7A 2V17L 4S11A 3GMNB 5DI8A 1J8HD 4POYA 3GIZL 2XQBH 1OD9A 4Z9KB 3FFCD 3ZE1E 4JFOA 2XWTA 2VIRA 3VXOA 4QXUH 2Y06L 3MCKA 5T33H 2VZOA 5CGMA 1OWRM 1NAKL 5CKGA 1K3IA 4K7FA 2W0FB 3T0EC 1TVHA 1UEYA 1F3RB 2NW2A 4Y19E 3HLAB 4P46B 4L4TA 5DTFB 5A2IH 3F58H 2Q3ZA 4NO3A 1ODAA 4QRPE 4R0LC 4PRPE 3AS3A 4CU6A 2NZIA 1A14H 4CJ1A 2DQCH 1MH5A 4PJHE 3V4PL 1CTNA 4Q0XL 3ARVA 3ARZA 5MHSE 5DMIL 1ADQL 2NY6C 4YE4H 5KG9B 1UM6L 1ONQB 2ZCLH 4LLYA 4N0YH 1RU9H 3HE6C 4MAYA 4Z0BH 1ND0A 5I16B 5JLZB 3MV8D 5J57B 5D6DC 5EWIL 5HTSA 3WJLA 1HZHH 2DKMA 3S36H 3IXTB 4Y5YB 5DD6B 5BS0B 3LEXB 1T83A 4U05A 5CUSH 4KTDL 4TULH 3WXVL 4PJBA 3WKNA 3S88H 4PJXF 3UMTA 2VLKB 4JY4B 4MJ5B 5C08B 2VZVA 4J1UB 3NOIA 2D0GA 1QFWM 2HFFA 2GCYB 2EDNA 1CVRA 4QRRE 2E7LC 3T0ED 1SJEB 2VN7A 3PDOA 4U2ZA 3N85H 4ESKA 1J8HA 5D6CB 1A3QA 1U8MB 3FFCA 3OKMA 1FL6B 5LCVH 1A2YB 3C9NB 1T22A 5EC1A 4WHYG 2NY6D 3GSOB 1QOKA 5GIRA 1HHIA 5AG8A 3HE6D 3BKYL 4QTIL 2JE8A 2J5LC 5DUPL 3ZDXE 4D0DB 3IKCB 1FIGH 1T1XB 2CUMA 3BKMH 4JO2L 3RP1A 1D9KB 2YHGA 3CX2A 5I1DB 2NYYC 3EYVA 4X9IA 4X6DE 2YUZA 3HI6L 1QLFB 1QKZH 2VTFA 4K07A 3MV8A 4OCXL 3IDGA 3U30B 1U58B 3LS5L 5DFWH 4ODWB 4JPKH 4Y4HC 4XHJC 3BUYA 2ATPB 4D2NA 1QBML 4WW2F 5FECA 2VDKL 3GSUA 5ESVA 1IAKB 1DJSA 4LPVA 1YMMD 4G8FB 4RQQA 4JHBA 3RWJA 1GOGA 5E2VL 5EZOH 4V1DB 3GMMB 5DJCB 1I8KB 3T0EA 1LP9B 3MFFA 2VL4A 4R0LA 2DIBA 4XNQA 4MA3B 4QRUA 3LKOA 2YUXA 5EA0L 4EDXA 2NYYD 3PHQB 4NUGH 4OZHB 4MZ3A 4UQ3A 3HE6A 1XGTA 2AJZB 1MIML 1I4FB 1PQZB 2DQHH 2UV3A 4K94H 4KROB 4NYLA 4C4KT 3QJFB 3S5LA 1ZA3A 3VFMB 4ZODA 4GRWB 3QCTL 5D6DA 1XGYL 3VXRE 1I9IH 2AJVL 4KI1A 5JHLH 4Y4HD 4O2EA 4XHJD 3FT2B 1FCGA 1WFNA 5I1LB 5LJYH 5B22A 4ONGH 3QR2A 1L9MA 3RX8A 4E0RB 2IF7A 2AXGA 4LBEB 3INUL 3D9AL 5DT1L 1XGQA 5FYKH 4XVUD 3R4DA 5E5RB 3I2CL 1EMTL 2WMPA 1W0VA 1KEGL 1FYTE 1ZT7B 2BMKA 5CGTA 3NH7L 4XX1G 1GCFA 5B3NA 2EDOA 2ZSWB 4ZXBB 2E7LA 2RIKA 4Y7MA 4G6JH 1QPXA 3ARDC 1J1XL 1Y0LB 3FB8B 3NFNA 4PRNA 2FHBA 4NZRH 1N59A 1NCUA 3UBXA 1D5ZB 1NCWL 4UU9B 1YMMA 2FWOA 1BQSA 1CGSL 5H2BA 2VC2L 1NBVH 1MFEH 5HHVH 4P3DB 1OAQH 5KBNC 4QXGL 5GGVY 4WEBH 1U9KA 4YFDB 3W0WB 3L5JA 2VWEC 5HHQA 1KEML 4KAQL 5JIKA 5CWSB 1U8NB 1TZIB 2YD9A 1N6QH 3I6GB 4YHIA 4L5FL 3VH8G 1MCLA 2D03H 2XNAA 1IC7L 1ETZB 4WU5A 3QJHB 2X4PB 3LCYA 1YJDL 2I60H 4WNQA 1GAFH 2FX9L 2NMSA 4ZFFB 4FP8H 4BK5A 1BF8A 2E9WA 4Y5VB 4EDWL 2PF6A 3GDBA 3JSSA 1MREL 5T3ZD 4PJ7A 4P3CH 5LGKA 4UIKL 3ZE0E 4Y4HA 4LLDB 1JPGB 4D3CH 2F5BL 1UC6A 4XCCH 5BZWA 2H3NA 2ZUSA 5F6HI 3ARDD 3VFTA 4QY8A 5F70A 4LLUB 1UXWB 4JDZA 1DQQA 5I18L 5IW1A 1A7BA 1I1YA 3FT3B 1LK2A 3T4YA 1ZANH 1WEJL 3IFOA 5LGJB 3G6AA 2DI9A 3GRWA 5KANG 3MUZ1 4DKEH 4YUEL 3TEUA 3LOWA 5EO0B 3D0LB 1XGPA 4OF5A 3GM0A 3AS0A 2VB5A 2X4RA 3KNBA 1MF2H 1MQKL 3MJ7A 3VG9B 1EO7A 4NQVA 1QEWA 4PBXA 4RISH 4PD4J 1I3RA 1D5BB 3CLEH 5MENB 3TPUB 5T3XD 2BY1A 3FRPA 1RIUL 4OCSH 2VXVH 5JW3L 1K4CB 1CIDA 1CQKA 4P5MA 3JTTA 4H0GA 2HG5B 3PGCA 1IGMH 4CW1A 1SEBA 5EPMB 4X4ME 1G1CA 4YDKH 3QQ4B 2D7PA 3MJ9A 3BH9A 4U3XA 1TCRB 4Z7QE 5SWZB 4ORZC 1T20A 3MREB 5IVZA 3BP5B 3WFCL 4TSBL 4YXLH 2GJZB 5DK0A 1JNNH 2BVPA 3JV4A 5E00A 4J23A 3QNXB 4XBGA 5C0BD 2AJ3A 3MLZL 2G5BA 2WWKO 4PJIB 2VXSL 2WUCL 3O2VL 1LMKA 2MHAA 3C6LC 1AXSB 5JHDB 4XP4L 5IVNA 4ODSH 1MCJA 1J87A 4X5WB 1RUKH 3ARDA 5IBUB 1FC1A 1NGWA 4XAKE 5DRZB 3PV7A 3VXQB 1GC1H 1J88A 1KENH 3CH8A 4HIEB 2X4OB 1K5NB 2LTQB 5ISZE 1PGRB 4GUPA 1EJ6A 1A6UL 3RVUC 2V5TA 4Z7UE 4PJBF 1WWBX 4JFHD 5F3BB 1MI5E 4N5UA 3RWHA 5JOFA 4XCFH 2V9RA 4P2RE 32C2A 3SDXB 2SEBB 4GMSL 1QO3A 5DHVB 4U6HA 4GSDH 3SE8L 1IT9L 1A1OB 2QSTA 3OX8B 1PSKL 3WV0A 1WTGT 2JELL 4POUB 1T4KA 4LKCB 1DZBA 3TIDB 1MCWW 1K85A 1U3HC 4FZEH 2JJWA 3O8XB 5FO9B 1B9ZA 5CJQL 3U7WH 1DUZA 4X8JA 3MRKB 1G7PA 2W9DH 3HZKB 3O41A 3O3BB 2BSTA 3MLYL 3C6LD 2C4XA 1Z0NA 4DOHB 4OLXL 2DDQH 2DLEA 1CGYA 1IKFH 1I7RA 2VDLH 4EUPH 4YDJB 2W60A 5C0BA 4HUUB 4R4FH 3REVB 2DTMH 1BZ7A 3M1BB 1OSZB 5CIPB 5DDHA 2WBWB 5I75B 4ZD3L 1G7HA 3RVUD 5GGRY 1YNKH 1VEPA 1KJMA 2BFVH 4CU7A 1OGAB 4EZMA 4NQDB 4PJ5E 3ZKNC 1ERNA 1JF1A 5CZKA 3BKCH 4HKBB 5KS9A 3NAAH 1NC4D 3UZQA 1FP5A 5A16B 5FK9B 1B3JA 2NY0C 3S4SA 4DQOH 4ZAKB 2YOCA 4X6CA 3OAYK 2FECL 1CGWA 4HIIB 1U3HD 2JCCA 3PWPB 2DBLH 2GSIB 5DQ9B 2B20A 3GMLB 5IHZB 3OKDA 4NNXA 2IBGA 5HDBE 5IEHA 2J1KA 1MUJB 4XCEB 1ZTXH 3EOBB 3O6MH 1ZT4B 1I1FB 5TDNA 2ZG3A 5LBSL 3I50H 4Z78A 2Q1EA 4EQ2A 3T2PA 3DO7B 5FDWA 3I6KB 1FZOB 4HCRL 1YUHA 5L2JB 4CVXB 4X5XB 2LU7A 1ZEAH 1S9XB 3OKOB 3X17A 3A6CL 3C6LA 3RVXC 2R4SL 1ZSDA 3EOAA 5BMFH 5CINL 3ZKND 1INEH 1BLNA 1DQML 4WTZA 1A9BA 1Q9LB 2D9QB 4DZ8B 4XPAL 3L3IA 1KELH 5EZJB 3T65A 2NY0D 3NPSB 1EAPB 1NDGB 3RVTC 1ULVA 5IIEB 5T1LA 4B41A 1G7JB 2YD3A 3MRPA 5F72S 1KTDB 3MOAL 2E7BA 4I3GA 1EX0A 1NC4A 4ODUA 1CVSC 1LEGA 3QP3A 3MA7B 4K23L 2OZ4H 3HS0A 3O4LB 1X44A 1T7WA 2HTKC 1KG0B 1N3NA 1U3HA 3IVKA 2MPAH 3W2DL 2OQJA 1MLBB 1YYMH 1SYSB 4Y0GA 1VGKA 4WFED 2AEPH 3MYZA 5IFJB 2APXA 4Q9RH 1GGIH 1BIIB 1HKLH 3E3QE 4R4NC 4RFOH 3C5SA 1KLGB 3VE0A 2BVOA 1EEZA 2P5WA 5IV2A 4FHBD 3RVXD 3MRIA 1HXYB 1TJIL 2J8HA 3K46A 4M7ZB 1JF6A 1S9KC 1YNTA 3HZMB 3QQ9C 4F7EA 2H1PL 1H15A 3MQIA 3QIBC 2H2PC 3RVTD 3O11B 4FQLH 2W59A 3WIIH 4RFNC 2YPKB 4HJJL 1FNLA 3V5KA 3D0VB 3QWQB 4OCYH 4ZO8A 4TVPH 5T5NF 3IRPX 4KJWC 4FTVD 5C09B 4GG6E 3NZ8A 3CXHK 5DRWB 4NRYA 4J8RB 2PR4H 2HTKD 5I9QC 3BHBA 3DX8B 4L8DB 3BEVB 5HDLA 4MMZC 4CMMA 1WZ1H 2E27H 1YEFL 15C8L 3JWOL 4OLUH 3F5WA 4QGTA 3MRQB 3OGOE 1LK3L 3EBAA 1T1ZB 2RBLA 5D71H 5HJ3B 2P7TB 3QXWA 2YN3A 4R4ND 5DJDB 4OI9A 1J0JA 3P4NA 3S3JA 4F7CB 3IGAA 1U92A 4RGNC 5IB4A 1KJVB 5C2UB 2HKFL 4ERSH 3QQ9D 4I0CC 3PF2A 1P69B 4JRXB 4CMHC 3QIBD 2H2PD 2L4OA 5CSGA 3BN3B 3VJ6A 3T2NL 1LO0L 2FZ3B 3GBML 1VB9A 4JY6A 4HH9B 3WN5B 1RZGA 1CK0H 3V79C 2W65A 3IDXL 5CD3A 2CRZA 2EDFA 2C1OB 4EUPG 4KJWD 5GISL 1LDSA 1HHJA 2HRLA 1T0NB 1Z5LB 1TNNA 1SJVA 1J5OL 1IE5A 4X6BA 4R2GB 5I0DA 1ITBB 4HZLB 5IB5A 4P4KC 1JVKA 2ADIA 1JGUH 5L6YL 2DRUA 5HY9A 3U4AA 4FTVA 3GSNB 3QEGH 3EYQC 3IDJA 4N9OB 3E2HC 2QHRL 1OAYH 3GSNL 3OPZH 4RGND 2I24N 2R15A 2CDFA 4OCRH 5KANI 4H8WC 4UAOB 3GUTB 4MJIB 4M5YL 1FLTX 4JG0H 3RY5A 3VD7A 4JPIA 4OGZA 1RZ8B 2R2HB 4LSSH 3DARA 4ODTH 1E6OH 1RIHL 1ZGLB 4XC1L 3HR5A 3EYOB 3FB5A 1HN1A 4W70A 4OUOA 4D9RE 2EDDA 4FXKB 1DFBL 4HS8H 1EJOH 3QIBA 1JE6A 1EUUA 3IDIB 2FATH 3GSRB 5ID1A 2CMRH 1INDL 1JNHA 4FFZH 3B2UC 1LDPL 5TDOA 3VCLA 2DN7A 1OAXH 1QFUL 2WSKA 4K3HA 4P4KD 1VADA 3V4UH 4HIJA 5IVXB 3GHBH 1FLRH 2Z8RA 1U3JA 1U8LB 2WBKA 3IKKA 4GS7B 1IGFL 4PJCA 4UBDC 5ID0A 4PRPD 2LQRA 4O58H 2QSCH 1U41A 1NCDL 4Q2ZB 1HHGB 4HV8A 5D72L 1A6PA 3EHBC 4LNRA 3VI4F 3UPRB 1IBGL 5FM8A 4BZYA 2X1OA 3CIQA 3OG6B 1MY7A 3MMEA 2UWEA 5KS9F 4KJPC 5DC4B 5HHOE 1P9MC 3RAJH 3T08A 1CFTB 4JKPL 1FIEA 1OARH 1X5FA 3IJHA 4G8EA 1BFVL 4HULB 4O4YH 5BV7H 2BSRA 2JCCF 3QCVH 5DJ2B 2WIMA 1RHFA 3CDGA 1CL7H 2R1XB 2VDNH 1N6UA 3R8QA 1NUNB 4ZS7H 3T8XB 2A6KA 1S9VB 1NGQH 3B2UD 3OQ3B 3V2AR 4OUUA 1CGTA 3W9EA 1UH2A 2BP3A 3ZL4L 1BFSA 3BZFB 4M61B 4HG4K 1SM3H 4EIGB 4QRRD 1ACZA 1CDIA 4M1DH 2OSLA 4K9EL 3U7YL 4PJEF 4UBDD 2FNBA 5B38B 5EU3A 3KPNA 4DUXA 1MCIA 4ZUUB 3EHBD 5FUCE 4P4KA 1CR9H 5KVFL 5C70A 4CDHA 1KIQA 3GMPA 4KJPD 3MZGB 4ZFGH 5GS0L 3AVEA 3DROA 2GJ6B 1PDKA 4PRPA 5D7LD 4HWNA 1U8HA 4OCNC 4AM0B 5BZDA 4HKJB 5CGYC 4GLRH 3JV0A 4W6YB 2RFXA 3TH3T 3QFDB 5DF0A 3HAEH 5C7XL 5I8OH 4U6VH 3BAEL 4TSCH 2DI8A 1U8QB 4WEUD 1PYWA 3RU8L 2Q6WB 4PLKD 3VRJA 2D9CA 1QFWI 1UKTA 4M3KB 4K8RH 4UIMB 4K71C 1WWCA 4KHTL 5E8PA 5KSBE 4NZDA 1FNSH 3WNNA 5GGQL 1NEUA 1KCSH 2Y7QA 4OT1L 1P7HL 4FXLA 8CGTA 1JWSA 5AAWA 1LO4L 2FO4B 4LHUB 1AGEA 2C26A 3D25B 1H5BC 4DGIL 2G5RA 2VR9A 1SHMA 4LVNC 3KLAB 3HC4H 3QDGE 4QRRA 3LRSB 1KXTB 1NBZA 3UYRH 5FUOL 3I3EA 4I77L 1DVFB 2HLAA 3CFCL 4AY0A 1MLCA 3X3FL 1RZKH 4BH8B 4XC3L 3DUUB 4L8BA 3WXWH 1CD0A 3K2UH 4M48H 3MRLB 5CGYD 4KZDH 3IFNH 1ZA6B 1VEMA 3D6GA 4EOWL 2GT9A 1FVCA 3VXME 2BVTA 5HGBA 4F33A 1P9MA 3GSQB 2AQ1A 3O6LH 4OZ4A 5D7LA 4JFFE 5MEPB 1ZVHA 1FFOB 3WUWG 4PIRF 3VXRD 1G7MA 2XZCH 1ORQA 5BVPL 3CZJA 3BPOC 3L3DA 5F1NA 1HWHB 1QUNA 3BGMA 1NAMB 1VESA 2GAZB 4YO0B 3WLBA 3VXNA 1UT9A 4X6DA 1DLHB 3GSXB 4N8CH 2VKXA 5E6IB 3LS4H 3ESUF 3BIKA 1FNGB 1RV6X 1N26A 3TFKC 2JB6A 5CBEA 5GJTH 5GSRA 4N8VG 5E8OB 1NCCL 3PWLA 2VUOA 2ZP0T 1F4YH 4LIQE 1FYTD 3O0RL 3PP4H 1SY6L 2B5IB 4YHYC 1S7TB 2OR7A 1EXUB 4LLVA 3OMZA 2WUBH 1VFBB 1CFSA 2N56A 2EYRA 5E5MB 5JW4Q 3HTLX 5DSCB 2XRAL 1UZ8B 3DTXA 4G8IB 3UYPA 1G9NC 2Q20A 4FQJL 4FABH 3DI3B 5CEZE 3TWCL 1J86A 2NNAA 3BP4B 1F11A 4B0MM 5E2JA 2QQQA 3RY6C 1D5XA 4RAVB 5DJZA 2OJZH 3GMOB 4R6UA 5GHWL 3CAFA 3FOMB 1AGCA 5HI3C 4OIIL 5E08H 3ZDYE 2V6HA 1T1YB 1MFCL 2OTUB 1O7VA 3UTOA 3WFHA 2X7LA 5CZXC 3TFKD 3QDME 3FT4A 4YGVB 1N64H 3VXRA 1WV7T 2NY5L 5EZLA 2P24A 5KOMC 3HZYA 3RX7A 4GXUN 1P7KA 5INDA 3O3DB 4LK4A 2G2RB 5IF0B 3ULVL 3LEVH 2B1AL 3QEHA 2FO1A 1J1OH 4X6EA 5I15H 1P1ZB 2DJSA 4HFUL 4P0DA 1G7QB 4XPTL 2OTWA 5DUBA 5I74C 1TVDA 3LSOB 3VFUB 1H5BA 1FYTA 3L3GA 3QA3B 4NJAL 3V9FA 4QGYA 1YEEL 1T21A 2BVQB 4HGWB 1C16B 1QQDB 3BP7A 3RL2B 1MHEA 1AIFA 3CFKA 1R6VA 2BSED 4PRDA 4H88H 3QG6B 1AO7E 3DMMB 3FTGA 5K9JL 5HI3D 1PKQA 5ESQA 2XY2A 3GSVB 2EDWA 3NIGF 1OAUL 1S5HB 4QHNA 1TPXC 3P0VH 1R3LB 3LDBC 1CCZA 1K2DB 1OWWA 4AK1A 3QXAB 4KVCH 3BRFA 3GZKA 4HX1A 4E9LA 5H8DA 3HNVL 1HH6A 3X14B 2F53D 3VWJC 5IP4A 3A67H 2PYFB 1PD6A 1T7ZA 1I1AB 4P9HL 3HAEG 1IMHC 2UWEF 1MCDA 6CGTA 5HDQH 1C5CH 2VSCA 4OV5B 1BJMA 1FHGA 5AYUL 2XY1A 5CEZL 1G9ML 2A83B 4RMTA 3W11C 3ZTNH 4Y1AD 3UTTB 3BISA 4Q6IB 2AK4D 3NIDF 1C12A 2QQKH 2ZCKH 3OWEA 4XAKD 4ZOCA 2HN7A 5EORL 4GKZA 2APTA 5ISZD 1AFVL 3MOBH 3RWEB 5ITBH 3X13B 3ZT7A 4FQIH 3SDDB 3CSYB 1JIBA 3F7VB 4YHMH 3MNWB 3KYKH 4J3VA 1CE6A 4U6XB 3HI1A 4I0PB 4P2RD 4NO2A 2GY7B 3QZWG 4OB5H 4PS4L 1DN0A 3RY6A 1PW3A 5JTWA 3OGCA 4ZUTB 5I1JL 1E6JH 2NW3A 3QHFL 3L3OA 3LPGA 5DWUH 3VWJD 3LY6A 4HKXB 1PFCA 1RJYB 2HAZA 4LDOB 3RUGF 1TXKA 3MJ9H 4X4MA 5ICZA 3LN4B 3GNML 1X5HA 2PCPA 3DXAD 3IFLH 2CRMA 2ITCA 1KXQE 4LHJB 3RGVB 1QLEL 1JHLL 3O2WL 5LQBH 2F53A 5DQJA 1MWAH 2DIAA 1XGUA 3W11D 1G0DA 1ZWIA 3TO2A 1OP5H 3GGWA 4RZCA 4MDJB 2B4CH 4P5KB 5T3ZH 3SE9L 5I1CL 1IVLA 2YUWA 3G5ZB 1DBBL 3G9VA 3SJVE 1JPFB 4F37K 3VG0L 3F7PC 2AXFA 3IDNA 1P7QD 4IHOB 4HXAL 3C5JA 5ITFA 3MLRH 4K2UH 1H3XA 5L7XL 3MJ8B 1DBMH 5EU7E 4EIZC 1I9RL 4Y1AA 5JQ6H 4PJ5D 2AK4A 2ICES 5IW6B 4X8XA 2P45B 5FKPA 5ISZA 5TPWH 5HYJB 3AU1B 4O51A 2IGFH 3FRUB 4Z7UA 4AJ0A 5DFVC 1ZT1A 4JHAL 4P2RA 3M17B 4N0UB 4P2OB 3WO3B 4HPYH 2L7UA 1T89C 1HILB 2HVKB 3K1KC 5J11B 1KIPA 5FOBA 1UB6A 3H7BB 4NZTL 1W72A 4TPRL 1P84K 5ICXA 4OJFH 1AI1H 3TT1L 4ZDHA 1K4DA 3VWJA 4HS3A 5JUEH 5E56A 1M7IB 2Q3AA 4M62H 1FPTL 4MD4B 1AC6A 3LN5A 3BPLB 2PW2B 5IKCB 3S5LG 2CDGB 2NCMA 2EKJA 5C71A 2VUYA 4Y4KB 3OKLA 4OAWB 3ULUL 3DXAA 3ULSA 4TUKL 1P6AB 5EO9A 4TUOA 2Y25A 3GKWH 1VEOA 5FHAL 4PRHB 5FYLE 5E8NA 1GGBH 1K8IA 1X5KA 4WTXA 2VLJE 1MCPL 2V9QA 4X6DF 3FQTB 3DV4B 2V5YA 4WI6A 3QULB 3H0TA 1P7QA 1VACB 1WWWX 3VFWB 5DFVD 1NL0H 4Z7WE 5IB3A 3EDDA 1TQBB 3O2DA 4NHUA 4PJ5A 3LB6C 3D85B 4YDVB 5E2UH 4KPHH 4XZUB 3IXAB 5DJYA 5TE4H 4ZTOH 3TA3C 2BOCB 3P0YH 4G3YH 4S1SL 4LPWA 4OIBA 2VXQH 3ZKMC 4X7EC 2X70B 2E6JA 2DM4A 43C9B 1RI8A 3ZKSD 2OK0L 5E99H 4S0TD 4CGTA 4QHLA 2WQRA 5JR1H 1PLGH 2OR9L 4I3RL 1WCBB 1Q9KA 1FJ1A 5DLML 3TT3H 5DUML 5EBGA 1OP9A 3BH8A 2GTZA 3HPLA 4BQ6A 3Q5OA 2CPCA 3V52H 2VDOL 4UILL 1AKJD 5DHXB 4K55A 4O9HH 5L0QC 1A7RL 2HVJA 2W9EH 5IMKA 2DLHA 4LLQB 5I1EL 2QQLL 4F3FB 4APQB 5FCSH 1RHHB 1G6RB 4M5ZH 2XV6B 4P2QD 3ECBB 4OLWL 4C56E 3LB6D 1G6RL 3QO1B 5IBLC 1A3RH 1WFTA 1Q72L 5DJXB 3TA3D 1HDMA 1XCTB 1BX2A 1B0GA 3ZKMD 3OJDB 5CJBA 2R0WL 4D0BA 5DFTA 1O5DT 5F3HA 2DKSA 4WTWA 3VD4A 5I8EB 3MXVL 4KDWA 5IMMA 1FFNA 4MQSB 5HVHC 5TH2A 5CHNA 1T89A 1IEBB 1GZPA 4G7YH 1H9VA 2ICWB 2VLJB 4YQXH 3VGBA 1IQDB 3FRPG 4FQXC 4RWYL 5F88A 3HUJE 3ROLA 1WT5C 3U4EB 3L3KB 1U8PA 1IJ9A 3L7EB 4M7KL 1KACB 3VI3E 3TNMA 4Z7WB 5KJRH 5D4QA 4DN3H 5FFLA 2OXGA 2CKBH 4NNYB 3VMOA 2Q8BL 3D2UD 1J0IA 1DL7L 1AKJA 4NDMA 3WFBL 4YHZL 4L1DA 1MJJB 4UT9H 5EUKB 1S7WA 1SJHA 3L7FA 5IBLD 1KIRA 2EDTA 4QXTA 3L9RB 1NH6A 3DVIA 5GGRA 4NO5B 4XCYA 3H9SB 5F71A 3UXFA 1NMCC 3LV3B 1TZHA 3VFGH 2A9NL 3FQRA 1QSFB 1D5IH 1UB5B 4P2QA 3Q48A 4U4BA 3K8MA 4FQPA 1AQDA 4OZIA 3MCG1 3TA3A 2VZSA 4UDUA 2XQBL 2V7HB 4AEIH 3QUMA 2J6EA 2M26A 2WV3A 3WDJA 3VD3A 2CJUH 2FEEI 4QXUL 4YDLC 3T3ME 1RAMA 2DLTA 4KK6C 4DKDC 5T33L 4FQXD 1GVIA 4JFZH 5AZ2H 5CLTA 3VH8B 1CU4H 4IRSC 5TF0A 3ARFC 2CLRA 1J8KA 2FL5A 1N8ZB 3V0VA 2AQ3A 4RFEA 4C56B 1KPRA 4G8GB 2DQCL 4FG6C 1U95A 4JFYB 3TPKA 5E4EC 1F90H 1KGCD 3UROR 4RWHA 3MRMA 2IAMB 4BJLA 4YE4L 4MCYB 2ZCLL 5EC2A 3TCXA 1JNLH 2V5MA 1JWUA 4N0YL 5KVMC 1RU9L 4X0KA 4D9RD 5J4MA 2WZPD 1Q8MA 4Z0BL 2WM0A 1G1YA 2FGZA 1TZGH 2C3WA 3F8UB 3D2UA 5SWQA 2UVFA 4PY7B 4BKLA 3OKEB 1HZHL 3S36L 2OI9C 3TNNA 3L95A 2YA0A 3MTRA 3UTSE 3WHXB 4I18C 4EJ1C 2YD8A 3FO2A 5CUSL 1EHAA 3U9PH 3WKMH 4TULL 3S88L 1V3JA 2VITB 3L5IA 4I2XE 4JRYE 3DHMA 1Q0XH 4KK6D 3FHQA 4IMKA 1KV3A 2D2OA 2J12B 1A8JH 1M71A 2DQFB 3MLUH 4IRSD 2JKXA 3N85L 3SDYH 3ARFD 5EBLA 1JZ8A 3KJ4C 4Y4FB 1WC7A 2UUDH 5LCVL 4D0CA 1T2XA 2NPLX 3FAWA 4FG6D 4XVTH 4FQXA 3DYPA 2M8XA 4E41B 4DKFH 1WT5A 4WIQA 4H5SA 4Z7UF 5EBMA 3ESVF 2EDHA 3EO9H 5DJAB 3RFZC 3SGDH 4LVOB 4KRPC 1BBDH 3U2SA 1XZ0A 1YEJL 5HHPA 1OLZA 5FXCH 1FIGL 2NXYC 4BZ1H 3BKML 4X6FB 4LPYA 5D2NB 4UDTA 3V4PH 2FJFA 3PNWB 3C2AH 5I1HH 3LKRA 1C5BH 2E9IA 4GAYA 1QKZL 3JV6B 2CK2A 1DEDA 1Q9OA 5ENWA 1KPUA 4JPKL 2V7NA 4GBXC 1R5VB 1YDPA 1YPZB 5E9DE 2GITB 4LCWD 4L9LB 2R2CA 4QT5B 4W6WB 4PGCA 1ZLVK 4F7PA 3HCVA 2UYLB 5TE6H 4OD2A 2FJGB 5EZOL 2R0ZH 4ODVH 2FEDC 4IRSA 5DJ6B 3MJGX 4N9GA 2IALB 3ARFA 2IQ9H 4KRPD 2EO1A 1U8KA 4G9DB 5HGGS 4ZFOB 5IJVA 2NXYD 3OHXA 1CE1H 2Y23A 3PABA 4OCLC 5H94B 2BRQA 4YDIH 4ZFOL 3KHOA 4Y16C 3OKNA 4NUGL 2LAAA 4I2XB 4TRPH 4JJ5A 4K94L 2DQHL 5HHNB 1EFXB 3DUHA 4GH7B 4HS6B 4BA8A 1I9IL 2YRZA 5JHLL 2DQUH 4GBXD 2H6PB 2H26A 4I18A 3FFDA 1S7RB 4MMXC 5D2LA 4ONGL 1RZFH 3CNKA 3SGJC 3RHWK 4X4XB 3QDGD 4GAGH 4L4VE 5GS2H 5E94B 2Z91B 3S9DB 4XRCB 1HSBB 4U0QB 5GRJH 3W81A 4NKIH 3HKFA 4XWGH 1U0QA 2VLLB 4X7TB 3KYNB 3MRFB 2ED9A 1ITCA 4UI2A 2FEDD 3BT2H 4RSVA 1BOGA 4G6JL 1A9EB 2XYCA 4JVUA 4GQ9H 4LCWA 4A6YA 5F7LB 2XQYG 4FMFA 2X9YA 4NZRL 3VXMD 4QRTB 3BZEA 4YBQC 5F93C 1MFEL 3QXTA 4YHOH 5HHVL 5IK3B 1OAQL 1JK8A 1GH7A 3WSQH 5F44A 4JFFD 2FIKA 3P11H 4WEBL 1S9WB 4Y16D 2ORBH 5EUOA 4FXGA 4QTHB 3WNLA 1QTYT 1N6QL 1BAFH 3QUYC 5HHXH 3BMVA 2HJKA 5E9DB 2D03L 3KPRB 1ZLWH 1VPOH 4YHPA 2FD6H 3OV6A 2I60L 3VFNA 5EA0H 1GAFL 2W92A 5HYEA 1RD6A 4FP8L 5IB2A 3UTPE 4P5TB 1NFDA 5MP6L 1DTUA 5FM4A 5KSBA 3NBNA 4JN1H 1E4XH 5E5UB 1S7QA 4H1LH 5ADOH 4P3CL 1MCOH 1LO3H 2H8PA 4MWFA 2ZOKB 2ZWLT 4LGPB 5I76B 4D3CL 3MRDA 4GBXA 4U1GC 5DD3H 1FFQA 4BELD 1H0DB 3DURA 2YEZB 1XMWA 1DBAH 4XCCL 1IC4H 4ODHH 4JM2F 3QDGA 1QD0A 2O61B 5F7NC 4PJFA 5C0FA 1ZANL 5KN5B 4U1SA 1KTLA 1FGNH 3IDMB 3PV6A 4YBQD 3FOLA 1S7UA 1BJ1J 1N2RA 3HE7B 3MNVB 2WIIA 1MCRA 4DKEL 5CILH 4EI5B 5DMKB 1MCHA 3K4ZA 5SWSE 2R8SH 3MUJA 3VXMA 1MF2L 4OZIF 2RCSH 1CFNB 4WU7B 1EHXA 3DHJA 3QUYD 4LCCB 2ARJB 4RISL 1UWXH 4P59H 4JFFA 3VRLE 3CLEL 4M4PA 1E4WH 2CDEA 2VERN 4OCSL