4LQ3A

Crystal structure of human norovirus rna-dependent rna-polymerase bound to the inhibitor ppnds
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
505
structure length
495
Chain Sequence
GTYCGAPILGPGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFTQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEGGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYKYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFKISINEPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGMDYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Naphthalene-sulfonate inhibitors of human norovirus RNA-dependent RNA-polymerase.
pubmed doi rcsb
source organism Norovirus
molecule tags Viral protein/replication inhibitor/rna
molecule keywords RNA-dependent RNA-polymerase
total genus 145
structure length 495
sequence length 505
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 4lq3A02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4lq3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lq3A03
1N48A 3GIIA 4RU9A 1S49A 3FDSA 3EPIA 3IRXB 2RKIB 4NCGB 3DRPB 5DGAA 3BQ1A 2HWIA 3HVAA 4NLRA 4ZP9A 5K14B 3E51A 1QAIA 3ISNC 4EBCA 3OSPA 3C6UB 4K4ZA 5KT2A 3G6VA 2QE5A 3KHRA 5F8HA 1TKXB 3BREA 2BR0A 1HMVA 4ZPBA 3DOLB 4TYAA 3V6HA 5C24B 5KFTA 3QO9A 4RW8A 1ZTWA 4ZHRA 3BSOA 2I5JB 4R8UB 3MEGA 4MKAA 3LALA 4ICLB 3KHGA 3V6DB 2BQRA 3HKWA 2ALZA 1TP7A 4YP3A 2AGQA 4IRKA 1JLCA 3H5XA 5KFHA 1RAJA 1VRUB 3LP0A 3VQSA 3DRRA 1S48A 4IFVA 3MECA 4RW7B 2IM0A 4RNHA 3KLEB 4F50A 3OLAA 5KFMA 4PQUB 1TVRB 4HKQA 2W9CB 4J9OA 4M95A 2OH2A 3I0SA 1HNVA 2V9WA 2WK4A 1JLAB 4I2QA 4GC6A 5J2PB 3PW2A 4NRTA 1JLGA 3UQSA 4RW4B 3Q8PB 1GX6A 1HNIB 3EZUA 1TKXA 2V4RA 1S10A 1JX4A 2FVRA 3M8PA 5HLFB 3DDKA 4K50A 4ZP6A 4JUZA 1XR5A 1K1QA 5EDWA 2R2UA 2C22A 3I0RA 3TAMA 1JLQB 3DOKB 4HYKA 1IKYB 2WOMA 4IDKB 3NBPA 3DYAA 3PW7A 2VA3A 5KT4A 4FS1A 1S97A 5KFLA 2WONA 2XWYA 1C0TB 1DLOB 5EUHA 3V4IB 2HNDA 2ASLA 4O4GB 5JXSA 2J6TA 1S9GB 3KLGA 3CDUA 1S6PB 3FQLA 5KFYA 3CO9A 4I7FB 3KK2A 3KHHA 4WFXA 3RBEA 1RT4B 1S6QA 2BANA 4IQXA 3H5UA 5C42B 4ECYA 3NL0A 1TKZA 3RB3A 2BQ3A 4QWBA 2OPQB 1TL3B 1NHUA 3LP2B 2IAJA 4RW9B 3MEDA 1WNEA 3BR9A 4RNFA 1RT6A 3CJ4A 4H4OA 5EWFA 4Q0BB 2OPPA 3CJ0A 3CJ2A 1EETA 1EP4A 4ECVA 5HLFA 4WFYA 4NLTA 2W8KA 5DG9A 2ZE2B 4ECRA 2DPIA 4K4TA 1N6QA 4O44A 2B6AB 4ZVHA 3TAMB 2R2RA 1TKTA 2F8EX 3DI6B 3M9NB 2IM1A 1LWEA 1QE1A 1RTIA 3HVTB 1IKVB 3PZPA 1J5OA 4O4RA 2IA6A 4R0EA 5KFEA 3UPFA 4Y34A 5KG5A 2AWZA 1SV5B 1RT4A 4TQSA 1R0AA 2ZD1B 3G86A 5KFXA 5KG2A 1IKXB 1TKZB 1HPZB 4J9NA 2YNFA 2D3UA 3MEEB 4ZVEA 4NLSA 1LWFB 3LP2A 1C0UB 2ASJA 4I2PA 2FLLA 4Q8EA 5KFNA 3GIJA 2JEJA 4KO0A 3KMSA 3MEGB 5CYQB 4WZMA 4ED3A 1LW2A 2WHOA 3D5MA 4RNOA 1JLBB 4R5PB 1VRTA 1BQNA 3QLHB 4ZMMA 3KLGB 3BSCA 3BJYA 4K4XA 3CVKA 4KV8A 1GX5A 4YR3A 4ZVFA 2IJFA 4O44B 4J9LA 4Q8FA 4ZVGA 3I5CA 1JLFB 4RUAA 3KLHA 4IG3B 1OS5A 1TL3A 4NCGA 4TQRA 3QGGA 2IC3B 5EWGA 3KJVB 5J2NA 4LSNA 1S0MA 1FK9B 4Q44A 3UR0A 4NLPA 3H5SA 5HP1A 1IKXA 4ED7A 3SFGA 4WYLA 2OPPB 3PW5A 2VA2A 4MH8A 4IH7A 1NHVA 1LWFA 5KFCA 2ATLA 2UVVA 3IG1B 3MFHA 5I42B 3OL7A 4H4MB 2FLPA 5DLFA 2IMWP 3KLVA 4DEZA 3QZ8A 5T14A 3UDLA 4IR9A 3V6JA 3T5HA 3OL6A 3DI6A 1J5OB 5L1JA 3PW4A 3DYAB 2W7OA 2C28A 1HYSA 2B43A 4ECXA 4NLXA 2FVCA 2IM2A 1C1BA 5L9XA 1S6PA 1TV6B 3FQKA 3SI8A 1SUQA 2JEIA 4ECWA 2GIQA 5F8IA 1JLGB 4RW4A 5KT6A 3N6MA 1JLFA 5KG6A 3ISND 2XI3A 4K4YA 5KFRA 4O3QA 1JKHA 3KK1B 2B5JB 1HNVB 4MK9A 3BQ0A 3MR6A 3RB6A 1HNIA 1S0NA 2FLNA 4TLRA 2YKNA 3PW0A 2WCXA 4WE1A 5C25B 5F9LA 5KFFA 5CYQA 3H4DA 3MR3A 5J2MA 2AU0A 3LANA 4KBIA 2AGPA 3BSAA 1ZETA 4J9SA 1JLCB 1D0EA 1JLBA 4R5PA 3GYNA 5HROA 1DLOA 2E9TA 2CJQA 4IFVB 1HARA 3TQ1A 4QW9A 2OPSB 2YNGA 1HQEB 2GIRA 2D3ZA 2ZKUA 3DOKA 3CDWA 4RNMA 2W9CA 1DTQA 1FKPB 4ECTA 1TKTB 4O4GA 1S9GA 3BGRB 5KG7A 2FVSA 3MTKA 1RTHB 5J2NB 2DPJA 3OSNA 4LSNB 4XO0A 3GIMA 4IFYB 3OL9A 1TQLA 2UUWA 1SUQB 3RB0A 5EWEA 2C2EA 2XI2A 5JUMA 4Q0BA 3NAIA 2B5JA 1Z4UA 2HWHA 2V4QA 3NAHA 1RT1A 4U7CA 3I0RB 1RTDB 3PJWA 3BQ2A 1S9EB 3RAXA 3T19A 1N6QB 4H54A 1BQMA 1C2PA 3RBDA 5KFKA 3SFUA 1SH3A 4NRUA 4TY8B 4PUOB 1VRTB 5KG0A 3BSNA 5C5JA 5KFPA 2OPSA 2YNGB 3QYYA 4ED8A 4Y2CA 4MKBA 4DL7A 3HVTA 2ASDA 1FKPA 3V81B 2D41A 1TVRA 3OLBA 3KLHB 2R8KA 2YKNB 4NLOA 3DRSA 5D3GB 1QAJA 4RNNA 2R8JA 2ZD1A 1FK9A 4ICLA 3LAKA 4IRCA 5KFOA 4ID5A 3HVWA 3QGHA 4IG0B 4TN2A 4LSLB 5KFJA 3H98A 4QWDA 4EYHB 4KKOB 5J2QB 5HP1B 4YMEA 3M8QB 1MMLA 2UVRA 1RT1B 3N6NA 1RT3A 4DG1B 4ZP8A 2JEFA 3DM2B 1CSJA 4KV8B 3JYTA 1QE1B 1KLMB 4M94A 1N5YA 3PR5B 2W7PA 1SH0A 1RTHA 3T1AA 3H40A 5KT3A 2J6UA 2AX1A 1RTJA 3E01B 4J9RA 1IM4A 4G1QB 3MEEA 2R8GA 1S6QB 2BANB 5C42A 2IBKA 1RYSA 4DL6A 2IC3A 3KJVA 2OPQA 5KT5A 4NYZA 5KFWA 4ECQA 2IAJB 4RW9A 1T05A 5DQHA 3G6XA 4H4MA 3IGNA 2UVUA 5FDLB 1LW0B 5C25A 1IKYA 1RA7A 2WOMB 3NBPB 4IDKA 4TXSA 4ECZA 4DL5A 1JLEB 4PUOA 3PR4A 4NLGA 3KK3B 2W9BB 2HNDB 5KFQA 4NLYA 3NGDA 2FVPA 3KLIB 5DGBA 2ZE2A 5KG1A 3DM2A 3DLGA 2HMIB 2VG6B 4K4VA 1RA6A 4IG3A 5DQIA 2XCAA 1S1VB 3I5BA 2UUTA 4F4XA 4K4WA 1JKHB 3FSIA 3T5JA 4IH6A 3DRPA 4DL4A 3DLEA 2C2RA 3MEDB 5KG4A 1RT6B 3V6KA 3H2LA 3CIZA 5J1EB 5I3UB 1NNDA 4MK7A 4IKAA 4LQ3A 3NKYA 3TVKA 4ZP7A 5HBMB 3GILA 3MFIA 2J6SA 1RT7A 3Q8RB 5KFUA 2YNHB 3RB4A 1S1TB 2I1RA 4WE1B 2I5JA 1HQUB 2BE2B 4R8UA 3EPGA 4ZPDA 1KLMA 4YQWA 3Q8SB 4ECSA 3QIPB 3OHBA 4XPCA 5DQGA 2AX0A 4O3RA 2W8LA 2FJWA 1DTTB 5HROB 4QPXA 2ILZA 4Y2AA 4KE5A 4KSEB 4J9QA 4PWDB 4B3OA 1QUVA 2R8HA 5K14A 1SH2A 1RTJB 4Y3CA 1SV5A 3CWJA 2VG5B 1HYSB 4YR2A 4NLWA 5CYMA 1RYRA 4EO6A 1LWCB 3KLFB 3BGRA 3FFIB 4EO8A 1XR6A 3GQCA 4RW6B 4URQU 4G3IA 4O3SA 5C24A 3KMQA 1K1SA 1JLAA 4JV1A 3MF5A 4K4SA 2YKMB 3CJ5A 2VG7B 3PVXA 1LW0A 4KO0B 2HNZA 2RF2A 4NLDA 3ITHB 5DG7A 5HBMA 3M9OB 1T03B 1T3NA 4IG0A 5J2QA 1REVA 2YNHA 3I5AA 3LAMA 3IG1A 3LP0B 4J9KA 5I42A 1HQEA 2OPRA 3MECB 3LP1B 4K4UA 2ILYA 1BQMB 5KFGA 1DTQB 2R2SA 4EEYA 1RT5A 3T5LA 3JYTB 3C6TB 1S1VA 4YR0A 4JV2A 1C0TA 4O3OA 2BQUA 1UWBA 5KG3A 3DLEB 1FKOB 1YVFA 2W9AA 2BRLA 2AGOA 2WB4A 3H59A 2VG5A 1S4FA 3DMJA 1JXLA 1S1XB 1TL1A 4JV0A 3KK1A 3QGIA 5DLGA 4NLQA 4J9PA 3DRSB 5D3GA 5F8GA 2IM3A 4Q43A 4QWEA 4ZPCA 4DG1A 4H4OB 4ID5B 1IKWB 3IS9B 4J9MA 2AQ4A 2V0NA 5KFIA 1DTTA 3M8QA 2IJNA 4URSA 4Q45A 4EBDA 4IRDA 4TY8A 4PWDA 2HAIA 2YNIA 4URGA 1KHVA 2OPRB 2RKIA 4WZQA 2WTFA 4RZRA 4O3NA 4ED2A 5KFVA 4RW7A 4IH5A 4KFBB 5L1IA 3N6LA 1RT2B 3DLKB 3E01A 1C1CA 3PHEA 2HNYB 1IKVA 4DL2A 3KLEA 4XPEA 4RW6A 3OHAA 5KFSA 3MR2A 4U6PA 1RDRA 4GC7A 5KFBA 3KNAA 1ZTTA 2FJVA 5F8MA 2YKMA 4IR1A 2CKWA 4G1QA 4ZHRB 4KHRA 4KKOA 4F4ZA 2XGQA 3M9MB 1HMVB 3DOLA 1S1WA 3H4BA 1RT3B 1JLEA 4WXOA 4DL3A 3M8PB 3V6DA 2WRMA 3KLIA 4KAIA 4MIAA 1N56A 2B6AA 3GIKA 1RTDA 4FBTA 4TY9A 1HQUA 3C6TA 2VG6A 4RUCA 1W25A 2BRKA 1LW2B 3IRXA 3PJXA 4MFBA 2XC9A 3RAQA 4ED6A 3KOAA 4EBEA 1VRUA 3QZ7A 4F4WA 2E9ZA 3I0SB 3T5KA 2FJXA 2QV6A 5KFDA 4I7FA 3HHKA 2XCPA 3KK2B 5J2PA 4KFBA 4PQUA 1RT2A 3DLKA 4ED1A 1C1CB 5I3UA 1S0OA 1T05B 5F8NA 1S1TA 5L1LA 2VG7A 2UVWA 4NLUA 1JLQA 2R2TA 1U09A 1S1WB 4LSLA 4WFZA 3QIDA 1S1UA 2GC8A 3ITHA 1BQNB 3QLHA 2WONB 4WXWA 2XGPA 4ECUA 3V4IA 3MR5A 3DLGB 2FVQA 5KFAA 2HMIA 4B3OB 5KFZA 1I6JA 5F8LA 3FRZA 2EC0A 3QIPA 4EYIB 2JEGA 4FBUA 1D1UA 4LQ9A 3OL8A 2HNYA 4NZ0A 1MU2A 1RT5B 4F4YA 3V81A 3IN5A 5KT7A 3GV8B 4I2QB 1S9FA 5F8JA 1UWBB 4IOBA 1FKOA 1TV6A 4KB7A 4NLVA 1JIHA 2RDIA 3CDEA 1R0AB 3JSMB 2E9RX 4ED0A 2RF2B 4O3PA 3GV5B 1HPZA 2YNFB 2C2DA 1KHWA 2JLEA 4TYBA 4QWAA 2BE2A 4KHMA 5DG8A 3H5YA 2RDJA 3QO9B 4RW8B 2HNZB 4I2PB 5J2MB 1T03A 1T94A 4MFBB 3G6YA 1N5YB 1LWEB 1RTIB 3IGVA 3KK3A 2W9BA 3D28A 4ZPAA 1C1BB 5CYMB 4X2BA 1LWCA 4MK8A 3KLFA 3FFIA 3GV7B 3C6UA 1N4LA 1MU2B 3Q8QB 3ICLA 2O5DA 4IFYA 3KHLA 3CJ3A 2JC0A 3DMJB 5FDLA 1S1XA 1TL1B 3JSMA 4FS2A 1EETB 1EP4B 5J1EA 1REVB 5F9NA 4MIBA 1S1UB 4OL8A 4QWCA 3NMAA 1C0UA 5L1KA 1RT7B 2D7SA 3LP1A 2R8IA 4WYWA 2YNIB 1IKWA 3IS9A 3DRRB 2JC1A 4QW8A 1S9EA 1XR7A
chains in the Genus database with same CATH superfamily
4JYAJ 3W3SA 2B8QA 2VPYB 4NXNJ 3GIIA 2JLGA 3ZTRA 1N32F 1H7WA 4EZ6A 3AXKA 4HI2A 5M2RA 2AKWB 4NLRA 4ZP9A 4K8RA 1BMQB 3HHEA 4YB7A 4ATNA 2FB0A 4NE9C 5ADZA 3D6MB 3G6VA 3KHRA 1WHYA 4B17A 5F8HA 3F73A 1RKIA 3VAFA 3BREA 3ZZYA 4ZPBA 2ZKTA 3UCUP 1T3OA 4OMFG 1S7HA 1UEUA 3QO9A 4RW8A 1IBLF 1XIQA 5GAGU 3R9LA 4CYUA 3V6DB 4YS2A 2FJDB 2VOPA 2R4FA 4LIRA 2QMUB 4CO2A 1R31A 1IUJA 4BHQA 3IWXA 2ALZA 2CG8A 2F63A 3R5CA 2G2YA 1VRUB 1YWXA 4UF4A 7FDRA 1U49A 1X4DA 3G8QA 2WSCC 2N82B 2ZJPQ 1Q53A 3AHPA 3SXLA 1XMQF 2QLJB 2ZH3A 4B3RF 2GQCA 2K9IA 3GSDA 3I0SA 2CJYB 2KDOA 3LOUA 4FKYA 2WK4A 3J81j 3D0GE 1FESA 4YOEA 1ITPA 1JLGA 3Q8PB 2DIUA 2BJ8A 2RH3A 3M2VB 1U8WA 2AYGA 4M5DB 2A6OA 3ETOA 4JI7J 3DRYA 3EZUA 5LM7E 1TKXA 1GEHA 1IRQA 2OEKA 4X4QA 3DDKA 1AFJA 1K1QA 2R2UA 2JVOA 3UO0A 3AA9A 1OJ4A 1FE0A 3CJSA 3TAMA 1U0HA 1IKYB 2G13A 3NGSA 3NBPA 4I0WA 2JJ4D 4KIAA 4P7TA 1S97A 3OXGA 2R7XA 2R3VA 1RU2A 5B0GA 2EC2A 3G9CA 4OYMA 1LNQA 3FQLA 1GXTA 4I7FB 3Q24A 3R1LA 3LPEA 4F36A 4WFXA 3A8JA 1XERA 2ZWOA 2LMIA 4U8YA 5IT4A 2HGMA 4K5SA 5IT0A 3H5UA 3OW2R 4IQXA 1NM2A 2LXUA 4ECYA 4BDPA 2Q79A 3TZWA 2AF6A 4QWBA 1SJRA 2NUHA 2YWGA 1NHUA 3RAMA 4ZMMA 3HSDA 3C3LA 2EG1A 1SKUB 3MEDA 1UJ5A 2CPFA 1N33F 3HCXA 4DR3F 1N54B 3VZHA 4C48A 4H4OA 1KQKA 3IBCB 2HGNA 4AT1B 4ZN3A 4HDGA 3TUJC 2FGCA 4CWBA 1EP4A 2YWHA 1WC4A 5DZ7A 3I31A 1UL3A 3MZIA 2W8KA 2HQFA 2XLIA 2E5GA 3SBMA 2DXEA 3HFVA 4K4TA 5HK4A 4ECRA 4ZVHA 2HQDA 2F8EX 4M63A 2LEPA 2IM1A 1LWEA 1RTIA 4N7TA 3HVTB 1IKVB 5DO2A 2KFNA 1FRHA 5I3PA 5LSLA 1FI4A 3K57A 2IA6A 2QEXS 1VHFA 2OFGX 2PIIA 2QZ8A 3O8WA 1U1MA 4B9VA 1KTQA 2YX4A 3PACA 4OJ1A 1HBUA 3TRGA 3W62A 1RT4A 1R0AA 2UXCJ 2K1RB 1ARRA 3G86A 5KFXA 2DNPA 2BW2A 5ETNA 4C4WA 2UUAF 2E1PA 2Z56B 2EFNA 1WOPA 4NMXA 4QPTA 3RW6A 3EWGA 2B7BB 1OSDA 4RX6A 1NSPA 3AX5A 1ZAVA 2KG0A 3TANA 4FDFA 1R89A 3MPUB 1LW2A 2WHOA 2QT7A 3R5AA 4RL1A 1T7PA 4USHA 1VRTA 1EZZB 1MROB 4K4XA 1VYAA 2QLBB 3M32A 5E3AA 1KVIA 2DR8A 2IJFA 1NLKL 3OFGA 2E1AA 4J9LA 1SXLA 4ZVGA 3I5CA 3PRDA 2EW9A 4WCEQ 1PIEA 4OLOA 1TL3A 3CCLS 3OPKA 4FYDA 2Y3YA 3KJVB 5J2NA 4B9MA 2MZ1A 1FX4A 4Q44A 3K58A 4FP9A 3T1HF 4JI1J 1QVFR 4NLPA 1PJ5A 3H5SA 4ENOA 2VQFJ 3PO5A 4P73A 3UVJA 1U9PA 4WYLA 1OQ6A 1F9EB 2OPPB 3GFHA 3PW5A 2RJZA 2VA2A 1NHVA 4LIWA 5KFCA 1X4CA 3LUYA 2FLPA 2HIYA 4W4MA 3KLVA 3QZ8A 4LRBA 4DI6A 2ZJRQ 4F0KA 2V8VA 3TYTA 4LFAJ 1CBKA 3GPAA 3K5MA 3NP5A 4AUKA 2W7OA 2QSFA 1HYSA 1VOMA 3R2DJ 2K6LA 2PI4A 2CAXA 2IM2A 1OSCA 1KD1T 2LXFA 1S6PA 2FZGB 5HVGA 2JEIA 2GIQA 4RW4A 1R7IA 3DOMB 4CT9A 4DPYA 3ISND 2UUAJ 2CUYA 4O3QA 1JKHA 2R7TA 1ZS6A 2HFVA 1JJ2R 1FJGJ 1U25A 3POTA 2O3DA 1ACMB 5C25B 3ENQA 1TU0B 1VC5A 5IT9Y 5J2MA 2CNLB 4M5MA 2NXUA 2B56A 2VC1A 3VGUA 1U1QA 1JLCB 2OEMA 2PMHA 5E33A 4LF7F 1NK6A 1M1GA 4G1IA 3GIRA 1DLOA 2E9TA 4CNZA 2E7VA 4I1TA 4H4KA 1MMNA 2HRTA 4NEZA 2MZTA 4JI0F 3TQ1A 3AWRA 3A3PB 1WI8A 2GIRA 4A8XA 3VEAA 3K59A 1ZYQA 1X4GA 2EG2A 2CJ9A 4DDFA 2HVHA 2RMLA 4O4GA 1Q8LA 2HLTA 2AJQA 1RTHB 3C66A 2KB2A 3A1YG 5JJBA 1AUDA 3T1HJ 1VBZA 2UUWA 1SUQB 2G2ZA 3GCXP 4MYUA 4DS5A 3NNCA 2DNHA 4QR0A 2DNOA 4HT7A 2RHSB 3OTOJ 1QLNA 5K8NA 2B5JA 1NCLA 2IY5B 1ZPVA 4XAKA 2E66A 2FHKA 4U7CA 4DPXA 3HZEA 3AQOA 1RTDB 5IM0A 3PJWA 4WKRA 2PEBA 3BQ2A 3L9ZA 2YQ1A 4NASA 1N6QB 1C2PA 1CQNA 4CLTA 3I32A 3MUTP 2KL8A 1RJJA 5DS7A 1RBLA 3OJUA 2I9SA 2VQEJ 1TKDA 3NEKA 3SFUA 4F3QA 1YHQS 3ZTPA 1NB7A 4TY8B 4QCLA 4LF5F 5KG0A 2P9GA 2GMHA 5IV4A 3UNYA 4ZDNA 2XTCA 1T9YA 5HMXA 4F3OA 4AXIA 2BA3A 3B8HA 3DKDA 3MAAB 3V81B 1TVRA 2N3LA 2VIHA 1SVDA 2XYGB 3A4TA 2XMJA 2VBZA 3DRSA 3K7RA 3DHXA 2CQ0A 1FK9A 2IHR1 4ANEA 1NO8A 3FT7A 4DCJB 2GPEA 1WF1A 3IO1A 2F4VJ 1SI9A 3D6FB 2UVRA 3AXMA 4ANCA 2YX1A 4YMEA 3K8VA 2DH9A 3N6NA 2HG4A 2L9DA 4BWJA 1AZSA 1KP6A 1RT3A 4DG1B 2KJVA 3NNHA 3DM2B 3EM1A 2IBOA 4KV8B 1B0TA 2ZC4A 1TL7A 3U02A 1QE1B 1HLWA 5DZ6A 1XTZA 3MPYA 3JYTA 3MM6B 4B9SA 3C46A 1N5YA 4M94A 1V3SA 2PEHA 2RSQA 3T1AA 2MY7A 3CD6S 3S1TA 3TJ9A 2GW8A 4NPOA 4OI0A 1IM4A 1NJYA 3Q2TC 2DEIA 2HYIB 1H74A 2NZCA 2DEJA 2E5HA 3MEEA 1WEZA 2XSJB 5C42A 2Y1IA 2QLWA 4RUHA 2QA4G 1RYSA 1F3VA 2AHOB 2IC3A 2HBYB 2OPQA 1I94J 2GGPA 4ECQA 4JI3J 4B9UA 3G82A 4H4MA 2CJBA 2K06A 2V5HG 1VC6A 5FDLB 1IBCB 1IKYA 4ECZA 4LF7J 3NBPB 2C3OA 4TXSA 4DL5A 4USVA 3C15A 4CO3A 3KLIB 5DGBA 2FYXA 3TO8A 1QY7A 2KVQE 3DLGA 1EB0A 2GFFA 3BKFA 2M52A 4GVBB 4M8LA 1RA6A 3AX2A 1GMWD 5AXKA 5DQIA 3NY0A 1NK0A 4AE5A 1HA1A 3OUYA 2XSFA 2ZH1A 2G2OA 1NAQA 1PSDA 4K4WA 3DU5A 5T7LB 3FSIA 3T5JA 2DO4A 3GU0A 4GO5X 3MEDB 1PYOB 3S01A 5KG4A 4PG5A 4ZLNA 4DCOB 5IS2A 3O2IA 3B6BA 4O23A 1UA1A 4K0KJ 4LQ3A 1RHQB 3GILA 1TZ0A 1WSVA 2MPUA 3K2YA 2H1OE 3R7BB 4F0HA 2CJXB 1BUXA 2HBRB 3D1QA 2ZH8A 4WTYA 5JVHQ 2Q2KA 3L7PA 2ADBA 1QSSA 3PO4A 4I4BA 3NNEA 2I5JA 4WP3A 4YHHF 3UDEA 2DISA 1KLMA 4YQWA 3EPGA 2M5YA 2AEFA 2B51A 3QIPB 3VR1A 1CQMA 2AX0A 3THTA 2V8HA 5HATA 1DTTB 4RUBA 3GZ7A 3OD2A 2CVIA 4QPXA 3JQJA 4Y2AA 4HHHA 5B0BA 1VQKS 2AJ0A 1SH2A 1YRXA 4Y2MA 2LEBA 3HX9A 5GADU 3QJJA 1CJUB 2R9LA 4OFZA 1HBOB 3S8SA 1VIXA 2WBRA 1LWCB 3FFIB 4DV0J 5LXYA 3CUNA 4FXVA 5LJ5Y 1N5QA 1XR6A 2CRLA 2XO7A 1RXOB 4G1PA 2OO4A 1RB0A 3CD5A 3PV8A 4JV1A 1A9NB 3MF5A 2P9EA 1WI6A 3EGVA 3PVXA 1QDUB 2V68A 2LLZA 2HNZA 2RF2A 3MMJA 4BCAA 2GHWA 2QA4S 5HBMA 1FXRA 4DR2F 5BYQA 2CPJA 5IWAF 3G5OA 1U1KA 1XNQJ 1IVZA 1REVA 3A13A 3LAMA 3LP0B 5I42A 2FHJA 3CO0P 4DLGA 3MECB 2QMXA 1BQMB 1NUEA 4ZCKA 3BO2A 3TI0A 1K47A 1RT5A 2DR5A 4OYXA 2JXGA 2A6MA 3S6EA 3B82A 3MEKA 1FNMA 1C0TA 3A8EA 2J8SA 3W64A 4PKDB 2BQUA 1G2EA 1Z2LA 1EHWA 2B4OA 1I3OB 1B7FA 1MW7A 3FSYA 2UXDJ 1HL6A 3H59A 3DLLQ 3GP9A 4DX7A 4IOCQ 1CULA 1OHNA 1EAYC 2VBXA 2XTJP 3DGVA 1S1XB 4WP9A 4F04B 5CCMA 1DY3A 5DLGA 2OI2A 4NLQA 1BY9A 2NYIA 2Y0BB 4OX9J 2L9WA 2H4WB 2IM3A 2OLWA 4ALZA 3VGTA 3HFKA 1KOOA 2YQ3A 3M8ZA 5IOLA 2CIMA 2DNLA 2IJNA 1GMVA 4EI2A 4IRDA 2PN6A 1UVKA 2VDHA 4PG7A 2HAIA 4PWDA 3RR7A 4MJKA 2J0WA 1KHVA 4DU7A 2HFNA 5A0YB 3O3LA 1K0TA 2DVIA 1PKUA 3DLKB 3E01A 4TU9A 1YJTA 2MKKA 2ZFHA 2HNYB 3TUIC 3HVRA 3MR7A 1VBYA 4C8NA 3SMZA 2HHVA 4RW6A 3OHAA 1W7WA 4NYPA 5KFSA 3BGLA 1NPPA 5F8MA 2VH7A 3MM7A 2FJVA 3FBBA 3T6JA 2VC0A 3PHTA 1X4EA 1WC0A 1R0CB 4KHRA 1Q8BA 4X66F 3PFEA 4WIIA 5T41A 1KN6A 1ARQA 3DOLA 5DDPC 2M3DA 2QFIA 2ZITA 5IXUA 3QPIA 4PRFA 4ZVUB 4C11B 2W25A 4R0JA 3P4UB 5CXTA 2CA9A 3T1YJ 1I5OB 4TY9A 1XJWB 2VG6A 1AYEA 3J7YU 1RBOB 2VFSA 4PZVA 2DYAA 2GVDB 1S79A 3O44A 3OQ2A 2XC9A 4ED6A 1FJEB 3DXBA 3I0SB 5LT5A 3T5KA 1B0PA 1VS3A 2CZ9A 1Q7LB 4I7FA 2IVFB 3SSSA 3VAJA 4KFBA 2A2BA 3WIUA 3FK4A 4OZLA 1N0VC 3UWTA 1NK5A 2XB2D 4BWMA 2AJ4A 4FYWB 2DH8A 4RBVA 3TQEA 2V4JA 3MUMP 4ZLLA 3OVAA 9ATCB 3D0IE 1MNEA 3GE9A 1S1TA 2D1CA 2I2YA 2ROEA 5JVGQ 1H0HB 2W7AA 2UVWA 4CLSA 4HHUA 2L08A 3CC4S 1S0OA 1P94A 4LRVA 4JBCA 3QLHA 3GG1A 1U1RA 3BO3A 1U7LA 2HMIA 5KFZA 3HPOA 2ZH9A 5F8LA 2A1BA 2EC0A 3C14A 2OEJA 3FRZA 4DF8A 2JEGA 5FIIA 4LFCF 4LQ9A 3AOCA 3OL8A 1NLAA 3MCMA 1NZAA 1B99A 3V81A 4E0DA 1LWXA 1H38A 1NB2A 1YJUA 1J5EF 4QYRA 5KT7A 3GV8B 1JJ4A 3ZTOA 3HSZA 1E6VA 3V2UC 3TZZA 1S9FA 5EX0A 1UEVA 2WAQD 1EX8A 4R5PB 5B0CA 2V2QA 1R8HA 4AL6A 1SQGA 2RDIA 1U45A 1R0AB 2UU9J 5BYSA 3MM9A 3HJVA 4O3PA 5D6GA 2KG1A 1QVGR 4HTIA 5SUHA 1BHNA 4TYBA 2OTJS 4QWAA 2BE2A 2N4DA 4C7QA 5DG8A 1RWOB 2ZH2A 3ZXWA 4F4KA 4OYPA 4OYBA 2XM3A 2HHHF 4CNYA 3AA8A 2Z4PA 2VQEF 1FKAF 2YY3A 2AV5A 4J9UE 1N5YB 3UDVA 1URNA 1RWUA 1LWEB 1RTIB 2IVMA 5B0DA 2VL1A 2A3JA 2CJKA 4AD6A 3HLUA 1OM2A 3KK3A 2W9BA 1A0OB 2Z57B 3D28A 3QT7A 4P71A 1XMOJ 1ICEB 1NK7A 1CJTA 3D7SB 1N4LA 2BV3A 3C6UA 2RDDA 3N5FA 2SXLA 1MU2B 5ITHA 4X4TA 1WHVA 2KHCA 3D54A 1RAHB 1SC1B 1FX2A 1FVSA 3TZXA 3R1HA 1UKUA 4IFYA 4L73A 2D3O1 4YB6A 3CCES 2ACMA 5FDLA 1GNKA 3A3NB 4OLPA 3TX0A 2IDEA 1VQLS 1X93A 1RHJB 1EP4B 1RWKB 3QT8A 1S1UB 4NX9A 3TR5A 2BJDA 2EFPA 1VQ5S 5L1KA 1C0UA 2HHPA 4OZ1A 4PCQA 4WYWA 1S57A 2VBYA 3IS9A 3UE2A 2JC1A 1CPZA 3PX4A 1TL5A 5A8KA 3W5YA 1N48A 3PY8A 1M5HA 3AB4B 3BN7A 3HHLA 5CD4H 1Q16B 2RAQA 1D09B 2NSBA 2U1AA 3K5OA 4LUBA 3D6TB 1W26A 4USWA 1XC9A 3Q86A 1D8YA 1URRA 3HHLC 3HVAA 5K14B 3SEOA 1QAIA 3CC7S 1TFWA 3THVA 2MGZA 1GQEA 4EBCA 2DIVA 3TWZA 1WORA 3LO3A 3CCSS 4I56A 5HL7Q 4WP8A 1PG5B 3CW2C 1OY6A 3M30A 2BR0A 1DJ0A 1HMVA 1FDNA 4TYAA 2E1MC 3ZFVA 3DDIA 3DDNA 3MDFA 4CQ1A 3VHQA 4ZHRA 3KHGA 2I5JB 1CS4B 3R6GB 1S5ZA 3LALA 4ICLB 4MKAA 2PA8D 2F5GA 3NRBA 4OV6A 3W5XA 4C97A 4ES3A 1GXUA 1WKLA 3GYXB 5F41A 2GJFA 2DNZA 1V5VA 1TP7A 4YEAA 4DV4F 2N4CA 2KYZA 4DJBA 1JLCA 3GXQA 3QATA 1T9XA 4DR4J 2ADLA 2DKOB 1IWGA 1N88A 3ILOA 2GCFA 4RW7B 3H20A 2IM0A 3IFEA 1M5SA 3CJ8A 1UETA 4M5HA 4RNHA 3KLEB 5KFMA 4F50A 3KJQB 4HKQA 4J9OA 2N7CA 2KXHA 3FGVA 2V9WA 3QSIA 1PO6A 1L5UA 2AY0A 5J2PB 1FFGB 2B9WA 3BH7B 2RIJA 2RUSA 2HW3A 2HURA 2W2QP 2GVZA 2VB6A 4CI0B 1JX4A 1PBUA 2GO9A 1R6YA 2QYGA 3M8PA 2XMAA 1HBMB 4K50A 4ZP6A 1TR0A 1H6KX 1XR5A 2Y1LB 2C22A 2M9KA 4OV1A 3ET6A 2EKYA 4P72A 2WOMA 4IDKB 1UA0A 1G3OA 1HYSB 4FS1A 3GFXA 4ZVQB 2KH9A 3V4IB 1C0TB 1VCTA 1DBDA 2ASLA 1MYLA 4O4GB 4F26A 3CC2S 4QR1A 4U7UK 1S6PB 4ETZA 1Y5IB 3KK2A 1Y7PA 1YJWS 1QTGA 5K8OA 5IV3A 4B3MF 1IQZA 1S6QA 2BANA 1QTNB 2NCKL 2YWKA 4DV5F 3NL0A 1SC3B 2DNYA 5HVHA 4LFBJ 2BJEA 1KFDA 3IWNC 3L7OA 2IAJA 4NA1A 1PJ6A 4RW9B 1WNEA 2QJ3A 3QT5A 5HJYA 1CJVA 3UI3A 1RAGB 4AFFA 2H4YB 2QTWA 2Z58B 3CJ0A 3CJ2A 3MTJA 3J7Z5 1DQ9A 4ECVA 1A7GE 2BABA 1YJ7A 4KHPF 2MLXA 3VZIA 4DPOA 5CH7B 1S6OA 2DR7A 1MWQA 4O44A 4ID8A 2B6AB 1LK5A 4KT0C 2GHPA 2NXJA 2Z2LA 3PTWA 1YBAA 4FYYB 3EVWA 4UZCA 3O5TB 3ETMA 1QE1A 3H25A 4B02A 3PZPA 1J5OA 2FJAB 2RU9A 1PAUB 4PQAA 4R0EA 4RBUA 5KFEA 1JB0C 2VKRA 2CZVC 2KZMA 4RKUC 5GAEI 2KM8C 2GZOA 2COLA 1SV5B 1TUWA 1YGYA 5A8WA 3QAEA 3SCJE 3TARA 1XMQJ 1P9YA 3ISZA 4ILMA 5KG2A 1KOHA 1Q0NA 2MKSA 3BN4A 2V50A 2RHQB 3UN3A 2FC8A 2RQCA 4AAIA 1RHMB 3MEEB 4ZVEA 2XSJA 5GAHI 3WC2A 1LWFB 1JXEA 4LT6A 2ZBRA 2ASJA 4OYAA 1RZMA 4EMDA 3GIJA 1X8DA 2OKQA 1VK8A 3H8YA 2W2NP 1U1PA 3O1LA 1HWKA 1PJ7A 2JEJA 1H72C 1FNOA 2BA9A 3MEGB 2J7UA 3VGSA 4WFAQ 1F5BA 2YKOA 3MM6A 3FSXA 4TNOA 3UR3C 4X4NA 4NXNF 3LGHA 1JLBB 1FO1A 1GFWB 1IWAA 1YKWA 2JH3A 3AJ1A 4P2FA 5HANA 4L75A 3CVKA 5K8PA 3BJYA 3M8RA 1UWAA 2RS2A 2FY8A 4RBTA 2MHEA 3CE8A 4RUAA 2JWNA 1CC7A 1OS5A 1F9FA 1P1TA 4H4KC 2XEXA 3VCDA 5RUBA 4TQRA 1AROP 4ZVSB 2IC3B 1S0MA 1FK9B 4CP5A 4XIUA 4DUYJ 4DCPB 1KVKA 3G82B 1NDPA 1SJFA 4DQIA 3QFHA 4PXEA 3TVZA 3MAQA 2EFVA 4GKKF 4C3LA 4WJBA 2EK1A 4ERDA 4N76A 3NS7B 1RCXB 4LVOP 3OL7A 3F41A 4OYWA 2OELA 3UDLA 2JXHA 1VJWA 3V4MA 5A2QU 3V6JA 1V9OA 3OL6A 1FDAA 3IAS9 2PMZD 1X0FA 5J1NA 1N34F 1MNTA 1OWXA 1PYSB 3DYAB 3FBCA 4L74A 2Q6BA 5D0RA 5FD1A 3TJAA 4DUYF 1FRLA 4B9LA 1KQGB 5GVQA 1Q8KA 5T7LA 1HBUB 1C1BA 4JI3F 3SI8A 2HBQB 1FHTA 1X5OA 3D4JA 4ECWA 1NDCA 1EKRA 5KT6A 3L4BC 3N6MA 5KG6A 2XI3A 3M2UA 1B01A 4DV2F 4X65F 5C2GA 3MMCA 3RB6A 2MZRA 2JFKA 1HNIA 5BXIA 1NEEA 2YKNA 1FXDA 2R7UA 3GWCA 3JSYA 1BDVA 2NS1B 1H3DA 2UZAA 3P5BP 1IJEB 3AD8C 2BUNA 3B4MA 1DFDA 3BSAA 4FN5A 4CLFA 4J9SA 2V8PA 2FGOA 4UOHA 1BAZA 1WC3A 3EXCX 4IFVB 1HARA 2HRUA 4X4SA 3D68A 4QW9A 2OPSB 2CPGA 2YNGA 3DOKA 2D3ZA 2ZKUA 4DLEA 3CDWA 4B3TF 3AH6A 2DNMA 4RNMA 2W9CA 9RUBA 1FKPB 4CT8A 1LQ9A 1S9GA 2FVSA 3U27A 5J2NB 4XO0A 1X9MA 2DXDA 4V19X 3W7BA 4IFYB 2MQQA 2GIFA 1TQLA 1VHIA 2ATCB 3MM8B 2HGLA 1V5IB 3RB0A 1I94F 2KU7A 3BDEA 4K7QA 3UVJB 4TU7A 2C2EA 2QA2A 3DRXA 4Q0BA 1Y5LB 3K8WA 4KYZA 3ZZPA 4A8WA 2ZHAA 2HWHA 3JTOA 4HACA 3A8IA 1IBKF 1D3WA 1RT1A 2OMOA 1RTZA 3I0RB 1J27A 4M5GA 2BDPA 2UUBJ 2HZAA 5AT1B 2QMWA 4CO4A 3VF0B 4ZN1A 2F4VF 2Q66A 4FF3A 2CQ4A 1BQMA 1R27B 1WC5A 1WUUA 2NXCA 5IQ6A 1TAUA 5KFKA 3U1LA 4A8FA 2Q1LA 4KH0B 1CJKB 3HF5A 2NXNA 1AT1B 1P8GA 4NRUA 3MMAA 4C9DA 5EHHA 2BJ1A 5KFPA 5C5JA 1UFWA 5HQMA 4ZVTB 4AQYF 4A8MP 1K8AT 4DL7A 4MKBA 2KYXA 2ASDA 2RQ4A 4DV2J 1L3UA 2DNNA 2CPXA 2KVIA 3R5JB 2UXCF 3CCTA 3PEJA 1UPMB 4KY3A 4DR2J 3OLBA 2R8KA 4K0KF 4NLOA 1HD0A 2V63A 3D9BA 2ZM6J 3HFZB 2ZZNA 2EFOA 4EZ9A 3MCNA 3POTB 2UXBJ 4D3GA 4QZVB 1CS4A 3P45B 1WEXA 4ICLA 4IRCA 5KFOA 4UW2A 3QGHA 3TA2A 2M8DB 2ZEJA 4OI1A 4U7UD 3IBFB 4OX8A 2MQPA 2XZDB 4I68A 2L3MA 4F8RA 1CSJA 5H1SV 2F8HA 1AW0A 4DR5J 3PW2A 2RE1A 3LW5C 3M6WA 5ETVA 4JI8F 1X4BA 4MMOA 1X0PA 5HQLA 2W7PA 1RTHA 4MT1A 2J0SD 2P6SA 3PCOB 2YVSA 2MXYA 3CDBA 2J6UA 4QU6A 3GLJA 3UNGC 4DXLA 2ZUAA 3KDNA 4J9RA 2G9OA 5CZVA 2HPUA 2G1DA 1HR0J 1VQ9S 2R8GA 3PX0A 1R0BG 2E5LJ 1VQ7S 4XDDA 3FCHA 1QSYA 1F5CA 4S0MA 4OI2A 1HNXJ 5IM0B 5DQHA 1LFWA 1KEKA 5LMUF 1SIZA 3PM9A 2RQMA 1HIYA 1LW0B 4YDXA 4AXJA 2WOMB 1RA7A 4IDKA 3CB4A 3FEZA 1BLUA 3G71S 1ZAWA 1X9WA 2CG4A 1Q4RA 2K7KA 2M2BA 2WB1D 4NLYA 2K1OA 2I8EA 4O0NA 4DN9A 4DR6F 1OMSA 3DM2A 5CD4A 2HMIB 3P8BB 4G65A 2ERRA 1WELA 1ZA2B 2EFGA 3TZYA 4ZIVA 8AT1B 3D66A 3G87A 1VBKA 3UCZP 1K44A 4QU7A 4F4XA 2DGWA 3B54A 3DRPA 4IYQA 2UUCF 2PFFB 2CQGA 1FRKA 1OPZA 1IR1A 1CJVB 1R8AA 1VMBA 2QRRA 3VVUA 4X62J 1JK9B 1NNDA 5I3UB 4PG4A 1XN9A 1V3RA 3VV2B 1QM9A 1RT7A 3Q8RB 2GNKA 1RGVA 4ZVRB 2YNHB 2QA1A 3SDEB 3RB4A 2MB0B 2I1RA 3FMBA 4WE1B 4GMKA 2VFUA 5HMYA 2H3EB 1UJ4A 2BE2B 1M5VC 4ECSA 2MKJA 3Q8SB 3CJKB 1IBMJ 3L7UA 3DFEA 2GMLA 2FJWA 3HD1A 2MSSA 4KE5A 2ADCA 4PWDB 4IQMA 2RVJA 2HHWA 3RUBL 2R8HA 2VPZB 1MWZA 2VPWB 2N3OA 1S4EA 4Y3CA 1SV5A 2NLWA 2W2PP 2VG5B 4GVBA 4PEOA 5A8WB 4LFCJ 1MG7A 4KR0B 1MSWD 3M1VB 3BGRA 2Z8QA 2KM8B 3P96A 1L3TA 2V4JB 3K17A 2VKZG 4DHVA 3GQCA 4URQU 2GGPB 4J91A 2VHGA 4O3SA 3PDNA 3KMQA 2MZSA 1JLAA 3GSIA 5C24A 4ZK7M 2J0QD 1MYKA 4K4SA 2FZCB 2VU5A 2R7WA 3JS9A 3CDAA 1H2UX 1VJQA 1Y3KA 2R7RA 3M9OB 2QG9B 3T1YF 3ENWA 1YITS 1T3NA 4IG0A 4MIWA 3TEGA 2VFRA 4WU2A 2HQIA 2M70A 2XO6A 4J9KA 1VQ6S 4FVMA 2CPYA 5G4DA 5D78A 1UUJA 3BPDA 3EZOA 5KFGA 2CVEA 1RLDA 1DTQB 3ILJA 4MAKA 2R2SA 4JV5J 1T9UA 1N0UA 3ZNUA 2DHXA 4O3OA 1HW8A 5KG3A 3CF5Q 1IBLJ 4NXMJ 3UD4P 2LYVA 2LECA 4QIGA 2AGOA 1S0VA 1CJUA 3QT6A 3FRYA 4DV7F 4CO1A 1UEKA 3THPA 1JXLA 1NH8A 4JV0A 4M1KA 5AXLA 2AD9A 3RR8A 4J9PA 2HVZA 5D3GA 3FNNA 2XTEA 1EKSA 1FVQA 1FT8A 1EJ7L 4Q43A 1NU4A 1T11A 4ZPCA 2DHSA 4FPIA 5LMNJ 4J9MA 3EDRB 3IS9B 1HI1A 4A48A 3Q0AA 2MJNA 5KFIA 3W65A 1DTTA 3M8QA 4URSA 5GADI 1TAQA 3IXQA 2NQPA 1N33J 4YHHJ 3HHLB 2BACA 2CPIA 2CQ3A 2FJEB 2YNIA 4URGA 3TAPA 4DUZJ 4WZQA 2BNWA 2CNNB 2KI2A 2RRBA 4ED2A 4NCAA 5KFVA 3A12A 3PFOA 4RW7A 2HHTA 1HNZF 1D9FA 4FNIA 3PKYA 4X4RA 4DL2A 1SC4B 4Z7YA 3KLEA 5K20B 1T95A 4XPEA 2XMMA 2CPZA 2DGTA 1VLYA 2X1GA 5ETRA 1RDRA 2KT3A 4U6PA 4GC7A 1ZTTA 1VQ8S 1SIWB 3CCZA 4ZHRB 2CQCA 1KDNA 2APOA 3HSJA 2P6TA 4ED4A 1XK8A 4YN3B 1QAYA 1ZPWX 1S1WA 2FHOB 1IR0A 1JLEA 4WXOA 1GH8A 1WOSA 3LGNA 3M8PB 3C19A 4CYUB 3CPWR 3V6DA 4KAIA 1HNWJ 1RI7A 1WF0A 5IWAJ 3GIKA 1RTDA 4FBTA 2LCWA 4C3MA 1HQUA 2DGXA 3ILIA 3M6UA 4CLZA 4UQTA 1TFYA 3BKUA 2BRKA 2O01C 3C8YA 2H5JB 4DQQA 3AX3A 3NG8A 2VOOA 1VRUA 1YQHA 2KELA 3QZ7A 4DV6F 1QTMA 4J7CA 2CPHA 2HIQA 2P8IA 3R7NB 3CCVS 1U0SA 1K0VA 4HV0A 3KYLA 5K9FA 3HHKA 3KK2B 4DX5A 1F1BB 5J2PA 3PJ9A 1MMDA 3DLKA 1SJ3P 3KFWX 3L95X 4P74A 2R7SA 2HLUA 1S99A 2C3MA 2V8GA 3WX4A 4DV4J 3VGVA 2RNEA 2UV8G 1T05B 4USKA 1L3SA 4USUA 2BJ9A 5L1LA 1KLNA 3OTDA 3H2VE 2A2CA 3CJKA 2RBFA 4NLUA 2BMBA 2JX2A 2EXUA 2Q6CA 3ET6B 4J90A 4M5JA 3ITHA 3QIDA 2F9DA 2W4DA 3OFEA 1BQNB 2XGPA 3V4IA 2A0FB 4DWIA 4FXDA 2FVQA 2LXIA 5GMDA 4B3OB 2O67A 1I6JA 3AJDA 4BC9A 3NS5A 4OJHA 4EYIB 4RJVA 4ER8A 4FBUA 4QIFA 3H42A 4JI0J 3RW7A 2HNYA 4NZ0A 3QRPA 4F4YA 4L76A 1NBEB 3IN5A 3FCVA 2BE9B 2IVYA 3R5GA 4I67A 1UW9A 1ZM2A 4LFAF 1FKOA 1ZZFA 1TV6A 2HRYA 4KB7A 1JWWA 3CDEA 1T9TA 5G0RB 5IC6B 4A4JA 2CPEA 1FFWB 4DPTA 3SYZA 4ZJOA 3BGOP 3TAQA 3BV8A 1KS2A 1Y0HA 4Y65A 3GV5B 2JNJA 2EBGA 2C2DA 2JLEA 3OTOF 3CMAS 1UVIA 2HEKA 2HK2A 4OX7A 2RDJA 1S76D 4ELTA 4E98A 2WVCA 3CGIA 1KNZA 4A47A 4JI6F 1T03A 2CZ4A 4OIXA 4OZ5A 1RE1B 2ZH7A 1FJGF 3IGVA 3QWPA 2VASA 3C15B 2VJVA 1DURA 4C8ZA 1LFPA 2NPIA 2HZVA 4C8OA 3VWSA 1U6FA 2H54B 4LVNP 5CYMB 5H9FJ 3C14B 4C0BA 4EGLA 2VF3A 4L3KA 3OFFA 3PYGA 2C3UA 1T8EA 1HWLA 1FWLA 4ZA1A 4OQJA 2KKHA 2LDYA 3FVYA 1N52B 3GB0A 1NPKA 4N41A 3SQGA 1D8ZA 2YKAA 1KR4A 4L72B 2QSWA 3LA0A 3ZTQA 4FS2A 3GJSB 2FTRA 4OL8A 2WSEC 4QWCA 1RWPB 3MPVA 4ZOSA 2VZ9A 3RBZA 3EUNA 4DV3J 3T41A 1GMWA 1S12A 4B3SJ 2X1AA 1IKWA 3DRRB 4QW8A 2CQHA 1LK7A 1XR7A 4IR9A 2QFJA 5SZTA 5EGYA 2XMTA 4RU9A 3PYEA 3Q8UA 1S49A 2IMOA 3FDSA 2YX7A 4OZJA 2CAJA 2IJRA 4OI4A 1PAEX 3DRPB 3SQOP 5FLXU 3EPIA 2HWIA 3BQ1A 5DGAA 3E51A 3J80U 1H2VZ 4PWUA 1Q5VA 3OSPA 2E5LF 3C6UB 3FEXB 4OHZA 4K4ZA 3W9IA 1D9AA 1HBOA 2QE5A 2XMVA 4MTPA 3W61A 1R6VA 4CLKA 5IFMA 1VQ4S 3TOQA 3V6HA 4DQRA 4ZJQA 3BBFA 1ZTWA 1BDTA 2PSZA 2CNOB 2W24A 1X5SA 3MEGA 3MPDA 1YZ6A 4DR3J 4PWWA 2MKIA 3IR7A 3Q22A 1RISA 3HKWA 3BBCA 3R5BA 4DFJA 2YWWA 4OJ3A 4YP3A 3NWRA 3MD3A 4IRKA 3W5ZA 2BOAA 4FF4A 1RAJA 1T9WA 1GTEA 2OSRA 3LP0A 3VQSA 3KXDA 6AT1B 4IFVA 3MECA 3CCWA 2V2KA 2LA6A 5CAAA 4PQUB 3HSGA 3NGUA 2MQOA 2W9CB 5IQQA 3CMES 2B9EA 2W2OP 3HKZD 1KBRA 3MMCB 3MGJA 2HQGA 4J9VA 4OI6A 2CQBA 1JLAB 2AT1B 3JSBA 4X62F 1SBRA 4QIVA 5I4MA 4Y00A 4RW4B 3UQSA 1YSJA 4LBHA 4DU8A 4GC6A 3N5BA 5K8MA 3G8SA 3MM8A 1CULB 2IRXA 4HVZA 4KH1B 1GX6A 5LOQA 3OTEA 3M30B 3QFWA 4IUFA 5K5MA 3AQPA 5HLFB 4B3SF 3FMTA 4Z37A 2UP1A 4CCHA 4JUZA 4DZDA 3PIOQ 2DRBA 5EDWA 2H5IB 2K8GA 3I0RA 3FUYA 2CXEA 2W01A 1JLQB 3DOKB 2FIUA 4NXMF 3HD2A 1LKZA 3DYAA 5MLCV 5KT4A 2VA3A 1Q16A 1DLOB 5EUHA 2HNDA 1YI2S 1S9GB 3DGPA 3CDUA 3A3OB 4C98A 4P2XA 3CO9A 3KLGA 3KHHA 2BJ7A 2M88A 4F2RA 1O8BA 1Y11A 3GJQB 4WPAA 3EDQB 3RB3A 2BQ3A 1TKZA 3OJSA 3B4DA 2PI5A 4F67A 3BKTA 2UU9F 4DFKA 1SJ4P 3JSRA 2KO1A 3NNAA 3R2CJ 4OYOA 3LP2B 1M5PC 2HFSA 3N0VA 4HDHA 3TA1A 2QC3A 3BR9A 3KWMA 2PDAA 5E2QA 3L3CA 3D1OA 1FD2A 3D2WA 2GVZB 4DR1F 5E5NA 3BF4A 4UOFA 3F44A 4WFYA 4NLTA 4X4PA 3PRBA 5DG9A 4RU2A 1RAFB 2ZE2B 1EQ0A 3W2VA 5A6PA 3K5PA 1N6QA 1NDKA 3MCSA 1JJHA 1JJCB 4HH0A 1NMEB 4WIQA 3TP2A 1F9HA 4ZVOB 3DI6B 3M9NB 2R2RA 4X84A 2DGVA 3T6BA 2Y8YA 3NOGA 3HXMA 1SJ1A 4B9TA 4ELVA 3UPFA 4Y34A 1FTCA 2XZWA 2MKHA 2ZNZA 3JTNA 7FD1A 3EGWB 4TQSA 3MAAA 2CQ1A 3AAWB 1IKXB 2CWXA 1HPZB 3WX8A 1HNWF 2YNFA 1WDTA 2D3UA 4FYVB 3ZZRA 2ZZMA 3AD9C 1FRJA 3O6QA 3BBBA 4I2PA 4DQSA 4BBYA 2FLLA 5KFNA 1YJNS 3HT0A 3FC9A 1WSRA 4KO0A 3KMSA 2DGSA 4P9SA 4X64J 4YY3F 2YPYA 5CYQB 1OY9A 1JNZB 1NRKA 2V8DA 2C2MB 3MMAB 4RNOA 4CLUA 2H9ZA 1U24A 3QLHB 5E0OA 4DMZA 2YQ0A 4OZNA 2QYCA 4KV8A 1GX5A 3UDCA 4YR3A 2DHGA 1HNZJ 4O44B 3R7SB 1X7VA 2HK3A 2CDRB 4Q8FA 2VD3A 2OMLA 4BLGA 4Y0FA 3IM8A 1JLFB 1Q8IA 4M5LA 1B7YB 2ABYA 4YFUA 4NCGA 4AL7A 1WWHA 2LQ5A 2YWEA 3P5TL 3PYFA 4DUTA 4X64F 3OT9A 4LSNA 2EK6A 2J9EA 3CT9A 3MMBA 3H0PA 3MI7X 1TELA 2CPDA 3NS6A 1T02A 4KQZA 1UCNA 3SFGA 2PD1A 2Y8WA 4A8KA 4USIA 3UD3P 4IH7A 2CDQA 4FNHA 2BOPA 1LWFA 2ATLA 3IG1B 4P75A 2ASYA 3P3DA 4H4MB 4PXBA 2Z2MA 2E1RA 3SDEA 3I6PA 1VR6A 2DY9A 4OHWA 4DEZA 2OAUA 3I4PA 2F65A 2M7SA 2QLXA 4USMA 3T5HA 1J5OB 3GONA 5BR8J 4DSJA 3P49B 5L1JA 3PW4A 1VQOS 2XS5A 4DS4A 2C28A 1WF2A 2B43A 1FRMA 4ECXA 4NA3A 2WVDA 2HWTA 4NLXA 4HT5A 1V3ZA 2RS8A 3ZZZA 2ZH5A 1TV6B 3FQKA 3PG9A 1SC6A 2BBEA 5F8IA 1SL0A 1JLGB 5CABA 3TA0A 5KOWA 3VALA 5KFRA 4K4YA 1NJWA 1NJIT 5ETSA 3MUVP 4M5DA 3KK1B 1HNVB 4MK9A 4DZ6A 4MJWA 3CD0A 1KQFB 5GMKa 4F02A 2KRRA 3AT1B 4TLRA 5BYRA 5DJBA 3TAMB 2HHQA 4HH1A 2BVZA 2WCXA 3ONQA 1YG0A 4WE1A 3FBEA 3ZC4A 2XBPA 5D0GA 2MHNA 3K5LA 1R8BA 3SCLE 3FBFA 3MR3A 3H4DA 3LANA 1WDDA 2IA0A 3BGUA 1ZETA 5B7WA 1VBXA 2NREA 4LFBF 4F25A 1D0EA 1JLBA 4M5NA 4R5PA 3D1HA 2BNZA 3GYNA 2XG8A 3MCOA 4FZVA 1Q7YT 2HS0A 4DSLA 1RP5A 3F0NA 3M6XA 2FD2A 3JXOA 3TJ8A 1SB6A 5A8KB 4ILLA 1TL4A 2JZ5A 3H2UB 1DTQA 2G0IA 2KN4A 1EA4A 1TKTB 2XZTB 4LBPA 5KG7A 3BGRB 4Q2LA 1OG7A 1G4CA 4ES1A 4OHXA 2DNKA 3OSNA 2DNGA 3CCJS 3C2PA 5EWEA 2BKNA 3CJRA 1SKRA 3M2UB 3W66A 3KG4A 1BXNA 1HWIA 1XQIA 1WTFA 4IOAQ 3DU6A 2A18A 2V4QA 3CJQA 4G6VB 3HULA 2JRSA 3LGMA 4OZ3A 2JOQA 5HVFA 3TVYA 4C0HA 1KSPA 3LWLA 2NPFA 3M2RA 2Q43A 3GR1A 2OGUA 3EE3A 2MTLA 4I64A 2RQKA 5DRKA 2QGFB 4UOGA 1SH3A 1X31C 2LP4A 2ZWPA 2IIHA 2F7VA 3F56A 3GFZA 1S77D 2H51B 2NXEA 4ETXA 4X4VA 2OPSA 2XHCA 1HFEL 2YNGB 3NGTA 3QYYA 1RK8A 1B3TA 1YK9A 3VAHA 4Y2CA 1OIAA 4I69A 2CFXA 3JQKA 1FKPA 4LF2A 4YDDB 4WKYA 2XQCA 1QSLA 3CSKA 1ZM9A 2GX8A 3KLHB 2YKNB 1IN0A 5D3GB 1QAJA 2RD5C 2YKPA 2RRAA 3R97A 1UZDA 5E3RA 1S72S 2MYFA 1G1XA 2ZD1A 5CZXA 1R8CA 3WZ0A 1ZZNA 1J5EJ 2HQCA 4EK2A 4IG0B 4LSLB 3H98A 4ZCMA 5HP1B 3DLBA 2VPXB 1MMLA 3M8QB 4HACB 1RT1B 2ZBIA 3HT3A 1HBMA 1AXQA 3NOCA 4O0IA 2JEFA 2ZH4A 1RAEB 4C3KA 1RAAB 3PR5B 5LSOA 3MM5A 3RU0A 2R7OA 2BKOA 2H48B 2HHHJ 3CTRA 2MMYA 2NUUG 3QAUA 2AX1A 2WVEA 4FVCA 3WIVA 5KT3A 1F0XA 1RTJA 3J7YI 3HK2A 1VK3A 3E01B 5IC4B 2MQ8A 2JSXA 2XWXA 1S6QB 1C4AA 1GAOA 2BANB 4A8QA 2E29A 2A2DA 2U2FA 3T3FA 4DL6A 1N36J 5KT5A 2P5VA 3M4XA 4PPZA 5KFWA 2B9XA 2IAJB 4KC5A 2KXFA 4RW9A 1T05A 3IGNA 3U1MA 1DQ8A 1I51B 2MQLA 3W60A 2AEMA 3KUEA 1CJKA 4KRWA 1TK0A 1N5SA 3TX8A 2EFQA 2HNDB 3N79A 3QWUA 4PXCA 1RSCA 5KFQA 2DJWA 3NGDA 3Q23A 1D9DA 3MAHA 3CNQP 4CM0A 2B4UA 3IC1A 2VG6B 1VC0A 4CLPA 4K4VA 4ZPVR 1RAIB 1RWXB 4IG3A 2I38A 5ETPA 3BDPA 1OO0B 1S1VB 3RJMB 2UUTA 2YKQA 4P52A 3VW4A 2BJ3A 4Y6IA 2XCAA 4EUVA 1JKHB 2XMUA 3QJLA 4IH6A 1CG2A 3DLEA 1P27B 3VAKA 5D15A 3WC0A 1KQSR 2VUGA 4ZCLA 3FMWA 2PT0A 3TUZC 4HI1A 4U95A 3H2LA 2KOEA 4ME7E 2QL7B 2X3DA 3CIZA 3W2WB 5J1EB 1Q81T 4MK7A 1ELOA 3TVKA 4RPFA 4Y2KA 4Y28C 1F3FA 3E8OA 2DH7A 4DBQA 5L8RC 4OX9F 2WVFA 3LTOA 1S1TB 2AEJA 2AW0A 3I87A 3M7VA 1OPIA 1S7IA 3N9UC 4WK3A 4R8UA 1HQUB 1FJCA 2IPOB 2F1FA 4JI1F 1JQGA 3W8GA 3GJRB 3OR1A 1Q78A 1RHKB 5AE1A 1YJ9S 4ZS6A 4O3RA 1XMBA 3NWGA 5HROB 3CD7A 2GQQA 4KSEB 4LRFA 4LRAA 1ZAXA 1WC1A 2JL9A 1AA1B 2IYGA 1PC4A 3CWJA 2FHJD 2XLJA 4NLWA 1OYEA 4JOUA 5CYMA 1TUVA 4MKVA 2KHDA 4EO6A 4F3MA 2E1CA 1KRPA 3QRRA 4UUXA 5GMEA 2LKZA 4M5IA 4EO8A 1M1HA 3UCGA 4G3IA 4FF2A 2YKMB 1KWMA 3G6ES 1FJ7A 1LW0A 4KO0B 4UY85 1U8SA 3DN9A 1X5PA 3AOAA 3MM9B 4NLDA 3ITHB 2LQ9A 2OHDA 5ETMA 5HAOA 5DG7A 1T03B 3BGFA 5J2QA 2M4MA 1UPPA 2P2CB 2YNHA 3HDSA 3I5AA 4DL0C 1F6TA 2C3PA 2JHEA 1HQEA 2OPRA 3T9NA 2GV1A 4K4UA 2ILYA 3BZQA 3PXGa 4EEYA 1HBNB 2G1HA 5LL6d 4DV6J 1UVMA 3C6TB 4YR0A 1M90T 4JV2A 1JXVA 4C8YA 1P9QC 4KJIA 5DDQC 4ZLJA 4LRCA 1WKKA 4D8JA 1FKOB 1NHKL 4CTAA 2W9AA 2WW4A 1O51A 1CJTB 2WB4A 3G8TA 4USJC 5G0RA 3CCMS 2VG5A 3QMQA 3OBIA 1WTBA 1F5AA 2PA3A 1S4FA 4KGVB 4RO0A 1NZ8A 2KT2A 4NYOA 1YX2A 3M1VA 4A8OA 2WZ1A 4L6V3 3QGIA 2FJBB 4LF6F 4KGMA 3G4SS 5F8GA 4PYAA 3SZ2A 2M8HA 4DFMA 4QWEA 3QRQA 2KTQA 1S59A 4W98A 1CLFA 1TMMA 4DG1A 4ID5B 1IKWB 3TW0A 2AQ4A 2BXJA 3NMRA 2V0NA 3JQMA 3QBCA 4EBDA 2FDNA 3EMTA 3EXYA 3G96A 4FYXB 3M05A 1WG1A 3D0HE 1TMJA 2DTJA 2RUGA 3KNGA 4GRSA 1NSAA 2DHHA 2WTFA 5B0FA 3N01A 4RZRA 2R7QA 1NPRA 2G0JA 2J8AA 5L1IA 4IH5A 2DITA 3N6LA 1RT2B 2V9KA 5IZHA 1C1CA 3PHEA 5LSRA 3OVBA 2HHXA 2GJIA 2VFTA 2XYPB 3H90A 3HP6A 1RKJA 4ILRA 4LJMA 2DNRA 2K2PA 5KFBA 3KNAA 4C2MA 2Z0GA 4CZCA 2ZVSA 3C16B 4G1QA 2VICA 1PARA 4NCBA 1RADB 4FF1A 1I1GA 4LF1A 3ZZTA 4KKOA 1TTHB 4F4ZA 4J5OA 1EARA 2XGQA 3M9MB 1HMVB 3IR7B 3IR6B 4BS2A 1Y00A 3H4BA 1BWEA 3KTQA 2HHUA 1XBWA 1RABB 1FFSB 5ETLA 2WRMA 3KLIA 1N56A 2OIHA 1AB8A 4LF8J 1B70B 2DXFA 1Z2ZA 4K2JA 8ATCB 3HHNB 2C2OB 2HKEA 2E5IA 1UMJA 3AD7C 4MFBA 3RAQA 1SPBP 2MQNA 3E3XA 2ZBCA 3LWMA 4F4WA 1SL2A 2E9ZA 1X5TA 3ZO7A 2AYEA 2XCPA 4OHYA 1LV5A 2J9DE 2D68A 1B0VA 4DR7J 2LQJA 4P10A 3NGRA 5MAOA 4M5KA 2QX0A 2P9CA 2HS3A 1QUPA 2ALYB 4QQBA 4KHPJ 2C1EB 4LF9F 2ACYA 4DPWA 5F8NA 3NLCA 1HW9A 4QYZJ 3BR8A 2VG7A 3M2RB 1JLQA 2D74B 3R6LB 1U09A 1S1WB 1IBMF 4WFZA 3NCRA 4WXWA 1N36F 1KVJA 3MR5A 2O66A 5KFAA 3E2EA 3HJFA 2QIFA 3WBZA 2B7CB 4P2SA 4PXDA 2J9CA 1E6YA 1UW4A 3OV7A 1T9VA 2MQMA 4HR2A 2VODA 3FZ2A 4TKTA 1MWYA 4V19J 3FEYB 1NJXA 3HHDA 1Q1KA 4N8NA 4ZPWR 4NWBA 2YWFA 1SIWA 1UWBB 4IOBA 2MLYA 1N34J 1JIHA 4JV5F 3QNWB 5EX3A 2V2VA 5EN1A 3U7JA 4DX6A 1Y10A 3JSMB 2DD8S 2E9RX 2RF2B 4YB1P 4C8KA 2KZZA 1HPZA 2MJUA 3OVSA 2NYHA 2DNQA 2YNFB 4E8UA 5L38A 3EX7B 4JI4F 1B64A 2KJWA 1UVJA 3QO9B 4RW8B 5A8RB 3KJFB 4I2PB 4DV7J 4DR1J 1UZHA 5LXRA 3S7RA 5E41A 3JAMY 2V2ZA 5D8HB 2MDAA 1T94A 4QJVA 3IAM9 4F7VA 2H65B 2YXLA 3MM5B 1J2VA 5M2UA 3I56S 4WWSA 1IR2A 1PYTA 4DSEA 1U26A 1F2HA 2JDJA 5LMNF 2ZOGA 4X2BA 4MK8A 4Y2IA 5ETOA 2DGOA 5F3TA 3KLFA 4JI4J 2YH1A 2RT3A 3R5DA 4GKKJ 3NCPA 4IO1A 3Q8QB 4J37A 4USTA 1P1LA 3AY0A 1OY8A 3QOQA 3I9ZA 3UD5A 3W9HA 2FC9A 2FZKB 3CJ3A 2JC0A 3CIMA 2WVBA 3DMJB 2ZM6F 2A10A 4UUWA 1TL1B 2E44A 1IXKA 2LVWA 1KC8T 1CVJA 1RQ0A 2QL9B 3EYZA 4LR9A 4DV0F 4KPYA 2M0GB 1RT7B 6FDRA 1XNRJ 2C2ZB 2D7SA 3LP1A 2R8IA 3I4HX 3HO1A 4UY8T 2HFOA 4TVAB 3NGKA 1S9EA 5FLXY 3MURP 1WC6A 2RRNA 4F4AA 4N56A 1EQMA 2QN6B 2WBMA 2Y1JA 4X4UA 2X51A 3UN5A 3IRXB 2RKIB 4NCGB 2W2MP 3W63A 2EI5A 2L48A 3ISNC 3VAGA 1SL1A 5KT2A 1DRZA 1U1LA 1XNRF 4DV5J 1XEZA 3WDOA 1PGZA 1TKXB 2H5EA 3Q89A 3DOLB 4CLYA 3M8SA 1WG4A 3T9ZA 2C3YA 2WSFC 5KFTA 1O0PA 2GO8A 5C24B 2D9OA 2DT9A 3BSOA 2F3JA 4R8UB 5KTQA 3EVMA 3OR2A 1NK4A 2BQRA 3N4WA 5M2PA 3OR1B 3GFYA 5D0EA 3K5NA 2AGQA 1HWUA 2IRUA 2XMWA 5CQGA 5L9NA 3H5XA 3MOZA 2C42A 5KFHA 4LF6J 3VAMA 2RU3A 2XYHB 1S48A 2WW8A 3DRRA 4JI5J 2H1YA 2GS8A 1L3VA 3J7ZT 3OLAA 2F9JA 1TVRB 2HBZB 2MZJA 4C6AA 3J81Y 1YBTA 3EJMA 2D69A 4ITSA 4M95A 1KTVA 1HNVA 3MMBB 3OXFA 1RBAA 2N7YA 3SQGB 4I2QA 2ZZTA 2J0XA 4JI8J 4NRTA 3VAIA 2IDLA 4ELUA 2O1PA 3D67A 3FKBA 3IA0A 3M8YA 4NI2A 2K1RA 2JFDA 4U96A 1VDHA 5B09A 5E3CA 1FE4A 1HNIB 2V4RA 4Q7AA 4DR4F 1S10A 4B3MJ 2XS7A 3D3BJ 4Q2MA 2EWHA 3RBXA 1HHSA 1UAWA 1V6HA 2PE8A 3CXCR 2HHSA 1SQFA 1TL7B 1UFLA 3MXHP 2H3AA 1YRTA 3PEHA 5E3QA 3IP0A 4HYKA 4PUOB 5HMZA 3PW7A 5JMNA 5KFLA 2WONA 2XWYA 3ENVA 4KGXB 1BQXA 3GG0A 1HNXF 2J6TA 5JXSA 2W4PA 4PPDA 5KFYA 2XTDA 5GAGI 2BW7A 4CTAB 1WOOA 2LFVA 3NCQA 3AB2B 3RBEA 4QIWD 1RT4B 1U02A 1VQPS 4QIEA 2GHVC 2E7XA 2MEWA 2XULA 5C42B 5AJ3J 2NR0A 2JBVA 2V34A 4DR6J 5D77A 4FXEA 4LF4F 2OPQB 2B8PA 1GXLA 1TL3B 3ZNJ1 2VQFF 2PGCA 5D0HA 2OH2A 2HZCA 2CQDA 2ZDOA 1IJFB 2L9NA 4WK1A 1RT6A 3QQCD 2BYCA 2G0CA 3CJ4A 4RNFA 4OYZA 4DR5F 5EWFA 4Q0BB 2AJ2A 2HFZA 1Y3JA 3D6HB 1Q86T 5FJ4A 2OPPA 4WBFA 2OFHX 1EETA 4ZKAA 5HLFA 3IMQJ 4DQPA 1BD6A 3CCUS 1W2IA 2LA4A 1KKHA 3DCAA 5AJ3F 1RAOA 1LOUA 2MY8A 2DPIA 4JI5F 2IYIA 2YTCA 2PFDA 1HR0F 3WHIA 4NOHA 1TKTA 2X1BA 1IM6A 4K2XA 2UXDF 4O4RA 1VISA 2HVEA 3FCWA 3UFCX 3Q2SC 3DHWC 3ZZ0A 5AXNA 4GKJJ 4JI2J 5KG5A 4DSKA 2AWZA 3US5A 2XNQA 1M1KT 3H7HB 2IFXA 3L09A 5AXMA 3C16A 4CDIA 3HI9A 3CMQA 2ZD1B 3GYGA 4J9NA 1TKZB 2CNKB 1TUGB 2LDIA 4NMLA 4NLSA 1HI8A 4P6QA 3LP2A 2W4CA 1TK5A 1C0UB 1NSKL 1HQ2A 3BM7A 1Q95G 1NDLA 4Q8EA 4LF5J 3IR5B 1DZ5A 4C8LA 5AE2A 2GAHC 2LEAA 3KJNB 3LQVA 2L41A 4ED3A 4WZMA 2ZNYA 1GTHA 4Z7CA 3D5MA 4A46A 4LBIA 4KTQA 2CADA 3DGPB 1BQNA 2AIRB 3KLGB 4DFPA 3BSCA 3J80Y 2EEYA 2BE7D 2QO3A 4DR7F 4ZVFA 1FWPA 2LQ8A 4LSZB 4DOZA 3IM9A 3ZZOA 3RRHA 3DOMA 2MGZB 3KLHA 4IG3B 2F40A 5HI7A 4UT4A 2XMKA 5DDOC 5D4NA 1WD6A 2F8MA 3QGGA 5CCLA 5EWGA 1S6UA 3UR0A 1RUSA 1UP1A 5HP1A 1IKXA 2Z2ZA 4GVLA 2I6WA 4DN0A 5BJRA 4ED7A 1DARA 4MH8A 4WTOB 3NO7A 3TEHB 4FKXA 4C8MA 4RR5A 2UVVA 1FXLA 3BPSP 1IBKJ 1FDBA 3MFHA 5I42B 2FVRA 5DLFA 2K3KA 2IMWP 4QBUA 5T14A 4B9NA 1FF2A 1U2CA 4N5SA 1ZM4A 2X7IA 1E6YB 3DI6A 3KG1A 2V67A 2W1BA 3I96A 2XY6A 2Z2YB 1VFJA 2HVDA 1VI7A 2B9YA 3GCWP 4HTJA 1U6BA 2FVCA 1HWJA 5L9XA 2I0XA 1Q5YA 1SUQA 2VBWA 1VQNS 1AUSL 1JLFA 4YUDA 5D4OA 2CQIA 3BQ0A 2FLNA 2B5JB 3I82A 4DPUA 3MR6A 5HSPA 1S0NA 3CCQS 3RYLA 1F2GA 2MKCA 4NA2A 1NKBA 3PW0A 5A2QY 3M2VA 1KFSA 1REGX 1X4AA 3GR0A 5F9LA 4NLGA 2B4VA 2UXBF 5KFFA 1R3NA 5CYQA 2AU0A 2HFUA 5I3QA 4KBIA 4D3HA 2AGPA 1YZ7A 3KG0A 4ZIWA 3SSRA 3RG6A 2KXNB 2CJQA 5HROA 4OX6A 4ZJLA 4W90B 2IRYA 4B08A 2AYBA 4DSIA 1A6LA 1WHWA 5A0YA 3CEDA 1HQEB 2AP6A 1ZM3A 5GAHU 1HKAA 3KKFA 2V6AA 4ECTA 5ETQA 3LF0A 2V69A 3MTKA 4MYTA 3WQPA 3VVTA 1BGXT 4LSNB 2DPJA 4V1Ak 1K9MT 5IT9U 3GIMA 3OL9A 2DO0A 1SQEA 3W2WA 2ROGA 2LU2A 1HHTP 1F60B 4NL5A 4JP8A 5B0EA 5L46A 1FEHA 1YLXA 1ZA1B 2GAGC 2XI2A 3NAIA 3BYRA 4OYIA 5JUMA 1Z4UA 4AQYJ 2K5JA 1M5KC 4CLLA 3NAHA 1CEZA 4MKYA 4DUZF 2ZBPA 4N77A 1QD1A 3HHLD 4OI3A 1UVLA 3K89A 1S9EB 2V1TA 2D9PA 4NZ6A 2AN7A 2FQQB 4H54A 3T19A 1H98A 3W9JA 3RAXA 1FERA 3RBDA 1C4CA 2HQ3A 5ETKA 2GQ2A 4PABA 3MWBA 5HMWA 2J76E 4JI6J 1B4SA 1UFKA 1FNXH 2V1SA 3BS9A 3LH2S 3GJTB 1T0TV 1VRTB 3BSNA 2CQ2A 4CRJA 4UQGA 2OD6A 5F0WA 4ANDA 1U48A 4CH7A 4UTGA 4ED8A 1U6ZA 3HVTA 2BSQE 1VRQC 2OD4A 2D41A 3GMGA 3H87C 2AZ3A 1SKWA 2MKYA 2Y0SD 3SV3A 4ZVPB 2YH0A 1XWLA 5HO4A 1ULRA 3SCIE 3MOJB 4RNNA 1OYDA 3SCKE 3ADAC 2R8JA 2PO4A 3I9V9 4HLBA 3OR2B 3LAKA 1SKSA 4ID5A 1BWVA 3HVWA 5KFJA 4TN2A 5DETA 4QWDA 5J2QB 4EYHB 3UN2A 1NXIA 1LXNA 1YJRA 2DBBA 3EICA 1GT8A 2X3GA 4KKOB 4TU8A 3R3TA 3PYDA 4ZLPA 4OJGA 2OTLS 3GTYX 4ZP8A 4FXWA 4L3NA 3EGNA 1KLMB 3J7A1 1MN7A 3Q8YA 1YBUA 1VQYA 4U8VA 2R7VA 1SH0A 2J9DA 4DV1J 4JYAF 2CYYA 2XNRA 4CO0A 3H40A 1RWVB 1SJQA 4IO9Q 1X4FA 2OUGA 2FLOA 4G1QB 3RZAA 1NKCA 2R42A 2IBKA 4CH0S 2G4BA 3KDOA 1PBAA 2OP5A 5D4LA 3KJVA 3RGIA 3AJ2A 4NYZA 2XLKA 2ZUGA 3M8WA 2HS4A 2ZBQA 3G6XA 2VJUA 3RTVA 4WFNQ 2UVUA 3PRVA 3I55S 2B3TB 2UUCJ 2DHAA 3RRGA 4DV1F 5C25A 1U4BA 4PUOA 1LXJA 1JLEB 5BR8F 3OTCA 5C7PA 6FD1A 3PR4A 3KK3B 1MROA 3M32B 2W9BB 2FVPA 4PG6A 1RCOB 1Q79A 1RWWB 2ZE2A 5KG1A 3W2VB 1APSA 4CM2A 1AFIA 4OHVA 3D3CJ 1PC5A 2AZ1A 5LJ3Y 2MSTA 3I5BA 4X66J 1H2TZ 3DC2A 2MLZA 5DM6Q 2XS2A 2K3IA 1VLOA 3R27A 1VQSA 4R25A 4DL4A 2C2RA 4QOTA 2PMWA 4DSFA 5H9FK 1WACA 2Y9HA 1RT6B 2UV8A 2XY7A 3V6KA 4NEYA 2YPZA 4N47A 3CJTA 3K0JA 4CO5A 2E5JA 3VEBA 4IKAA 2J6SA 3NKYA 5HBMB 4ZP7A 5B0AA 3V5RA 3FJ2A 2VFVA 2BZ2A 3MFIA 2AJFE 2GA7A 2J5AA 4OZ2A 5KFUA 4JI7F 3QJPA 1JNRB 2ZH6A 2XY5A 1YDLA 3N28A 4ZPDA 1YJVA 1O5JA 2K7JA 3OHBA 4XPCA 2LQBA 5DQGA 2W8LA 1U1NA 2JLFA 4TLQA 2ILZA 4J9QA 4U67Q 4WF9Q 2XHWA 3ENAA 4A8YA 1QUVA 4B3OA 5K14A 4LF9J 4W92B 1RTJB 2ZOMA 3BB5A 1EIYB 3RRKA 4YR2A 2ZC3A 1RYRA 2VV5A 1FRIA 2DRDA 3BH6B 1ZH5A 3KLFB 1WHXA 3ULHA 1R43A 3EZ5A 3U1NA 4RLEA 4RW6B 3JTPA 1K1SA 1R8PA 3X3UA 3KUGA 3CJ5A 2AYMA 2VG7B 4OZ0A 4PAAA 5LMUJ 5E3PA 4F2SA 3JB9k 4QR2A 5A8RA 5J1PA 1FEEA 3KUHA 5A76A 3W8PA 4LF8F 3AOBA 3OTBA 4N8OA 4ES2A 4UZBA 3CCRS 3P6YC 3IG1A 4Z2XA 1UJ6A 1ZBTA 1MLAA 3LP1B 1RHUB 2VDIA 4XTTA 1L3KA 3BYPA 5HJXA 4XK8C 1U0HB 3R8YA 4CLWA 5KOXA 3T5LA 3JYTB 2D3OR 1S1VA 2VONA 3ELHA 2AJ1A 4GKJF 1XMOF 1M0SA 2DY1A 2GVDA 1FD8A 1UWBA 2XZ2A 2YBVA 3DLEB 4RWWA 1YVFA 2BRLA 2GMJA 2ZHBA 1NH7A 1DAXA 3VQTA 3ZTSA 4JB8B 1DQAA 3BEGB 3DMJA 1RHRB 1TL1A 3KK1A 4P2MA 4F0MA 2J7WA 1GK8A 1Y5NB 3DRSB 4ZPTR 2DK2A 1KONA 4PR6A 4QYZK 4KPCA 4EWTA 4C11A 1NJZA 3VTIA 1P6TA 4PYDA 4H4OB 1U2RA 2NSCA 4HEA9 5L39A 3ILLA 4LRDA 1PCAA 3J81U 4DF4A 2J7KA 4I6AA 4Q45A 1G7CB 4B3RJ 4YY3J 2DGQA 4TY8A 1NK8A 1YRUA 2EBEA 1Z1ZA 2OPRB 2RKIA 2FY1A 4O3NA 2UUBF 3QGPA 1QJHA 4KFBB 5DM7Q 1RU1A 3MD1A 2BX6A 1X60A 4WU3A 2K29A 2EVZA 1IKVA 1QAXA 2KKEA 1SCJB 4EFAC 4ZITA 3OUYB 3MR2A 3Q83A 3TNVA 3NXZA 2EKNA 2QL5B 4IR1A 1E6VB 1IQTA 2DR9A 2CJAA 2YKMA 1WEYA 2CWKA 2CKWA 2KFYA 4YB5A 1ROFA 2CQPA 4P7VA 3M6VA 1HD1A 1PILA 3DLHA 2DB1A 5H9EJ 5HN0A 4NI2B 2NZ4A 3MHYA 2QLFB 4K5RA 3EVOA 4B3TJ 1AZSB 1RT3B 1NKEA 2RB7A 4A8SA 2DCLA 1ZOTA 3HMJG 4DL3A 4MIAA 2B0GA 2B6AA 3DNCA 3UW1A 1HBNA 2RILA 3BO4A 1VQMS 4AL5A 4Q5VA 3C6TA 1H7XA 4RUCA 1W25A 3PNIA 1LW2B 1VGYA 3IRXA 3PJXA 4BC7A 5GAEU 3KOAA 1FCAA 4EBEA 1X4HA 2PC6A 3PIPQ 2FHMA 2FJXA 5B08A 2ZOFA 2QV6A 3Q8VA 1WG5A 5KFDA 5F0UA 4X4OA 4X65J 4PQUA 1CC8A 1RT2A 4ED1A 1C1CB 3LPYA 1N5TA 5THWA 3AFGA 2FUG9 4EU0A 4I6YA 2OSQA 5I3UA 1NK9A 1WJ9A 5F3ZA 2BM1A 1FWKA 4KGKA 4LR8A 1N8RT 1HI0P 5CYJA 3J7AN 2KFZA 2KT5A 4CH1A 4FPRA 1RACB 1G6BA 5A6WA 4DX8H 5KAKA 4WFBQ 1MN9A 2B4PA 2DCUB 1RWMB 2ZHOA 3IBWA 1U1OA 2ROPA 1W2BR 5U47A 2R2TA 1FDDA 4LSLA 1S1UA 2DR6A 2DGUA 2GC8A 2POKA 5E7OB 2WONB 4ECUA 1YIJS 2HVIA 3DLGB 4DV3F 2JXIA 1OQ3A 2C2NA 1O6XA 3HZGA 2BM0A 3IWLA 3QIPA 2ZDPA 4U9RA 3W1YC 4NZ7A 1WKJA 1D1UA 1GMUA 3LJPA 3DXSX 5DDRC 1HHQA 1MU2A 1XNQF 1RT5B 3EGZA 4GO7X 3JAMU 1H73A 3SIPB 1N32J 3OFHA 4I2QB 2BEFA 4HL9A 5HQ8A 5F8JA 4E2FB 2GJ2A 4NLVA 4UOCA 4HHJA 2EPIA 5ETTA 4ED0A 3B78A 1M5OC 1VIOA 2LU1A 3DLJA 3ZZUA 1KHWA 2MZQA 5C2CA 4CIOA 2ZJQQ 3SV4A 4KHMA 1DHMA 2KRBA 1U47A 3H5YA 3X1LB 7AT1B 1BE4A 1N5VA 1NSQA 2HNZB 1YTYA 1Y9OA 5CA5A 3A8KA 4RWXA 5J2MB 8RUCA 3FZBA 1RWNB 2Y1RI 2OJ3A 3MPWA 4MFBB 3G6YA 5AE3A 2BKPA 2V94A 3PX6A 3PKMA 4LF4J 1LEOA 1U2FA 4ZPAA 1C1BB 2HSEB 4K59A 4LREA 2FPHX 1FA0A 1FTRA 1LWCA 2ZVIA 3IRWP 3FFIA 3SSQA 3GV7B 2HAFA 2DRAA 1Y4ZB 3G2XA 3OXLA 2F4FA 3ICLA 2JVRA 4LR7A 4JI2F 4AYBD 5H9EK 1Q82T 4LMZA 2O5DA 1TK8A 4C0OC 1K73T 2AMCB 2Q3PA 3KHLA 3MM7B 4XDCA 3AODA 1S1XA 4PG8A 3JSMA 2Z30B 1EETB 1JMTA 5J1EA 1REVB 1B28A 4MIBA 4ZCIA 5F9NA 2X1FA 4ED5A 1BC6A 1FRXA 3NMAA 2C2KB 3QSYB 3TUPA 1UVNA 3HM9A 5CHCB 2YNIB 1X9SA 1RLCL 4I6WA 3CULA 4KGZB 2E7WA 1UTAA 5D4PA
chains in the Genus database with same CATH topology
3W3SA 2VPYB 3GIIA 2JLGA 1N32F 1H7WA 4EZ6A 4HI2A 5M2RA 4NLRA 4ZP9A 3HHEA 4YB7A 4ATNA 2FB0A 5ADZA 3G6VA 3KHRA 1WHYA 4B17A 5F8HA 3F73A 1RKIA 3VAFA 3BREA 3ZZYA 4ZPBA 2ZKTA 3UCUP 1T3OA 4OMFG 1S7HA 1UEUA 3QO9A 4RW8A 1IBLF 5GAGU 3V6DB 2VOPA 2FJDB 2R4FA 4LIRA 4CO2A 1R31A 1IUJA 4BHQA 3IWXA 2ALZA 3R5CA 1VRUB 1YWXA 7FDRA 1U49A 1X4DA 3G8QA 2WSCC 2N82B 2ZJPQ 1Q53A 3AHPA 3SXLA 1XMQF 2ZH3A 4B3RF 2GQCA 3GSDA 3I0SA 2OH2A 3LOUA 2KDOA 4YOEA 2WK4A 3D0GE 1FESA 1JLGA 3Q8PB 2DIUA 2RH3A 3M2VB 2AYGA 4M5DB 3ETOA 3DRYA 3EZUA 1TKXA 4X4QA 3DDKA 1AFJA 1K1QA 2R2UA 2JVOA 3AA9A 1FE0A 3TAMA 2G13A 1IKYB 4I0WA 4P7TA 3NBPA 4KIAA 2JJ4D 1S97A 3OXGA 5B0GA 3G9CA 3FQLA 1GXTA 4I7FB 3Q24A 3R1LA 4WFXA 1XERA 2LMIA 5IT0A 5IT4A 2HGMA 4K5SA 3OW2R 3H5UA 4BDPA 4IQXA 2LXUA 4ECYA 2Q79A 2AF6A 4QWBA 1SJRA 2NUHA 2YWGA 1NHUA 3RAMA 3C3LA 2EG1A 3MEDA 1UJ5A 2CPFA 1N33F 4DR3F 1N54B 3VZHA 4H4OA 1KQKA 2HGNA 4HDGA 3TUJC 2FGCA 1EP4A 2YWHA 3I31A 1UL3A 3MZIA 2W8KA 2XLIA 2E5GA 4ECRA 4K4TA 4ZVHA 2F8EX 4M63A 2LEPA 2IM1A 1LWEA 1RTIA 3HVTB 1IKVB 5DO2A 2KFNA 1FRHA 5I3PA 5LSLA 3K57A 2IA6A 2QEXS 1VHFA 2OFGX 2PIIA 2QZ8A 3O8WA 1U1MA 4B9VA 1KTQA 2YX4A 3PACA 4OJ1A 1HBUA 3TRGA 1RT4A 1R0AA 2K1RB 3G86A 5KFXA 2DNPA 2BW2A 4C4WA 2UUAF 2EFNA 3RW6A 4QPTA 2B7BB 1OSDA 4RX6A 1ZAVA 2KG0A 3TANA 1R89A 1LW2A 2WHOA 2QT7A 3R5AA 1T7PA 4USHA 1VRTA 1MROB 4K4XA 3M32A 5E3AA 1KVIA 2DR8A 2IJFA 4J9LA 3OFGA 2E1AA 1SXLA 4ZVGA