4LQ3A

Crystal structure of human norovirus rna-dependent rna-polymerase bound to the inhibitor ppnds
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
505
structure length
495
Chain Sequence
GTYCGAPILGPGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFTQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEGGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYKYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFKISINEPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGMDYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Naphthalene-sulfonate inhibitors of human norovirus RNA-dependent RNA-polymerase.
pubmed doi rcsb
source organism Norovirus
molecule tags Viral protein/replication inhibitor/rna
molecule keywords RNA-dependent RNA-polymerase
total genus 145
structure length 495
sequence length 505
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 4lq3A02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4lq3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lq3A03
3JYTB 1XR6A 4KSEB 2J6TA 3KK3B 5KFLA 1ZTWA 5KFTA 4MK7A 4K4SA 3C6TB 1IKYB 5KFKA 5KFFA 2C22A 2D3ZA 4PQUB 4NLPA 3JYTA 2UVUA 2OPPB 3PJXA 2R8IA 1RT7A 4J9QA 3PW5A 2AGPA 3MTKA 2AWZA 1HNVB 2CJQA 5C24A 4TY8B 1EETB 2B5JA 4ID5B 4Q44A 4I7FA 1D0EA 5EWFA 1I6JA 1CSJA 1REVA 3JSMA 2ATLA 5J2QB 1N6QA 4IFYB 2VG6A 1ZETA 4YQWA 2BR0A 4ED0A 3OHBA 2C28A 2RF2A 3DM2B 2AX0A 1HQUB 2JC1A 3N6LA 3DI6B 1HPZB 4RW6A 2W7OA 5D3GB 3DRPA 3DDKA 1EP4B 2BRLA 2B43A 3KMSA 4MKBA 3H40A 2RDJA 3RAXA 2HMIB 5F8GA 2I5JB 3C6UB 4ED3A 5DG9A 3OHAA 4EBEA 2J6SA 1C0TA 3H98A 5F8MA 3DI6A 1C2PA 1HMVA 4OL8A 3KJVB 2BE2B 1TVRB 3UPFA 3OLBA 2OPQB 2R2SA 1S9EB 5EWEA 5DG7A 1S1XB 4Q8FA 1S9GB 4F4XA 4B3OB 3MEEB 4DL5A 1N6QB 2FVCA 4RW7B 4ZHRB 3DLKA 3KLEA 4FS1A 5F8HA 3ITHB 4NLDA 3T5JA 5HP1B 3RAQA 2UVVA 2W9CA 1IKYA 3QGHA 4IRCA 3IG1B 3M8QB 2XC9A 2AGQA 1TL1B 2WOMA 3DOLA 4ZVHA 1N56A 4RNHA 4FBUA 4RU9A 3KOAA 4H54A 2R8HA 2OPSA 1HNVA 1BQMB 4IG3B 3MFHA 4WE1B 2WK4A 4NLUA 4NLWA 3KK1A 3M8QA 5J1EB 4O3QA 1XR7A 4M94A 1TKXA 2D3UA 1JLGB 4ICLA 2YKNA 4DL6A 3FFIA 3H4DA 4LQ9A 4HYKA 4NRUA 3PR4A 2OPRB 1S6PB 2QE5A 4IDKB 3CJ4A 4JV0A 1JKHA 3ISND 2WONB 4IR9A 4O3OA 4ED7A 1S9EA 1Z4UA 5KFAA 2AGOA 4WFYA 2DPIA 1VRUA 1S9GA 2IJNA 4YR2A 1HMVB 4URSA 3TAMB 5DGAA 1NNDA 5KT2A 4DL3A 4RUCA 1SH0A 4Y2CA 2IBKA 2IM0A 1LW2B 4NLQA 1JLFA 4DEZA 3M9OB 3V4IA 4ECSA 3V81A 4ZP8A 4KFBB 3I0SA 4URQU 3FQKA 1R0AA 4I2QA 4MFBB 1EP4A 3QZ8A 4TYAA 3MR2A 3M8PA 4NZ0A 1VRUB 2F8EX 2WCXA 1DLOA 5CYMB 4ZVEA 3BJYA 3GILA 2FJWA 4ED1A 2FLNA 2C2EA 1XR5A 5DLFA 5T14A 1JLEA 3E01A 3HVTB 4IFYA 1SV5A 4ZPDA 4G1QA 1S6QB 2YNGA 5J2PB 4LSLB 1HYSA 1HNIA 1FK9B 3GIMA 3GIIA 2YNFA 3FFIB 4F4WA 3MECA 1DTQA 3G6XA 3KLFA 2HNZA 2ASLA 2BQRA 1IKVB 5FDLB 2V4RA 5KFWA 3DYAB 1EETA 2HNYA 4G3IA 4TY8A 1HNIB 2YNIB 2V4QA 3RBEA 4KBIA 4LSLA 1RAJA 2IAJB 4J9SA 5KFSA 4ZPBA 1UWBA 2ZD1B 4ECTA 5C42B 3PZPA 5J2MA 4RW4A 1T94A 5KT7A 2R2UA 4WXWA 2FVRA 2FJXA 4WYLA 3I0RA 2HNDB 1TL3B 5HLFA 3D5MA 4QWCA 3RBDA 4J9RA 1S1UA 3DLGB 3FRZA 5I3UB 1RYRA 4RNFA 4F50A 2R8GA 4NLRA 5KFDA 3PJWA 1VRTB 2VA3A 2UVRA 4KFBA 3V81B 1S10A 4XO0A 3BQ0A 4EBDA 2JEGA 4EYIB 2UVWA 1RT1A 4R5PB 4MIBA 1U09A 3DOKA 5KFXA 2JEJA 5K14B 2FLPA 2W9BA 4O4RA 3KLGA 4EYHB 2IMWP 3N6MA 3CWJA 1LWCA 3GIJA 4Q0BB 1RT4B 4ZP7A 4IG0B 2C2DA 3QLHA 3H59A 1S0NA 1N5YA 1REVB 2J6UA 2ZE2B 5KT4A 5KG6A 1LW0B 2YKMA 5KT6A 3KK2B 3ISNC 2B5JB 4ID5A 4IQXA 3QO9A 5KFMA 4FS2A 3V6JA 5J1EA 3KK1B 3PHEA 4IRKA 4YR3A 1SH2A 3H5YA 2IM1A 4TN2A 2OPSB 1IKVA 5FDLA 2RKIA 2HNZB 5KG1A 4EO8A 5F9NA 5DQHA 1S1WA 4Q45A 2D7SA 3KLFB 1JLAA 3ICLA 4X2BA 1KLMB 1D1UA 2FVQA 1JX4A 2WB4A 5DG8A 2V9WA 2I1RA 2CKWA 2IAJA 5C25B 5L1JA 1JLCA 1RT3A 3M9MB 1LWFA 2JC0A 1LWEA 1RTIA 2XGQA 3KLVA 4K50A 2RKIB 5KFGA 3IS9B 1KHVA 4I7FB 4Y2AA 4ZVGA 4RZRA 1S1TA 3NBPA 4IR1A 3NAIA 3CJ5A 3DLEA 2OPQA 4RNOA 4TXSA 1FKOA 3H2LA 3MF5A 3QO9B 2I5JA 2V0NA 3C6UA 3LP2A 2B6AB 3MR5A 3G6YA 3H5XA 5KFIA 4K4YA 3I0SB 1R0AB 3MFIA 1HPZA 3KLHA 1WNEA 1C1CA 3DRPB 3GYNA 5DLGA 3V6KA 2BRKA 1T03B 5L9XA 3Q8SB 5KFCA 1J5OB 4PUOB 4J9OA 4R5PA 3BQ2A 3SFUA 5F8LA 3H5UA 2XWYA 3BSCA 3PW7A 4PWDB 1C1BB 3KMQA 1S9FA 5KFPA 4DL7A 2HWIA 2JEIA 1RTHA 4RW8A 1SUQB 1RTDA 1FKOB 3T5KA 1SH3A 2XCAA 1S1UB 4QW9A 5L1LA 2B6AA 4IH6A 5L1KA 3DLGA 3V6DB 3CVKA 4KE5A 4DG1A 3KHLA 1N4LA 3QGIA 3BSOA 2XI2A 4QPXA 1RT7B 4RW4B 1IKXB 1TKZB 3DMJB 4WYWA 4H4MA 1MMLA 3BGRB 1FKPA 4O4GB 3UDLA 1KLMA 5EWGA 5JUMA 5KG7A 3NGDA 1RA7A 3RB3A 3RB4A 2IA6A 4RUAA 5C42A 4IOBA 4WE1A 4TYBA 3BQ1A 1S48A 3QZ7A 3OSPA 3H5SA 3OSNA 2AU0A 5KFQA 3IN5A 3CJ0A 1S4FA 3FSIA 2BE2A 3BR9A 5KFYA 4U6PA 1IM4A 1NHVA 3DYAA 3OL8A 5KFRA 4ECWA 5KFNA 5KG2A 4F4ZA 5J2PA 4ZHRA 4GC7A 2YNHA 4NLGA 3MEGB 3E51A 1FK9A 5JXSA 1JLEB 2W9BB 5KFJA 4J9NA 4IH5A 2YNGB 4RW6B 3VQSA 5EUHA 4Q0BA 3T5LA 3HVTA 1T03A 2AX1A 3G86A 4ZP9A 1BQNB 3HHKA 3LP0B 2RF2B 3DM2A 4PUOA 2WHOA 4FBTA 3MEDA 3OL7A 3FQLA 1C0UB 1NHUA 3V4IB 3OL9A 2YNHB 5I42A 3QIPB 3DRSA 1VRTA 5F8NA 2ILZA 4ZVFA 3DLEB 3PW4A 1TKTA 3LP0A 2ZKUA 5KG3A 4QWDA 4HKQA 2HNDA 4XPEA 1HQUA 5KFUA 2GIRA 4JV2A 1JLQB 2BQ3A 3T5HA 4MIAA 3CJ3A 4NLVA 1JLCB 3TAMA 4I2PB 5L1IA 1JLBB 1QUVA 4K4ZA 1RTIB 3M9NB 1JIHA 3NMAA 5KFOA 3I5BA 3JSMB 3BSNA 1FKPB 3G6VA 1IKXA 1TKZA 2HNYB 4O4GA 4LSNA 4KHRA 4TY9A 3RB0A 1BQMA 4IG3A 4MH8A 1S97A 4ECZA 1S1VB 4QWEA 5C24B 5J2NB 4WZMA 4K4XA 1MU2A 3GIKA 4ECRA 4NLTA 5EDWA 1TL1A 3DOLB 4H4OB 2ASDA 1OS5A 2R8KA 3QLHB 3UQSA 3ITHA 4IH7A 4LSNB 1N5YB 4G1QB 3EPIA 4GC6A 4KO0B 4KV8A 4ZMMA 3KK2A 4ZPCA 3IG1A 2XCPA 3KLGB 4IRDA 1DTTA 4EEYA 2UUTA 3Q8QB 2R8JA 3KK3A 5F8IA 1RT4A 4IG0A 4DG1B 4IKAA 3LAMA 3KHRA 3UR0A 1TVRA 2VG7A 1HQEA 3RB6A 4I2PA 4TLRA 3KJVA 3PW2A 4ECUA 4URGA 3V6HA 2QV6A 1T05A 4MFBA 1RTDB 1RA6A 4K4VA 1RT2A 4RW9B 3M8PB 4NRTA 3I5AA 4KKOA 3LP1A 4O44B 1C0UA 1RT5B 3Q8PB 4ECXA 1TQLA 4NCGB 3QIPA 4Q43A 5D3GA 1RDRA 4J9KA 1TL3A 2EC0A 1T05B 2IJFA 3I0RB 3IGVA 1J5OA 4K4TA 4YMEA 4NLSA 3OL6A 5HLFB 3IRXB 4K4UA 4ZP6A 1JXLA 5KG0A 5CYQA 4MKAA 2E9ZA 3MEGA 2XI3A 1RT3B 5DQGA 4Q8EA 2W8LA 1DTTB 1JLGA 1KHWA 3OLAA 3HKWA 3BREA 2OPRA 3IGNA 3TQ1A 2DPJA 5HROB 3CJ2A 4KHMA 3LP2B 1TV6B 3T1AA 1JLAB 4YR0A 3PR5B 3EPGA 1N48A 2VA2A 3EZUA 3KHGA 3KLIA 2AQ4A 4F4YA 3NKYA 2JEFA 3MECB 2D41A 2XGPA 4JV1A 2YNFB 1YVFA 2WOMB 5J2NA 2JLEA 4R0EA 1LWEB 4MK8A 4O3PA 4NYZA 4YP3A 1TV6A 4J9MA 3C6TA 5DQIA 5KFZA 5HROA 3DMJA 4H4MB 3QIDA 2ZE2A 1S0MA 1HYSB 4PQUA 4DL4A 4B3OA 3CDUA 1QAJA 4M95A 3DLKB 3KLEB 1JLQA 3D28A 5CYQB 3MEEA 1DLOB 1JLBA 2ILYA 2FJVA 3SFGA 1GX6A 3CDWA 3DOKB 1S1XA 3DRRA 5CYMA 3GV5B 3NAHA 4WFXA 4ECYA 4TQSA 1SUQA 2RDIA 4J9PA 1TKTB 2HMIA 1S49A 4ECQA 1RYSA 4O3RA 1RT2B 3LANA 4KAIA 1RT5A 5KFVA 3GQCA 3LP1B 3CIZA 4O44A 5I42B 4WFZA 1K1SA 1LWCB 4RW9A 2R2RA 1LW2A 1IKWA 4RNNA 1QE1A 2ASJA 4ED6A 3DRRB 2W7PA 1JKHB 1RTJA 4NLOA 4PWDA 1S6PA 3CDEA 4IDKA 4MK9A 4KO0A 4KV8B 4Y34A 5KFBA 2WONA 1T3NA 4WZQA 2YKNB 3CO9A 4QW8A 2W8KA 5J2MB 4RNMA 4ED2A 3MR6A 1K1QA 1UWBB 2ZD1A 5KFHA 2W9AA 4O3SA 4ECVA 2ALZA 2IM2A 2HAIA 4H4OA 3N6NA 5F9LA 4JUZA 2E9TA 1HARA 5KT3A 3KNAA 1MU2B 4WXOA 3TVKA 3KLIB 4QWAA 3BSAA 4LQ3A 2IC3B 2E9RX 1S1VA 2HWHA 1LWFB 3GV7B 1DTQB 2GIQA 4TQRA 1RT6A 5C25A 3IS9A 1ZTTA 4RW7A 2OPPA 3BGRA 3MR3A 2WRMA 3Q8RB 2W9CB 4Y3CA 2OH2A 2R2TA 2C2RA 5HP1A 1S6QA 2GC8A 1SV5B 2YNIA 4NLYA 1S1WB 1W25A 3LALA 4KB7A 3E01B 5KFEA 4J9LA 3PW0A 1S0OA 4U7CA 1QAIA 1RT6B 1TP7A 2IM3A 1C0TB 2IC3A 4DL2A 3V6DA 2VG5A 5HBMB 3DRSB 4ED8A 3HVAA 2BQUA 3LAKA 3T19A 4NCGA 4IFVA 4EO6A 5KT5A 1RTHB 2O5DA 4KKOB 3HVWA 1C1BA 1BQNA 1LW0A 2YKMB 4RW8B 3I5CA 2BANB 4R8UB 5KG5A 4XPCA 3SI8A 3IRXA 2FVSA 2UUWA 3MEDB 3KHHA 5KG4A 3QYYA 1QE1B 4O3NA 2VG7B 3NL0A 5F8JA 1IKWB 1RTJB 5K14A 3KLHB 2WTFA 5J2QA 1C1CB 5DGBA 1RT1B 4IFVB 4I2QB 4EBCA 3PVXA 2BANA 2VG6B 4R8UA 4NLXA 3GV8B 2FVPA 3FDSA 1GX5A 1JLFB 5I3UA 3H4BA 2FLLA 4ICLB 2VG5B 1TKXB 5HBMA 4QWBA 4K4WA 3NBPB 1S1TB 5C5JA 4ZPAA 3QGGA 1HQEB
chains in the Genus database with same CATH superfamily
3JYTB 1XR6A 2CPYA 2K8GA 2FQQB 4KSEB 4NZ6A 4V1Ak 4DL0C 3US5A 3KK3B 4B9UA 3D1QA 4LVNP 1ZTWA 3CDAA 4DR4F 1U2FA 1IBKF 4ZDNA 4MK7A 3R9LA 1A0OB 3BPSP 3C6TB 4LBHA 1IKYB 1HBOB 4DWIA 2RSQA 2DHGA 2D3ZA 1RWOB 1M5KC 4ATNA 3GFHA 3JYTA 5FJ4A 3PJXA 3PM9A 4CLUA 3GJRB 2GCFA 4NL5A 4DMZA 5HATA 5C24A 4TY8B 4Z2XA 1FFWB 1DBDA 4LREA 1B64A 2QN6B 4ID5B 5E5NA 4M5JA 5B09A 2VOOA 5EWFA 3GYGA 1I6JA 2ATLA 2NZCA 4ELVA 3Q2SC 2Q6CA 4FVMA 1NSKL 2JZ5A 5E41A 2LQBA 3R1LA 4FXEA 3PYGA 4UUXA 4U67Q 2BR0A 4MMOA 2E5JA 1FJGF 2QT7A 1D9FA 3DM2B 2VJVA 1EHWA 1PC5A 4DR5F 2LVWA 3ZTOA 3KG4A 2QIFA 2OEKA 2L48A 2N3LA 5BXIA 4X66F 4F67A 3S6EA 3GG1A 1OHNA 3BPDA 1ZS6A 4I1TA 5D3GB 1VQKS 3CCQS 2ZOFA 2CJXB 2MKCA 2J0QD 4PRFA 4D8JA 1WD6A 2LU1A 3EM1A 2KVIA 1P1LA 2AIRB 1YK9A 1CJUA 3MCMA 4KIAA 2FDNA 2L3MA 5AXMA 1RKIA 2PMZD 2GAHC 3H98A 3W9IA 4P7VA 3MUTP 3P96A 3G6ES 4BS2A 1C2PA 1TU0B 2FPHX 4LFBF 2HEKA 1R89A 3T1HJ 1K8AT 4MIWA 5B0DA 3FMTA 5F41A 3BN4A 2OPQB 1NO8A 1S9EB 4USIA 2N3OA 3PIOQ 3MMCA 4PWWA 2ZM6F 3LF0A 1G4CA 1S9GB 4U7UK 3OV7A 4WKRA 3MD3A 2GVDB 5IT9U 1N6QB 4F0KA 2EG2A 2W9CA 3M8QB 1CVJA 3J7YU 3P4UB 1VC5A 3KJVB 2NXJA 2CQCA 4CLSA 3KOAA 4DQSA 3T6JA 1NPRA 3N28A 2R8HA 3FBFA 1HNVA 1BHNA 1BQMB 3G82B 3M6XA 3PNIA 3CMES 4NLUA 3P45B 2UUCF 2GVZB 2RUSA 4ICLA 4NI2B 3ONQA 4P75A 1APSA 2V68A 1U8WA 4LQ9A 3BBBA 1YSJA 2OPRB 4IDKB 4AL7A 3C16A 1CJKB 3QSIA 4K59A 2M8HA 2M88A 3ISND 4M5MA 1T9WA 2F63A 4O3OA 3RRKA 3VHQA 2DPIA 4AE5A 3UE2A 1YG0A 1F0XA 2BACA 2CIMA 4C4WA 2IJNA 3NNAA 3D66A 1R8BA 2ZEJA 2GGPB 3NO7A 1HWIA 3GJTB 2HQFA 4URSA 2HQ3A 4P73A 3TAMB 2AEFA 1YJVA 2R7RA 4DL3A 2FY1A 4AL5A 1HBUA 5GAEI 2KT5A 3BBCA 1FO1A 1JLFA 1TR0A 2LP4A 2VH7A 2LMIA 3MHYA 4L75A 1JXEA 3MAHA 3TJ9A 4KFBB 5CQGA 3W65A 5A8KB 1FXDA 4I2QA 3LWLA 1GXLA 1KONA 1HNWF 3QZ8A 4TYAA 4IOCQ 1YJRA 4NWBA 3KXDA 4NZ0A 2WCXA 2ZVIA 2VODA 2CDRB 3CGIA 3PCOB 5DDOC 5CYMB 1JK9B 5DJBA 4U8YA 1Q4RA 1YIJS 2FLNA 1UEUA 2B4UA 5DLFA 1JLEA 1WF0A 1CULA 4ZPDA 2YNGA 3LTOA 5HQMA 3L09A 5KOXA 1HYSA 3WX4A 4ZITA 3GIIA 4F4WA 1N34F 3MECA 2EW9A 3PIPQ 4UOCA 4B9MA 3CJKB 1TUWA 2V8GA 2BQRA 4PG6A 4QOTA 5KFWA 1MSWD 2P6TA 4JI4J 4B3RF 4G3IA 3UN3A 2V4QA 1JNRB 3VVTA 2E1MC 5LSOA 2E5IA 3EWGA 4KBIA 3FBEA 3NP5A 5KFSA 1NJWA 1SKRA 1UWBA 1RP5A 1NBEB 1OO0B 1R6VA 1WEXA 1X60A 4I6AA 3BR8A 5LT5A 2COLA 2E1CA 2XULA 3OVBA 3MOJB 2NZ4A 4WXWA 1AZSA 5DZ6A 1N88A 4PR6A 1M5PC 2P9EA 1TL3B 3FRYA 5HLFA 2Z58B 1URRA 3CIMA 4G1IA 1NZAA 3RBDA 1S1UA 5G0RA 5BR8F 4KJIA 2J7KA 1E6VB 4NPOA 5DDQC 4CI0B 1AFJA 4C9DA 3FUYA 3SYZA 4DFKA 1RWKB 2PSZA 4F50A 1TK8A 5IT9Y 1SVDA 2F4VF 3IWXA 5D6GA 5IM0B 2XTCA 2FHKA 2OUGA 3CD0A 1IN0A 1NUEA 3ZZTA 2F40A 3V81B 4KRWA 1S10A 4EYIB 2UVWA 2DD8S 1E6VA 1H73A 1V3ZA 2JDJA 1U4BA 4AYBD 1ZA1B 2C42A 2FJBB 4HI1A 1OY8A 5K14B 1CG2A 5RUBA 2AN7A 3S7RA 4AAIA 2IMWP 3OFHA 1S76D 3WC2A 1KVKA 1RT4B 4IG0B 1S0NA 5U47A 2C2DA 1AW0A 3PHTA 3PX4A 4C8NA 1RHUB 3CCTA 4UUWA 4UW2A 2E44A 3MMAA 4J7CA 3G5OA 1Q78A 4IQXA 4QIWD 4ES2A 1GTHA 5KFMA 2DNOA 3OBIA 3SV4A 3V6JA 5J1EA 3H8YA 4DQPA 3G8QA 1MWQA 4YR3A 3K5LA 1WJ9A 4DV2F 4RU2A 1IKVA 4R0JA 2RKIA 5FDLA 1HQ2A 2BKPA 4EO8A 2ZM6J 2AJQA 1S72S 2AY0A 5MAOA 3VZIA 3MPUB 4AQYF 2DGOA 3NWGA 3AD7C 5DG8A 2V9WA 1UETA 2Y1RI 5K8MA 4Q2MA 3TUJC 1JLCA 1RISA 5L1JA 1RT3A 3NRBA 5ETLA 2JC0A 5J1PA 2N7CA 2YPZA 2XLJA 3M9MB 3KLVA 4HEA9 4K50A 1X4EA 3WZ0A 3L3CA 4CLYA 4DR5J 3T1YJ 1Z2LA 1WEYA 4ZVGA 1WELA 3MMJA 2CQIA 2DR6A 3NBPA 3NAIA 3CJ5A 3FEZA 1FKOA 1QSYA 2RMLA 1SJ1A 2XSJA 3QO9B 2HQIA 2I5JA 3LP2A 4X4QA 3OW2R 2M70A 4C3KA 5H9FJ 2J0XA 1QD1A 3H5XA 3HXMA 4YB6A 2ADBA 4GKKF 4FYYB 3R2CJ 3BGOP 4K4YA 3HF5A 4UZCA 4FN5A 2HHVA 4WK3A 3HSGA 4HTIA 3W2WB 2ZH7A 1RAFB 3RW7A 1B7FA 3NXZA 4DR6F 1Q79A 4ZJQA 1T9YA 3DRPB 3GYNA 3V6KA 2R7VA 1J5OB 2DH9A 4JI8F 3RRGA 3GJQB 3SFUA 4GVBB 4ZIWA 1NSAA 4L72B 2YKPA 2HSEB 2XMKA 3BSCA 3BKFA 3MCSA 3KJFB 1C1BB 3VW4A 2ALYB 2BNZA 3H2UB 3ZZZA 4EI2A 4QYZK 4JYAJ 3MEKA 2QA2A 2M8DB 3HT0A 4C8LA 1H3DA 4CQ1A 3GG0A 2AHOB 3R5AA 1RTHA 2ZJPQ 1VQLS 1SUQB 3IXQA 4I64A 3CUNA 2HQGA 2VONA 1N33F 3OR2A 3T5KA 2ZZNA 1ICEB 1RXOB 2GMHA 3T6BA 4FF4A 3K58A 2JFKA 3HD2A 2D9OA 3VAFA 2I2YA 2K7JA 2EG1A 1S7HA 2CNLB 2ZVSA 2LA6A 2XI2A 3GB0A 1CJKA 1RT7B 3QGIA 3ILLA 3AX5A 2BW7A 3DMJB 4H4MA 2W2PP 1MMLA 4FXVA 1FKPA 2A1BA 2GIFA 1K44A 3HLUA 1KLMA 3TVYA 4P2FA 2XEXA 3UN2A 1T3OA 5JUMA 3FSXA 5KG7A 3RB3A 1U1MA 2IA6A 5E33A 3VZHA 1WG4A 4IOBA 1O0PA 2VB6A 1XC9A 4A46A 2A3JA 3OSPA 1NB7A 2AU0A 2AJ2A 4LRCA 3A3NB 2Z2MA 5HSPA 1REGX 1VK3A 5KFQA 1F9FA 3FSIA 1T11A 4DF8A 1FFGB 2M4MA 2MPUA 3DYAA 5KFRA 1ZA2B 2XO6A 4FP9A 3K5NA 4ZS6A 4ECWA 2IRUA 3UNYA 4V19X 3SBMA 2HVHA 4PXBA 3A3OB 5J2PA 1AFIA 2ZWPA 2XYHB 4OYZA 3MEGB 2ZOGA 1MMDA 1UJ4A 4YB1P 1YJUA 3HHLC 4X4VA 2BA3A 1SKWA 4Q0BA 4OHXA 5ETKA 3T5LA 4YEAA 5HMYA 3QRQA 1CJTB 2KG0A 1J5EJ 2VL1A 2OO4A 1H38A 1FJCA 1M0SA 3M32B 3ZFVA 1UP1A 4PUOA 1MWZA 3PYFA 4WFBQ 1S77D 4DOZA 1YRTA 2Y3YA 1H2TZ 4WJBA 3EXCX 3Q22A 5I42A 5JMNA 1SQFA 1VRTA 3F73A 2ILZA 2KRBA 1RHJB 1TKTA 2OSQA 5KG3A 1OYEA 1UA1A 3AJ1A 4WBFA 2DGXA 2K5JA 5ETSA 5F3ZA 9ATCB 1IQZA 1X8DA 3QT8A 4N41A 3CJ3A 4NLVA 1JLCB 5L1IA 1JLBB 3OVSA 1RTIB 1NJZA 1PYSB 2UU9J 3U1MA 1VQPS 1HBOA 3JSMB 2XY6A 3SCLE 1RWVB 2CPXA 4I67A 1TKZA 2HNYB 3GWCA 2BYCA 3UCGA 4IG3A 4ETZA 1IBMJ 3J80U 1S97A 1HBNB 3CJRA 5C24B 5FLXY 4KGVB 4QWEA 1ZZFA 2BUNA 4ZLLA 4XTTA 3GIKA 4F2RA 5GAHI 4NLTA 5EDWA 4ECRA 3JB9k 4CNYA 2FYXA 4H4OB 4F04B 2VQEJ 4NXMJ 1KBRA 1BWVA 1V3SA 3O8WA 4DS5A 2R8KA 2EKYA 3UQSA 3PY8A 2IPOB 4LSNB 1PGZA 1NZ8A 4HHJA 2XTJP 3EPIA 2WBRA 4GC6A 2EI5A 3IG1A 3KLGB 4EFAC 3D6HB 1HD0A 4DSEA 4EEYA 2CQ0A 3KK3A 4LF7F 2QMWA 1M5HA 4NASA 2IVFB 4DG1B 1N5VA 3M8RA 2DHXA 1KQGB 3MM9A 3M2UA 2K6LA 4TLRA 3KJVA 3HJFA 4ECUA 2BJ7A 1GH8A 3K59A 3CULA 1LQ9A 3HM9A 5A8WA 3EUNA 1SJ3P 1XMQJ 2LXUA 4DV1J 2HHHF 3K8VA 5A76A 4DS4A 5CYJA 2OIHA 4ANCA 1C0UA 2Y0SD 3CC4S 3NS5A 2F8MA 2CZ9A 2KELA 2X51A 3MR7A 3QIPA 4Q43A 1WG5A 2UXBJ 5DDPC 1TL3A 4TU8A 2PDAA 2M52A 4M5GA 2QA4S 4F02A 2DGTA 2WSEC 4M1KA 3UDEA 3RR8A 2BM1A 2CJYB 4C48A 4WIQA 4JI7F 1JB0C 2IHR1 4ZP6A 1WDTA 2MJUA 3C19A 4MKAA 2E9ZA 1X31C 3LUYA 3MEGA 3KUHA 5CYQA 3KDOA 5L9NA 3JTPA 4O0NA 2HPUA 4E98A 5DQGA 3G8SA 1X5OA 1JLGA 1R8HA 3HKWA 3IGNA 2OPRA 3NG8A 5F0WA 4DXLA 3TQ1A 2DPJA 3MXHP 3GYXB 4AT1B 1TV6B 3RGIA 2B56A 2GO8A 4YR0A 3EPGA 2M0GB 2VA2A 1X7VA 2GA7A 1RLCL 4UY85 1R27B 3KLIA 4F4YA 4QJVA 2B9YA 2JEFA 4EMDA 4BC7A 4K5RA 1GXTA 1YVFA 2WOMB 3EX7B 4MK8A 4O3PA 4NYZA 2G0JA 3K5MA 1FX2A 1TV6A 3FCHA 3M6VA 1YJNS 4OI1A 2ADLA 2HLUA 4EK2A 3EJMA 4LRAA 1S0MA 1EQ0A 4B3OA 2XYGB 2BEFA 5ADZA 4M95A 1SC4B 3CB4A 5ETNA 2B4PA 2V2ZA 3TARA 1ACMB 2V5HG 1F9EB 1FVQA 2JOQA 4G6VB 2W7AA 3NNCA 2KU7A 3DLJA 3CDWA 2CPDA 1S1XA 4M5DA 4B02A 1GXUA 3CC7S 3TR5A 2VKZG 4B9VA 2W01A 4OMFG 4K0KF 1SUQA 1HW8A 2VBYA 1YITS 1FNXH 1RT2B 4OV1A 2J9CA 1CJUB 1PAEX 1WHYA 5KFVA 3GQCA 2C2KB 2U1AA 3N79A 4M5HA 3NNEA 4DX8H 2HHXA 1LFPA 4J5OA 4QCLA 1FE0A 2FUG9 4PXCA 3DRRB 4LBPA 4NE9C 4RJVA 2QLJB 3W9JA 4ED6A 1UCNA 3AAWB 2HLTA 4IDKA 1WC4A 3C8YA 4MK9A 1VQNS 4Y34A 1RACB 4WZQA 2YWGA 3TZYA 3F56A 4Y00A 5J2MB 4FF3A 2ZD1A 1KR4A 4HHHA 2ALZA 1YQHA 2HAIA 4H4OA 3N6NA 2DRBA 4YY3J 2F5GA 1YDLA 5D0HA 1HARA 1QAXA 2FB0A 2XNRA 5B0EA 1Q5VA 3TVKA 1O8BA 1UL3A 2R7TA 4OFZA 3PEJA 2HS3A 1JXVA 1DTQB 1CC7A 4LRDA 2A0FB 2HBYB 3MM5A 4IO9Q 1ZTTA 3DCAA 3BGRA 1RKJA 2WRMA 1OQ6A 5ETOA 3T3FA 3LW5C 4Y3CA 4OZ5A 5HP1A 1KC8T 2GC8A 2HURA 3H0PA 4NLYA 1RHKB 4Q7AA 4F4AA 4J9LA 2NQPA 2WSFC 3MUMP 3B8HA 1YJWS 3V4IA 3TJ8A 2GS8A 1NH8A 1RLDA 2CADA 2HFVA 2VD3A 3BBFA 4RR5A 5HMZA 4DL2A 3MMBA 3DRSB 3V6DA 2XB2D 3Q2TC 4G65A 3TEGA 1FJ7A 2OP5A 3NWRA 3JAMY 2J8AA 3LAKA 4W4MA 1FDBA 2VPZB 1HHQA 4IFVA 4EO6A 5KT5A 2Y1IA 4KKOB 2YX1A 1EZZB 1LW0A 1Q16B 2BANB 2BKNA 2FZCB 1JX4A 3IRXA 2FVSA 2HBQB 1H7XA 2XNQA 4ZCIA 2N4DA 2RNEA 5KG4A 3QYYA 2H4WB 2K9IA 4PPDA 1X4CA 2GPEA 3VTIA 3NGUA 5K14A 3KLHB 5L8RC 2V94A 5GMKa 2Q43A 4KGXB 4Y65A 3O5TB 4MKVA 4IFVB 4FXWA 2CQBA 2FC8A 1S6OA 2XM3A 1D9DA 3SDEB 1FDNA 1RJJA 4DV5F 1TKDA 4DV6J 3SEOA 2JLFA 4RBTA 2GJFA 3ZC4A 2C2ZB 3UD5A 3M2UB 4OYPA 2Q3PA 1Q86T 1PJ5A 1R8AA 4JI7J 4CO2A 4OJ3A 3OTBA 4RKUC 2ZWOA 3R2DJ 1NK8A 1S5ZA 4K4SA 5EGYA 1Y5NB 2K1RB 3LGHA 5KFKA 2J7UA 4X4TA 2MZSA 4ER8A 3C2PA 2UVUA 4PQUB 2KOEA 2MEWA 2KKEA 1RT7A 3OTDA 4ZVTB 3PW5A 2MZJA 3DFEA 3MTKA 1NJYA 4LF9F 2Q6BA 2CJQA 3IA0A 2NSBA 2H9ZA 3SSQA 4DR7J 2A2DA 2DXDA 1EETB 3BEGB 3TW0A 3EGVA 2B5JA 3W2VB 5CABA 4EZ9A 1H2VZ 1D0EA 2K29A 3CPWR 2HHHJ 1Y9OA 1CSJA 1Y10A 2H54B 2KB2A 3CSKA 3ZZ0A 3JSMA 4LBIA 4HDGA 1U26A 1CULB 3HFKA 4W98A 4YQWA 1ZETA 4X84A 4ED0A 2UXBF 2JXGA 3CD7A 1X0PA 1DHMA 4ZVUB 4A8QA 4LRVA 3SCKE 2VBXA 4GVBA 1KLNA 3N6LA 3DI6B 1M5OC 2DEIA 3PRDA 4WF9Q 2DNPA 2F9DA 3KYLA 2BRLA 2VFSA 1G6BA 2B43A 4OX8A 3TOQA 5A8KA 1FNOA 2HAFA 2RDJA 3AH6A 5F8GA 3C6UB 1SIWA 3T41A 3QGPA 1SC3B 2PT0A 3NOGA 4PXEA 1TL5A 4ZJOA 3TYTA 2J6SA 3J7AN 1UFWA 3QJLA 5F8MA 5G4DA 4DCPB 1HMVA 2WVCA 1U6ZA 2BE2B 3H25A 2RHQB 2R2SA 4DV4F 4Q8FA 5DG7A 5EWEA 1S1XB 3E8OA 4JB8B 4HVZA 4USVA 4BCAA 3T1HF 1N33J 3TA0A 4F4XA 4B3OB 4NMLA 1WTBA 3MEEB 1KSPA 2CWKA 3C15B 3KDNA 2MZRA 2NREA 4B3TJ 2UVVA 5F8HA 2NS1B 3ITHB 3BF4A 1V9OA 3T5JA 2F4VJ 4U95A 3AOAA 2E5GA 1TL1B 3DOLA 3BKUA 4GO7X 3BGFA 4ZVHA 1N56A 1N34J 1F5AA 4B3MF 2QO3A 1LKZA 4OI3A 4P9SA 4U8VA 4RU9A 1IR1A 3GE9A 4OX9J 1U2CA 1H72C 1C4CA 1ZM2A 2GX8A 2L9NA 1HIYA 2PA3A 2OPSA 1D3WA 1S7IA 3VF0B 2KZMA 3MFHA 2AV5A 2CPEA 1MG7A 3DN9A 3I87A 4WE1B 4AXJA 4NLWA 3EDRB 3WIUA 3KTQA 2EXUA 1XR7A 2G9OA 4USTA 3IBWA 1JLGB 4O3QA 3RU0A 1IUJA 2YKNA 3RBXA 2CDQA 3FFIA 2SXLA 3CW2C 2V63A 3MDFA 3CJSA 3O44A 3TZWA 4HYKA 3RR7A 4JV0A 4C98A 1NDPA 4IR9A 4JI6J 1S9EA 4WFYA 2YTCA 5CXTA 1ZH5A 5GADU 3QRRA 2V4JA 1S9GA 1Y11A 1HMVB 3UD3P 4ME7E 2OD6A 5KT2A 3GMGA 3VWSA 1SH0A 4Y2CA 3EXYA 3G4SS 2IM0A 3GU0A 3MGJA 3EGNA 1A9NB 4PEOA 4ECSA 2DNGA 4ZP8A 7FDRA 3I0SA 5K20B 2ZBIA 2B4OA 4MFBB 3VQTA 3TUPA 1H98A 4NX9A 3CEDA 3UW1A 4FYDA 1URNA 2DTJA 3M6UA 1Q5YA 1S99A 1VRUB 2G2OA 4QR2A 2BSQE 4ZVEA 2M5YA 2VPYB 4M63A 2XZWA 3FSYA 2FD2A 5AXKA 2L41A 3E01A 4O23A 2F65A 1LNQA 2HRYA 4C0HA 4LFCF 4G1QA 1S6QB 4LSLB 1F2GA 3FT7A 1RZMA 1SPBP 2JNJA 1HNIA 1DY3A 4PG5A 1AUDA 2XHCA 2YWFA 2YNFA 3FCWA 3FFIB 1N32J 3J7A1 1KVJA 3M8YA 3R27A 1R3NA 3IRWP 4ZCMA 1DTQA 2D69A 2YBVA 3DC2A 2QZ8A 2ZNZA 3KLFA 4KTQA 2HNZA 4ZVQB 1KOOA 3NOCA 5HANA 1NSPA 1RADB 3DYAB 2YXLA 2ASLA 1IBLJ 1L5UA 2KXNB 2E7XA 4TY8A 4C8ZA 1HNIB 2YNIB 2G0IA 5LSLA 4LSLA 1RAJA 2C3PA 4DQQA 2FHJA 3OR1A 2ZD1B 2M9KA 1U1NA 3PZPA 1T94A 4JI1J 3D7SB 3X1LB 3CCLS 3PFEA 3N5FA 2FJXA 3I0RA 4JV5F 3M7VA 1P94A 3VEAA 3DHWC 5IWAJ 3BDPA 4LF8J 3F0NA 1UA0A 3QOQA 1T8EA 5IT4A 5I3UB 3G87A 4RNFA 2DXEA 4NLRA 2W25A 5KFDA 3W63A 4TNOA 1VRTB 2OD4A 4P52A 1XWLA 1B3TA 1SIWB 4KFBA 4B3SJ 3L9ZA 4ZLPA 3HMJG 2LFVA 3PRVA 4HACA 4JI5F 1ZYQA 1BMQB 3P5BP 2P5VA 5ETQA 4R5PB 2RS2A 1U09A 4Y2IA 3PX0A 4ALZA 1FRJA 2OGUA 5KFXA 1Q8KA 1FX4A 1NAQA 4A8SA 4J9UE 3VALA 4EYHB 3B78A 2O1PA 3CWJA 4K5SA 2B4VA 3GIJA 3M30B 4Q0BB 1FTCA 5A0YA 5IM0A 1DQAA 3H59A 1YKWA 2KHCA 2GFFA 2GW8A 3FMBA 3HT3A 2J6UA 5KT4A 4PXDA 3LGMA 5KG6A 2YKMA 1G7CB 1VS3A 2I9SA 1QDUB 3ISNC 4DU7A 4LMZA 2L9WA 4ES1A 4R5PA 2DISA 5D4LA 3LPEA 1AXQA 4ED4A 4FS2A 2JVRA 1FWKA 1UKUA 4IRKA 1FCAA 4JI0F 5CCLA 1SH2A 5IZHA 2AD9A 3LP0B 4QU6A 4PQAA 2OPSB 2E29A 2PFFB 4ED3A 3MZIA 4Q45A 3NNHA 4JP8A 4DFJA 1U1LA 1D1UA 1IVZA 2DIVA 1WC0A 3FNNA 4C0OC 2WB4A 5IC6B 1R8PA 2CKWA 3C14A 1K0VA 5C25B 3TX0A 1KRPA 5HO4A 1HHTP 4LSZB 2OKQA 3TQEA 1UPPA 1S1TA 1XBWA 3Q89A 2HG4A 4IR1A 4RNOA 1W2IA 3DLEA 1U49A 2R9LA 1R6YA 4TXSA 4B9LA 3IC1A 3H2LA 2V0NA 4ZOSA 4YDXA 1IBKJ 4FNHA 4ELTA 2QC3A 1WKJA 5KFIA 3BN7A 1VDHA 1ZAWA 3GR1A 5A0YB 3HK2A 2XZ2A 4DDFA 3OJUA 1HPZA 4DR2F 1T9UA 4GO5X 4O4GB 4XDDA 4CO3A 3G8TA 2KKHA 2G4BA 2XMWA 5DLGA 1T03B 4LIRA 1IBMF 2BRKA 1TFWA 5ETVA 4ZLJA 3KLEA 1RCOB 3R8YA 3BQ2A 1WHXA 1J5EF 2AYGA 2VASA 3H5UA 4NEYA 2C3YA 2A2BA 3GCWP 3MTJA 4WP3A 4CLPA 1P27B 3B82A 1OPZA 3PW7A 1WHWA 2V6AA 1HD1A 4A8WA 1NMEB 4K0KJ 5CCMA 1PO6A 3ENVA 3JS9A 2BNWA 1TL7A 4DLGA 2JHEA 3PACA 3SQGA 5A8WB 1FKOB 3UCZP 3EVWA 4OX6A 4USJC 1SH3A 1JNZB 2XCAA 5L1LA 3PYDA 1NK5A 1WOOA 2XS2A 2DRAA 1O5JA 1NKCA 3LOUA 3Q8YA 1WSVA 1RTZA 4KE5A 2Q79A 3ZZOA 4F3QA 3BSOA 4WU2A 4DR3J 4QPXA 3J7Z5 2QTWA 5B0AA 1TKZB 3S8SA 4F4KA 4QIFA 3UDLA 5ITHA 3OR1B 2DB1A 4JI2F 2RU3A 1D8ZA 4LJMA 4DX5A 1VISA 3NGDA 4QYZJ 1RK8A 1FD8A 4NA3A 2LCWA 3RZAA 3MM5B 3BQ1A 3AOBA 2MKJA 3H5SA 1AB8A 1AA1B 1S4FA 2M3DA 2H4YB 1LFWA 2IFXA 3BR9A 4M5IA 4TKTA 1IM4A 1NHVA 5ETMA 3OL8A 1NM2A 4EUVA 3MMAB 4HH1A 4OI0A 1XK8A 2B51A 2C3MA 2N82B 3I82A 5KFNA 4UTGA 3MCOA 1ROFA 1JQGA 3VAGA 4ZHRA 2H5IB 2YNHA 4NLGA 1KFDA 1ULRA 5JXSA 1JJCB 1U0HA 2MLXA 4Z7YA 4J9NA 2E66A 4B9TA 4IH5A 4HHUA 3U1LA 2YNGB 3VV2B 1M1KT 4RW6B 2PEBA 5IWAF 8RUCA 2LECA 4ILLA 4YB5A 4NZ7A 1PARA 2RF2B 5HMWA 4MKYA 1U6FA 3F44A 2JXIA 3HHNB 1GT8A 3MM7B 2EFPA 3OL7A 3FQLA 5THWA 1C0UB 2HHSA 3OL9A 2YNHB 3QT6A 1NK9A 1PBAA 5K5MA 1A7GE 4CO5A 2HZCA 4B3SF 5F8NA 3CNQP 4NA1A 2N7YA 3CMAS 3WX8A 3IWLA 2XZDB 2RRAA 4FNIA 4QWDA 3S01A 3ZNJ1 4HKQA 3UN5A 2I0XA 1HQUA 2EPIA 3W5ZA 2OFHX 3HKZD 5BJRA 1EARA 1GNKA 4MT1A 2GGPA 1AZSB 3TAMA 3L7UA 3GR0A 1D09B 4B3RJ 1QTMA 2ZBCA 1TUVA 3VAIA 4DV0J 5K8OA 3R6GB 3A8IA 3BSNA 3D4JA 4O4GA 3G96A 1QUPA 2CA9A 4DN0A 2GMLA 2KT2A 2R42A 1NH7A 4ECZA 2V34A 4WZMA 1MU2A 3R3TA 3CXCR 1AUSL 1SJQA 1PG5B 1X4AA 5AJ3F 3BDEA 2ASDA 1OS5A 2CZVC 2W1BA 3QLHB 5GAHU 3ITHA 3EZ5A 1FERA 4G1QB 5T41A 1FDDA 4KV8A 3D0IE 3HSZA 4QR0A 3OD2A 3F41A 2XZTB 3ZZPA 2UUTA 4P74A 1F3VA 5F8IA 4X65F 3KHRA 3K5OA 3UR0A 1HQEA 3RB6A 4I2PA 5BYRA 2HK3A 3FJ2A 1Q53A 3GSIA 1NLKL 2CG4A 2DBBA 2QV6A 3TZXA 3V6HA 4MFBA 1RA6A 2NUHA 4HACB 1RT2A 2LEPA 2V50A 4DSLA 3M8PB 3I5AA 1R43A 2HGLA 1LK7A 3HZGA 4OYBA 2VV5A 4CZCA 3OUYB 3LH2S 4U7UD 1HBUB 1N52B 4NCGB 1YRXA 2V1SA 3THPA 1RDRA 3HJVA 2B8QA 4DU8A 4J9KA 5IC4B 2QMXA 2RRNA 4U9RA 3DLBA 1FKAF 2ADCA 5B0BA 1J5OA 2YWWA 3IR5B 1U24A 3HI9A 1X4FA 4ERDA 3TX8A 2NLWA 1UJ5A 2HQCA 5EX0A 3R1HA 1RT3B 1GMWA 3CCES 2FGCA 2DK2A 4C2MA 1G3OA 2J8SA 1PCAA 3C16B 4A8XA 2DR5A 2LLZA 3KKFA 3ZTRA 3ZO7A 3QJPA 1K9MT 2P9GA 2XYPB 3LP2B 2E5LF 1LWXA 3JSBA 1B99A 3TRGA 3ZXWA 1KD1T 2UUAF 3KHGA 1YBAA 5HQ8A 1YBUA 3OQ2A 2J0WA 2XQCA 3QAEA 3A4TA 3L7OA 4ZPVR 2XGPA 1XERA 1FEHA 1I5OB 3GLJA 5FIIA 4E2FB 2BBEA 3K17A 4CH1A 1U1KA 4DR3F 1MN9A 4CLZA 2R7OA 1B0PA 2Z2YB 2R7UA 5DQIA 4JI2J 1Q1KA 4PQUA 3DMJA 3B4DA 3FK4A 4H4MB 1U7LA 4ZCLA 3AY0A 4GKKJ 3B4MA 2F3JA 5JJBA 2XSFA 5CYQB 1DLOB 1RSCA 1JLBA 1UVKA 2ILYA 1VLYA 1SL1A 1VQ6S 3SFGA 2F9JA 2DCUB 1T0TV 2DH7A 3GCXP 3HSJA 3W64A 4ECYA 2P2CB 2RDIA 4J9PA 4JYAF 1S49A 2AF6A 1WHVA 3QT5A 1RYSA 2EC2A 3I4PA 5GADI 1Q82T 3NGKA 1TAQA 4OI2A 4DUYF 3LP1B 4LUBA 5I42B 4EZ6A 2R2RA 3IBFB 2W2QP 1CBKA 1LW2A 2CPJA 3QPIA 1QE1A 4RNNA 2VZ9A 2KI2A 2O3DA 2W7PA 3HSDA 2RD5C 4OYIA 1KEKA 1E6YA 2J7WA 4DR7F 4IOAQ 4NLOA 3DXSX 3A8KA 4PWDA 1FRXA 1NXIA 2NXNA 3R5BA 1WF1A 4KV8B 1XNRF 4HL9A 4OLPA 1T3NA 2R7XA 4QW8A 5LJ3Y 2E5HA 1L3TA 1RBOB 4DV5J 1UWBB 4N8NA 2XO7A 4O3SA 5KTQA 2MSTA 1NB2A 3AQOA 4C3LA 2IBOA 2IVYA 4WWSA 2RE1A 1OY6A 1ZM9A 2AGQA 1Z1ZA 2H5EA 1FEEA 1K0TA 1UTAA 1HWLA 1KQKA 1KNZA 1ARQA 3MI7X 3BSAA 4LQ3A 1HBNA 3GV7B 3BO2A 2BJEA 4EGLA 2KFZA 4XAKA 1B7YB 4TQRA 3SSRA 1WI8A 3NY0A 1SJFA 1JWWA 3IS9A 4RW7A 2OPPA 1KVIA 4DX7A 4A8MP 2C2EA 1VRQC 2OMOA 2QG9B 5SZTA 2OH2A 2CQHA 1S6QA 5K8PA 2YNIA 1W25A 4KYZA 3UD4P 3E01B 3PW0A 1VQMS 1HNZF 1VOMA 3RG6A 1S0OA 3BGUA 3FBBA 1RT6B 2ERRA 1TP7A 3I4HX 3FVYA 2F4FA 2QA1A 1C0TB 3TA1A 2DY1A 2LQ9A 1CQNA 4KC5A 4OYXA 3W66A 3PJ9A 3UI3A 3JQJA 1JMTA 4XK8C 4WFNQ 3KNGA 3W9HA 4KHPJ 4NCGA 4EU0A 3FMWA 4L76A 8AT1B 1QVGR 2RS8A 3SMZA 4B3TF 1WSRA 1XEZA 1RTHB 3GFYA 3I5CA 4R8UB 1WUUA 4QQBA 3BH7B 3G9CA 1WOSA 2UUWA 1UAWA 3KHHA 3GZ7A 3N5BA 5FLXU 1VGYA 1QE1B 2OSRA 1U0SA 4O3NA 1MROA 3NL0A 5F8JA 2VG7B 3OTOJ 3J7ZT 3MWBA 4D3GA 4X4NA 3DRXA 2WW8A 2ZH3A 5J2QA 2QEXS 2B0GA 4DSFA 2QL9B 1FNMA 2VG6B 3CCWA 3GV8B 3FDSA 4CDIA 1TL4A 1JLFB 4DJBA 2CJKA 2FHJD 4LR7A 3AJ2A 4ICLB 2FLLA 3PKMA 2QRRA 3MPVA 4GKJF 1IJFB 2VFRA 4A8FA 2MDAA 2V8PA 1S1TB 3AD9C 5C5JA 4CIOA 4I7FA 1WDDA 1T9VA 2AJFE 2U2FA 3AXKA 2Q66A 3PXGa 4CLLA 1OM2A 1BGXT 2RILA 3EZOA 4DHVA 1TUGB 4RL1A 1DJ0A 1GMVA 3N01A 2HFOA 3BKTA 4BDPA 4LIWA 5KFFA 3DNCA 3C14B 3TAPA 3I6PA 3T9ZA 3CCRS 5LXRA 4IQMA 3DGPB 3PEHA 3QFHA 4FF2A 1OY9A 2E1AA 1UVMA 2AGPA 1OSDA 2AWZA 2ZFHA 1HNVB 2DRDA 4OZ2A 5AT1B 4C8YA 4N7TA 4P10A 4ID8A 3POTA 2MKSA 4ZKAA 4PYAA 4ILMA 2MQNA 3OXFA 4Y2KA 3QJJA 3IO1A 1ZAXA 2XY5A 4Q44A 3JXOA 5AXNA 1IWAA 1BDVA 2H5JB 1NU4A 2NPIA 1VI7A 1REVA 1XMQF 5LSRA 2CNNB 2LXFA 5J2QB 1DAXA 2ABYA 2HIYA 2X1GA 2KN4A 2NXUA 4NCBA 4IFYB 2VG6A 4CCHA 1SC6A 1YJ9S 1N36F 3P5TL 2EK1A 2NXCA 3OHBA 2RF2A 1SCJB 2C28A 5CH7B 4DSIA 4YN3B 1W7WA 2CPZA 3W8PA 1PSDA 2JC1A 1TZ0A 1IBLF 1HPZB 1M1HA 2YPYA 2W7OA 2L08A 3DRPA 3DDKA 1EP4B 4RPFA 1Q7LB 3KMSA 2MQQA 2P6SA 3H40A 2HRTA 2I8EA 2XSJB 2K7KA 1GEHA 2BA9A 1P6TA 4PG7A 1EKRA 4WP9A 1C0TA 3HPOA 2YH1A 4LF7J 2R7WA 5I3QA 3DI6A 2W2MP 2ZITA 2GZOA 5DZ7A 4ZN3A 2Y1LB 3QAUA 2IYGA 5H1SV 3OLBA 2LQ8A 2LQJA 2GAGC 4ENOA 5KT3A 1GTEA 1NRKA 2OI2A 3IM8A 3K7RA 3Q23A 2VC0A 3K2YA 1B4SA 2MSSA 3I56S 2H3AA 2FVCA 4RW7B 2EEYA 3DLKA 1X5TA 4OHWA 5ETTA 2IA0A 5I4MA 2DHHA 5LOQA 2K1RA 3IG1B 3WQPA 3Q8VA 4I0WA 2XC9A 2WOMA 1RI7A 3AODA 5CAAA 7FD1A 1XJWB 2FHMA 5CZXA 4X4PA 5J1NA 1RWPB 1AROP 4CT8A 2KG1A 4H54A 1U25A 1NLAA 2QLWA 3KUEA 3L4BC 3I32A 4IG3B 4Z7CA 1V3RA 2AW0A 2OTLS 3HFVA 1FVSA 3LWMA 4LF5F 2QLFB 3M8QA 5J1EB 5KOWA 2D3UA 2ZNYA 3EYZA 2ZKTA 3QNWB 4P72A 4YUDA 4YHHF 4MJWA 1ITPA 4ETXA 3PR4A 2BJ9A 1WEZA 4FPIA 2BKOA 3ZNUA 1S6PB 1YRUA 4CLKA 3CJ4A 2Y1JA 3K0JA 1KQSR 2PMHA 3DRYA 1HNWJ 1JKHA 2MKYA 1AYEA 2Z30B 2DNRA 5KFAA 1VQ7S 2UXCJ 3CO0P 2QA4G 2GHVC 1P8GA 1S6UA 4H4KA 3CJQA 2QFJA 4R25A 4RUCA 2IBKA 2KDOA 3D6MB 5IXUA 2UUCJ 1XIQA 2QSWA 4ZPTR 1LW2B 4NLQA 2EBGA 3MCNA 5IT0A 2V8VA 3Q86A 3V81A 3PDNA 2VHGA 3MM8B 2Z2LA 4URQU 1PJ7A 3VAKA 1R0AA 2UUBF 3MR2A 3NGRA 4PABA 1SQEA 1XQIA 1F5CA 2F8EX 4TVAB 2OHDA 1U6BA 3BJYA 1OIAA 3PFOA 4CM2A 2PGCA 2FJWA 1XR5A 5T14A 1U0HB 3HVTB 2WVDA 1SV5A 2QX0A 3RAMA 3U27A 3GJSB 1HR0J 2WVBA 3PKYA 2YX4A 4FDFA 5J2PB 1CLFA 2MJNA 1Q0NA 1RB0A 2D9PA 3NCRA 2BDPA 3G6XA 3SZ2A 2IVMA 1VQ5S 3PRBA 2V4RA 1UMJA 1DZ5A 2AJ1A 3FZ2A 3PTWA 3QWUA 4HT5A 2HNYA 3DOMA 4CNZA 3JTOA 4UT4A 3TO8A 4USHA 1M5SA 2IAJB 4HI2A 4Y6IA 4N56A 5D4NA 4J9SA 2R7SA 2Q2KA 3DDIA 4OZJA 5C42B 5J2MA 4L73A 2MKKA 5KT7A 2V2VA 1PIEA 1KP6A 1RABB 2J9DA 1VC0A 1VIOA 5B7WA 1PKUA 4WYLA 1IM6A 1X5PA 2J9EA 4NMXA 3NGTA 4YY3F 3CF5Q 5IFMA 1YZ6A 2C3UA 1CEZA 4YS2A 2VBZA 1WC3A 3A12A 3D5MA 2EFGA 2DO4A 3JSRA 2YX7A 3OFGA 4H4KC 4P2SA 5LXYA 4QWCA 5AE1A 4J9RA 2UZAA 2JWNA 1QSLA 4KPYA 3U02A 5B0CA 1HBMA 2VF3A 3AQPA 1RYRA 1Y3JA 2JBVA 1U45A 2VA3A 5BYQA 2VFVA 1SL2A 2UVRA 3IBCB 3QBCA 2KJVA 1UJ6A 4BC9A 2JEGA 1XMOJ 2CFXA 2J5AA 1RCXB 1RT1A 3WIVA 1MW7A 2MLYA 4V19J 4MIBA 4OJHA 7AT1B 1SB6A 2Z4PA 4PKDB 2JEJA 2X1FA 1ELOA 3HDSA 3IWNC 3N6MA 2HS0A 1N5YA 3M6WA 1REVB 2E1RA 3P49B 3ENAA 2B5JB 4KH1B 1GK8A 3TA2A 3IR7A 3M1VA 1FI4A 2HHQA 2EFVA 3Q8UA 4DSKA 2D68A 3KK1B 4KGKA 3PHEA 4M5DB 5E0OA 1CQMA 1H2UX 1VHFA 3G82A 4Q2LA 3W2VA 4TN2A 2AMCB 2BOPA 1PYTA 2CPHA 2XHWA 3W7BA 5DQHA 3A8JA 3D1OA 1VBXA 1DARA 2D7SA 2DNKA 3TVZA 3KLFB 1ZM4A 1JLAA 3R7NB 1KLMB 3CCSS 4RLEA 1TELA 1UEVA 1U1OA 2B9WA 1Y0HA 2HGNA 2CNKB 1I51B 3A8EA 3C15A 1VBYA 2I1RA 2IAJA 4PCQA 4HTJA 2VQFF 1RBLA 1V5VA 3VAMA 1R31A 1WC5A 2KXFA 3IS9B 4I7FB 5LMUJ 4Y2AA 4CLFA 3AB2B 2OEMA 4WTOB 1NPKA 1SC1B 3UDVA 2OPQA 3OVAA 4DPTA 1T7PA 4LFAF 2ROGA 2BJ3A 1H6KX 3C6UA 3DGVA 4GVLA 3MR5A 3R7BB 1U1QA 4AQYJ 5ETPA 4QU7A 3UNGC 2DXFA 4F25A 3TANA 3MM8A 1R0AB 3M2VB 3MFIA 1OWXA 3SDEA 2IRXA 2D3OR 4LF6J 3R7SB 3KLHA 2W2NP 2PI5A 4I56A 4WKYA 3OXLA 2F1FA 2W24A 3GP9A 2XWXA 2B7BB 2W4DA 5KFCA 3Q8SB 1FHTA 3ENQA 4GRSA 2AKWB 1KWMA 5E3PA 5E3QA 2H1YA 5DS7A 2XWYA 2Z2ZA 1YJTA 4B9NA 4PWDB 2K3IA 5AJ3J 1PJ6A 2VDIA 3KMQA 1S9FA 3HHLD 5KFPA 4DL7A 1X4DA 2HHTA 1MWYA 1EIYB 1C4AA 1XN9A 2ZDPA 2JEIA 2V1TA 4YFUA 2KZZA 3I96A 1RTDA 1Y7PA 2HFNA 4ANDA 1IR0A 1Q95G 1S1UB 4QW9A 2B6AA 4KQZA 2XY7A 4IH6A 4PPZA 4CO1A 5H9EK 4X4RA 5L1KA 4C8KA 2AEMA 3V6DB 2HBRB 5D4PA 1N0VC 3Q24A 3HO1A 1N4LA 5D4OA 4C3MA 4DG1A 3KHLA 1ZZNA 3D1HA 3FBCA 1IKXB 4PYDA 3MM6B 4WYWA 2CQ3A 3QRPA 2G1DA 2HS4A 3W61A 2NXEA 3GXQA 1FF2A 4RUAA 2CPFA 3V2UC 2GV1A 3C46A 2ACYA 3R5JB 4P6QA 1OG7A 3QZ7A 2GNKA 4X4SA 1NK0A 4WTYA 1YBTA 3VCDA 2JX2A 1QSSA 2Y0BB 6FD1A 2ZH2A 2NSCA 5KFYA 3VR1A 2PO4A 4ZIVA 2RIJA 5HN0A 2ZHOA 4J37A 4TLQA 5EX3A 1AT1B 1TL7B 3R5GA 2CQ2A 3ETOA 1VQYA 1VBZA 1NJIT 1JJ4A 2PIIA 1KN6A 1N5SA 3KG0A 5KG2A 1X9WA 1MLAA 2OELA 2FTRA 2MQ8A 3M8SA 2ZH9A 1KS2A 2HBZB 3E51A 5E3AA 2IRYA 1YTYA 2FIUA 2QL5B 4QBUA 5HVFA 1SL0A 4X65J 4N5SA 3WDOA 5IQ6A 2WSCC 3CCUS 4LF1A 1T03A 4DZDA 2NR0A 4LR9A 1RWXB 3BYPA 3GFXA 2XTEA 4ZP9A 2CNOB 3CDBA 3HHKA 1F5BA 2DYAA 4X66J 1OQ3A 2WHOA 4FBTA 5AE2A 3ENWA 2X3DA 3VGUA 5M2PA 4Z37A 4O0IA 1KOHA 3IM9A 2CQDA 3G71S 3DRSA 3CJTA 1WKLA 4LF2A 4P7TA 1HI1A 3OXGA 4ZVFA 5B0GA 2CPGA 3UCUP 2CPIA 3M32A 2DGUA 4AL6A 3LP0A 2VDHA 4DV4J 2YH0A 5KFUA 5A2QY 3GPAA 2FJEB 4JV2A 3EVOA 4QYRA 2IYIA 3R6LB 2CUYA 2YKOA 4I2PB 2QGFB 4I6YA 4KGMA 5B0FA 2GHWA 1QUVA 1IBCB 1PILA 1R0CB 2KO1A 3M9NB 4MAKA 3NMAA 1SXLA 2XMUA 2YY3A 5KFOA 3CC2S 2MZ1A 3ELHA 4DN9A 1FKPB 2H3EB 1HWKA 2XTDA 5K9FA 1BQMA 4NI2A 3BO3A 1HW9A 4MH8A 2DITA 1S1VB 4DUZJ 1HLWA 4HV0A 4K4XA 1B28A 2CQPA 2R4FA 2VFUA 3ZTPA 1UVJA 2DR7A 1KFSA 3QMQA 4DPWA 3DGPA 1TL1A 2HVEA 3DOLB 4DBQA 4NYPA 3DXBA 5IQQA 1WG1A 3BGLA 1TK5A 5D8HB 1N5YB 1BXNA 1FE4A 4IH7A 2RBFA 4ZVSB 2M2BA 2VC1A 2QL7B 2MB0B 2JXHA 1SKUB 1M5VC 2NYHA 3HHLA 3KWMA 1H7WA 1VCTA 4MJKA 4LFBJ 8ATCB 4JI5J 3R97A 4F3OA 1MROB 1N0UA 2VG7A 3J81j 5DM7Q 1B01A 1Q81T 1VQ4S 5D0GA 4UZBA 1UUJA 2CVEA 2HHWA 2QMUB 1HA1A 4GMKA 2HRUA 4K4VA 2KM8C 4RW9B 2WVEA 1P9QC 2DGVA 4O44B 2G0CA 1RT5B 4C7QA 4ECXA 1JXLA 1TQLA 1QY7A 2Y9HA 5E3RA 4OI6A 3TUZC 1QVFR 3ZTQA 2RT3A 5FD1A 1S0VA 2RQMA 2EC0A 1T05B 5G0RB 3FC9A 4LF8F 4K4TA 3ETMA 3OL6A 1VK8A 1RAHB 5HLFB 2GMJA 4K4UA 1BD6A 2HW3A 2DVIA 2B7CB 4Y28C 2XI3A 1B70B 2ZH1A 4Q8EA 4KHPF 2VPXB 4I68A 1DTTB 3OLAA 1KHWA 3L7PA 4AUKA 5CHCB 2LEAA 2QLBB 1DQ9A 1LXNA 4B08A 3IMQJ 5HROB 1R0BG 3CJ2A 4KHMA 2VQFJ 2CJBA 1N48A 4OYWA 2YQ1A 2P8IA 3UFCX 1MYLA 5MLCV 1RHRB 3E3XA 2BABA 3P8BB 4JV1A 3J7YI 4D3HA 2JLEA 4R0EA 1WF2A 1LWEB 4F8RA 4I69A 3M9OB 4DFMA 2MZQA 4DUTA 1RAGB 2FC9A 1X9MA 5HL7Q 3ISZA 3W62A 2DIUA 4ILRA 5KFZA 3SQOP 4FPRA 5HROA 2ZE2A 4NA2A 4CH0S 1HYSB 3P6YC 4OZ1A 2CYYA 1NJXA 1CS4B 4F2SA 3DLKB 3H2VE 5H9EJ 4UOHA 1HNZJ 3NMRA 1RHQB 5IV3A 1ZPVA 1OYDA 2RUGA 3GIRA 2DEJA 3RBZA 5GAGI 2FJVA 4C8OA 3DOKB 3DRRA 4DCOB 3NAHA 3ADAC 4I4BA 1UFLA 1TKTB 1YX2A 4CLTA 5JVHQ 4ECQA 3SCJE 4TU7A 1X9SA 3LANA 4JI3J 2IJRA 4KAIA 4A48A 1WTFA 1Y00A 1Z2ZA 3CIZA 4O44A 5T7LB 4WFZA 1K1SA 2ZBRA 2C2MB 2RB7A 1GQEA 1L3KA 4OZ0A 1IKWA 5GAEU 2PI4A 1O6XA 2ASJA 4CH7A 2DGSA 4N47A 1MMNA 1U02A 1JKHB 1RTJA 4WCEQ 1CJTA 2ATCB 1VMBA 1QJHA 3A13A 1S6PA 3CDEA 2DNHA 3IAM9 2F7VA 4PZVA 3WC0A 1W2BR 5KFBA 4DR1J 4DPYA 1F1BB 2A18A 2YKNB 3CO9A 1SKSA 4RNMA 4ED2A 3D0GE 1K1QA 1KQFB 2W9AA 4F36A 1BAZA 5HJXA 3S1TA 4ECVA 2E7WA 2V67A 2ZC4A 1Y5IB 2KL8A 2CRLA 4WPAA 3AX3A 2ZBQA 3JAMU 4C97A 2ASYA 3GSDA 2E9TA 1ZM3A 2B8PA 2DH8A 4JUZA 2H1OE 2JFDA 2OFGX 1HWUA 3DU6A 3EGWB 4WXOA 4ES3A 3KLIB 4BLGA 4DV2J 2KJWA 2E9RX 2IC3B 4CYUA 3H87C 1LWFB 2APOA 2GIQA 9RUBA 2H51B 3H90A 4OZLA 1HI0P 1U47A 1VFJA 3QT7A 3W3SA 1T9XA 3MR3A 3NEKA 2V69A 3Q8RB 2R2TA 1F3FA 5CD4H 4KB7A 4ZCKA 1S1WB 3LALA 3O6QA 3RJMB 4OHYA 4DF4A 4U7CA 2BM0A 4OHVA 1UZHA 2LQ5A 2IM3A 2FHOB 3EGZA 3N9UC 2IC3A 2FLOA 2BX6A 2X7IA 2VG5A 3M2RA 2Y8YA 3HVAA 4RX6A 2A2CA 1FRIA 3T19A 4QIEA 5DO2A 4RW8B 3SXLA 3OUYA 3HVWA 1C1BA 1BQNA 1RHMB 2YKMB 4QIGA 4S0MA 5KG5A 3SI8A 1YHQS 1RU2A 3FZBA 3MEDB 2C2OB 2WVFA 3FEYB 1NDLA 2O01C 1MNEA 1T02A 1DQ8A 4X64F 5BR8J 4ZVOB 3W1YC 1JJHA 4A8YA 1FWLA 1P9YA 2MQLA 1UW4A 1BE4A 2VUGA 3UVJB 2WW4A 4PWUA 4LF5J 1RT1B 3H20A 4ZK7M 4I2QB 1CPZA 4R8UA 2Y8WA 3TZZA 2MY8A 1GX5A 3V4MA 3W2WA 3OJSA 2DHAA 2XS7A 2V8HA 5HBMA 2AP6A 2ZH6A 1PAUB 2H48B 2HFSA 1HBMB 1X4HA 4ZPAA 3QGGA 2AYBA 2C2NA 2F8HA 2EWHA 2BXJA 2J6TA 4IRCA 4ITSA 2MQPA 1MNTA 5KFLA 3LJPA 1BY9A 1WC6A 1SBRA 1X5SA 1EX8A 1NDKA 5KFTA 4OLOA 1FRLA 3BS9A 2BV3A 4IUFA 2C22A 4ED5A 4HT7A 4M5KA 2NYIA 4NLPA 2OPPB 2R8IA 2P9CA 4Q5VA 4J9QA 2BZ2A 2XMAA 3GONA 2QYCA 2RHSB 1R8CA 4P71A 2MHEA 2HIQA 2GQ2A 1FT8A 1ZAVA 4UF4A 2BW2A 2OEJA 2QFIA 2Z0GA 2ZJRQ 2HVIA 3RRHA 2YVSA 3FCVA 5D0EA 5HAOA 4FF1A 1M1GA 1NSQA 1N5QA 3FKBA 4E0DA 5I3PA 1N6QA 3MPYA 2LA4A 4JI3F 2OTJS 1RWMB 2K06A 2MY7A 2CG8A 3JSYA 1WI6A 1FFSB 3QSYB 3VGVA 4OQJA 1A6LA 3NLCA 1HKAA 2AX0A 2XMJA 1HQUB 1RAAB 1RUSA 2JSXA 2UV8A 1H74A 2YKAA 4RW6A 1GFWB 4X4UA 2GQCA 2FY8A 1FRMA 2KFYA 4MKBA 2CQ1A 3CCVS 2HVZA 3RAXA 2HMIB 2I5JB 3WBZA 2C3OA 3MM7A 4DR6J 4OZ3A 3OHAA 3IP0A 3R5DA 4EBEA 1PYOB 1ZOTA 2EKNA 2AZ1A 3MAQA 2E5LJ 4DUZF 3QQCD 3THTA 2HFUA 3B54A 3MD1A 2A6MA 3MMBB 1N54B 1TVRB 3U1NA 3UPFA 4N76A 4J91A 1UFKA 2UXDJ 2LDYA 2MMYA 1BDTA 4DR4J 4YDDB 1WKKA 4DL5A 4FS1A 4KY3A 4ZHRB 4K2JA 2XG8A 4NLDA 3HCXA 5HP1B 3EVMA 4FVCA 3KJQB 3RAQA 1LK5A 1IKYA 3QGHA 4K2XA 1VQOS 3PV8A 3W5YA 1V5IB 3AHPA 2DNLA 2GQQA 1NEEA 4RNHA 3T9NA 1Q8BA 1VLOA 2ZHAA 1IWGA 3IFEA 1D9AA 4X4OA 1NKBA 4FBUA 4RBVA 3MAAA 4CP5A 5C2GA 1S57A 4DV0F 2ZH5A 1VC6A 4WU3A 2I6WA 2WK4A 2CVIA 1WWHA 3KK1A 3OR2B 4M94A 1TKXA 1Y5LB 5BYSA 3PYEA 4DL6A 5C2CA 3H4DA 3RW6A 1N5TA 4NRUA 5D15A 2HK2A 2QE5A 1Q8LA 2VICA 1UVLA 2A10A 2YKQA 1FWPA 1E6YB 1UPMB 2WONB 3UVJA 4B17A 2LDIA 1VQSA 1Z4UA 4CTAB 5L38A 4ED7A 2X1BA 4ZJLA 2AGOA 4X62J 4N77A 1VRUA 2Z57B 3JQKA 4DPOA 4YR2A 1NKEA 2AEJA 4RWWA 1FXLA 1NNDA 2DNMA 2EBEA 2V8DA 2HFZA 4ZPWR 3HHEA 3RTVA 1KTVA 2DNNA 5K8NA 3MPWA 3Q83A 1CC8A 3CE8A 1OJ4A 4DEZA 2ZC3A 2UU9F 1VBKA 1F60B 4DV1F 3FQKA 1P1TA 1T9TA 4A47A 2ZZMA 1EP4A 4CT9A 1RQ0A 5DDRC 1XMOF 1HHSA 3M8PA 3TWZA 4F0MA 2MTLA 1J2VA 4FKYA 4RWXA 3W5XA 2Z8QA 3VAJA 5DGAA 1DLOA 1M90T 1DFDA 1GMWD 4ELUA 3NGSA 5E7OB 3GILA 4ED1A 1QM9A 2QSFA 2DJWA 2J76E 3AT1B 4LFAJ 4FYWB 1I3OB 3DDNA 3EDQB 4IFYA 5E2QA 3TEHB 4CLWA 4CRJA 3BO4A 1U8SA 3CCJS 3CJ8A 1Q7YT 2JLGA 1FK9B 1VJQA 3GIMA 2KT3A 5LL6d 1K73T 3ET6A 4P2XA 4USKA 2UUAJ 2FZKB 3M2RB 2IDEA 2W4CA 4OL8A 4JV5J 1IKVB 2YWEA 3B6BA 5FDLB 3QWPA 1VQ8S 1X93A 3AA9A 4UOFA 3I9ZA 1EETA 2V9KA 1G1XA 3SSSA 2BJ1A 3POTB 1FXRA 2G13A 1J27A 4J90A 4A4JA 3RBEA 4LFCJ 3ET6B 3D68A 4ZPBA 3NCQA 4RUHA 2DO0A 5HVHA 2XBPA 4ECTA 1VQ9S 4RW4A 3O3LA 3TP2A 2R2UA 1DURA 2CZ4A 3CTRA 3MMCB 4HR2A 1X4GA 1L3SA 2CWXA 4NYOA 2FVRA 2J9DE 1TMMA 4OX7A 2CAXA 2HNDB 4RBUA 3W8GA 1XNQJ 4IO1A 5AXLA 2ZUAA 3SQGB 1IXKA 5A8RB 1D8YA 4PAAA 5D0RA 2PMWA 5KAKA 1IRQA 4KT0C 4ZLNA 5IV4A 1W26A 3DLGB 4N8OA 3FRZA 2MQMA 2KFNA 2JH3A 3AWRA 1S59A 2HGMA 4QIVA 1N8RT 2R8GA 4YOEA 1Y4ZB 3PJWA 3NCPA 3CMQA 3M8ZA 3N4WA 2ZHBA 2D1CA 4PG8A 4LF6F 2YWHA 4XO0A 2G2YA 3BQ0A 2MKHA 2IIHA 4EBDA 2A6OA 4W92B 1BQXA 1UWAA 2JVOA 2OMLA 4OI4A 3K57A 3DOKA 4DV3F 4JI0J 4UY8T 2EFOA 2HYIB 3D54A 1YI2S 2FLPA 2W9BA 4O4RA 4HLBA 3KLGA 2C1EB 1NK7A 3I9V9 1LEOA 1LWCA 3TUIC 3ZZRA 3OTCA 5A6PA 4ZP7A 2LEBA 1SJ4P 3QLHA 4UOGA 1FDAA 4C0BA 2DHSA 2ZE2B 4ZVRB 3KK2B 1LW0B 4M5LA 5KT6A 1WACA 2Q1LA 3MUVP 2LU2A 4ID5A 3ZZYA 3A1YG 3QO9A 5HK4A 3U7JA 1NK4A 1FA0A 3MAAB 3UR3C 1QTGA 3H5YA 2IM1A 2RQKA 2W4PA 3HD1A 4F26A 2KH9A 2HNZB 4L74A 5KG1A 1IR2A 3P3DA 1S1WA 4AXIA 5M2UA 1YZ7A 5F9NA 3PO5A 1Q8IA 4RUBA 4JI4F 2HQDA 3ICLA 4X2BA 2B3TB 5GVQA 4OJGA 1TFYA 3BM7A 1I94F 4NXNJ 2FVQA 2GVDA 4K8RA 2PA8D 2EFNA 4KR0B 1LWFA 1LWEA 1RTIA 2XGQA 2RKIB 5KFGA 1UW9A 1KHVA 4XDCA 4RZRA 3CD5A 1LOUA 3D67A 1KDNA 1SJRA 2PN6A 1S12A 3MPDA 3UO0A 4DV7F 3OFEA 2CQGA 3MF5A 1RWWB 2WB1D 2BE7D 3LO3A 4OZNA 2B6AB 5GAGU 3G6YA 2RRBA 3BZQA 2GO9A 2XLIA 4OJ1A 4NOHA 2X1AA 1HFEL 3IR7B 3I0SB 1YLXA 3M1VB 3THVA 2KHDA 4WIIA 1UEKA 1BUXA 3SCIE 1MYKA 1V6HA 4AD6A 1WNEA 1B0VA 1RE1B 2VIHA 2DR9A 1C1CA 5AE3A 2YWKA 4PUOB 3LQVA 1QTNB 5L9XA 2RDDA 4X62F 4J9OA 2PEHA 4YB7A 3J81Y 2V4JB 5F8LA 1RGVA 1BWEA 4DQRA 1H0HB 4BHQA 1RAEB 3M2VA 2ZH8A 3AD8C 2BVZA 3D3BJ 2ZOMA 3R5CA 2HWIA 2D74B 2LYVA 4RW8A 4FKXA 3CCMS 3KFWX 4OYMA 4GKJJ 2YQ0A 2GVZA 2KVQE 4L6V3 4DV6F 3TAQA 3ILIA 5A8RA 2GHPA 2MZTA 1B0TA 3DLGA 2DR8A 1RWNB 1GAOA 3W60A 3CVKA 4M5NA 1NDCA 3AA8A 2HZVA 1MN7A 1L3UA 4QPTA 4EWTA 1NPPA 4RW4B 1FRHA 2XMVA 6AT1B 2J0SD 2XLKA 3BGRB 4LRFA 3M05A 5EWGA 1RA7A 1QAYA 5HJYA 3RB4A 3D6FB 5C42A 3GFZA 2AZ3A 4TYBA 4WE1A 1S48A 2D3O1 4A8KA 3LGNA 3OSNA 1UVNA 4JBCA 3CJ0A 3BB5A 3IN5A 3HFZB 2UXCF 2BE2A 2O66A 2W2OP 3M4XA 4USUA 4U6PA 1O51A 2ZJQQ 1U1RA 1BC6A 3PO4A 1WC1A 6FDRA 5A6WA 4NCAA 5D78A 4CO0A 4F4ZA 5LMNF 1VHIA 4ZN1A 4GC7A 3JTNA 1HI8A 2OAUA 1FK9A 3RUBL 3MURP 1JLEB 1GMUA 2W9BB 5KFJA 1N36J 1S79A 4BWJA 1YGYA 3X3UA 2ROEA 4F3MA 3M30A 3VQSA 5EUHA 1FJEB 2QYGA 3HVTA 2RAQA 1KTQA 2AX1A 2ZUGA 4AFFA 4DFPA 1XNQF 5GMDA 3VEBA 1IJEB 2VBWA 3D0HE 1VIXA 1BQNB 2IDLA 2M7SA 3DM2A 3G86A 3K5PA 3AXMA 1PC4A 3C3LA 3MEDA 1OMSA 1UZDA 1NHUA 3V4IB 5T7LA 1F6TA 3OFFA 2KM8B 4WFAQ 3QIPB 2MGZB 1LV5A 3O2IA 4KH0B 2FZGB 2POKA 3NS6A 1EQMA 3DLEB 2WZ1A 4MTPA 4DPUA 4E8UA 4TU9A 2RU9A 3T1YF 2ZKUA 3PW4A 4DSJA 2DNQA 3G2XA 2E1PA 4UQTA 2HNDA 5IOLA 3VGSA 4XPEA 1JJ2R 2GIRA 3LPYA 2VKRA 4DV3J 1JLQB 2O67A 2BQ3A 5M2RA 1FTRA 2LKZA 2YQ3A 2KYXA 4MIAA 5DG9A 3T5HA 2DGWA 3E2EA 3I31A 3K89A 4K4ZA 2PFDA 1KKHA 2RJZA 2WBMA 1JIHA 2XMTA 1EAYC 1T95A 3I5BA 4K7QA 3CD6S 5HI7A 5GMEA 3DKDA 3G6VA 3DOMB 1IKXA 4LSNA 4KHRA 4TY9A 2FJDB 3RB0A 5DETA 5L46A 2CAJA 1K47A 1VR6A 3EE3A 4F0HA 3CCZA 4C11A 2NUUG 2IY5B 5EN1A 4CYUB 4W90B 1R7IA 5J2NB 4Y2MA 2KYZA 1OSCA 1BLUA 4DCJB 2EVZA 3RYLA 1EB0A 1SQGA 2DCLA 1OPIA 2DNZA 4YHHJ 4DR1F 3TI0A 3C66A 1HR0F 4LF4J 1SIZA 2IMOA 1I94J 4NXNF 2DGQA 3IR6B 4KO0B 2V2QA 1RAOA 2G2ZA 4ZPCA 4FYXB 3L95X 4ZMMA 2MKIA 2XCPA 3KK2A 1DTTA 2EFQA 3Q8QB 4LF9J 2R8JA 1RT4A 4IG0A 2VU5A 4JI6F 4IKAA 3LAMA 3UWTA 3WHIA 1TVRA 4HH0A 4KGZB 3PW2A 4FXDA 5H9FK 2BE9B 4URGA 3IAS9 4DPXA 1HNXJ 3EICA 1HWJA 1T05A 4LR8A 1RTDB 3J80Y 2RQCA 2ZH4A 3AB4B 2GJIA 4NRTA 2B9XA 4KKOA 3LP1A 3Q8PB 4UQGA 2G1HA 5LM7E 2UUBJ 4KPCA 5D3GA 2RVJA 1ARRA 3D9BA 4FZVA 3ZTSA 4OX9F 4B3MJ 1FJGJ 3BYRA 5D77A 3OTEA 2BJ8A 2JL9A 4L3NA 2AYMA 2IJFA 3I0RB 1U48A 4IRDA 2K3KA 3IGVA 2HKEA 2MLZA 4L3KA 2QJ3A 3SIPB 4NLSA 1CS4A 3CT9A 4USMA 4YMEA 2CJ9A 1XMBA 3ILJA 3IRXB 5KG0A 3V5RA 5B08A 2CJAA 3ILOA 1VYAA 1EA4A 2W8LA 5HVGA 2HZAA 1WORA 3BREA 3O1LA 2QLXA 1F9HA 4F7VA 4DZ6A 5JVGQ 4WP8A 1RU1A 3T1AA 2MYFA 3DLLQ 1JLAB 3PR5B 2NCKL 3OT9A 5A2QU 2KXHA 3EZUA 2ROPA 3M8WA 4ANEA 4BBYA 2HWTA 4CWBA 2AQ4A 4JI8J 3NKYA 4DV7J 3MECB 2ZBPA 1X0FA 4B9SA 2D41A 4A8OA 1U2RA 2YNFB 5J2NA 1HNXF 1NCLA 3CJKA 2NPFA 5DM6Q 4DLEA 2B9EA 1RWUA 2DKOB 4YP3A 2VQEF 4NXMF 4LT6A 4J9MA 1U9PA 1X4BA 2CXEA 1XTZA 3C6TA 2K2PA 3MM6A 2AT1B 3QIDA 1HL6A 2VPWB 2PC6A 3AOCA 2ACMA 4C6AA 3HVRA 3CDUA 4DL4A 5IS2A 1QAJA 4JI1F 4HDHA 3KLEB 1JLQA 3D28A 2V2KA 1RBAA 1UVIA 3AFGA 3MEEA 1TTHB 2L9DA 3HZEA 2Z56B 4RO0A 1GX6A 3UDCA 1CJVA 2DNYA 3OPKA 5CYMA 5F3TA 2MQOA 3J81U 4XIUA 3GV5B 4WFXA 5L39A 1PBUA 3H42A 1NHKL 2HVDA 2BOAA 2MHNA 5CA5A 4TQSA 2FJAB 4OHZA 3Q0AA 2HMIA 2N4CA 2PD1A 4O3RA 2LXIA 3H7HB 5LMNJ 2AJ0A 1RT5A 3BH6B 2MGZA 3DU5A 2VJUA 1N32F 2DT9A 1LWCB 4USWA 4RW9A 1TMJA 1FRKA 2MXYA 5LMUF 4DQIA 4G1PA 4DX6A 3HULA 1CJVB 1RAIB 5C7PA 3VAHA 4X64J 2XMMA 3PX6A 4NEZA 3BV8A 5EHHA 2GJ2A 3ULHA 1L3VA 4KO0A 4P2MA 3I55S 4QR1A 1WOPA 1VJWA 1LXJA 1YJ7A 2WONA 3HHLB 3GTYX 4BWMA 2W8KA 1XNRJ 1G2EA 1TAUA 4MYTA 4DUYJ 3MR6A 3HP6A 1DRZA 5KFHA 2OJ3A 2I38A 5ETRA 2IM2A 2CQ4A 5F9LA 4LVOP 4C11B 2ZDOA 3MOZA 5E3CA 5CZVA 4JOUA 3KNAA 4DI6A 1MU2B 5HQLA 4OYAA 4QWAA 1S1VA 4MYUA 2AJ4A 2HWHA 4QZVB 2R7QA 3A3PB 4IYQA 3TNVA 3N0VA 2EK6A 1RT6A 5C25A 3HHDA 2X3GA 5LJ5Y 3EMTA 4J9VA 2WAQD 3AJDA 3D3CJ 1I1GA 2W9CB 5CD4A 2C2RA 3QATA 3JQMA 5F0UA 1F2HA 1SV5B 3FEXB 1ZBTA 1ZPWX 2PE8A 3HX9A 3KUGA 5KFEA 1TK0A 2UP1A 1NK6A 1QAIA 1FESA 3DLHA 3SV3A 3DHXA 5DRKA 4OV6A 4WK1A 3LA0A 2XS5A 2DY9A 5HBMB 3OTOF 4ED8A 4ZA1A 2K1OA 2FGOA 2BQUA 2UXDF 1SI9A 4LF4F 5SUHA 1S4EA 2O5DA 2ZZTA 2RQ4A 3D2WA 3ZZUA 3VVUA 2R3VA 3PG9A 4U96A 4XPCA 4DR2J 4PG4A 3AX2A 2HHPA 3K8WA 4M8LA 2BMBA 4OIXA 4CO4A 3MM9B 2UV8G 1IKWB 1RTJB 2E7VA 2VFTA 3FGVA 4ZVPB 4CTAA 1EJ7L 3NS7B 4C8MA 4LRBA 2WTFA 1C1CB 5DGBA 2RH3A 4EBCA 3PVXA 1Q16A 2BANA 2OLWA 4NLXA 2JRSA 4FYVB 5HMXA 4Y0FA 4OYOA 2FVPA 2KTQA 3D6TB 2HHUA 5I3UA 3H4BA 1IQTA 3KG1A 3VGTA 2VG5B 1TKXB 1YWXA 2BJDA 4K4WA 2KRRA 3QFWA 4QWBA 1U1PA 1QLNA 3TJAA 2VOPA 3NBPB 1EKSA 2AYEA 4CM0A 2H65B 1FD2A 4I6WA 2JJ4D 1Y3KA 1HQEB 3KJNB
chains in the Genus database with same CATH topology
3JYTB 1XR6A 2CPYA 2K8GA 4NZ6A 4KSEB 4DL0C 3US5A 3KK3B 4B9UA 3D1QA 4LVNP 1ZTWA 3CDAA 4DR4F 1U2FA 1IBKF 4ZDNA 4MK7A 3C6TB 1IKYB 1HBOB 4DWIA 2RSQA 2DHGA 2D3ZA 1M5KC 4ATNA 3GFHA 3JYTA 5FJ4A 3PJXA 3PM9A 2GCFA 4NL5A 4DMZA 5C24A 4TY8B 4Z2XA 1DBDA 4ID5B 5E5NA 5B09A 2VOOA 5EWFA 1I6JA 2ATLA 4ELVA 3Q2SC 2Q6CA 4FVMA 2JZ5A 5E41A 2LQBA 3R1LA 4UUXA 4U67Q 2BR0A 4MMOA 2E5JA 1FJGF 2QT7A 1D9FA 3DM2B 1PC5A 4DR5F 2LVWA 3KG4A 2QIFA 2L48A 2N3LA 4X66F 4F67A 3S6EA 3GG1A 1OHNA 4I1TA 5D3GB 1VQKS 3CCQS 2ZOFA 2MKCA 2J0QD 4PRFA 1WD6A 2LU1A 2L41A 2KVIA 1P1LA 5DG9A 5AXMA 4KIAA 2FDNA 2L3MA 1RKIA 2PMZD 4BS2A 3H98A 4LFBF 4P7VA 3MUTP 3P96A 3G6ES 1C2PA 2FPHX 1R89A 1K8AT 4MIWA 5B0DA 2N3OA 5F41A 3BN4A 2OPQB 1NO8A 1S9EB 4USIA 3PIOQ 3MMCA 2ZM6F 3LF0A 4U7UK 1S9GB 4WKRA 3OV7A 3MD3A 1N6QB 2EG2A 2W9CA 3M8QB 1CVJA 3J7YU 1VC5A 2CQCA 4DQSA 3KOAA 3T6JA 3N28A 2R8HA 1HNVA 1BQMB 3M6XA 3CMES 3PNIA 4NLUA 2UUCF 4ICLA 3ONQA 1APSA 4LQ9A 1YSJA 2OPRB 4IDKB 4AL7A 4K59A 2M8HA 2M88A 3ISND 1UVJA 4O3OA 3RRKA 2DPIA 4AE5A 3UE2A 1YG0A 1F0XA 2BACA 2CIMA 4C4WA 2IJNA 3NNAA 1R8BA 4URSA 2GGPB 3NO7A 1HWIA 3TAMB 2R7RA 3Q22A 2HQ3A 4DL3A 5DGAA 1M90T 1YJVA 4ELUA 2FY1A 4AL5A 1HBUA 5GAEI 2KT5A 1FO1A 1JLFA 2VH7A 1TR0A 3MHYA 2LMIA 3M9OB 3SV3A 1JXEA 3MAHA 5A8KB 4KFBB 5CQGA 2R9LA 3V4IA 1FXDA 4I2QA 3LWLA 1GXLA 1KONA 1HNWF 3QZ8A 4TYAA 4IOCQ 1YJRA 4NWBA 4NZ0A 2WCXA 2VODA 3CGIA 5DDOC 5CYMB 1JK9B 5DJBA 1Q4RA