4LQ5A

Crystal structure of ligand binding domain of cysb, a lysr member from salmonella typhimurium lt2 in complex with effector ligand, o-acetylserine at 2.8a
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
239
structure length
239
Chain Sequence
EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator CysB
publication title rystal structure of ligand binding domain of CysB, a LysR member from Salmonella typhimurium LT2 in complex with effector ligand, O-acetylserine at 2.8A
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Gene regulation
total genus 51
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lq5A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lq5A02
3GBBA 2R6GE 2Y7RA 4AB5A 4U21A 1H43A 1JEUA 4NTLA 4H67A 3S9LC 4GXAA 3T9UA 2XX7A 2H25A 3MVWA 4P11A 5TPAA 1A7LA 3K4UA 3Q25A 3QUFA 3H3GA 4OFJA 1XS5A 2I58A 1XHYA 2DE3A 3B7DA 3SEYA 2OWTA 2F5XA 4RK9A 1EH3A 4ZZEA 4OYVA 4NF5B 1ZLQA 1UQWA 3PV0E 1USYE 5H8HB 2V93A 3K02A 1TWYA 4YAHX 4Q30B 4GFRA 5HPQA 3DLNA 3V5AA 4EF2A 3C9HA 3HHGA 4G68B 4EXLA 2XD3A 2UVHA 4G77A 4KYSA 1IUDA 2UXAA 2H9BA 2Q8JA 5L9MA 1QW0A 3IORA 2DS9A 2D5WA 1ZU0A 2XD2A 4ZEBA 4GL0A 1MPBA 2DVCA 4R74A 4R6HA 2F34A 4OEVA 3VLWA 3JZJA 4N6PA 2AIXA 4M1VA 3MJNA 3OOAA 3SEXA 2I49A 5AA3A 4IO7A 3IB1A 1VFEA 3TEPA 1H3DA 4KCCA 4POWA 2O51A 4JWYA 1FTMA 2RCBA 2UYEA 4FEDA 5H8FA 1QJMA 1I6AA 2XXXA 2HAVA 2VGQA 1FQDA 1B3LA 1SYHA 4ZECA 2ZMBA 2OJTA 2F7AA 1R9QA 2DQVA 2O1MA 2CZLA 2I6EA 4NF4A 5K2XA 1RYOA 1MXVA 4KD5A 1MY0A 3KGCA 4JWXA 3SDFA 2YLNA 2Q89A 3T22A 2NWJA 2ZNSA 4OERA 2Y7KA 4F1YA 1PB8A 3IR1A 4THIA 3G3GA 4DIGA 1YCJA 3LC8A 1A54A 1SW4A 1PBPA 2QL3A 2GFEA 1I6BA 1BLFA 3RTFB 2VD3A 4PFYA 1AMFA 2ONRA 2HCAA 2XXTA 3P7IA 2E1SA 1IITA 3K1MA 4OVJA 1MDP1 3L6GA 3VXBA 2RCAA 4ZZAA 2XXIA 3K0VA 5TP9B 1I69A 1LAHE 4EUOA 1JW4A 4WKMA 1XT8A 2ABHA 3OMBA 4IB2A 2HEUA 1SI1A 1JETA 4OMBA 1SW2A 3FJMA 4NF5A 4RY1A 1AIVA 5FHNA 3G7WA 5H8HA 4EF1A 3VV5A 2UYFA 5BUUA 2HZLA 2I3VA 2NOOA 4XKRA 3IAZA 4G68A 1MM6A 3WAFA 5IAIA 2B65A 3PUWE 2E0SA 1UIUA 1BIYA 3LSWA 2AL4A 5DYHA 3E9XA 4HS7A 1II5A 4QFKA 4RXLA 4Q5TA 4F29A 4ISUA 3V8XB 4OENA 2GH9A 3ECRA 5CMMA 1DSNA 4X1BA 1MH3A 1NMUA 3OSRA 2QPQA 1FQAA 1IEJA 1QULA 2QMWA 4UA8A 5EHMA 1ATGA 4QSDA 4RK2A 3PPRA 3PMVA 4GRKA 2XX8A 1LB9A 1B51A 2V84A 5M2VA 4PETA 5F7VA 3FGSA 1J1NA 1OLCA 1MDQA 2XXWA 3GBAA 4NF8B 4BLAA 4YICA 3W15C 1B4HA 3F11A 1S7YA 3IK6B 3RY3A 1B32A 4MLVA 4AB6A 4KR5A 3OELA 1QVSA 1VR5A 1PB7A 4PFUA 1B0LA 1WVJA 4YKJA 4ZE8A 4OXVA 3FV1A 1EZ9A 1OLAA 1IXGA 4YKKA 3PPPA 4F3SA 1A40A 3IOWA 4DE8A 3E4RA 4YMBA 3K6XA 3TPAA 3VE1B 1B5HA 1P1OA 1MQHA 1N76A 4ZE9A 3D4CA 5H8SA 1JW5A 5TP9A 3O2AA 4KQPA 5FTIA 5CM6A 3M3KA 3O66A 2R71A 5KDTB 4NF6B 1LBCA 4DDDA 5I57B 5H8NA 2NXOA 3N6UA 1CB6A 4U1OA 4ESWA 1MQJA 3UGWA 3G3JA 1N0TA 2PT2A 3IO4A 5L8DA 3IOUA 3HV1A 3K00A 2H5YA 3OEKA 3WAEA 4EQ9A 5DT6A 4XKNA 4OEUA 1US4A 3C34A 1IZ1A 3CR9A 4OQOA 4ND9A 1JVYA 3CG1A 3C33A 1F9BA 3IJOB 2DE2A 1QUIA 4EDPA 3EHTA 5DVIA 3G3FA 5AE4A 1FQEA 2DXRA 4MFIA 3SERA 2F36A 1GVCA 3PD8A 1ZKBA 2F7CA 1WDNA 5JTYB 3MZBA 3H6VA 1EZOA 3MW0A 4H6DA 4TQUQ 2F97A 1Y9UA 3FVOA 1M5FA 3DP6A 1FTJA 2ZYNA 2GHAA 2R9JA 3VVEA 1R1NA 1TT1A 4QFOA 2VP1A 3IL1B 3RN8A 5AA2A 3M3LA 1YAEA 4LQ2A 4XTCQ 4BDMA 4RNSA 2Q2CA 1SW1A 1Y1ZA 3RGYA 1LGBC 4OFLA 3DP4A 3OO7A 4F31B 3KFMA 2LAOA 4DLDA 1B6HA 1ZTYA 3MUQA 2QMXA 2P1SA 2QRYA 5DEXB 2QS3A 3OXNA 3CRBA 3PUZE 4YZZA 1H45A 3KEIA 4NE4A 2VOZA 3K2DA 3SEVA 2IEEA 3IOTA 4NEDA 4FATA 4P0IA 4IO6A 2I0BA 5CMKA 1B0HA 1MQIA 3L6HA 3PGFA 4R9FA 2HQ0A 3T9HB 3TCFA 3VDFA 4ELOA 4QFLA 2Z8FA 5H8QB 1BKAA 3MZ1A 4EXKA 5AA2D 1LCTA 1M5CA 4TLLB 1R9LA 1OQHA 1FTLA 4H5GA 4RJZA 1MPCA 1VFDA 3SKPA 4IY6A 1MY1A 1URSA 2ANJA 1A8FA 5I2NA 3K6VA 3W9VA 4Z0IA 2UVJA 4R73A 3MP6A 3PUXE 3UORA 3UN6A 3OO8A 5DTBA 1B1XA 4F18A 4ELRA 2VHAA 3GLBA 2DWAA 2YJPA 2QS2A 4LZ5A 1RYXA 1JQFA 3MVXA 3V83A 3ILUB 4G8HA 3U92A 2V3UA 4GL8A 1FQFA 2I4BA 3PUYE 1B7ZA 3HCQA 2V3QA 4H8IA 4R75A 1B3FA 2Y7PA 1VE4A 4F3PA 1GR2A 1HSLA 3QYTA 3BKIB 3H03A 2O7UA 4DCXA 5CMBA 3BFTA 4YKIA 1LFIA 1XC1A 1POY1 2D21A 5K2YA 4F39A 1MRPA 5JTYA 1ZIUA 3RPWA 4LZ8A 3KZGA 3CFLA 1LBBA 2GRVA 5I59B 4TLMB 1B3GA 1GV8A 4FAJA 1OVTA 3K1PA 4RPNA 3PU5A 2ALUA 3O6HA 2ZYOA 3ZSFA 1NNFA 4QF9A 3MPKA 2HXWA 1TXFA 1O7TA 4KI0E 1R6ZA 4LA9A 1MY4A 1LB8A 2F6PA 3I3VA 3FIRA 3UA8A 2CMOA 3RNNA 1O64A 3H6TA 5DEXA 3G3IA 5EHSA 2M8CA 4I62A 5KZTA 4MBPA 2YPNA 1XVXA 2ESNA 1SBPA 1A99A 4I9DA 2OZZA 3SEWA 4EQ7A 5F1QA 3C35A 2DOJA 2X7PA 3VLVA 1Y3PA 3MAMA 3T96B 5AA4B 3VVDA 3CIJA 4ZS9A 2A5TB 4OWDA 2O68A 1N7WA 1MG1A 3OEMA 4O3AA 1GTKA 4U23A 4DXCA 3QIMA 1N3WA 2HZKA 5LOMA 1B5JA 4LUBA 5DVFA 2F8DA 4MF3A 4MLQA 3I6VA 2OLBA 4ESXA 3GXAA 1SQYA 3OO9A 4I8CA 3BFUA 3O6IA 1M5DA 4F2OA 1N84A 4FORA 3U72A 1B46A 3K6UA 1MXXA 3H4ZA 5CI5A 1SVXB 3FUZA 3N5LA 2PMSA 2QJEA 3CSBA 4FEBA 5ISUA 1DTGA 1SD3A 4QHQA 5DVJA 5AA1A 1T0KA 2A5SA 2RC7A 1PB9A 4JBZA 3W9WA 1Y20A 2V25A 1P1NA 4C1UA 2IA4A 3USDA 5ELVA 3CG3A 4EQBA 1ELJA 1EU8A 1UTHB 2RC8A 2ZNTA 1MQGA 3FASA 3O28A 3QK6A 5I59A 4PP0A 4L17A 4BDQA 4R9GA 3LSXA 5L9OA 3Q26A 2Z22A 4E0WA 1M5EA 2GHBA 1IXIA 4G68C 1UIVA 1FQCA 2I48A 3N6TA 3TZAA 1N7XA 1O63A 2OCUA 3V89B 1H44A 3MVYA 4IO3A 4YB7A 1HSEA 3K6WA 3S9MC 4GQOA 4DZ1A 3TODA 2Z23A 4IGRA 2ZNUA 4XKQA 4LQ5A 1NFTA 4ELQA 5CBSA 4U4XA 1B7UA 1B5IA 2I4CA 1IXCA 4JSDA 3KN8A 3EHSA 1N3XA 3CSGA 3MZ9A 3C31A 4GLIA 4U22A 4GIZA 3VVFA 3JV9A 4KPTA 1Q1KA 5CRYA 3QUJA 3H6UA 4YU0A 3O6GA 3RT8A 3KN3A 5TPAB 1PC3A 3B6TA 3OO6A 3FXUA 2B3BA 2NVUB 4H1XA 2XX9A 1Y4TA 3B6WA 2AL5A 4JSOA 3TTKA 5AA4A 2P0SA 3EHUA 1OQGA 1P1QA 3A09A 5FHOA 2NUVA 4RYAA 5BWJA 5HM4B 1M5BA 1QKBA 2A5TA 1PDAA 2FYIA 1DPEA 4AQ4A 3DP8A 3TTNA 1D9YA 4IO4A 4KFQA 1JW1A 1MQDA 3N94A 1D4NA 3TQWA 2P2AA 1S9TA 3HSTA 3R7XA 1POTA 3IO6A 2B3FA 2RINA 3PPOA 1MY2A 4DXBA 2X26A 3TCHA 1B40A 1IIWA 3FVKA 4XIGQ 2ONKE 1QUJA 1B58A 2UVGA 2RKMA 2PT1A 3SEUA 1Q35A 3S9EA 4GXSB 1AL3A 3T93B 4KCDA 3ODBA 5FHMA 4TOZA 3UP9A 1NNKA 2O7IA 3OENA 4H0WA 5TU0A 1LSTA 4F19A 3IJXB 1OVBA 2VD2A 1FW0A 3PPNA 1DTZA 3G3HA 3O97A 4HTGA 4U2RA 3DELB 4NF8A 1MPDA 4ZEIA 1FTOA 3C4MA 3QXMA 5B7DA 3GZGA 5J1DA 4NF4B 4X1DA 1UTBB 5HBCA 3KOSA 1JVXA 2DYXA 2ZYKA 1A8EA 2AYSA 2O84X 1SDXA 4H5FA 1MH4A 4MH5A 1AOVA 2FA7A 3Q27A 1MM7A 1BP5A 5L9SA 1RKMA 4R6YA 3KJ7A 2G93A 4QFPA 4F2QA 1ZMGA 3T66A 4HW8A 1PEBA 4NWDA 3LBSA 5I2KB 1KWHA 1XVYA 3EQ1A 4GD5A 4F22A 3H6WA 3ZKKA 3R6UA 4IO5A 4BDOA 4LATA 4LZ7A 3IB0A 3LSLA 5KDTA 2UVIA 4NF6A 2REJA 5I57A 3FJ7A 1YTVA 5ICTA 4FECA 3MBPA 2OBGA 4M4GA 3O29A 2XXUA 1IQ7A 1B3HA 3UK4A 1I6QA 1WODA 1D3KA 1MXUA 2RF1A 3TTRA 3TKDA 3O9PA 4C0RA 3KJTA 4G4PA 4OTEA 4U1ZA 3PMWA 1B3EA 2FNCA 3PPQA 4FJPA 3CFZA 4R2FA 3PUVE 3FVGA 2DVZA 2HFBA 3TMGA 4Q8RA 3SESA 1US5A 1QUKA 4HCYA 1IXHA 2DXYA 4G8MA 3KSJA 3TUSA 1MXYA 4QSCA 1SYIA 5ICQA 3FJGA 4XXUA 3BBRA 2Z8DA 3TFLA 4OESA 4UACA 4LVQA 5KCJB 3IOVA 4YMAA 4Z7EA 2H4IA 3MP8A 2XXQA 4KYEA 3ILTB 2ZYMA 4E0XA 4OFOA 3M3FA 1YPNA 1B2HA 2THIA 3OSQA 1NKXA 3FV2A 3UIFA 3MPLA 4ELPA 3A3CA 1QKAA 3S4UA 2XXPA 1UTBA 3DM0A 1P99A 2RC9A 2W7YA 4IY5A 5I58B 3CI8A 4ZEDA 3KBRA 4IGTA 1ANFA 3U94A 4BDRA 4GF8A 3FZVA 3H06B 1JNFA 5I56B 1A55A 2DWHA 2DWIA 4JDFA 4NWCA 4ECFA 2DP8A 5I2KA 1BTJA 1LCFA 2X7QA 2XXRA 1B05A 4GVOA 4WXJA 2XHDA 4FIMA 1P1WA 1Y3NA 5H8QA 1LLSA 3EPEA 4IO2A 1D9VA 4BDNA 3KOTA 3FD3A 4F1VA 1NNPA 3MQ9A 3RTWB 3TQLA 3TTLA 3TDJA 1DMBA 5CMCA 3FATA 5CBRA 3LUYA 1CE2A 3FXQA 5H8NB 4C1TA 1LAGE 4ZEKA 4O3CA 1TFAA 4FE8A 4NMYA 2I3WA 3KSXA 4ZDMA 4PQJA 4QRZA 4N07A 3S2VA 5IKBA 1NNTA 3JYRA 2HAUA 2F7BA 1FCKA 2Y84A 1NH8A 3RUMA 3LSFB 1SW5A 3EN3A 3C32A 3FXRA 4F3BA 4YKPA 3QAXA 3MVZA 1FQBA 3ZKLA 3HO7A 2DE4A 1LFGA 3MP1A 2QSXA 4ONYA 4R2BA 2H99A 2XXHA 4K3FA 1NL5A 1DOTA 4HCWA 4WEPA 1B1HA 1URGA 3HN0A 4JB7A 3A3UA 4R6KA 4R72A 2KLFA 3AXFA 5KCJA 1B4ZA 1XOCA 5A5XB 3TELA 1ZBMA 4PE5B 4JXIA 3Q28A 3S9NC 4RPOA 3K01A 1MXZA 1VSOA 1Y4CA 3G3KA 1MY3A 2REGA 4PFWA 4H8JA 4X48A 3T9XB 1Z7NE 1S50A 3HPIA 4H65A 3U1OA 3TTMA 3CFXA 4F1UA 4GOTA 3K1NA 4Q0CA 1EZPA 5AA2B 2OWSA 3SETA 3IB2A 5B70A 2OK2A 3THIA 5I58A 4KYDA 1NH7A 3PMXA 4OZ9A 1B9JA 1LAFE 4X9TA 2XXVA 5FTHA 1HSJA 3MC2A 1URDA 3KN7A 5JEIA 2O1LA 3PD9A 4N13A 2Z8EA 4JWOA 3ZS6A 1OMPA 2I0CA 1Y1MA 2F35A 3VFJA 1FTKA 2Q2AA 4LONB 5I56A 2DWJA 3E13X 3E3KA 4DCYA 4I1DA 3VXCA 4BDLA 1ZJLA 3TCGA 1SI0A 1PBQA 1B7HA 5EYFA 4F3GA 3ONMA 4OETA 3CVGA 3FVNA 4DXUA 4OHNA 4G8NA 1N04A 4QFNA 3U8QA 3EF7A 4LP2B 1LFHA 5CC2A 3U93A 4U4SA 2H98A 5ITPA 2QS4A 2Q9TA 4G2ZA 2O69A 5I2NB 3OD7A 3R26A 3Q29A 4XKPA 3C36A 3RLFE 1LAXA 4P0GA 3I5OA 3M8UA 3KG2A 2Y7WA 1DPPA 3B6QA 3RT6B 2F78A 1TFDA 1GGGA 3QSLA 5I84A 2ZXTA 3T9VA 4ZEFA 1B52A 4POXA 4RA1A 4QSEA 4YB5A 3MWBA 4GWOA 3RQTA 2PBWA 3VLUA 2G29A 3H7MA 5JK4A 2XXYA 1OIBA 5A5XA 4YB6A 3HHFA 1L5TA 4WEDA 1UTHA 2WKYA 2Q88A 1P1UA 2V3TA 2D3IA 5H8FB 5ITOA 2DSFA 4KHZE 4O3BA 2PVUA 2PX1A 2F6GA 3TAJA 2O6AA 3IX1A 4PFTA 1H76A 1Y3QA 1MS7A 2ONSA 2Y7IA 2PYYA 2BJJX 3TYHA 3D4GA 1MXWA 3LR1A 1Z7ME 1JEVA 1USYH 1AH5A 3N26A 2QS1A
chains in the Genus database with same CATH superfamily
3GBBA 2R6GE 1VDWA 2Y7RA 4AB5A 4U21A 1H43A 1JEUA 4NTLA 4H67A 3S9LC 5EYHA 4GXAA 3T9UA 2XX7A 2H25A 3MVWA 4P11A 5TPAA 4FBPA 1A7LA 3K4UA 3Q25A 3QUFA 4MX6A 1FPGA 3H3GA 4OFJA 1XS5A 4NX1A 2I58A 1XHYA 2OWZA 2DE3A 3B7DA 3SEYA 1YYZA 3IFCA 4XEQA 2OWTA 2F5XA 4RK9A 1EH3A 4ZZEA 4OYVA 4NF5B 1ZLQA 1UQWA 3PV0E 1USYE 2L5VA 4PAKA 5H8HB 1EYIA 2V93A 3K02A 1TWYA 1NUYA 4YAHX 4Q30B 2GQ1A 4GFRA 4PGNA 5HPQA 3DLNA 3V5AA 4EF2A 3KC1A 3C9HA 3HHGA 4G68B 4EXLA 2XD3A 2UVHA 4G77A 4KYSA 1IUDA 2UXAA 2H9BA 4IR8A 2Q8JA 5L9MA 1QW0A 3IORA 2DS9A 2D5WA 1ZU0A 2XD2A 4ZEBA 4GL0A 1MPBA 2DVCA 4R74A 4R6HA 2F34A 4OEVA 3VLWA 3JZJA 1YZ0A 4N6PA 5DW8A 2AIXA 4M1VA 3MJNA 3OOAA 3SEXA 2I49A 5AA3A 4IO7A 3IB1A 1VFEA 3TEPA 1H3DA 4KCCA 4POWA 2O51A 4H45A 4JWYA 1FTMA 2RCBA 4OA4A 2UYEA 4FEDA 5H8FA 1QJMA 1I6AA 2XXXA 2HAVA 1LBVA 4PCDA 4QBAA 2VGQA 1FQDA 1B3LA 3LUZA 1NV4A 1SYHA 4ZECA 5I5PA 2ZMBA 2OJTA 2F7AA 4X04A 1R9QA 2DQVA 2O1MA 2CZLA 2I6EA 4NF4A 4G61A 5K2XA 1RYOA 1MXVA 5ET7A 4KD5A 1MY0A 3KGCA 4JWXA 4PAFA 3SDFA 2YLNA 2Q89A 1FPEA 1KA0A 4OANA 3T22A 2NWJA 2ZNSA 4OERA 2Y7KA 4F1YA 1PB8A 3IR1A 4THIA 3G3GA 4DIGA 1YXIA 1YCJA 2CZHA 3LC8A 1A54A 1SW4A 2DDKA 1PBPA 2QL3A 2GFEA 1I6BA 1BLFA 3RTFB 2VD3A 4PFYA 1AMFA 2ONRA 2HCAA 2XXTA 3P7IA 2E1SA 3PTYA 1IITA 3K1MA 4OVJA 1MDP1 5IZ1A 3L6GA 1NUZA 3VXBA 2RCAA 4ZZAA 2XXIA 3K0VA 5TP9B 1I69A 1LAHE 4EUOA 1JW4A 4WKMA 1XT8A 2ABHA 3OMBA 4IB2A 2HEUA 3HFUA 1SI1A 3FBPA 1JETA 3BIGA 4OMBA 5IGAA 1SW2A 3FJMA 5EQ9A 4NF5A 4RY1A 2KR0A 1AIVA 5FHNA 3G7WA 4MNIA 4PE3A 5H8HA 4EF1A 3VV5A 2UYFA 4NAPA 5BUUA 2HZLA 2I3VA 5J16A 2NOOA 4XKRA 3IAZA 4G68A 1MM6A 3WAFA 5IAIA 2B65A 3PUWE 3KBZA 2E0SA 1UIUA 1BIYA 3LSWA 2AL4A 2PCRA 5DYHA 3E9XA 4HS7A 4PFBA 1II5A 4QFKA 4RXLA 4Q5TA 4F29A 4ISUA 4DI3D 3V8XB 4OENA 2GH9A 3ECRA 3A29A 5CMMA 1DSNA 1K9ZA 4X1BA 1MH3A 1NMUA 4P56A 2Q74A 3OSRA 2QPQA 1FQAA 1IEJA 1QULA 2QMWA 4UA8A 5EHMA 1ATGA 1LEVA 4QSDA 4RK2A 3PPRA 3PMVA 4GRKA 2XX8A 1LB9A 1B51A 2V84A 5M2VA 4PETA 5F7VA 2Q8MA 3FGSA 2PFZA 1J1NA 1OLCA 1MDQA 2XXWA 5I3SA 3GBAA 4NF8B 3E79A 4BLAA 4YICA 3W15C 1B4HA 3F11A 1LBWA 1S7YA 3IK6B 3RY3A 2CZKA 4P1LA 1B32A 2QFLA 4MLVA 4KR5A 4AB6A 4GWWA 3OELA 1QVSA 1VR5A 1PB7A 4PFUA 1B0LA 4GBWA 1WVJA 1NV5A 4YKJA 1G0IA 4ZE8A 4OXVA 3FV1A 1EZ9A 1OLAA 1IXGA 4YKKA 3PPPA 4F3SA 1A40A 3IOWA 4DE8A 3E4RA 4YMBA 3K6XA 3TPAA 3CHGA 3VE1B 1B5HA 1P1OA 1MQHA 1N76A 4ZE9A 3D4CA 5H8SA 1JW5A 1KZ8A 5TP9A 3O2AA 4KQPA 5FTIA 5CM6A 3SZPA 3M3KA 3O66A 2R71A 5KDTB 4NF6B 1LBCA 1NV6A 4DDDA 1K9YA 5I57B 5H8NA 2NXOA 3N6UA 1CB6A 4U1OA 5ET5A 4ESWA 1MQJA 3UGWA 3G3JA 1N0TA 2PT2A 3IO4A 5L8DA 1NI9A 3IOUA 4HE1A 3HV1A 3K00A 2H5YA 3OEKA 3WAEA 4EQ9A 5DT6A 1BK4A 4XKNA 4OEUA 1US4A 3C34A 1IZ1A 2HXRA 3CR9A 4OQOA 4HE0A 2XWOA 4ND9A 1RDZA 4P8BA 1JVYA 3CG1A 3C33A 1F9BA 3IJOB 2DE2A 1QUIA 4EDPA 1CNQA 3EHTA 5DVIA 3G3FA 5AE4A 1FQEA 2WX9A 4JVIA 2DXRA 4MFIA 3SERA 2F36A 1GVCA 3PD8A 1ZKBA 3KC0A 2F7CA 1WDNA 4PC9A 5JTYB 3MZBA 3H6VA 4P47A 1EZOA 2P3VA 3MW0A 4H6DA 4TQUQ 2F97A 1Y9UA 3FVOA 1M5FA 3DP6A 1FTJA 2ZYNA 2GHAA 2R9JA 3VVEA 1NUWA 1R1NA 1TT1A 4QFOA 2VP1A 3IL1B 3RN8A 5AA2A 3M3LA 1YAEA 4LQ2A 4XTCQ 4BDMA 4RNSA 1IMFA 2Q2CA 1SW1A 1Y1ZA 3RGYA 1LGBC 4OFLA 3DP4A 3OO7A 4F31B 4H46A 3KFMA 2LAOA 4DLDA 1B6HA 1ZTYA 5EYGA 3MUQA 2QMXA 2P1SA 2QRYA 5DEXB 2QS3A 3OXNA 2WBBA 3CRBA 3PUZE 4YZZA 1H45A 3KEIA 4NE4A 5FBPA 2VOZA 3K2DA 3SEVA 2IEEA 3IOTA 4NEDA 4FATA 4MJOA 4P0IA 4IO6A 2I0BA 5CMKA 1B0HA 1MQIA 3L6HA 3PGFA 2WYPA 4R9FA 2HQ0A 3T9HB 3TCFA 3VDFA 4ELOA 2ZZWA 4QFLA 2Z8FA 5H8QB 1BKAA 3MZ1A 4EXKA 2HHMA 5AA2D 1LCTA 1M5CA 4TLLB 1R9LA 1OQHA 1FTLA 4H5GA 4RJZA 1MPCA 1VFDA 3SKPA 4IY6A 1MY1A 1URSA 2ANJA 1A8FA 5I2NA 3K6VA 3W9VA 4Z0IA 2Y5LA 2FHYA 2UVJA 4R73A 1IMBA 3T0JA 3MP6A 3PUXE 3UORA 3UN6A 3OO8A 5DTBA 1B1XA 4F18A 4ELRA 2VHAA 3GLBA 2DWAA 2YJPA 2QS2A 2CZIA 5EQ8A 4LZ5A 1RYXA 1FPIA 1JQFA 3MVXA 3V83A 3ILUB 4G8HA 3U92A 2V3UA 4GL8A 1FQFA 2I4BA 3PUYE 1B7ZA 3HCQA 2V3QA 4H8IA 4R75A 1B3FA 2Y7PA 5A5LA 1VE4A 4F3PA 1GR2A 1HSLA 3QYTA 3BKIB 3H03A 2O7UA 4DCXA 5CMBA 4P1EA 3BFTA 4YKIA 1LFIA 1FSAA 1XC1A 1POY1 2D21A 5K2YA 4F39A 1MRPA 5JTYA 1ZIUA 3RPWA 4LZ8A 3KZGA 3CFLA 1LBBA 2GRVA 2P3NA 5I59B 4TLMB 3RPLB 1B3GA 1GV8A 4FAJA 1OVTA 3K1PA 4RPNA 2VT5A 4NQ8A 3PU5A 2ALUA 3O6HA 1LBZA 2ZYOA 3ZSFA 4O8MA 1NNFA 4N8YA 4QF9A 3MPKA 4XF5A 2HXWA 1TXFA 1O7TA 4KI0E 1FRPA 5EQAA 1R6ZA 4LA9A 1MY4A 4PBHA 4N81A 1LB8A 2VPNA 1FBGA 1QGXA 2F6PA 3I3VA 3FIRA 1XI6A 3UA8A 2CMOA 3RNNA 1O64A 1FPDA 3H6TA 5DEXA 3G3IA 5EHSA 2M8CA 4I62A 5KZTA 4MBPA 2YPNA 1XVXA 3ISPA 2ESNA 5LDZA 1SBPA 1A99A 4I9DA 2OZZA 3SEWA 4EQ7A 5F1QA 3C35A 2DOJA 2X7PA 3VLVA 1Y3PA 3MAMA 3T96B 5AA4B 1FBDA 3VVDA 3CIJA 4ZS9A 2A5TB 4OWDA 2O68A 5ET8A 1N7WA 2XA5A 1JP4A 1MG1A 3OEMA 4PFIA 4O3AA 1FTAA 1GTKA 4U23A 4DXCA 3QIMA 1N3WA 2HZKA 5LOMA 1B5JA 4LUBA 5DVFA 2F8DA 4MF3A 4MLQA 3I6VA 2OLBA 4ESXA 3GXAA 1SQYA 3OO9A 4I8CA 3BFUA 1NV1A 3O6IA 1M5DA 4OVPA 4F2OA 1N84A 4FORA 3U72A 1B46A 3K6UA 1MXXA 3ROJA 3H4ZA 4PF8A 5CI5A 5IZ3B 1SVXB 3FUZA 4N8GA 3N5LA 2PMSA 2QJEA 3CSBA 3FXBA 4MMPA 4FEBA 4PDDA 5ISUA 1DTGA 1SD3A 4QHQA 5DVJA 5AA1A 1T0KA 2A5SA 2RC7A 1PB9A 4JBZA 3W9WA 1Y20A 2V25A 1P1NA 4C1UA 1FBHA 2IA4A 3USDA 5ELVA 1EYKA 4MHFA 3CG3A 1IMEA 4EQBA 1ELJA 2VPOA 1EU8A 1UTHB 2RC8A 2ZNTA 1MQGA 3FASA 3O28A 3QK6A 5I59A 4PP0A 4L17A 4BDQA 4R9GA 3LSXA 5L9OA 3Q26A 2Z22A 4E0WA 1M5EA 2GHBA 1IXIA 1NV7A 4G68C 4N91A 1UIVA 4HE2A 4PGPA 1FQCA 2I48A 3N6TA 3TZAA 1N7XA 1O63A 2OCUA 3V89B 1H44A 3MVYA 4IO3A 4YB7A 1HSEA 3K6WA 3S9MC 4GQOA 3IFAA 4DZ1A 3TODA 2Z23A 4IGRA 2ZNUA 4O94A 4XKQA 2XWKA 4LQ5A 1NFTA 4ELQA 2F3DA 4GX6A 5CBSA 4GBVA 4U4XA 1B7UA 1B5IA 2I4CA 1IXCA 4JSDA 3KN8A 3EHSA 1N3XA 3CSGA 3MZ9A 3C31A 4GLIA 4U22A 4GIZA 2PFYA 3VVFA 3JV9A 4KPTA 1Q1KA 4DI4B 4PDHA 5CRYA 3QUJA 3H6UA 5ET6A 4YU0A 3O6GA 2QVRA 3RT8A 3KN3A 5TPAB 1PC3A 3B6TA 3OO6A 3FXUA 2B3BA 2NVUB 4H1XA 2XX9A 1Y4TA 3B6WA 2AL5A 4JSOA 3TTKA 5AA4A 2P0SA 3EHUA 1OQGA 1P1QA 3A09A 3LV0A 5FHOA 4PAIA 2NUVA 4RYAA 4LN5A 5BWJA 5HM4B 1M5BA 1QKBA 2A5TA 1PDAA 2FYIA 4NN3A 1DPEA 4O7IA 4AQ4A 4I40A 3DP8A 3TTNA 1D9YA 4IO4A 4KFQA 1JW1A 1MQDA 3N94A 1D4NA 3TQWA 2P2AA 1S9TA 3HSTA 3R7XA 3U65A 1POTA 3IO6A 2B3FA 2RINA 4N4UA 1FBFA 3PPOA 2FBPA 1MY2A 4DXBA 2X26A 3TCHA 1B40A 1IIWA 3FVKA 4XIGQ 2ONKE 5T3JA 1QUJA 5IZ3A 1DCUA 1B58A 2UVGA 2RKMA 3B50A 2PT1A 3SEUA 1Q35A 3S9EA 1SPIA 1INPA 4MNPA 4GXSB 1FPKA 4HXVA 3B8BA 1AL3A 3T93B 4KCDA 3ODBA 5FHMA 2FIEA 4TOZA 3UP9A 1NNKA 2O7IA 3OENA 4H0WA 5TU0A 1LSTA 5IM2A 4F19A 4N6DA 3IJXB 1OVBA 2VD2A 1FW0A 3PPNA 1DTZA 3G3HA 3O97A 4HTGA 4U2RA 2ZZXA 3DELB 2ZZVA 4NF8A 1MPDA 4ZEIA 1FTOA 3C4MA 3QXMA 5B7DA 3GZGA 5J1DA 4NF4B 4X1DA 1UTBB 5HBCA 3KOSA 1JVXA 1Q9DA 1LBYA 2DYXA 2ZYKA 1A8EA 2AYSA 1DK4A 2O84X 1SDXA 2FVZA 4H5FA 1MH4A 4MH5A 1AOVA 2FA7A 3Q27A 4JVDA 4PBQA 1MM7A 1BP5A 5L9SA 1RKMA 4R6YA 3KJ7A 2G93A 4QFPA 4F2QA 1ZMGA 3T66A 4HW8A 1PEBA 4NWDA 3LBSA 5I2KB 1KWHA 4MEVA 1XVYA 3EQ1A 4GWSA 4GD5A 4F22A 3H6WA 3ZKKA 3R6UA 4IO5A 4BDOA 4LATA 4LZ7A 3IB0A 3T1BA 3LSLA 5KDTA 2UVIA 4NF6A 1FBPA 4OVSA 2V4CA 2REJA 4GWUA 5I57A 3FJ7A 1YTVA 4PFRA 5ICTA 4FECA 3MBPA 2OBGA 4M4GA 3O29A 2XXUA 1IQ7A 1B3HA 3E78A 3UK4A 1I6QA 1WODA 1D3KA 1MXUA 2RF1A 4GX3A 3TTRA 4P9KA 3O9PA 3TKDA 2OX3A 4C0RA 3KJTA 4G4PA 1IMAA 4OVQA 4OTEA 4U1ZA 4NG7A 3PMWA 1B3EA 4NF0A 3NOHA 2FNCA 3PPQA 4FJPA 2HPGA 3CFZA 1NV2A 4R2FA 3PUVE 3FVGA 2DVZA 2CEXA 2HFBA 3TMGA 4Q8RA 3SESA 1US5A 1QUKA 4HCYA 1IXHA 2DXYA 4G8MA 3KSJA 2FIXA 3QMFA 3TUSA 1MXYA 1FBCA 1FJ6A 4QXDA 4QSCA 1SYIA 5ICQA 3FJGA 4XXUA 2JJKA 3MSTA 3BBRA 2Z8DA 3TFLA 4OESA 4UACA 4LVQA 5KCJB 3IOVA 4I3EA 4YMAA 2B4LA 1NUXA 4Z7EA 2H4IA 2XWVA 1D9QA 3MP8A 2XXQA 4KYEA 1NV3A 3ILTB 2ZYMA 1LBXA 4E0XA 4OFOA 3M3FA 1YPNA 1B2HA 2THIA 3OSQA 4UABA 1NKXA 3FV2A 3UIFA 3MPLA 4ELPA 3A3CA 1QKAA 3S4UA 2XXKA 4NGUA 2XXPA 1UTBA 3DM0A 1P99A 2RC9A 2W7YA 4IY5A 5I58B 3CI8A 1NV0A 4ZEDA 3KBRA 2F3BA 4IGTA 4AS5A 1ANFA 3U94A 4BDRA 4GF8A 3FZVA 5ESYA 3H06B 1JNFA 5I56B 4NWCA 1A55A 2DWHA 2DWIA 4JDFA 4NHBA 4ECFA 2DP8A 5I2KA 1BTJA 1LCFA 2X7QA 2XXRA 1FBEA 1B05A 4GVOA 4WXJA 2XHDA 4FIMA 3MYUA 1P1WA 1Y3NA 2B4MA 5H8QA 1LLSA 4GWZA 4P3LA 3EPEA 4IO2A 1D9VA 5EQ7A 4BDNA 3KOTA 3FD3A 4F1VA 1NNPA 2BJIA 3MQ9A 3RTWB 3TQLA 1FPJA 3TTLA 1DMBA 5CMCA 3TDJA 3FATA 4AS4A 5CBRA 3LUYA 1CE2A 3FXQA 5H8NB 4C1TA 4OVTA 1LAGE 4ZEKA 4O3CA 3GYYA 1TFAA 4FE8A 4NMYA 2I3WA 3KSXA 4ZDMA 4PQJA 4MNCA 4QRZA 4N07A 3S2VA 5IKBA 1NNTA 2WYKA 4N15A 3JYRA 2HAUA 2F7BA 1FCKA 2Y84A 1NH8A 3RUMA 4GX4A 3LSFB 1SW5A 3EN3A 3C32A 3FXRA 4GWYA 4F3BA 2WEFA 4YKPA 3QAXA 2MKZA 3MVZA 1FQBA 3ZKLA 3HO7A 2DE4A 1LFGA 3MP1A 2QSXA 4ONYA 4R2BA 2H99A 2XXHA 4K3FA 1NL5A 1DOTA 4HCWA 4WEPA 1B1HA 1URGA 3HN0A 4JB7A 3A3UA 4R6KA 4R72A 1RDYA 2KLFA 3AXFA 5KCJA 1B4ZA 1XOCA 5A5XB 4MCOA 3TELA 2QVVA 1IMCA 1FPLA 5LTCA 1ZBMA 4PE5B 4JXIA 3Q28A 3RPLA 3S9NC 4RPOA 4X8RA 3K01A 1MXZA 1VSOA 3RYDA 1Y4CA 3G3KA 4OVRA 1MY3A 2REGA 4PFWA 4H8JA 4X48A 3T9XB 1Z7NE 1S50A 3HPIA 4H65A 3U1OA 3TTMA 3CFXA 4F1UA 4GOTA 3K1NA 4Q0CA 1EZPA 5I7IA 5AA2B 2OWSA 3SETA 3IB2A 5B70A 2OK2A 3THIA 5I58A 4KYDA 1NH7A 3PMXA 4OZ9A 1B9JA 1LAFE 4X9TA 2XXVA 5FTHA 1HSJA 4JVCA 3MC2A 1URDA 3KN7A 4I3YA 5JEIA 1FPFA 2O1LA 3PD9A 4N13A 2Z8EA 4N6KA 4JWOA 3ZS6A 1OMPA 2I0CA 1Y1MA 2F35A 4PF6A 1FTKA 2Q2AA 4XFEA 3VFJA 4LONB 5I56A 2DWJA 3E13X 3E3KA 4DCYA 4I1DA 3VXCA 4BDLA 1ZJLA 3TCGA 2R8TA 1SI0A 1PBQA 1B7HA 1IMDA 5EYFA 4F3GA 3ONMA 4OETA 1EYJA 3CVGA 1DBZA 3FVNA 5F24A 4DXUA 4OHNA 4G8NA 1N04A 4QFNA 3U8QA 3EF7A 4LP2B 1LFHA 5CC2A 3U93A 4U4SA 3D1RA 2H98A 2WBDA 5ITPA 1KA1A 2QS4A 2Q9TA 4G2ZA 2O69A 5I2NB 2XWIA 3OD7A 3R26A 3Q29A 4XKPA 3C36A 1RDXA 3RLFE 2CEYA 1LAXA 4MIJA 4P0GA 3I5OA 3M8UA 3KG2A 1AWBA 2Y7WA 1DPPA 3B6QA 4KXPA 3RT6B 2F78A 1TFDA 1GGGA 1FJ9A 1G0HA 3QSLA 5I84A 2ZXTA 3T9VA 4ZEFA 1B52A 4POXA 4RA1A 2Y5KA 5IZZA 3BIHA 4QSEA 4YB5A 3MWBA 4GWOA 3RQTA 2PBWA 3VLUA 2G29A 2QVUA 3H7MA 5JK4A 2XXYA 1OIBA 5A5XA 4YB6A 3HHFA 4PTKA 1L5TA 4WEDA 1UTHA 2KQZA 2WKYA 2Q88A 1P1UA 2V3TA 2D3IA 5H8FB 5ITOA 2DSFA 4KHZE 4O3BA 4N17A 2PVUA 2PX1A 2F6GA 4O7MA 3TAJA 2O6AA 4GWXA 3IX1A 4PFTA 1H76A 1Y3QA 3EKIA 1MS7A 2ONSA 2Y7IA 2PYYA 2BJJX 1FPBA 3TYHA 3D4GA 1MXWA 3LR1A 1Z7ME 1JEVA 1USYH 1AH5A 4MAGA 3N26A 2QS1A
chains in the Genus database with same CATH topology
3GBBA 2R6GE 2Y7RA 4AB5A 4U21A 1H43A 1JEUA 4NTLA 4H67A 3S9LC 4GXAA 3T9UA 2XX7A 2H25A 3MVWA 4P11A 5TPAA 1A7LA 3K4UA 3Q25A 3QUFA 3H3GA 4OFJA 1XS5A 2I58A 1XHYA 2DE3A 3B7DA 3SEYA 2OWTA 2F5XA 4RK9A 1EH3A 4ZZEA 4OYVA 4NF5B 1ZLQA 1UQWA 3PV0E 1USYE 5H8HB 2V93A 3K02A 1TWYA 4YAHX 4Q30B 4GFRA 5HPQA 3DLNA 3V5AA 4EF2A 3C9HA 3HHGA 4G68B 4EXLA 2XD3A 2UVHA 4G77A 4KYSA 1IUDA 2UXAA 2H9BA 2Q8JA 5L9MA 1QW0A 3IORA 2DS9A 2D5WA 1ZU0A 2XD2A 4ZEBA 4GL0A 1MPBA 2DVCA 4R74A 4R6HA 2F34A 4OEVA 3VLWA 3JZJA 4N6PA 2AIXA 4M1VA 3MJNA 3OOAA 3SEXA 2I49A 5AA3A 4IO7A 3IB1A 1VFEA 3TEPA 1H3DA 4KCCA 4POWA 2O51A 4JWYA 1FTMA 2RCBA 2UYEA 4FEDA 5H8FA 1QJMA 1I6AA 2XXXA 2HAVA 2VGQA 1FQDA 1B3LA 1SYHA 4ZECA 2ZMBA 2OJTA 2F7AA 1R9QA 2DQVA 2O1MA 2CZLA 2I6EA 4NF4A 5K2XA 1RYOA 1MXVA 4KD5A 1MY0A 3KGCA 4JWXA 3SDFA 2YLNA 2Q89A 3T22A 2NWJA 2ZNSA 4OERA 2Y7KA 4F1YA 1PB8A 3IR1A 4THIA 3G3GA 4DIGA 1YCJA 3LC8A 1A54A 1SW4A 1PBPA 2QL3A 2GFEA 1I6BA 1BLFA 3RTFB 2VD3A 4PFYA 1AMFA 2ONRA 2HCAA 2XXTA 3P7IA 2E1SA 1IITA 3K1MA 4OVJA 1MDP1 3L6GA 3VXBA 2RCAA 4ZZAA 2XXIA 3K0VA 5TP9B 1I69A 1LAHE 4EUOA 1JW4A 4WKMA 1XT8A 2ABHA 3OMBA 4IB2A 2HEUA 1SI1A 1JETA 4OMBA 1SW2A 3FJMA 4NF5A 4RY1A 1AIVA 5FHNA 3G7WA 5H8HA 4EF1A 3VV5A 2UYFA 5BUUA 2HZLA 2I3VA 2NOOA 4XKRA 3IAZA 4G68A 1MM6A 3WAFA 5IAIA 2B65A 3PUWE 2E0SA 1UIUA 1BIYA 3LSWA 2AL4A 5DYHA 3E9XA 4HS7A 1II5A 4QFKA 4RXLA 4Q5TA 4F29A 4ISUA 3V8XB 4OENA 2GH9A 3ECRA 5CMMA 1DSNA 4X1BA 1MH3A 1NMUA 3OSRA 2QPQA 1FQAA 1IEJA 1QULA 2QMWA 4UA8A 5EHMA 1ATGA 4QSDA 4RK2A 3PPRA 3PMVA 4GRKA 2XX8A 1LB9A 1B51A 2V84A 5M2VA 4PETA 5F7VA 3FGSA 1J1NA 1OLCA 1MDQA 2XXWA 3GBAA 4NF8B 4BLAA 4YICA 3W15C 1B4HA 3F11A 1S7YA 3IK6B 3RY3A 1B32A 4MLVA 4AB6A 4KR5A 3OELA 1QVSA 1VR5A 1PB7A 4PFUA 1B0LA 1WVJA 4YKJA 4ZE8A 4OXVA 3FV1A 1EZ9A 1OLAA 1IXGA 4YKKA 3PPPA 4F3SA 1A40A 3IOWA 4DE8A 3E4RA 4YMBA 3K6XA 3TPAA 3VE1B 1B5HA 1P1OA 1MQHA 1N76A 4ZE9A 3D4CA 5H8SA 1JW5A 5TP9A 3O2AA 4KQPA 5FTIA 5CM6A 3M3KA 3O66A 2R71A 5KDTB 4NF6B 1LBCA 4DDDA 5I57B 5H8NA 2NXOA 3N6UA 1CB6A 4U1OA 4ESWA 1MQJA 3UGWA 3G3JA 1N0TA 2PT2A 3IO4A 5L8DA 3IOUA 3HV1A 3K00A 2H5YA 3OEKA 3WAEA 4EQ9A 5DT6A 4XKNA 4OEUA 1US4A 3C34A 1IZ1A 3CR9A 4OQOA 4ND9A 1JVYA 3CG1A 3C33A 1F9BA 3IJOB 2DE2A 1QUIA 4EDPA 3EHTA 5DVIA 3G3FA 5AE4A 1FQEA 2DXRA 4MFIA 3SERA 2F36A 1GVCA 3PD8A 1ZKBA 2F7CA 1WDNA 5JTYB 3MZBA 3H6VA 1EZOA 3MW0A 4H6DA 4TQUQ 2F97A 1Y9UA 3FVOA 1M5FA 3DP6A 1FTJA 2ZYNA 2GHAA 2R9JA 3VVEA 1R1NA 1TT1A 4QFOA 2VP1A 3IL1B 3RN8A 5AA2A 3M3LA 1YAEA 4LQ2A 4XTCQ 4BDMA 4RNSA 2Q2CA 1SW1A 1Y1ZA 3RGYA 1LGBC 4OFLA 3DP4A 3OO7A 4F31B 3KFMA 2LAOA 4DLDA 1B6HA 1ZTYA 3MUQA 2QMXA 2P1SA 2QRYA 5DEXB 2QS3A 3OXNA 3CRBA 3PUZE 4YZZA 1H45A 3KEIA 4NE4A 2VOZA 3K2DA 3SEVA 2IEEA 3IOTA 4NEDA 4FATA 4P0IA 4IO6A 2I0BA 5CMKA 1B0HA 1MQIA 3L6HA 3PGFA 4R9FA 2HQ0A 3T9HB 3TCFA 3VDFA 4ELOA 4QFLA 2Z8FA 5H8QB 1BKAA 3MZ1A 4EXKA 5AA2D 1LCTA 1M5CA 4TLLB 1R9LA 1OQHA 1FTLA 4H5GA 4RJZA 1MPCA 1VFDA 3SKPA 4IY6A 1MY1A 1URSA 2ANJA 1A8FA 5I2NA 3K6VA 3W9VA 4Z0IA 2UVJA 4R73A 3MP6A 3PUXE 3UORA 3UN6A 3OO8A 5DTBA 1B1XA 4F18A 4ELRA 2VHAA 3GLBA 2DWAA 2YJPA 2QS2A 4LZ5A 1RYXA 1JQFA 3MVXA 3V83A 3ILUB 4G8HA 3U92A 2V3UA 4GL8A 1FQFA 2I4BA 3PUYE 1B7ZA 3HCQA 2V3QA 4H8IA 4R75A 1B3FA 2Y7PA 1VE4A 4F3PA 1GR2A 1HSLA 3QYTA 3BKIB 3H03A 2O7UA 4DCXA 5CMBA 3BFTA 4YKIA 1LFIA 1XC1A 1POY1 2D21A 5K2YA 4F39A 1MRPA 5JTYA 1ZIUA 3RPWA 4LZ8A 3KZGA 3CFLA 1LBBA 2GRVA 5I59B 4TLMB 1B3GA 1GV8A 4FAJA 1OVTA 3K1PA 4RPNA 3PU5A 2ALUA 3O6HA 2ZYOA 3ZSFA 1NNFA 4QF9A 3MPKA 2HXWA 1TXFA 1O7TA 4KI0E 1R6ZA 4LA9A 1MY4A 1LB8A 2F6PA 3I3VA 3FIRA 3UA8A 2CMOA 3RNNA 1O64A 3H6TA 5DEXA 3G3IA 5EHSA 2M8CA 4I62A 5KZTA 4MBPA 2YPNA 1XVXA 2ESNA 1SBPA 1A99A 4I9DA 2OZZA 3SEWA 4EQ7A 5F1QA 3C35A 2DOJA 2X7PA 3VLVA 1Y3PA 3MAMA 3T96B 5AA4B 3VVDA 3CIJA 4ZS9A 2A5TB 4OWDA 2O68A 1N7WA 1MG1A 3OEMA 4O3AA 1GTKA 4U23A 4DXCA 3QIMA 1N3WA 2HZKA 5LOMA 1B5JA 4LUBA 5DVFA 2F8DA 4MF3A 4MLQA 3I6VA 2OLBA 4ESXA 3GXAA 1SQYA 3OO9A 4I8CA 3BFUA 3O6IA 1M5DA 4F2OA 1N84A 4FORA 3U72A 1B46A 3K6UA 1MXXA 3H4ZA 5CI5A 1SVXB 3FUZA 3N5LA 2PMSA 2QJEA 3CSBA 4FEBA 5ISUA 1DTGA 1SD3A 4QHQA 5DVJA 5AA1A 1T0KA 2A5SA 2RC7A 1PB9A 4JBZA 3W9WA 1Y20A 2V25A 1P1NA 4C1UA 2IA4A 3USDA 5ELVA 3CG3A 4EQBA 1ELJA 1EU8A 1UTHB 2RC8A 2ZNTA 1MQGA 3FASA 3O28A 3QK6A 5I59A 4PP0A 4L17A 4BDQA 4R9GA 3LSXA 5L9OA 3Q26A 2Z22A 4E0WA 1M5EA 2GHBA 1IXIA 4G68C 1UIVA 1FQCA 2I48A 3N6TA 3TZAA 1N7XA 1O63A 2OCUA 3V89B 1H44A 3MVYA 4IO3A 4YB7A 1HSEA 3K6WA 3S9MC 4GQOA 4DZ1A 3TODA 2Z23A 4IGRA 2ZNUA 4XKQA 4LQ5A 1NFTA 4ELQA 5CBSA 4U4XA 1B7UA 1B5IA 2I4CA 1IXCA 4JSDA 3KN8A 3EHSA 1N3XA 3CSGA 3MZ9A 3C31A 4GLIA 4U22A 4GIZA 3VVFA 3JV9A 4KPTA 1Q1KA 5CRYA 3QUJA 3H6UA 4YU0A 3O6GA 3RT8A 3KN3A 5TPAB 1PC3A 3B6TA 3OO6A 3FXUA 2B3BA 2NVUB 4H1XA 2XX9A 1Y4TA 3B6WA 2AL5A 4JSOA 3TTKA 5AA4A 2P0SA 3EHUA 1OQGA 1P1QA 3A09A 5FHOA 2NUVA 4RYAA 5BWJA 5HM4B 1M5BA 1QKBA 2A5TA 1PDAA 2FYIA 1DPEA 4AQ4A 3DP8A 3TTNA 1D9YA 4IO4A 4KFQA 1JW1A 1MQDA 3N94A 1D4NA 3TQWA 2P2AA 1S9TA 3HSTA 3R7XA 1POTA 3IO6A 2B3FA 2RINA 3PPOA 1MY2A 4DXBA 2X26A 3TCHA 1B40A 1IIWA 3FVKA 4XIGQ 2ONKE 1QUJA 1B58A 2UVGA 2RKMA 2PT1A 3SEUA 1Q35A 3S9EA 4GXSB 1AL3A 3T93B 4KCDA 3ODBA 5FHMA 4TOZA 3UP9A 1NNKA 2O7IA 3OENA 4H0WA 5TU0A 1LSTA 4F19A 3IJXB 1OVBA 2VD2A 1FW0A 3PPNA 1DTZA 3G3HA 3O97A 4HTGA 4U2RA 3DELB 4NF8A 1MPDA 4ZEIA 1FTOA 3C4MA 3QXMA 5B7DA 3GZGA 5J1DA 4NF4B 4X1DA 1UTBB 5HBCA 3KOSA 1JVXA 2DYXA 2ZYKA 1A8EA 2AYSA 2O84X 1SDXA 4H5FA 1MH4A 4MH5A 1AOVA 2FA7A 3Q27A 1MM7A 1BP5A 5L9SA 1RKMA 4R6YA 3KJ7A 2G93A 4QFPA 4F2QA 1ZMGA 3T66A 4HW8A 1PEBA 4NWDA 3LBSA 5I2KB 1KWHA 1XVYA 3EQ1A 4GD5A 4F22A 3H6WA 3ZKKA 3R6UA 4IO5A 4BDOA 4LATA 4LZ7A 3IB0A 3LSLA 5KDTA 2UVIA 4NF6A 2REJA 5I57A 3FJ7A 1YTVA 5ICTA 4FECA 3MBPA 2OBGA 4M4GA 3O29A 2XXUA 1IQ7A 1B3HA 3UK4A 1I6QA 1WODA 1D3KA 1MXUA 2RF1A 3TTRA 3TKDA 3O9PA 4C0RA 3KJTA 4G4PA 4OTEA 4U1ZA 3PMWA 1B3EA 2FNCA 3PPQA 4FJPA 3CFZA 4R2FA 3PUVE 3FVGA 2DVZA 2HFBA 3TMGA 4Q8RA 3SESA 1US5A 1QUKA 4HCYA 1IXHA 2DXYA 4G8MA 3KSJA 3TUSA 1MXYA 4QSCA 1SYIA 5ICQA 3FJGA 4XXUA 3BBRA 2Z8DA 3TFLA 4OESA 4UACA 4LVQA 5KCJB 3IOVA 4YMAA 4Z7EA 2H4IA 3MP8A 2XXQA 4KYEA 3ILTB 2ZYMA 4E0XA 4OFOA 3M3FA 1YPNA 1B2HA 2THIA 3OSQA 1NKXA 3FV2A 3UIFA 3MPLA 4ELPA 3A3CA 1QKAA 3S4UA 2XXPA 1UTBA 3DM0A 1P99A 2RC9A 2W7YA 4IY5A 5I58B 3CI8A 4ZEDA 3KBRA 4IGTA 1ANFA 3U94A 4BDRA 4GF8A 3FZVA 3H06B 1JNFA 5I56B 1A55A 2DWHA 2DWIA 4JDFA 4NWCA 4ECFA 2DP8A 5I2KA 1BTJA 1LCFA 2X7QA 2XXRA 1B05A 4GVOA 4WXJA 2XHDA 4FIMA 1P1WA 1Y3NA 5H8QA 1LLSA 3EPEA 4IO2A 1D9VA 4BDNA 3KOTA 3FD3A 4F1VA 1NNPA 3MQ9A 3RTWB 3TQLA 3TTLA 3TDJA 1DMBA 5CMCA 3FATA 5CBRA 3LUYA 1CE2A 3FXQA 5H8NB 4C1TA 1LAGE 4ZEKA 4O3CA 1TFAA 4FE8A 4NMYA 2I3WA 3KSXA 4ZDMA 4PQJA 4QRZA 4N07A 3S2VA 5IKBA 1NNTA 3JYRA 2HAUA 2F7BA 1FCKA 2Y84A 1NH8A 3RUMA 3LSFB 1SW5A 3EN3A 3C32A 3FXRA 4F3BA 4YKPA 3QAXA 3MVZA 1FQBA 3ZKLA 3HO7A 2DE4A 1LFGA 3MP1A 2QSXA 4ONYA 4R2BA 2H99A 2XXHA 4K3FA 1NL5A 1DOTA 4HCWA 4WEPA 1B1HA 1URGA 3HN0A 4JB7A 3A3UA 4R6KA 4R72A 2KLFA 3AXFA 5KCJA 1B4ZA 1XOCA 5A5XB 3TELA 1ZBMA 4PE5B 4JXIA 3Q28A 3S9NC 4RPOA 3K01A 1MXZA 1VSOA 1Y4CA 3G3KA 1MY3A 2REGA 4PFWA 4H8JA 4X48A 3T9XB 1Z7NE 1S50A 3HPIA 4H65A 3U1OA 3TTMA 3CFXA 4F1UA 4GOTA 3K1NA 4Q0CA 1EZPA 5AA2B 2OWSA 3SETA 3IB2A 5B70A 2OK2A 3THIA 5I58A 4KYDA 1NH7A 3PMXA 4OZ9A 1B9JA 1LAFE 4X9TA 2XXVA 5FTHA 1HSJA 3MC2A 1URDA 3KN7A 5JEIA 2O1LA 3PD9A 4N13A 2Z8EA 4JWOA 3ZS6A 1OMPA 2I0CA 1Y1MA 2F35A 3VFJA 1FTKA 2Q2AA 4LONB 5I56A 2DWJA 3E13X 3E3KA 4DCYA 4I1DA 3VXCA 4BDLA 1ZJLA 3TCGA 1SI0A 1PBQA 1B7HA 5EYFA 4F3GA 3ONMA 4OETA 3CVGA 3FVNA 4DXUA 4OHNA 4G8NA 1N04A 4QFNA 3U8QA 3EF7A 4LP2B 1LFHA 5CC2A 3U93A 4U4SA 2H98A 5ITPA 2QS4A 2Q9TA 4G2ZA 2O69A 5I2NB 3OD7A 3R26A 3Q29A 4XKPA 3C36A 3RLFE 1LAXA 4P0GA 3I5OA 3M8UA 3KG2A 2Y7WA 1DPPA 3B6QA 3RT6B 2F78A 1TFDA 1GGGA 3QSLA 5I84A 2ZXTA 3T9VA 4ZEFA 1B52A 4POXA 4RA1A 4QSEA 4YB5A 3MWBA 4GWOA 3RQTA 2PBWA 3VLUA 2G29A 3H7MA 5JK4A 2XXYA 1OIBA 5A5XA 4YB6A 3HHFA 1L5TA 4WEDA 1UTHA 2WKYA 2Q88A 1P1UA 2V3TA 2D3IA 5H8FB 5ITOA 2DSFA 4KHZE 4O3BA 2PVUA 2PX1A 2F6GA 3TAJA 2O6AA 3IX1A 4PFTA 1H76A 1Y3QA 1MS7A 2ONSA 2Y7IA 2PYYA 2BJJX 3TYHA 3D4GA 1MXWA 3LR1A 1Z7ME 1JEVA 1USYH 1AH5A 3N26A 2QS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GBB A;  2R6G E;  2Y7R A;  4AB5 A;  4U21 A;  1H43 A;  1JEU A;  4NTL A;  4H67 A;  3S9L C;  4GXA A;  3T9U A;  2XX7 A;  2H25 A;  3MVW A;  4P11 A;  5TPA A;  1A7L A;  3K4U A;  3Q25 A;  3QUF A;  3H3G A;  4OFJ A;  1XS5 A;  2I58 A;  1XHY A;  2DE3 A;  3B7D A;  3SEY A;  2OWT A;  2F5X A;  4RK9 A;  1EH3 A;  4ZZE A;  4OYV A;  4NF5 B;  1ZLQ A;  1UQW A;  3PV0 E;  1USY E;  5H8H B;  2V93 A;  3K02 A;  1TWY A;  4YAH X;  4Q30 B;  4GFR A;  5HPQ A;  3DLN A;  3V5A A;  4EF2 A;  3C9H A;  3HHG A;  4G68 B;  4EXL A;  2XD3 A;  2UVH A;  4G77 A;  4KYS A;  1IUD A;  2UXA A;  2H9B A;  2Q8J A;  5L9M A;  1QW0 A;  3IOR A;  2DS9 A;  2D5W A;  1ZU0 A;  2XD2 A;  4ZEB A;  4GL0 A;  1MPB A;  2DVC A;  4R74 A;  4R6H A;  2F34 A;  4OEV A;  3VLW A;  3JZJ A;  4N6P A;  2AIX A;  4M1V A;  3MJN A;  3OOA A;  3SEX A;  2I49 A;  5AA3 A;  4IO7 A;  3IB1 A;  1VFE A;  3TEP A;  1H3D A;  4KCC A;  4POW A;  2O51 A;  4JWY A;  1FTM A;  2RCB A;  2UYE A;  4FED A;  5H8F A;  1QJM A;  1I6A A;  2XXX A;  2HAV A;  2VGQ A;  1FQD A;  1B3L A;  1SYH A;  4ZEC A;  2ZMB A;  2OJT A;  2F7A A;  1R9Q A;  2DQV A;  2O1M A;  2CZL A;  2I6E A;  4NF4 A;  5K2X A;  1RYO A;  1MXV A;  4KD5 A;  1MY0 A;  3KGC A;  4JWX A;  3SDF A;  2YLN A;  2Q89 A;  3T22 A;  2NWJ A;  2ZNS A;  4OER A;  2Y7K A;  4F1Y A;  1PB8 A;  3IR1 A;  4THI A;  3G3G A;  4DIG A;  1YCJ A;  3LC8 A;  1A54 A;  1SW4 A;  1PBP A;  2QL3 A;  2GFE A;  1I6B A;  1BLF A;  3RTF B;  2VD3 A;  4PFY A;  1AMF A;  2ONR A;  2HCA A;  2XXT A;  3P7I A;  2E1S A;  1IIT A;  3K1M A;  4OVJ A;  1MDP 1;  3L6G A;  3VXB A;  2RCA A;  4ZZA A;  2XXI A;  3K0V A;  5TP9 B;  1I69 A;  1LAH E;  4EUO A;  1JW4 A;  4WKM A;  1XT8 A;  2ABH A;  3OMB A;  4IB2 A;  2HEU A;  1SI1 A;  1JET A;  4OMB A;  1SW2 A;  3FJM A;  4NF5 A;  4RY1 A;  1AIV A;  5FHN A;  3G7W A;  5H8H A;  4EF1 A;  3VV5 A;  2UYF A;  5BUU A;  2HZL A;  2I3V A;  2NOO A;  4XKR A;  3IAZ A;  4G68 A;  1MM6 A;  3WAF A;  5IAI A;  2B65 A;  3PUW E;  2E0S A;  1UIU A;  1BIY A;  3LSW A;  2AL4 A;  5DYH A;  3E9X A;  4HS7 A;  1II5 A;  4QFK A;  4RXL A;  4Q5T A;  4F29 A;  4ISU A;  3V8X B;  4OEN A;  2GH9 A;  3ECR A;  5CMM A;  1DSN A;  4X1B A;  1MH3 A;  1NMU A;  3OSR A;  2QPQ A;  1FQA A;  1IEJ A;  1QUL A;  2QMW A;  4UA8 A;  5EHM A;  1ATG A;  4QSD A;  4RK2 A;  3PPR A;  3PMV A;  4GRK A;  2XX8 A;  1LB9 A;  1B51 A;  2V84 A;  5M2V A;  4PET A;  5F7V A;  3FGS A;  1J1N A;  1OLC A;  1MDQ A;  2XXW A;  3GBA A;  4NF8 B;  4BLA A;  4YIC A;  3W15 C;  1B4H A;  3F11 A;  1S7Y A;  3IK6 B;  3RY3 A;  1B32 A;  4MLV A;  4AB6 A;  4KR5 A;  3OEL A;  1QVS A;  1VR5 A;  1PB7 A;  4PFU A;  1B0L A;  1WVJ A;  4YKJ A;  4ZE8 A;  4OXV A;  3FV1 A;  1EZ9 A;  1OLA A;  1IXG A;  4YKK A;  3PPP A;  4F3S A;  1A40 A;  3IOW A;  4DE8 A;  3E4R A;  4YMB A;  3K6X A;  3TPA A;  3VE1 B;  1B5H A;  1P1O A;  1MQH A;  1N76 A;  4ZE9 A;  3D4C A;  5H8S A;  1JW5 A;  5TP9 A;  3O2A A;  4KQP A;  5FTI A;  5CM6 A;  3M3K A;  3O66 A;  2R71 A;  5KDT B;  4NF6 B;  1LBC A;  4DDD A;  5I57 B;  5H8N A;  2NXO A;  3N6U A;  1CB6 A;  4U1O A;  4ESW A;  1MQJ A;  3UGW A;  3G3J A;  1N0T A;  2PT2 A;  3IO4 A;  5L8D A;  3IOU A;  3HV1 A;  3K00 A;  2H5Y A;  3OEK A;  3WAE A;  4EQ9 A;  5DT6 A;  4XKN A;  4OEU A;  1US4 A;  3C34 A;  1IZ1 A;  3CR9 A;  4OQO A;  4ND9 A;  1JVY A;  3CG1 A;  3C33 A;  1F9B A;  3IJO B;  2DE2 A;  1QUI A;  4EDP A;  3EHT A;  5DVI A;  3G3F A;  5AE4 A;  1FQE A;  2DXR A;  4MFI A;  3SER A;  2F36 A;  1GVC A;  3PD8 A;  1ZKB A;  2F7C A;  1WDN A;  5JTY B;  3MZB A;  3H6V A;  1EZO A;  3MW0 A;  4H6D A;  4TQU Q;  2F97 A;  1Y9U A;  3FVO A;  1M5F A;  3DP6 A;  1FTJ A;  2ZYN A;  2GHA A;  2R9J A;  3VVE A;  1R1N A;  1TT1 A;  4QFO A;  2VP1 A;  3IL1 B;  3RN8 A;  5AA2 A;  3M3L A;  1YAE A;  4LQ2 A;  4XTC Q;  4BDM A;  4RNS A;  2Q2C A;  1SW1 A;  1Y1Z A;  3RGY A;  1LGB C;  4OFL A;  3DP4 A;  3OO7 A;  4F31 B;  3KFM A;  2LAO A;  4DLD A;  1B6H A;  1ZTY A;  3MUQ A;  2QMX A;  2P1S A;  2QRY A;  5DEX B;  2QS3 A;  3OXN A;  3CRB A;  3PUZ E;  4YZZ A;  1H45 A;  3KEI A;  4NE4 A;  2VOZ A;  3K2D A;  3SEV A;  2IEE A;  3IOT A;  4NED A;  4FAT A;  4P0I A;  4IO6 A;  2I0B A;  5CMK A;  1B0H A;  1MQI A;  3L6H A;  3PGF A;  4R9F A;  2HQ0 A;  3T9H B;  3TCF A;  3VDF A;  4ELO A;  4QFL A;  2Z8F A;  5H8Q B;  1BKA A;  3MZ1 A;  4EXK A;  5AA2 D;  1LCT A;  1M5C A;  4TLL B;  1R9L A;  1OQH A;  1FTL A;  4H5G A;  4RJZ A;  1MPC A;  1VFD A;  3SKP A;  4IY6 A;  1MY1 A;  1URS A;  2ANJ A;  1A8F A;  5I2N A;  3K6V A;  3W9V A;  4Z0I A;  2UVJ A;  4R73 A;  3MP6 A;  3PUX E;  3UOR A;  3UN6 A;  3OO8 A;  5DTB A;  1B1X A;  4F18 A;  4ELR A;  2VHA A;  3GLB A;  2DWA A;  2YJP A;  2QS2 A;  4LZ5 A;  1RYX A;  1JQF A;  3MVX A;  3V83 A;  3ILU B;  4G8H A;  3U92 A;  2V3U A;  4GL8 A;  1FQF A;  2I4B A;  3PUY E;  1B7Z A;  3HCQ A;  2V3Q A;  4H8I A;  4R75 A;  1B3F A;  2Y7P A;  1VE4 A;  4F3P A;  1GR2 A;  1HSL A;  3QYT A;  3BKI B;  3H03 A;  2O7U A;  4DCX A;  5CMB A;  3BFT A;  4YKI A;  1LFI A;  1XC1 A;  1POY 1;  2D21 A;  5K2Y A;  4F39 A;  1MRP A;  5JTY A;  1ZIU A;  3RPW A;  4LZ8 A;  3KZG A;  3CFL A;  1LBB A;  2GRV A;  5I59 B;  4TLM B;  1B3G A;  1GV8 A;  4FAJ A;  1OVT A;  3K1P A;  4RPN A;  3PU5 A;  2ALU A;  3O6H A;  2ZYO A;  3ZSF A;  1NNF A;  4QF9 A;  3MPK A;  2HXW A;  1TXF A;  1O7T A;  4KI0 E;  1R6Z A;  4LA9 A;  1MY4 A;  1LB8 A;  2F6P A;  3I3V A;  3FIR A;  3UA8 A;  2CMO A;  3RNN A;  1O64 A;  3H6T A;  5DEX A;  3G3I A;  5EHS A;  2M8C A;  4I62 A;  5KZT A;  4MBP A;  2YPN A;  1XVX A;  2ESN A;  1SBP A;  1A99 A;  4I9D A;  2OZZ A;  3SEW A;  4EQ7 A;  5F1Q A;  3C35 A;  2DOJ A;  2X7P A;  3VLV A;  1Y3P A;  3MAM A;  3T96 B;  5AA4 B;  3VVD A;  3CIJ A;  4ZS9 A;  2A5T B;  4OWD A;  2O68 A;  1N7W A;  1MG1 A;  3OEM A;  4O3A A;  1GTK A;  4U23 A;  4DXC A;  3QIM A;  1N3W A;  2HZK A;  5LOM A;  1B5J A;  4LUB A;  5DVF A;  2F8D A;  4MF3 A;  4MLQ A;  3I6V A;  2OLB A;  4ESX A;  3GXA A;  1SQY A;  3OO9 A;  4I8C A;  3BFU A;  3O6I A;  1M5D A;  4F2O A;  1N84 A;  4FOR A;  3U72 A;  1B46 A;  3K6U A;  1MXX A;  3H4Z A;  5CI5 A;  1SVX B;  3FUZ A;  3N5L A;  2PMS A;  2QJE A;  3CSB A;  4FEB A;  5ISU A;  1DTG A;  1SD3 A;  4QHQ A;  5DVJ A;  5AA1 A;  1T0K A;  2A5S A;  2RC7 A;  1PB9 A;  4JBZ A;  3W9W A;  1Y20 A;  2V25 A;  1P1N A;  4C1U A;  2IA4 A;  3USD A;  5ELV A;  3CG3 A;  4EQB A;  1ELJ A;  1EU8 A;  1UTH B;  2RC8 A;  2ZNT A;  1MQG A;  3FAS A;  3O28 A;  3QK6 A;  5I59 A;  4PP0 A;  4L17 A;  4BDQ A;  4R9G A;  3LSX A;  5L9O A;  3Q26 A;  2Z22 A;  4E0W A;  1M5E A;  2GHB A;  1IXI A;  4G68 C;  1UIV A;  1FQC A;  2I48 A;  3N6T A;  3TZA A;  1N7X A;  1O63 A;  2OCU A;  3V89 B;  1H44 A;  3MVY A;  4IO3 A;  4YB7 A;  1HSE A;  3K6W A;  3S9M C;  4GQO A;  4DZ1 A;  3TOD A;  2Z23 A;  4IGR A;  2ZNU A;  4XKQ A;  4LQ5 A;  1NFT A;  4ELQ A;  5CBS A;  4U4X A;  1B7U A;  1B5I A;  2I4C A;  1IXC A;  4JSD A;  3KN8 A;  3EHS A;  1N3X A;  3CSG A;  3MZ9 A;  3C31 A;  4GLI A;  4U22 A;  4GIZ A;  3VVF A;  3JV9 A;  4KPT A;  1Q1K A;  5CRY A;  3QUJ A;  3H6U A;  4YU0 A;  3O6G A;  3RT8 A;  3KN3 A;  5TPA B;  1PC3 A;  3B6T A;  3OO6 A;  3FXU A;  2B3B A;  2NVU B;  4H1X A;  2XX9 A;  1Y4T A;  3B6W A;  2AL5 A;  4JSO A;  3TTK A;  5AA4 A;  2P0S A;  3EHU A;  1OQG A;  1P1Q A;  3A09 A;  5FHO A;  2NUV A;  4RYA A;  5BWJ A;  5HM4 B;  1M5B A;  1QKB A;  2A5T A;  1PDA A;  2FYI A;  1DPE A;  4AQ4 A;  3DP8 A;  3TTN A;  1D9Y A;  4IO4 A;  4KFQ A;  1JW1 A;  1MQD A;  3N94 A;  1D4N A;  3TQW A;  2P2A A;  1S9T A;  3HST A;  3R7X A;  1POT A;  3IO6 A;  2B3F A;  2RIN A;  3PPO A;  1MY2 A;  4DXB A;  2X26 A;  3TCH A;  1B40 A;  1IIW A;  3FVK A;  4XIG Q;  2ONK E;  1QUJ A;  1B58 A;  2UVG A;  2RKM A;  2PT1 A;  3SEU A;  1Q35 A;  3S9E A;  4GXS B;  1AL3 A;  3T93 B;  4KCD A;  3ODB A;  5FHM A;  4TOZ A;  3UP9 A;  1NNK A;  2O7I A;  3OEN A;  4H0W A;  5TU0 A;  1LST A;  4F19 A;  3IJX B;  1OVB A;  2VD2 A;  1FW0 A;  3PPN A;  1DTZ A;  3G3H A;  3O97 A;  4HTG A;  4U2R A;  3DEL B;  4NF8 A;  1MPD A;  4ZEI A;  1FTO A;  3C4M A;  3QXM A;  5B7D A;  3GZG A;  5J1D A;  4NF4 B;  4X1D A;  1UTB B;  5HBC A;  3KOS A;  1JVX A;  2DYX A;  2ZYK A;  1A8E A;  2AYS A;  2O84 X;  1SDX A;  4H5F A;  1MH4 A;  4MH5 A;  1AOV A;  2FA7 A;  3Q27 A;  1MM7 A;  1BP5 A;  5L9S A;  1RKM A;  4R6Y A;  3KJ7 A;  2G93 A;  4QFP A;  4F2Q A;  1ZMG A;  3T66 A;  4HW8 A;  1PEB A;  4NWD A;  3LBS A;  5I2K B;  1KWH A;  1XVY A;  3EQ1 A;  4GD5 A;  4F22 A;  3H6W A;  3ZKK A;  3R6U A;  4IO5 A;  4BDO A;  4LAT A;  4LZ7 A;  3IB0 A;  3LSL A;  5KDT A;  2UVI A;  4NF6 A;  2REJ A;  5I57 A;  3FJ7 A;  1YTV A;  5ICT A;  4FEC A;  3MBP A;  2OBG A;  4M4G A;  3O29 A;  2XXU A;  1IQ7 A;  1B3H A;  3UK4 A;  1I6Q A;  1WOD A;  1D3K A;  1MXU A;  2RF1 A;  3TTR A;  3TKD A;  3O9P A;  4C0R A;  3KJT A;  4G4P A;  4OTE A;  4U1Z A;  3PMW A;  1B3E A;  2FNC A;  3PPQ A;  4FJP A;  3CFZ A;  4R2F A;  3PUV E;  3FVG A;  2DVZ A;  2HFB A;  3TMG A;  4Q8R A;  3SES A;  1US5 A;  1QUK A;  4HCY A;  1IXH A;  2DXY A;  4G8M A;  3KSJ A;  3TUS A;  1MXY A;  4QSC A;  1SYI A;  5ICQ A;  3FJG A;  4XXU A;  3BBR A;  2Z8D A;  3TFL A;  4OES A;  4UAC A;  4LVQ A;  5KCJ B;  3IOV A;  4YMA A;  4Z7E A;  2H4I A;  3MP8 A;  2XXQ A;  4KYE A;  3ILT B;  2ZYM A;  4E0X A;  4OFO A;  3M3F A;  1YPN A;  1B2H A;  2THI A;  3OSQ A;  1NKX A;  3FV2 A;  3UIF A;  3MPL A;  4ELP A;  3A3C A;  1QKA A;  3S4U A;  2XXP A;  1UTB A;  3DM0 A;  1P99 A;  2RC9 A;  2W7Y A;  4IY5 A;  5I58 B;  3CI8 A;  4ZED A;  3KBR A;  4IGT A;  1ANF A;  3U94 A;  4BDR A;  4GF8 A;  3FZV A;  3H06 B;  1JNF A;  5I56 B;  1A55 A;  2DWH A;  2DWI A;  4JDF A;  4NWC A;  4ECF A;  2DP8 A;  5I2K A;  1BTJ A;  1LCF A;  2X7Q A;  2XXR A;  1B05 A;  4GVO A;  4WXJ A;  2XHD A;  4FIM A;  1P1W A;  1Y3N A;  5H8Q A;  1LLS A;  3EPE A;  4IO2 A;  1D9V A;  4BDN A;  3KOT A;  3FD3 A;  4F1V A;  1NNP A;  3MQ9 A;  3RTW B;  3TQL A;  3TTL A;  3TDJ A;  1DMB A;  5CMC A;  3FAT A;  5CBR A;  3LUY A;  1CE2 A;  3FXQ A;  5H8N B;  4C1T A;  1LAG E;  4ZEK A;  4O3C A;  1TFA A;  4FE8 A;  4NMY A;  2I3W A;  3KSX A;  4ZDM A;  4PQJ A;  4QRZ A;  4N07 A;  3S2V A;  5IKB A;  1NNT A;  3JYR A;  2HAU A;  2F7B A;  1FCK A;  2Y84 A;  1NH8 A;  3RUM A;  3LSF B;  1SW5 A;  3EN3 A;  3C32 A;  3FXR A;  4F3B A;  4YKP A;  3QAX A;  3MVZ A;  1FQB A;  3ZKL A;  3HO7 A;  2DE4 A;  1LFG A;  3MP1 A;  2QSX A;  4ONY A;  4R2B A;  2H99 A;  2XXH A;  4K3F A;  1NL5 A;  1DOT A;  4HCW A;  4WEP A;  1B1H A;  1URG A;  3HN0 A;  4JB7 A;  3A3U A;  4R6K A;  4R72 A;  2KLF A;  3AXF A;  5KCJ A;  1B4Z A;  1XOC A;  5A5X B;  3TEL A;  1ZBM A;  4PE5 B;  4JXI A;  3Q28 A;  3S9N C;  4RPO A;  3K01 A;  1MXZ A;  1VSO A;  1Y4C A;  3G3K A;  1MY3 A;  2REG A;  4PFW A;  4H8J A;  4X48 A;  3T9X B;  1Z7N E;  1S50 A;  3HPI A;  4H65 A;  3U1O A;  3TTM A;  3CFX A;  4F1U A;  4GOT A;  3K1N A;  4Q0C A;  1EZP A;  5AA2 B;  2OWS A;  3SET A;  3IB2 A;  5B70 A;  2OK2 A;  3THI A;  5I58 A;  4KYD A;  1NH7 A;  3PMX A;  4OZ9 A;  1B9J A;  1LAF E;  4X9T A;  2XXV A;  5FTH A;  1HSJ A;  3MC2 A;  1URD A;  3KN7 A;  5JEI A;  2O1L A;  3PD9 A;  4N13 A;  2Z8E A;  4JWO A;  3ZS6 A;  1OMP A;  2I0C A;  1Y1M A;  2F35 A;  3VFJ A;  1FTK A;  2Q2A A;  4LON B;  5I56 A;  2DWJ A;  3E13 X;  3E3K A;  4DCY A;  4I1D A;  3VXC A;  4BDL A;  1ZJL A;  3TCG A;  1SI0 A;  1PBQ A;  1B7H A;  5EYF A;  4F3G A;  3ONM A;  4OET A;  3CVG A;  3FVN A;  4DXU A;  4OHN A;  4G8N A;  1N04 A;  4QFN A;  3U8Q A;  3EF7 A;  4LP2 B;  1LFH A;  5CC2 A;  3U93 A;  4U4S A;  2H98 A;  5ITP A;  2QS4 A;  2Q9T A;  4G2Z A;  2O69 A;  5I2N B;  3OD7 A;  3R26 A;  3Q29 A;  4XKP A;  3C36 A;  3RLF E;  1LAX A;  4P0G A;  3I5O A;  3M8U A;  3KG2 A;  2Y7W A;  1DPP A;  3B6Q A;  3RT6 B;  2F78 A;  1TFD A;  1GGG A;  3QSL A;  5I84 A;  2ZXT A;  3T9V A;  4ZEF A;  1B52 A;  4POX A;  4RA1 A;  4QSE A;  4YB5 A;  3MWB A;  4GWO A;  3RQT A;  2PBW A;  3VLU A;  2G29 A;  3H7M A;  5JK4 A;  2XXY A;  1OIB A;  5A5X A;  4YB6 A;  3HHF A;  1L5T A;  4WED A;  1UTH A;  2WKY A;  2Q88 A;  1P1U A;  2V3T A;  2D3I A;  5H8F B;  5ITO A;  2DSF A;  4KHZ E;  4O3B A;  2PVU A;  2PX1 A;  2F6G A;  3TAJ A;  2O6A A;  3IX1 A;  4PFT A;  1H76 A;  1Y3Q A;  1MS7 A;  2ONS A;  2Y7I A;  2PYY A;  2BJJ X;  3TYH A;  3D4G A;  1MXW A;  3LR1 A;  1Z7M E;  1JEV A;  1USY H;  1AH5 A;  3N26 A;  2QS1 A; 
#chains in the Genus database with same CATH topology
 3GBB A;  2R6G E;  1VDW A;  2Y7R A;  4AB5 A;  4U21 A;  1H43 A;  1JEU A;  4NTL A;  4H67 A;  3S9L C;  5EYH A;  4GXA A;  3T9U A;  2XX7 A;  2H25 A;  3MVW A;  4P11 A;  5TPA A;  4FBP A;  1A7L A;  3K4U A;  3Q25 A;  3QUF A;  4MX6 A;  1FPG A;  3H3G A;  4OFJ A;  1XS5 A;  4NX1 A;  2I58 A;  1XHY A;  2OWZ A;  2DE3 A;  3B7D A;  3SEY A;  1YYZ A;  3IFC A;  4XEQ A;  2OWT A;  2F5X A;  4RK9 A;  1EH3 A;  4ZZE A;  4OYV A;  4NF5 B;  1ZLQ A;  1UQW A;  3PV0 E;  1USY E;  2L5V A;  4PAK A;  5H8H B;  1EYI A;  2V93 A;  3K02 A;  1TWY A;  1NUY A;  4YAH X;  4Q30 B;  2GQ1 A;  4GFR A;  4PGN A;  5HPQ A;  3DLN A;  3V5A A;  4EF2 A;  3KC1 A;  3C9H A;  3HHG A;  4G68 B;  4EXL A;  2XD3 A;  2UVH A;  4G77 A;  4KYS A;  1IUD A;  2UXA A;  2H9B A;  4IR8 A;  2Q8J A;  5L9M A;  1QW0 A;  3IOR A;  2DS9 A;  2D5W A;  1ZU0 A;  2XD2 A;  4ZEB A;  4GL0 A;  1MPB A;  2DVC A;  4R74 A;  4R6H A;  2F34 A;  4OEV A;  3VLW A;  3JZJ A;  1YZ0 A;  4N6P A;  5DW8 A;  2AIX A;  4M1V A;  3MJN A;  3OOA A;  3SEX A;  2I49 A;  5AA3 A;  4IO7 A;  3IB1 A;  1VFE A;  3TEP A;  1H3D A;  4KCC A;  4POW A;  2O51 A;  4H45 A;  4JWY A;  1FTM A;  2RCB A;  4OA4 A;  2UYE A;  4FED A;  5H8F A;  1QJM A;  1I6A A;  2XXX A;  2HAV A;  1LBV A;  4PCD A;  4QBA A;  2VGQ A;  1FQD A;  1B3L A;  3LUZ A;  1NV4 A;  1SYH A;  4ZEC A;  5I5P A;  2ZMB A;  2OJT A;  2F7A A;  4X04 A;  1R9Q A;  2DQV A;  2O1M A;  2CZL A;  2I6E A;  4NF4 A;  4G61 A;  5K2X A;  1RYO A;  1MXV A;  5ET7 A;  4KD5 A;  1MY0 A;  3KGC A;  4JWX A;  4PAF A;  3SDF A;  2YLN A;  2Q89 A;  1FPE A;  1KA0 A;  4OAN A;  3T22 A;  2NWJ A;  2ZNS A;  4OER A;  2Y7K A;  4F1Y A;  1PB8 A;  3IR1 A;  4THI A;  3G3G A;  4DIG A;  1YXI A;  1YCJ A;  2CZH A;  3LC8 A;  1A54 A;  1SW4 A;  2DDK A;  1PBP A;  2QL3 A;  2GFE A;  1I6B A;  1BLF A;  3RTF B;  2VD3 A;  4PFY A;  1AMF A;  2ONR A;  2HCA A;  2XXT A;  3P7I A;  2E1S A;  3PTY A;  1IIT A;  3K1M A;  4OVJ A;  1MDP 1;  5IZ1 A;  3L6G A;  1NUZ A;  3VXB A;  2RCA A;  4ZZA A;  2XXI A;  3K0V A;  5TP9 B;  1I69 A;  1LAH E;  4EUO A;  1JW4 A;  4WKM A;  1XT8 A;  2ABH A;  3OMB A;  4IB2 A;  2HEU A;  3HFU A;  1SI1 A;  3FBP A;  1JET A;  3BIG A;  4OMB A;  5IGA A;  1SW2 A;  3FJM A;  5EQ9 A;  4NF5 A;  4RY1 A;  2KR0 A;  1AIV A;  5FHN A;  3G7W A;  4MNI A;  4PE3 A;  5H8H A;  4EF1 A;  3VV5 A;  2UYF A;  4NAP A;  5BUU A;  2HZL A;  2I3V A;  5J16 A;  2NOO A;  4XKR A;  3IAZ A;  4G68 A;  1MM6 A;  3WAF A;  5IAI A;  2B65 A;  3PUW E;  3KBZ A;  2E0S A;  1UIU A;  1BIY A;  3LSW A;  2AL4 A;  2PCR A;  5DYH A;  3E9X A;  4HS7 A;  4PFB A;  1II5 A;  4QFK A;  4RXL A;  4Q5T A;  4F29 A;  4ISU A;  4DI3 D;  3V8X B;  4OEN A;  2GH9 A;  3ECR A;  3A29 A;  5CMM A;  1DSN A;  1K9Z A;  4X1B A;  1MH3 A;  1NMU A;  4P56 A;  2Q74 A;  3OSR A;  2QPQ A;  1FQA A;  1IEJ A;  1QUL A;  2QMW A;  4UA8 A;  5EHM A;  1ATG A;  1LEV A;  4QSD A;  4RK2 A;  3PPR A;  3PMV A;  4GRK A;  2XX8 A;  1LB9 A;  1B51 A;  2V84 A;  5M2V A;  4PET A;  5F7V A;  2Q8M A;  3FGS A;  2PFZ A;  1J1N A;  1OLC A;  1MDQ A;  2XXW A;  5I3S A;  3GBA A;  4NF8 B;  3E79 A;  4BLA A;  4YIC A;  3W15 C;  1B4H A;  3F11 A;  1LBW A;  1S7Y A;  3IK6 B;  3RY3 A;  2CZK A;  4P1L A;  1B32 A;  2QFL A;  4MLV A;  4KR5 A;  4AB6 A;  4GWW A;  3OEL A;  1QVS A;  1VR5 A;  1PB7 A;  4PFU A;  1B0L A;  4GBW A;  1WVJ A;  1NV5 A;  4YKJ A;  1G0I A;  4ZE8 A;  4OXV A;  3FV1 A;  1EZ9 A;  1OLA A;  1IXG A;  4YKK A;  3PPP A;  4F3S A;  1A40 A;  3IOW A;  4DE8 A;  3E4R A;  4YMB A;  3K6X A;  3TPA A;  3CHG A;  3VE1 B;  1B5H A;  1P1O A;  1MQH A;  1N76 A;  4ZE9 A;  3D4C A;  5H8S A;  1JW5 A;  1KZ8 A;  5TP9 A;  3O2A A;  4KQP A;  5FTI A;  5CM6 A;  3SZP A;  3M3K A;  3O66 A;  2R71 A;  5KDT B;  4NF6 B;  1LBC A;  1NV6 A;  4DDD A;  1K9Y A;  5I57 B;  5H8N A;  2NXO A;  3N6U A;  1CB6 A;  4U1O A;  5ET5 A;  4ESW A;  1MQJ A;  3UGW A;  3G3J A;  1N0T A;  2PT2 A;  3IO4 A;  5L8D A;  1NI9 A;  3IOU A;  4HE1 A;  3HV1 A;  3K00 A;  2H5Y A;  3OEK A;  3WAE A;  4EQ9 A;  5DT6 A;  1BK4 A;  4XKN A;  4OEU A;  1US4 A;  3C34 A;  1IZ1 A;  2HXR A;  3CR9 A;  4OQO A;  4HE0 A;  2XWO A;  4ND9 A;  1RDZ A;  4P8B A;  1JVY A;  3CG1 A;  3C33 A;  1F9B A;  3IJO B;  2DE2 A;  1QUI A;  4EDP A;  1CNQ A;  3EHT A;  5DVI A;  3G3F A;  5AE4 A;  1FQE A;  2WX9 A;  4JVI A;  2DXR A;  4MFI A;  3SER A;  2F36 A;  1GVC A;  3PD8 A;  1ZKB A;  3KC0 A;  2F7C A;  1WDN A;  4PC9 A;  5JTY B;  3MZB A;  3H6V A;  4P47 A;  1EZO A;  2P3V A;  3MW0 A;  4H6D A;  4TQU Q;  2F97 A;  1Y9U A;  3FVO A;  1M5F A;  3DP6 A;  1FTJ A;  2ZYN A;  2GHA A;  2R9J A;  3VVE A;  1NUW A;  1R1N A;  1TT1 A;  4QFO A;  2VP1 A;  3IL1 B;  3RN8 A;  5AA2 A;  3M3L A;  1YAE A;  4LQ2 A;  4XTC Q;  4BDM A;  4RNS A;  1IMF A;  2Q2C A;  1SW1 A;  1Y1Z A;  3RGY A;  1LGB C;  4OFL A;  3DP4 A;  3OO7 A;  4F31 B;  4H46 A;  3KFM A;  2LAO A;  4DLD A;  1B6H A;  1ZTY A;  5EYG A;  3MUQ A;  2QMX A;  2P1S A;  2QRY A;  5DEX B;  2QS3 A;  3OXN A;  2WBB A;  3CRB A;  3PUZ E;  4YZZ A;  1H45 A;  3KEI A;  4NE4 A;  5FBP A;  2VOZ A;  3K2D A;  3SEV A;  2IEE A;  3IOT A;  4NED A;  4FAT A;  4MJO A;  4P0I A;  4IO6 A;  2I0B A;  5CMK A;  1B0H A;  1MQI A;  3L6H A;  3PGF A;  2WYP A;  4R9F A;  2HQ0 A;  3T9H B;  3TCF A;  3VDF A;  4ELO A;  2ZZW A;  4QFL A;  2Z8F A;  5H8Q B;  1BKA A;  3MZ1 A;  4EXK A;  2HHM A;  5AA2 D;  1LCT A;  1M5C A;  4TLL B;  1R9L A;  1OQH A;  1FTL A;  4H5G A;  4RJZ A;  1MPC A;  1VFD A;  3SKP A;  4IY6 A;  1MY1 A;  1URS A;  2ANJ A;  1A8F A;  5I2N A;  3K6V A;  3W9V A;  4Z0I A;  2Y5L A;  2FHY A;  2UVJ A;  4R73 A;  1IMB A;  3T0J A;  3MP6 A;  3PUX E;  3UOR A;  3UN6 A;  3OO8 A;  5DTB A;  1B1X A;  4F18 A;  4ELR A;  2VHA A;  3GLB A;  2DWA A;  2YJP A;  2QS2 A;  2CZI A;  5EQ8 A;  4LZ5 A;  1RYX A;  1FPI A;  1JQF A;  3MVX A;  3V83 A;  3ILU B;  4G8H A;  3U92 A;  2V3U A;  4GL8 A;  1FQF A;  2I4B A;  3PUY E;  1B7Z A;  3HCQ A;  2V3Q A;  4H8I A;  4R75 A;  1B3F A;  2Y7P A;  5A5L A;  1VE4 A;  4F3P A;  1GR2 A;  1HSL A;  3QYT A;  3BKI B;  3H03 A;  2O7U A;  4DCX A;  5CMB A;  4P1E A;  3BFT A;  4YKI A;  1LFI A;  1FSA A;  1XC1 A;  1POY 1;  2D21 A;  5K2Y A;  4F39 A;  1MRP A;  5JTY A;  1ZIU A;  3RPW A;  4LZ8 A;  3KZG A;  3CFL A;  1LBB A;  2GRV A;  2P3N A;  5I59 B;  4TLM B;  3RPL B;  1B3G A;  1GV8 A;  4FAJ A;  1OVT A;  3K1P A;  4RPN A;  2VT5 A;  4NQ8 A;  3PU5 A;  2ALU A;  3O6H A;  1LBZ A;  2ZYO A;  3ZSF A;  4O8M A;  1NNF A;  4N8Y A;  4QF9 A;  3MPK A;  4XF5 A;  2HXW A;  1TXF A;  1O7T A;  4KI0 E;  1FRP A;  5EQA A;  1R6Z A;  4LA9 A;  1MY4 A;  4PBH A;  4N81 A;  1LB8 A;  2VPN A;  1FBG A;  1QGX A;  2F6P A;  3I3V A;  3FIR A;  1XI6 A;  3UA8 A;  2CMO A;  3RNN A;  1O64 A;  1FPD A;  3H6T A;  5DEX A;  3G3I A;  5EHS A;  2M8C A;  4I62 A;  5KZT A;  4MBP A;  2YPN A;  1XVX A;  3ISP A;  2ESN A;  5LDZ A;  1SBP A;  1A99 A;  4I9D A;  2OZZ A;  3SEW A;  4EQ7 A;  5F1Q A;  3C35 A;  2DOJ A;  2X7P A;  3VLV A;  1Y3P A;  3MAM A;  3T96 B;  5AA4 B;  1FBD A;  3VVD A;  3CIJ A;  4ZS9 A;  2A5T B;  4OWD A;  2O68 A;  5ET8 A;  1N7W A;  2XA5 A;  1JP4 A;  1MG1 A;  3OEM A;  4PFI A;  4O3A A;  1FTA A;  1GTK A;  4U23 A;  4DXC A;  3QIM A;  1N3W A;  2HZK A;  5LOM A;  1B5J A;  4LUB A;  5DVF A;  2F8D A;  4MF3 A;  4MLQ A;  3I6V A;  2OLB A;  4ESX A;  3GXA A;  1SQY A;  3OO9 A;  4I8C A;  3BFU A;  1NV1 A;  3O6I A;  1M5D A;  4OVP A;  4F2O A;  1N84 A;  4FOR A;  3U72 A;  1B46 A;  3K6U A;  1MXX A;  3ROJ A;  3H4Z A;  4PF8 A;  5CI5 A;  5IZ3 B;  1SVX B;  3FUZ A;  4N8G A;  3N5L A;  2PMS A;  2QJE A;  3CSB A;  3FXB A;  4MMP A;  4FEB A;  4PDD A;  5ISU A;  1DTG A;  1SD3 A;  4QHQ A;  5DVJ A;  5AA1 A;  1T0K A;  2A5S A;  2RC7 A;  1PB9 A;  4JBZ A;  3W9W A;  1Y20 A;  2V25 A;  1P1N A;  4C1U A;  1FBH A;  2IA4 A;  3USD A;  5ELV A;  1EYK A;  4MHF A;  3CG3 A;  1IME A;  4EQB A;  1ELJ A;  2VPO A;  1EU8 A;  1UTH B;  2RC8 A;  2ZNT A;  1MQG A;  3FAS A;  3O28 A;  3QK6 A;  5I59 A;  4PP0 A;  4L17 A;  4BDQ A;  4R9G A;  3LSX A;  5L9O A;  3Q26 A;  2Z22 A;  4E0W A;  1M5E A;  2GHB A;  1IXI A;  1NV7 A;  4G68 C;  4N91 A;  1UIV A;  4HE2 A;  4PGP A;  1FQC A;  2I48 A;  3N6T A;  3TZA A;  1N7X A;  1O63 A;  2OCU A;  3V89 B;  1H44 A;  3MVY A;  4IO3 A;  4YB7 A;  1HSE A;  3K6W A;  3S9M C;  4GQO A;  3IFA A;  4DZ1 A;  3TOD A;  2Z23 A;  4IGR A;  2ZNU A;  4O94 A;  4XKQ A;  2XWK A;  4LQ5 A;  1NFT A;  4ELQ A;  2F3D A;  4GX6 A;  5CBS A;  4GBV A;  4U4X A;  1B7U A;  1B5I A;  2I4C A;  1IXC A;  4JSD A;  3KN8 A;  3EHS A;  1N3X A;  3CSG A;  3MZ9 A;  3C31 A;  4GLI A;  4U22 A;  4GIZ A;  2PFY A;  3VVF A;  3JV9 A;  4KPT A;  1Q1K A;  4DI4 B;  4PDH A;  5CRY A;  3QUJ A;  3H6U A;  5ET6 A;  4YU0 A;  3O6G A;  2QVR A;  3RT8 A;  3KN3 A;  5TPA B;  1PC3 A;  3B6T A;  3OO6 A;  3FXU A;  2B3B A;  2NVU B;  4H1X A;  2XX9 A;  1Y4T A;  3B6W A;  2AL5 A;  4JSO A;  3TTK A;  5AA4 A;  2P0S A;  3EHU A;  1OQG A;  1P1Q A;  3A09 A;  3LV0 A;  5FHO A;  4PAI A;  2NUV A;  4RYA A;  4LN5 A;  5BWJ A;  5HM4 B;  1M5B A;  1QKB A;  2A5T A;  1PDA A;  2FYI A;  4NN3 A;  1DPE A;  4O7I A;  4AQ4 A;  4I40 A;  3DP8 A;  3TTN A;  1D9Y A;  4IO4 A;  4KFQ A;  1JW1 A;  1MQD A;  3N94 A;  1D4N A;  3TQW A;  2P2A A;  1S9T A;  3HST A;  3R7X A;  3U65 A;  1POT A;  3IO6 A;  2B3F A;  2RIN A;  4N4U A;  1FBF A;  3PPO A;  2FBP A;  1MY2 A;  4DXB A;  2X26 A;  3TCH A;  1B40 A;  1IIW A;  3FVK A;  4XIG Q;  2ONK E;  5T3J A;  1QUJ A;  5IZ3 A;  1DCU A;  1B58 A;  2UVG A;  2RKM A;  3B50 A;  2PT1 A;  3SEU A;  1Q35 A;  3S9E A;  1SPI A;  1INP A;  4MNP A;  4GXS B;  1FPK A;  4HXV A;  3B8B A;  1AL3 A;  3T93 B;  4KCD A;  3ODB A;  5FHM A;  2FIE A;  4TOZ A;  3UP9 A;  1NNK A;  2O7I A;  3OEN A;  4H0W A;  5TU0 A;  1LST A;  5IM2 A;  4F19 A;  4N6D A;  3IJX B;  1OVB A;  2VD2 A;  1FW0 A;  3PPN A;  1DTZ A;  3G3H A;  3O97 A;  4HTG A;  4U2R A;  2ZZX A;  3DEL B;  2ZZV A;  4NF8 A;  1MPD A;  4ZEI A;  1FTO A;  3C4M A;  3QXM A;  5B7D A;  3GZG A;  5J1D A;  4NF4 B;  4X1D A;  1UTB B;  5HBC A;  3KOS A;  1JVX A;  1Q9D A;  1LBY A;  2DYX A;  2ZYK A;  1A8E A;  2AYS A;  1DK4 A;  2O84 X;  1SDX A;  2FVZ A;  4H5F A;  1MH4 A;  4MH5 A;  1AOV A;  2FA7 A;  3Q27 A;  4JVD A;  4PBQ A;  1MM7 A;  1BP5 A;  5L9S A;  1RKM A;  4R6Y A;  3KJ7 A;  2G93 A;  4QFP A;  4F2Q A;  1ZMG A;  3T66 A;  4HW8 A;  1PEB A;  4NWD A;  3LBS A;  5I2K B;  1KWH A;  4MEV A;  1XVY A;  3EQ1 A;  4GWS A;  4GD5 A;  4F22 A;  3H6W A;  3ZKK A;  3R6U A;  4IO5 A;  4BDO A;  4LAT A;  4LZ7 A;  3IB0 A;  3T1B A;  3LSL A;  5KDT A;  2UVI A;  4NF6 A;  1FBP A;  4OVS A;  2V4C A;  2REJ A;  4GWU A;  5I57 A;  3FJ7 A;  1YTV A;  4PFR A;  5ICT A;  4FEC A;  3MBP A;  2OBG A;  4M4G A;  3O29 A;  2XXU A;  1IQ7 A;  1B3H A;  3E78 A;  3UK4 A;  1I6Q A;  1WOD A;  1D3K A;  1MXU A;  2RF1 A;  4GX3 A;  3TTR A;  4P9K A;  3O9P A;  3TKD A;  2OX3 A;  4C0R A;  3KJT A;  4G4P A;  1IMA A;  4OVQ A;  4OTE A;  4U1Z A;  4NG7 A;  3PMW A;  1B3E A;  4NF0 A;  3NOH A;  2FNC A;  3PPQ A;  4FJP A;  2HPG A;  3CFZ A;  1NV2 A;  4R2F A;  3PUV E;  3FVG A;  2DVZ A;  2CEX A;  2HFB A;  3TMG A;  4Q8R A;  3SES A;  1US5 A;  1QUK A;  4HCY A;  1IXH A;  2DXY A;  4G8M A;  3KSJ A;  2FIX A;  3QMF A;  3TUS A;  1MXY A;  1FBC A;  1FJ6 A;  4QXD A;  4QSC A;  1SYI A;  5ICQ A;  3FJG A;  4XXU A;  2JJK A;  3MST A;  3BBR A;  2Z8D A;  3TFL A;  4OES A;  4UAC A;  4LVQ A;  5KCJ B;  3IOV A;  4I3E A;  4YMA A;  2B4L A;  1NUX A;  4Z7E A;  2H4I A;  2XWV A;  1D9Q A;  3MP8 A;  2XXQ A;  4KYE A;  1NV3 A;  3ILT B;  2ZYM A;  1LBX A;  4E0X A;  4OFO A;  3M3F A;  1YPN A;  1B2H A;  2THI A;  3OSQ A;  4UAB A;  1NKX A;  3FV2 A;  3UIF A;  3MPL A;  4ELP A;  3A3C A;  1QKA A;  3S4U A;  2XXK A;  4NGU A;  2XXP A;  1UTB A;  3DM0 A;  1P99 A;  2RC9 A;  2W7Y A;  4IY5 A;  5I58 B;  3CI8 A;  1NV0 A;  4ZED A;  3KBR A;  2F3B A;  4IGT A;  4AS5 A;  1ANF A;  3U94 A;  4BDR A;  4GF8 A;  3FZV A;  5ESY A;  3H06 B;  1JNF A;  5I56 B;  4NWC A;  1A55 A;  2DWH A;  2DWI A;  4JDF A;  4NHB A;  4ECF A;  2DP8 A;  5I2K A;  1BTJ A;  1LCF A;  2X7Q A;  2XXR A;  1FBE A;  1B05 A;  4GVO A;  4WXJ A;  2XHD A;  4FIM A;  3MYU A;  1P1W A;  1Y3N A;  2B4M A;  5H8Q A;  1LLS A;  4GWZ A;  4P3L A;  3EPE A;  4IO2 A;  1D9V A;  5EQ7 A;  4BDN A;  3KOT A;  3FD3 A;  4F1V A;  1NNP A;  2BJI A;  3MQ9 A;  3RTW B;  3TQL A;  1FPJ A;  3TTL A;  1DMB A;  5CMC A;  3TDJ A;  3FAT A;  4AS4 A;  5CBR A;  3LUY A;  1CE2 A;  3FXQ A;  5H8N B;  4C1T A;  4OVT A;  1LAG E;  4ZEK A;  4O3C A;  3GYY A;  1TFA A;  4FE8 A;  4NMY A;  2I3W A;  3KSX A;  4ZDM A;  4PQJ A;  4MNC A;  4QRZ A;  4N07 A;  3S2V A;  5IKB A;  1NNT A;  2WYK A;  4N15 A;  3JYR A;  2HAU A;  2F7B A;  1FCK A;  2Y84 A;  1NH8 A;  3RUM A;  4GX4 A;  3LSF B;  1SW5 A;  3EN3 A;  3C32 A;  3FXR A;  4GWY A;  4F3B A;  2WEF A;  4YKP A;  3QAX A;  2MKZ A;  3MVZ A;  1FQB A;  3ZKL A;  3HO7 A;  2DE4 A;  1LFG A;  3MP1 A;  2QSX A;  4ONY A;  4R2B A;  2H99 A;  2XXH A;  4K3F A;  1NL5 A;  1DOT A;  4HCW A;  4WEP A;  1B1H A;  1URG A;  3HN0 A;  4JB7 A;  3A3U A;  4R6K A;  4R72 A;  1RDY A;  2KLF A;  3AXF A;  5KCJ A;  1B4Z A;  1XOC A;  5A5X B;  4MCO A;  3TEL A;  2QVV A;  1IMC A;  1FPL A;  5LTC A;  1ZBM A;  4PE5 B;  4JXI A;  3Q28 A;  3RPL A;  3S9N C;  4RPO A;  4X8R A;  3K01 A;  1MXZ A;  1VSO A;  3RYD A;  1Y4C A;  3G3K A;  4OVR A;  1MY3 A;  2REG A;  4PFW A;  4H8J A;  4X48 A;  3T9X B;  1Z7N E;  1S50 A;  3HPI A;  4H65 A;  3U1O A;  3TTM A;  3CFX A;  4F1U A;  4GOT A;  3K1N A;  4Q0C A;  1EZP A;  5I7I A;  5AA2 B;  2OWS A;  3SET A;  3IB2 A;  5B70 A;  2OK2 A;  3THI A;  5I58 A;  4KYD A;  1NH7 A;  3PMX A;  4OZ9 A;  1B9J A;  1LAF E;  4X9T A;  2XXV A;  5FTH A;  1HSJ A;  4JVC A;  3MC2 A;  1URD A;  3KN7 A;  4I3Y A;  5JEI A;  1FPF A;  2O1L A;  3PD9 A;  4N13 A;  2Z8E A;  4N6K A;  4JWO A;  3ZS6 A;  1OMP A;  2I0C A;  1Y1M A;  2F35 A;  4PF6 A;  1FTK A;  2Q2A A;  4XFE A;  3VFJ A;  4LON B;  5I56 A;  2DWJ A;  3E13 X;  3E3K A;  4DCY A;  4I1D A;  3VXC A;  4BDL A;  1ZJL A;  3TCG A;  2R8T A;  1SI0 A;  1PBQ A;  1B7H A;  1IMD A;  5EYF A;  4F3G A;  3ONM A;  4OET A;  1EYJ A;  3CVG A;  1DBZ A;  3FVN A;  5F24 A;  4DXU A;  4OHN A;  4G8N A;  1N04 A;  4QFN A;  3U8Q A;  3EF7 A;  4LP2 B;  1LFH A;  5CC2 A;  3U93 A;  4U4S A;  3D1R A;  2H98 A;  2WBD A;  5ITP A;  1KA1 A;  2QS4 A;  2Q9T A;  4G2Z A;  2O69 A;  5I2N B;  2XWI A;  3OD7 A;  3R26 A;  3Q29 A;  4XKP A;  3C36 A;  1RDX A;  3RLF E;  2CEY A;  1LAX A;  4MIJ A;  4P0G A;  3I5O A;  3M8U A;  3KG2 A;  1AWB A;  2Y7W A;  1DPP A;  3B6Q A;  4KXP A;  3RT6 B;  2F78 A;  1TFD A;  1GGG A;  1FJ9 A;  1G0H A;  3QSL A;  5I84 A;  2ZXT A;  3T9V A;  4ZEF A;  1B52 A;  4POX A;  4RA1 A;  2Y5K A;  5IZZ A;  3BIH A;  4QSE A;  4YB5 A;  3MWB A;  4GWO A;  3RQT A;  2PBW A;  3VLU A;  2G29 A;  2QVU A;  3H7M A;  5JK4 A;  2XXY A;  1OIB A;  5A5X A;  4YB6 A;  3HHF A;  4PTK A;  1L5T A;  4WED A;  1UTH A;  2KQZ A;  2WKY A;  2Q88 A;  1P1U A;  2V3T A;  2D3I A;  5H8F B;  5ITO A;  2DSF A;  4KHZ E;  4O3B A;  4N17 A;  2PVU A;  2PX1 A;  2F6G A;  4O7M A;  3TAJ A;  2O6A A;  4GWX A;  3IX1 A;  4PFT A;  1H76 A;  1Y3Q A;  3EKI A;  1MS7 A;  2ONS A;  2Y7I A;  2PYY A;  2BJJ X;  1FPB A;  3TYH A;  3D4G A;  1MXW A;  3LR1 A;  1Z7M E;  1JEV A;  1USY H;  1AH5 A;  4MAG A;  3N26 A;  2QS1 A; 
#chains in the Genus database with same CATH homology
 3GBB A;  2R6G E;  2Y7R A;  4AB5 A;  4U21 A;  1H43 A;  1JEU A;  4NTL A;  4H67 A;  3S9L C;  4GXA A;  3T9U A;  2XX7 A;  2H25 A;  3MVW A;  4P11 A;  5TPA A;  1A7L A;  3K4U A;  3Q25 A;  3QUF A;  3H3G A;  4OFJ A;  1XS5 A;  2I58 A;  1XHY A;  2DE3 A;  3B7D A;  3SEY A;  2OWT A;  2F5X A;  4RK9 A;  1EH3 A;  4ZZE A;  4OYV A;  4NF5 B;  1ZLQ A;  1UQW A;  3PV0 E;  1USY E;  5H8H B;  2V93 A;  3K02 A;  1TWY A;  4YAH X;  4Q30 B;  4GFR A;  5HPQ A;  3DLN A;  3V5A A;  4EF2 A;  3C9H A;  3HHG A;  4G68 B;  4EXL A;  2XD3 A;  2UVH A;  4G77 A;  4KYS A;  1IUD A;  2UXA A;  2H9B A;  2Q8J A;  5L9M A;  1QW0 A;  3IOR A;  2DS9 A;  2D5W A;  1ZU0 A;  2XD2 A;  4ZEB A;  4GL0 A;  1MPB A;  2DVC A;  4R74 A;  4R6H A;  2F34 A;  4OEV A;  3VLW A;  3JZJ A;  4N6P A;  2AIX A;  4M1V A;  3MJN A;  3OOA A;  3SEX A;  2I49 A;  5AA3 A;  4IO7 A;  3IB1 A;  1VFE A;  3TEP A;  1H3D A;  4KCC A;  4POW A;  2O51 A;  4JWY A;  1FTM A;  2RCB A;  2UYE A;  4FED A;  5H8F A;  1QJM A;  1I6A A;  2XXX A;  2HAV A;  2VGQ A;  1FQD A;  1B3L A;  1SYH A;  4ZEC A;  2ZMB A;  2OJT A;  2F7A A;  1R9Q A;  2DQV A;  2O1M A;  2CZL A;  2I6E A;  4NF4 A;  5K2X A;  1RYO A;  1MXV A;  4KD5 A;  1MY0 A;  3KGC A;  4JWX A;  3SDF A;  2YLN A;  2Q89 A;  3T22 A;  2NWJ A;  2ZNS A;  4OER A;  2Y7K A;  4F1Y A;  1PB8 A;  3IR1 A;  4THI A;  3G3G A;  4DIG A;  1YCJ A;  3LC8 A;  1A54 A;  1SW4 A;  1PBP A;  2QL3 A;  2GFE A;  1I6B A;  1BLF A;  3RTF B;  2VD3 A;  4PFY A;  1AMF A;  2ONR A;  2HCA A;  2XXT A;  3P7I A;  2E1S A;  1IIT A;  3K1M A;  4OVJ A;  1MDP 1;  3L6G A;  3VXB A;  2RCA A;  4ZZA A;  2XXI A;  3K0V A;  5TP9 B;  1I69 A;  1LAH E;  4EUO A;  1JW4 A;  4WKM A;  1XT8 A;  2ABH A;  3OMB A;  4IB2 A;  2HEU A;  1SI1 A;  1JET A;  4OMB A;  1SW2 A;  3FJM A;  4NF5 A;  4RY1 A;  1AIV A;  5FHN A;  3G7W A;  5H8H A;  4EF1 A;  3VV5 A;  2UYF A;  5BUU A;  2HZL A;  2I3V A;  2NOO A;  4XKR A;  3IAZ A;  4G68 A;  1MM6 A;  3WAF A;  5IAI A;  2B65 A;  3PUW E;  2E0S A;  1UIU A;  1BIY A;  3LSW A;  2AL4 A;  5DYH A;  3E9X A;  4HS7 A;  1II5 A;  4QFK A;  4RXL A;  4Q5T A;  4F29 A;  4ISU A;  3V8X B;  4OEN A;  2GH9 A;  3ECR A;  5CMM A;  1DSN A;  4X1B A;  1MH3 A;  1NMU A;  3OSR A;  2QPQ A;  1FQA A;  1IEJ A;  1QUL A;  2QMW A;  4UA8 A;  5EHM A;  1ATG A;  4QSD A;  4RK2 A;  3PPR A;  3PMV A;  4GRK A;  2XX8 A;  1LB9 A;  1B51 A;  2V84 A;  5M2V A;  4PET A;  5F7V A;  3FGS A;  1J1N A;  1OLC A;  1MDQ A;  2XXW A;  3GBA A;  4NF8 B;  4BLA A;  4YIC A;  3W15 C;  1B4H A;  3F11 A;  1S7Y A;  3IK6 B;  3RY3 A;  1B32 A;  4MLV A;  4AB6 A;  4KR5 A;  3OEL A;  1QVS A;  1VR5 A;  1PB7 A;  4PFU A;  1B0L A;  1WVJ A;  4YKJ A;  4ZE8 A;  4OXV A;  3FV1 A;  1EZ9 A;  1OLA A;  1IXG A;  4YKK A;  3PPP A;  4F3S A;  1A40 A;  3IOW A;  4DE8 A;  3E4R A;  4YMB A;  3K6X A;  3TPA A;  3VE1 B;  1B5H A;  1P1O A;  1MQH A;  1N76 A;  4ZE9 A;  3D4C A;  5H8S A;  1JW5 A;  5TP9 A;  3O2A A;  4KQP A;  5FTI A;  5CM6 A;  3M3K A;  3O66 A;  2R71 A;  5KDT B;  4NF6 B;  1LBC A;  4DDD A;  5I57 B;  5H8N A;  2NXO A;  3N6U A;  1CB6 A;  4U1O A;  4ESW A;  1MQJ A;  3UGW A;  3G3J A;  1N0T A;  2PT2 A;  3IO4 A;  5L8D A;  3IOU A;  3HV1 A;  3K00 A;  2H5Y A;  3OEK A;  3WAE A;  4EQ9 A;  5DT6 A;  4XKN A;  4OEU A;  1US4 A;  3C34 A;  1IZ1 A;  3CR9 A;  4OQO A;  4ND9 A;  1JVY A;  3CG1 A;  3C33 A;  1F9B A;  3IJO B;  2DE2 A;  1QUI A;  4EDP A;  3EHT A;  5DVI A;  3G3F A;  5AE4 A;  1FQE A;  2DXR A;  4MFI A;  3SER A;  2F36 A;  1GVC A;  3PD8 A;  1ZKB A;  2F7C A;  1WDN A;  5JTY B;  3MZB A;  3H6V A;  1EZO A;  3MW0 A;  4H6D A;  4TQU Q;  2F97 A;  1Y9U A;  3FVO A;  1M5F A;  3DP6 A;  1FTJ A;  2ZYN A;  2GHA A;  2R9J A;  3VVE A;  1R1N A;  1TT1 A;  4QFO A;  2VP1 A;  3IL1 B;  3RN8 A;  5AA2 A;  3M3L A;  1YAE A;  4LQ2 A;  4XTC Q;  4BDM A;  4RNS A;  2Q2C A;  1SW1 A;  1Y1Z A;  3RGY A;  1LGB C;  4OFL A;  3DP4 A;  3OO7 A;  4F31 B;  3KFM A;  2LAO A;  4DLD A;  1B6H A;  1ZTY A;  3MUQ A;  2QMX A;  2P1S A;  2QRY A;  5DEX B;  2QS3 A;  3OXN A;  3CRB A;  3PUZ E;  4YZZ A;  1H45 A;  3KEI A;  4NE4 A;  2VOZ A;  3K2D A;  3SEV A;  2IEE A;  3IOT A;  4NED A;  4FAT A;  4P0I A;  4IO6 A;  2I0B A;  5CMK A;  1B0H A;  1MQI A;  3L6H A;  3PGF A;  4R9F A;  2HQ0 A;  3T9H B;  3TCF A;  3VDF A;  4ELO A;  4QFL A;  2Z8F A;  5H8Q B;  1BKA A;  3MZ1 A;  4EXK A;  5AA2 D;  1LCT A;  1M5C A;  4TLL B;  1R9L A;  1OQH A;  1FTL A;  4H5G A;  4RJZ A;  1MPC A;  1VFD A;  3SKP A;  4IY6 A;  1MY1 A;  1URS A;  2ANJ A;  1A8F A;  5I2N A;  3K6V A;  3W9V A;  4Z0I A;  2UVJ A;  4R73 A;  3MP6 A;  3PUX E;  3UOR A;  3UN6 A;  3OO8 A;  5DTB A;  1B1X A;  4F18 A;  4ELR A;  2VHA A;  3GLB A;  2DWA A;  2YJP A;  2QS2 A;  4LZ5 A;  1RYX A;  1JQF A;  3MVX A;  3V83 A;  3ILU B;  4G8H A;  3U92 A;  2V3U A;  4GL8 A;  1FQF A;  2I4B A;  3PUY E;  1B7Z A;  3HCQ A;  2V3Q A;  4H8I A;  4R75 A;  1B3F A;  2Y7P A;  1VE4 A;  4F3P A;  1GR2 A;  1HSL A;  3QYT A;  3BKI B;  3H03 A;  2O7U A;  4DCX A;  5CMB A;  3BFT A;  4YKI A;  1LFI A;  1XC1 A;  1POY 1;  2D21 A;  5K2Y A;  4F39 A;  1MRP A;  5JTY A;  1ZIU A;  3RPW A;  4LZ8 A;  3KZG A;  3CFL A;  1LBB A;  2GRV A;  5I59 B;  4TLM B;  1B3G A;  1GV8 A;  4FAJ A;  1OVT A;  3K1P A;  4RPN A;  3PU5 A;  2ALU A;  3O6H A;  2ZYO A;  3ZSF A;  1NNF A;  4QF9 A;  3MPK A;  2HXW A;  1TXF A;  1O7T A;  4KI0 E;  1R6Z A;  4LA9 A;  1MY4 A;  1LB8 A;  2F6P A;  3I3V A;  3FIR A;  3UA8 A;  2CMO A;  3RNN A;  1O64 A;  3H6T A;  5DEX A;  3G3I A;  5EHS A;  2M8C A;  4I62 A;  5KZT A;  4MBP A;  2YPN A;  1XVX A;  2ESN A;  1SBP A;  1A99 A;  4I9D A;  2OZZ A;  3SEW A;  4EQ7 A;  5F1Q A;  3C35 A;  2DOJ A;  2X7P A;  3VLV A;  1Y3P A;  3MAM A;  3T96 B;  5AA4 B;  3VVD A;  3CIJ A;  4ZS9 A;  2A5T B;  4OWD A;  2O68 A;  1N7W A;  1MG1 A;  3OEM A;  4O3A A;  1GTK A;  4U23 A;  4DXC A;  3QIM A;  1N3W A;  2HZK A;  5LOM A;  1B5J A;  4LUB A;  5DVF A;  2F8D A;  4MF3 A;  4MLQ A;  3I6V A;  2OLB A;  4ESX A;  3GXA A;  1SQY A;  3OO9 A;  4I8C A;  3BFU A;  3O6I A;  1M5D A;  4F2O A;  1N84 A;  4FOR A;  3U72 A;  1B46 A;  3K6U A;  1MXX A;  3H4Z A;  5CI5 A;  1SVX B;  3FUZ A;  3N5L A;  2PMS A;  2QJE A;  3CSB A;  4FEB A;  5ISU A;  1DTG A;  1SD3 A;  4QHQ A;  5DVJ A;  5AA1 A;  1T0K A;  2A5S A;  2RC7 A;  1PB9 A;  4JBZ A;  3W9W A;  1Y20 A;  2V25 A;  1P1N A;  4C1U A;  2IA4 A;  3USD A;  5ELV A;  3CG3 A;  4EQB A;  1ELJ A;  1EU8 A;  1UTH B;  2RC8 A;  2ZNT A;  1MQG A;  3FAS A;  3O28 A;  3QK6 A;  5I59 A;  4PP0 A;  4L17 A;  4BDQ A;  4R9G A;  3LSX A;  5L9O A;  3Q26 A;  2Z22 A;  4E0W A;  1M5E A;  2GHB A;  1IXI A;  4G68 C;  1UIV A;  1FQC A;  2I48 A;  3N6T A;  3TZA A;  1N7X A;  1O63 A;  2OCU A;  3V89 B;  1H44 A;  3MVY A;  4IO3 A;  4YB7 A;  1HSE A;  3K6W A;  3S9M C;  4GQO A;  4DZ1 A;  3TOD A;  2Z23 A;  4IGR A;  2ZNU A;  4XKQ A;  4LQ5 A;  1NFT A;  4ELQ A;  5CBS A;  4U4X A;  1B7U A;  1B5I A;  2I4C A;  1IXC A;  4JSD A;  3KN8 A;  3EHS A;  1N3X A;  3CSG A;  3MZ9 A;  3C31 A;  4GLI A;  4U22 A;  4GIZ A;  3VVF A;  3JV9 A;  4KPT A;  1Q1K A;  5CRY A;  3QUJ A;  3H6U A;  4YU0 A;  3O6G A;  3RT8 A;  3KN3 A;  5TPA B;  1PC3 A;  3B6T A;  3OO6 A;  3FXU A;  2B3B A;  2NVU B;  4H1X A;  2XX9 A;  1Y4T A;  3B6W A;  2AL5 A;  4JSO A;  3TTK A;  5AA4 A;  2P0S A;  3EHU A;  1OQG A;  1P1Q A;  3A09 A;  5FHO A;  2NUV A;  4RYA A;  5BWJ A;  5HM4 B;  1M5B A;  1QKB A;  2A5T A;  1PDA A;  2FYI A;  1DPE A;  4AQ4 A;  3DP8 A;  3TTN A;  1D9Y A;  4IO4 A;  4KFQ A;  1JW1 A;  1MQD A;  3N94 A;  1D4N A;  3TQW A;  2P2A A;  1S9T A;  3HST A;  3R7X A;  1POT A;  3IO6 A;  2B3F A;  2RIN A;  3PPO A;  1MY2 A;  4DXB A;  2X26 A;  3TCH A;  1B40 A;  1IIW A;  3FVK A;  4XIG Q;  2ONK E;  1QUJ A;  1B58 A;  2UVG A;  2RKM A;  2PT1 A;  3SEU A;  1Q35 A;  3S9E A;  4GXS B;  1AL3 A;  3T93 B;  4KCD A;  3ODB A;  5FHM A;  4TOZ A;  3UP9 A;  1NNK A;  2O7I A;  3OEN A;  4H0W A;  5TU0 A;  1LST A;  4F19 A;  3IJX B;  1OVB A;  2VD2 A;  1FW0 A;  3PPN A;  1DTZ A;  3G3H A;  3O97 A;  4HTG A;  4U2R A;  3DEL B;  4NF8 A;  1MPD A;  4ZEI A;  1FTO A;  3C4M A;  3QXM A;  5B7D A;  3GZG A;  5J1D A;  4NF4 B;  4X1D A;  1UTB B;  5HBC A;  3KOS A;  1JVX A;  2DYX A;  2ZYK A;  1A8E A;  2AYS A;  2O84 X;  1SDX A;  4H5F A;  1MH4 A;  4MH5 A;  1AOV A;  2FA7 A;  3Q27 A;  1MM7 A;  1BP5 A;  5L9S A;  1RKM A;  4R6Y A;  3KJ7 A;  2G93 A;  4QFP A;  4F2Q A;  1ZMG A;  3T66 A;  4HW8 A;  1PEB A;  4NWD A;  3LBS A;  5I2K B;  1KWH A;  1XVY A;  3EQ1 A;  4GD5 A;  4F22 A;  3H6W A;  3ZKK A;  3R6U A;  4IO5 A;  4BDO A;  4LAT A;  4LZ7 A;  3IB0 A;  3LSL A;  5KDT A;  2UVI A;  4NF6 A;  2REJ A;  5I57 A;  3FJ7 A;  1YTV A;  5ICT A;  4FEC A;  3MBP A;  2OBG A;  4M4G A;  3O29 A;  2XXU A;  1IQ7 A;  1B3H A;  3UK4 A;  1I6Q A;  1WOD A;  1D3K A;  1MXU A;  2RF1 A;  3TTR A;  3TKD A;  3O9P A;  4C0R A;  3KJT A;  4G4P A;  4OTE A;  4U1Z A;  3PMW A;  1B3E A;  2FNC A;  3PPQ A;  4FJP A;  3CFZ A;  4R2F A;  3PUV E;  3FVG A;  2DVZ A;  2HFB A;  3TMG A;  4Q8R A;  3SES A;  1US5 A;  1QUK A;  4HCY A;  1IXH A;  2DXY A;  4G8M A;  3KSJ A;  3TUS A;  1MXY A;  4QSC A;  1SYI A;  5ICQ A;  3FJG A;  4XXU A;  3BBR A;  2Z8D A;  3TFL A;  4OES A;  4UAC A;  4LVQ A;  5KCJ B;  3IOV A;  4YMA A;  4Z7E A;  2H4I A;  3MP8 A;  2XXQ A;  4KYE A;  3ILT B;  2ZYM A;  4E0X A;  4OFO A;  3M3F A;  1YPN A;  1B2H A;  2THI A;  3OSQ A;  1NKX A;  3FV2 A;  3UIF A;  3MPL A;  4ELP A;  3A3C A;  1QKA A;  3S4U A;  2XXP A;  1UTB A;  3DM0 A;  1P99 A;  2RC9 A;  2W7Y A;  4IY5 A;  5I58 B;  3CI8 A;  4ZED A;  3KBR A;  4IGT A;  1ANF A;  3U94 A;  4BDR A;  4GF8 A;  3FZV A;  3H06 B;  1JNF A;  5I56 B;  1A55 A;  2DWH A;  2DWI A;  4JDF A;  4NWC A;  4ECF A;  2DP8 A;  5I2K A;  1BTJ A;  1LCF A;  2X7Q A;  2XXR A;  1B05 A;  4GVO A;  4WXJ A;  2XHD A;  4FIM A;  1P1W A;  1Y3N A;  5H8Q A;  1LLS A;  3EPE A;  4IO2 A;  1D9V A;  4BDN A;  3KOT A;  3FD3 A;  4F1V A;  1NNP A;  3MQ9 A;  3RTW B;  3TQL A;  3TTL A;  3TDJ A;  1DMB A;  5CMC A;  3FAT A;  5CBR A;  3LUY A;  1CE2 A;  3FXQ A;  5H8N B;  4C1T A;  1LAG E;  4ZEK A;  4O3C A;  1TFA A;  4FE8 A;  4NMY A;  2I3W A;  3KSX A;  4ZDM A;  4PQJ A;  4QRZ A;  4N07 A;  3S2V A;  5IKB A;  1NNT A;  3JYR A;  2HAU A;  2F7B A;  1FCK A;  2Y84 A;  1NH8 A;  3RUM A;  3LSF B;  1SW5 A;  3EN3 A;  3C32 A;  3FXR A;  4F3B A;  4YKP A;  3QAX A;  3MVZ A;  1FQB A;  3ZKL A;  3HO7 A;  2DE4 A;  1LFG A;  3MP1 A;  2QSX A;  4ONY A;  4R2B A;  2H99 A;  2XXH A;  4K3F A;  1NL5 A;  1DOT A;  4HCW A;  4WEP A;  1B1H A;  1URG A;  3HN0 A;  4JB7 A;  3A3U A;  4R6K A;  4R72 A;  2KLF A;  3AXF A;  5KCJ A;  1B4Z A;  1XOC A;  5A5X B;  3TEL A;  1ZBM A;  4PE5 B;  4JXI A;  3Q28 A;  3S9N C;  4RPO A;  3K01 A;  1MXZ A;  1VSO A;  1Y4C A;  3G3K A;  1MY3 A;  2REG A;  4PFW A;  4H8J A;  4X48 A;  3T9X B;  1Z7N E;  1S50 A;  3HPI A;  4H65 A;  3U1O A;  3TTM A;  3CFX A;  4F1U A;  4GOT A;  3K1N A;  4Q0C A;  1EZP A;  5AA2 B;  2OWS A;  3SET A;  3IB2 A;  5B70 A;  2OK2 A;  3THI A;  5I58 A;  4KYD A;  1NH7 A;  3PMX A;  4OZ9 A;  1B9J A;  1LAF E;  4X9T A;  2XXV A;  5FTH A;  1HSJ A;  3MC2 A;  1URD A;  3KN7 A;  5JEI A;  2O1L A;  3PD9 A;  4N13 A;  2Z8E A;  4JWO A;  3ZS6 A;  1OMP A;  2I0C A;  1Y1M A;  2F35 A;  3VFJ A;  1FTK A;  2Q2A A;  4LON B;  5I56 A;  2DWJ A;  3E13 X;  3E3K A;  4DCY A;  4I1D A;  3VXC A;  4BDL A;  1ZJL A;  3TCG A;  1SI0 A;  1PBQ A;  1B7H A;  5EYF A;  4F3G A;  3ONM A;  4OET A;  3CVG A;  3FVN A;  4DXU A;  4OHN A;  4G8N A;  1N04 A;  4QFN A;  3U8Q A;  3EF7 A;  4LP2 B;  1LFH A;  5CC2 A;  3U93 A;  4U4S A;  2H98 A;  5ITP A;  2QS4 A;  2Q9T A;  4G2Z A;  2O69 A;  5I2N B;  3OD7 A;  3R26 A;  3Q29 A;  4XKP A;  3C36 A;  3RLF E;  1LAX A;  4P0G A;  3I5O A;  3M8U A;  3KG2 A;  2Y7W A;  1DPP A;  3B6Q A;  3RT6 B;  2F78 A;  1TFD A;  1GGG A;  3QSL A;  5I84 A;  2ZXT A;  3T9V A;  4ZEF A;  1B52 A;  4POX A;  4RA1 A;  4QSE A;  4YB5 A;  3MWB A;  4GWO A;  3RQT A;  2PBW A;  3VLU A;  2G29 A;  3H7M A;  5JK4 A;  2XXY A;  1OIB A;  5A5X A;  4YB6 A;  3HHF A;  1L5T A;  4WED A;  1UTH A;  2WKY A;  2Q88 A;  1P1U A;  2V3T A;  2D3I A;  5H8F B;  5ITO A;  2DSF A;  4KHZ E;  4O3B A;  2PVU A;  2PX1 A;  2F6G A;  3TAJ A;  2O6A A;  3IX1 A;  4PFT A;  1H76 A;  1Y3Q A;  1MS7 A;  2ONS A;  2Y7I A;  2PYY A;  2BJJ X;  3TYH A;  3D4G A;  1MXW A;  3LR1 A;  1Z7M E;  1JEV A;  1USY H;  1AH5 A;  3N26 A;  2QS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...