4LQ9A

Crystal structure of human norovirus rna-dependent rna-polymerase in complex with naf2
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
501
structure length
501
Chain Sequence
GTYCGAPILGPGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFTQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEGGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYKYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFKISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Naphthalene-sulfonate inhibitors of human norovirus RNA-dependent RNA-polymerase.
pubmed doi rcsb
source organism Norovirus
molecule tags Viral protein/replication inhibitor
molecule keywords RNA-dependent RNA-polymerase
total genus 163
structure length 501
sequence length 501
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 4lq9A02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4lq9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lq9A03
2VA2A 3CJ5A 4O3PA 4RW9A 2WRMA 4YMEA 3KHLA 3DRSA 1RYSA 3H98A 4RW6B 4QW8A 3UDLA 1MU2B 4WFZA 1NNDA 3QO9A 4NLGA 3H40A 4NLPA 3KMQA 2IC3A 1UWBA 4K4WA 1IKYA 4MIAA 1S1UB 2I1RA 3V6JA 4ED6A 2OH2A 1NHVA 4Q44A 1HMVA 2FVSA 5FDLB 4RUAA 4ECVA 5I42A 2UUWA 1EP4B 2RDJA 1QE1B 1N48A 3E01A 2W9CB 1K1SA 5J2NB 5KFCA 3G6XA 4LSLB 1C0TB 3FSIA 2B6AA 3CJ0A 3MF5A 2C28A 1JLGB 4ZVGA 4JV2A 1KHWA 4J9RA 3DM2B 2GIRA 4DL6A 2FLLA 2ATLA 5KG6A 4F4ZA 4K50A 5C5JA 4R8UA 3BQ1A 3MR3A 2UVVA 3IS9B 1VRTB 4H4OB 5KFBA 1S9GB 1JLCA 1HARA 3E51A 3GIIA 1RTHA 1SV5B 4G1QB 3KJVA 3M8PA 2FVRA 1RT2B 1LWCA 1MMLA 4KV8A 4RUCA 1RT5B 4FS1A 4YQWA 4O3QA 1IKXB 3MEGB 4NCGB 1SUQB 3DOLB 4KHMA 5KFGA 3QZ7A 4J9LA 4RNFA 4YR0A 4ECWA 4H54A 3TQ1A 4WFXA 1RT7B 3QZ8A 2XGPA 4J9MA 3Q8RB 4TQSA 5CYQA 4IRKA 1T94A 5KFJA 1N5YA 3CWJA 3M9NB 4WZMA 5KG7A 2JEJA 1OS5A 3NKYA 2V4QA 4IFVA 4YR3A 3RBEA 4ZP6A 5KFPA 4ECUA 1FKPB 4QWDA 1RTIB 2FVCA 3IN5A 1HQUA 4RW4A 5C25B 1EETB 5C24A 3CDWA 1DLOA 4KHRA 4JUZA 4MK8A 4ECXA 5L1KA 1DLOB 3DLGA 4J9NA 3BSNA 2YNIA 4NLQA 1S6PA 1BQMB 2J6SA 2EC0A 5C42A 2R2TA 3RB4A 3UR0A 3MEDB 2JEFA 4DG1B 3KLEB 1S0NA 5CYMB 5HLFB 2HAIA 1LW2A 2UVRA 2GIQA 4IR1A 3DDKA 3KOAA 1HQEA 4IRCA 3FDSA 5J2MB 4J9OA 1J5OB 2W9BA 4DL5A 3KLGB 4QPXA 5J1EA 3DRRB 2BANA 5KG1A 4R5PB 1SUQA 3DOLA 3MEEA 2RF2A 1T3NA 1T03A 1S0OA 4RW7A 3DOKA 5KT4A 3HVTB 2RF2B 3BSOA 4WYWA 1LWCB 1IKWA 4XPCA 3PR5B 1T03B 4IOBA 4PUOA 3C6TB 4IG0B 4EBEA 3T5LA 4NRUA 1LWFB 4RW8A 3KLVA 3ICLA 4TQRA 3HHKA 2WB4A 2YNFA 1JLQA 2WCXA 3V6KA 3DLKB 3IGVA 3I0SA 5KFIA 1HYSB 3HVWA 3KK1A 1JKHA 1JLGA 4O44B 1TKZB 4ZPAA 5C24B 4X2BA 3OLBA 1JKHB 3SI8A 1R0AB 4M95A 2WOMA 2XGQA 1VRUB 4H4MB 5KFRA 3MTKA 3H4BA 1TV6A 2OPRB 3QYYA 3I5AA 3UQSA 3PZPA 4FBUA 4F50A 3LP2A 2BE2A 5KFVA 4URGA 4ECTA 4I2QB 2AQ4A 4QWCA 5KT5A 4NLWA 2QE5A 4RW7B 1C1CB 3BGRB 5KG3A 2W7OA 4NCGA 2IC3B 3RAXA 2B5JA 4TYBA 3KLHB 1N4LA 3CJ2A 3MEEB 3DRRA 1RT6B 3KJVB 3I0RB 2IMWP 3KLIB 1RTDA 4ZMMA 1IKXA 3MEGA 4TY8A 4IQXA 3LP0B 5HBMA 3KLEA 4KE5A 4QWBA 4DG1A 5DQIA 1XR5A 4ZP7A 4K4TA 2IM1A 5J2QB 5DGBA 1YVFA 3T1AA 4ECRA 1LW0B 3D5MA 5J2PA 2HNZB 3T19A 1REVA 3IG1B 4ED0A 3C6UB 2W9CA 3KK1B 4KSEB 4EBCA 4PWDA 2ZE2A 2YNHA 2UVWA 5T14A 3M8QA 4KO0A 4LSNB 3JSMB 4ZHRB 3PW7A 2W9AA 4K4VA 1LW0A 5J2PB 3C6TA 5KFAA 3H5XA 5L1JA 1S1VA 3V4IA 2AGOA 1S97A 1JLAB 3DMJA 4IFYB 1C2PA 5F9NA 3BQ0A 3LAMA 1RT1B 5FDLA 5EWFA 3PW5A 3CVKA 2BQ3A 2B5JB 2HWIA 2R2UA 1HQEB 1RA7A 1QUVA 2W8KA 3GIKA 4K4ZA 3PJXA 1JIHA 5L1LA 4ZP9A 3QO9B 1JLCB 5DG8A 1KLMA 3DLEB 4DL4A 1JXLA 1HPZA 2OPQB 3LP2B 3FQKA 1RA6A 3PHEA 4XPEA 4URSA 1RT4A 1ZTTA 2C2RA 2AU0A 3MR6A 2W8LA 1S1XB 3RBDA 2OPPB 3BR9A 3I5CA 4NLXA 4ZP8A 3KK2A 3HKWA 2HNDA 3LALA 4MFBA 3H5SA 2ZD1B 2D3UA 3N6NA 3IGNA 2HNYA 3I0SB 1JLAA 2GC8A 1JLEA 3DMJB 2ALZA 3FFIA 5D3GA 4EYIB 5KFWA 1S10A 4K4UA 3N6LA 3BSAA 3N6MA 1JLBA 3V6DB 4YP3A 2HWHA 3M8QB 4LSNA 1S1UA 3NBPB 1U09A 2WONA 3QIPB 1BQNA 1ZTWA 4NLRA 2ZE2B 1RT2A 3CJ4A 1TQLA 4ICLB 5KFEA 3JYTB 1UWBB 3KLGA 5KFMA 3ITHB 1SV5A 1CSJA 4ZVEA 4EEYA 1N6QB 2DPJA 4Y34A 5KT2A 4NYZA 4NZ0A 3NGDA 1HNVB 2B43A 5EDWA 3OLAA 3DRSB 4JV0A 4DEZA 5KT6A 1S9EA 2IA6A 3RB3A 2IM2A 2E9TA 1QAIA 3H59A 2OPQA 1RT6A 2CJQA 4J9PA 1KLMB 3DLEA 4LSLA 2IBKA 1TKXB 2OPSA 5JXSA 1EETA 1C1CA 2R8JA 2FVQA 3LP1A 1FKPA 2WONB 1RT3B 1RTJB 4KFBB 5KG4A 4XO0A 4NLTA 3KLFA 4RNOA 1I6JA 2I5JB 4O4GB 4TN2A 3NAHA 1SH2A 4IKAA 4IFYA 5KFKA 4J9QA 4Q0BB 3V6HA 2YKNA 4ED2A 4GC6A 1IKVB 2YKNB 4ED3A 1JLEB 5DG7A 1XR7A 2YNGA 1N56A 4O3SA 1S1TA 2OPPA 4YR2A 4IG3B 3OL8A 4KFBA 3QLHB 3CIZA 3KLFB 3QGHA 2R2RA 3OSPA 4NLVA 3OL9A 3MECA 1S0MA 3PW2A 4F4WA 4PWDB 2YNFB 2IJFA 1HPZB 2OPSB 5K14B 3ITHA 4PUOB 4I7FB 5KFUA 3LANA 5KFQA 4HYKA 1T05B 3MECB 3D28A 3QIPA 1S9EB 3I0RA 5J1EB 1TL1A 4TXSA 3G6VA 3MR5A 2VG6B 5KFFA 5DQGA 4IH6A 1N6QA 4B3OB 2RDIA 1GX5A 4MK9A 3OL6A 2BRKA 4IH5A 4ZVFA 1S1VB 4O4RA 4MKBA 2IM0A 1JLBB 3V6DA 5CYMA 5HLFA 2I5JA 4O4GA 4Q0BA 4I2PB 2VG7A 5DQHA 3NBPA 3OL7A 2HNDB 3NAIA 4F4YA 3BSCA 1BQMA 2AX0A 3H4DA 2JEIA 2DPIA 1TP7A 3V81A 4KKOA 1RTIA 3QGGA 3SFUA 1S1XA 5J2QA 4RW9B 4Y3CA 3OSNA 3KK2B 5KFDA 3SFGA 2E9RX 3TAMA 5DGAA 3KLIA 4NLUA 3KK3B 1S6QB 2JC1A 4J9KA 3T5HA 4U6PA 3NMAA 1JLFB 2HMIB 1RTDB 4IG0A 3PJWA 1RDRA 3BGRA 3BJYA 1HNIB 4PQUA 1FK9B 3CO9A 3KLHA 2JLEA 1FK9A 3GV8B 3PVXA 2AGQA 3V4IB 2FVPA 2RKIA 3M8PB 4URQU 4TLRA 1RTHB 2VA3A 3KHGA 4ZHRA 4QWAA 4ECZA 3FQLA 2XI2A 4MKAA 1FKOB 1RT1A 4NLOA 1TL3B 2BE2B 4Q43A 4M94A 3TVKA 1VRUA 2XCPA 4IRDA 5KT3A 1LW2B 1LWEA 1SH3A 1DTTA 5HROB 1DTQA 3Q8QB 3OHAA 3JSMA 2OPRA 3KNAA 1TV6B 4WXOA 2XWYA 2YNIB 2R2SA 2B6AB 2WHOA 3DI6A 5HP1A 4O3RA 2YNHB 4RNNA 3DLKA 5EWEA 4RZRA 2C2DA 2XC9A 3V81B 4EBDA 2UUTA 3LP0A 5EUHA 1SH0A 1RT4B 4WYLA 1S48A 2HNZA 5F8IA 5HBMB 1NHUA 4ZPDA 3DYAB 4TY9A 3VQSA 4Q45A 3FRZA 4IR9A 2VG7B 4I2PA 2R8HA 3ISNC 3GV5B 4Y2AA 1S9FA 4EO8A 4KAIA 3HVAA 3MR2A 4R5PA 1TKTB 1N5YB 3KMSA 5F8HA 2D7SA 1JLFA 4RNMA 3H5YA 4QW9A 2HMIA 4I2QA 4O3OA 4J9SA 1ZETA 5F8LA 2XI3A 5JUMA 5DLGA 4GC7A 5F8NA 3G6YA 5KFSA 4KV8B 1HNIA 2XCAA 4PQUB 3MEDA 2JEGA 3IRXB 1S1WA 1R0AA 2C22A 5C42B 1RYRA 1XR6A 3Q8SB 2W7PA 4ED7A 2ILYA 3DYAA 2WOMB 2V9WA 4RW4B 1HQUB 5C25A 4NLSA 1Z4UA 3H2LA 4ZVHA 5L9XA 2J6UA 3KHRA 2FJXA 4K4XA 1REVB 3IG1A 1DTQB 5HP1B 2BR0A 4K4YA 1S1WB 1C0TA 1HYSA 4WE1A 2BQUA 4TYAA 3GIMA 3GILA 2IM3A 3BREA 1FKOA 1TL3A 2V0NA 4Q8FA 4TY8B 4RW8B 3EPIA 2AGPA 1RT7A 5I42B 2E9ZA 5KFTA 2RKIB 4OL8A 5KFHA 1RT3A 1RTJA 3MFIA 3KHHA 2W9BB 1J5OA 3LP1B 1T05A 5KT7A 2BQRA 4IDKB 3UPFA 3RB0A 2BANB 4WZQA 2ILZA 3DOKB 5KFXA 1RT5A 2VG6A 5I3UB 1D1UA 4I7FA 3H5UA 2AX1A 1S9GA 2CKWA 4MIBA 4ZPCA 3QLHA 3GV7B 3ISND 1C1BA 2IAJA 2YKMA 4H4MA 5F8JA 3TAMB 4WE1B 1S6PB 5KFOA 3DI6B 3LAKA 2ASJA 4ZPBA 2YNGB 1D0EA 3PW4A 1TKZA 4O44A 3M9OB 4MH8A 3JYTA 2ASLA 5DLFA 1DTTB 5HROA 4R0EA 1C0UB 1KHVA 4KKOB 3GQCA 1JLQB 3NL0A 3CDEA 3I5BA 4RNHA 3E01B 1WNEA 3QIDA 3Q8PB 3BQ2A 4F4XA 1LWFA 4WXWA 4IFVB 4EO6A 2WK4A 1HMVB 2ZKUA 5KFNA 2V4RA 2FLPA 4G3IA 1IKWB 3QGIA 4HKQA 3FFIB 3HVTA 2BRLA 4B3OA 1C0UA 3CDUA 3T5JA 3EZUA 4RW6A 1S49A 5KG2A 5CYQB 1RAJA 4JV1A 1MU2A 2JC0A 1IM4A 5EWGA 5J2MA 1TL1B 1S6QA 4ECQA 1TKTA 4NRTA 2O5DA 4KBIA 2UVUA 1TKXA 4LQ9A 4ID5A 5K14A 1JX4A 2AWZA 3GYNA 5KG5A 3GIJA 1HNVA 1TVRB 3G86A 5I3UA 4K4SA 2FJWA 4NLYA 4Q8EA 1VRTA 1BQNB 4H4OA 2IJNA 3DLGB 3T5KA 4ECSA 5J2NA 2F8EX 1GX6A 1K1QA 4ED1A 4ICLA 4FBTA 5F8MA 4MK7A 4IDKA 1S4FA 4QWEA 4RU9A 4EYHB 4ED8A 2FJVA 4WFYA 3M9MB 2C2EA 3DRPB 2R8KA 1IKVA 4O3NA 5F8GA 4IG3A 2R8GA 3MFHA 2ASDA 1S1TB 1LWEB 4DL3A 3PR4A 2VG5A 5KG0A 1EP4A 2J6TA 1IKYB 5F9LA 4NLDA 2R8IA 2VG5B 4KB7A 3OHBA 1QE1A 3RAQA 3RB6A 4Y2CA 2HNYB 5L1IA 4DL7A 2WTFA 2ZD1A 4KO0B 3DRPA 3EPGA 5D3GB 4FS2A 5KFLA 2D41A 4IH7A 1TVRA 5DG9A 2FLNA 2QV6A 3C6UA 4G1QA 4MFBB 4ECYA 3IS9A 3CJ3A 1W25A 3IRXA 4R8UB 3PW0A 1C1BB 2IAJB 2YKMB 4U7CA 3KK3A 4DL2A 5KFZA 4LQ3A 2D3ZA 4ID5B 5KFYA 1QAJA 3DM2A
chains in the Genus database with same CATH superfamily
4DZDA 1RWOB 4WIQA 3KHLA 1XMOJ 1N8RT 3H98A 4C9DA 5H1SV 2HG4A 4CWBA 2KG1A 1WTBA 4QW8A 4C8ZA 4C8YA 1MU2B 2G4BA 4NLPA 2KOEA 1IKYA 2MZJA 2I1RA 2VD3A 2W2PP 3GG0A 3KYLA 2LA4A 3QAUA 4X64J 2OH2A 1HMVA 4PG4A 3IAM9 3UFCX 2FVSA 5BJRA 4AQYJ 1R8AA 4OZ2A 5FDLB 5IC6B 2XLJA 4QYZJ 4B3RF 1X0FA 1Q1KA 4DFKA 1EP4B 4DWIA 5D4LA 2C3YA 2VQFJ 2D1CA 3KG1A 1N48A 2HFSA 2J0XA 2QYCA 4HV0A 1K1SA 3CPWR 4LRDA 5J2NB 5KFCA 3Q8YA 2KI2A 2CQDA 5GMEA 3G6XA 4LSLB 1RWKB 1C0TB 1YI2S 3FSIA 4PXCA 3CJ0A 1KRPA 2BBEA 3TVZA 2EWHA 4K5SA 1JLGB 4ZVGA 2GO8A 4J9RA 2H51B 1FDAA 4YY3J 2J5AA 1FRXA 1FEEA 3K7RA 3L7UA 2MSTA 2ATLA 3TX8A 1WHWA 4NCBA 3HHNB 2I6WA 1B7FA 4QBUA 1N33F 2P2CB 3MR3A 1OMSA 3DC2A 1RTHA 4I0WA 4G1QB 1X9WA 1NKBA 1M90T 3UR3C 3FGVA 2WSCC 1SJ3P 4KV8A 1RT5B 4FS1A 4P52A 1PC4A 2QTWA 4CM0A 1IKXB 1VIOA 3MPUB 4KHMA 4NCGB 2J0WA 1R6VA 1FFGB 5T41A 4DL0C 1HNWJ 1TMJA 1UW4A 4H54A 1B0PA 1S77D 3PX0A 1H0HB 3R2DJ 3M6WA 4DR6J 4QU6A 2F9JA 4ZKAA 5KFJA 2IRUA 1HBNB 3QJJA 1H74A 4OLPA 3R6GB 3ELHA 1WG4A 2R3VA 3MCOA 3PACA 2ZWOA 3ILOA 1UKUA 2ADBA 1XMQJ 3UN3A 3CC7S 3UNGC 1XJWB 3CJ8A 3AXKA 3OFGA 5AT1B 3V5RA 1HQUA 4RW4A 4WK3A 3MOZA 3CDWA 1DLOA 2DEJA 4IQMA 4MK8A 3PIOQ 4ENOA 9RUBA 2BA9A 2MHEA 4DV7J 3J81j 3BSNA 3R5CA 4ETZA 2BE9B 1S6PA 3RTVA 2JEFA 3ULHA 2EC0A 3QQCD 3HO1A 2UXBJ 4PYDA 2K29A 3MEDB 3SV3A 2WSEC 1OSCA 4DG1B 4EMDA 3MUTP 2KJVA 4IR1A 4I6WA 3I87A 2XMVA 1UW9A 3KOAA 2PMHA 1TKDA 2DH8A 5IM0A 2W9BA 4DL5A 4J9UE 4QPXA 3A4TA 2JLFA 3DRRB 3R7SB 5KG1A 4XIUA 1SUQA 3DOLA 1IVZA 2L9DA 2RF2A 4YHHF 1S0OA 4RW7A 3DOKA 3VAFA 2KTQA 4WYWA 3BSOA 1LWCB 2CQCA 4NE9C 2HS4A 2QLXA 4ELVA 4CP5A 1WACA 5AJ3J 4PUOA 3C6TB 3CUNA 4I56A 4NRUA 4RW8A 2P6SA 3NGTA 4PKDB 3KLVA 1IN0A 2JVOA 3PFOA 3ZTSA 2QLJB 1KSPA 2OIHA 3BO3A 4HACB 3W60A 1SKUB 3AD7C 3HVWA 2XO6A 1W7WA 3W1YC 3GP9A 2FY1A 3C19A 1GFWB 1FRJA 4ZPAA 5C24B 4X2BA 1JKHB 3TJ8A 2W2OP 1CG2A 4X4SA 1UFWA 4TU7A 4CI0B 4OHYA 4AXIA 4XAKA 2XGQA 2UXCF 3VW4A 3L95X 1IR1A 4DR6F 4LRFA 3AHPA 3HX9A 1SIWB 2BE2A 2C2ZB 2EK6A 1YJ9S 1N0UA 2GCFA 4CIOA 3CXCR 4NLWA 2QE5A 5D4PA 3D68A 1Y00A 1UPPA 2DNYA 4DMZA 3V2UC 1U24A 3BGRB 3OQ2A 4NCGA 1VOMA 2IC3B 3RAXA 3I32A 4JYAF 4Y2MA 5MAOA 2ZH1A 2YH1A 1HD1A 3NXZA 1WG5A 3DRRA 1FDNA 1RT6B 4ZVUB 3IWLA 2IMWP 2BKNA 1PSDA 4X4RA 4DV5F 1RTDA 2J76E 4ZMMA 1IKXA 1U2FA 3NOGA 5HMYA 2AJFE 4JI8F 4IQXA 4DPYA 1A0OB 2DR9A 4QWBA 1XR5A 4ZP7A 1UJ5A 4A8OA 2HHSA 2NXNA 5DGBA 1FRKA 1YVFA 4DBQA 3HPOA 4EFAC 4HHJA 4I1TA 1X4GA 2CVEA 3C6UB 4PWWA 4OI0A 3D0GE 2ZVIA 2ZE2A 3VVTA 2YNHA 3H0PA 4A8MP 1XERA 4ZOSA 1EA4A 4NXMJ 2ZHBA 1PC5A 1HHSA 2R7UA 4OMFG 4KO0A 3UW1A 2AEMA 2CUYA 2CJAA 2VC0A 4HI2A 4ZHRB 2W9AA 1NZ8A 1B3TA 4DLGA 3EGVA 3PY8A 3VGVA 3MZIA 3V4IA 2AGOA 2YPZA 4UTGA 4DV0J 3MPWA 4DR3J 3AJ2A 1F9HA 1JLAB 3AJ1A 3JQKA 1TAQA 3LGMA 4C0HA 3H2UB 2UP1A 1FERA 3HFVA 3NLCA 4L3NA 2CDQA 5FDLA 3T6JA 2PSZA 2IVMA 3ILJA 2V34A 2V63A 4WPAA 2JLGA 3IA0A 1RA7A 3JAMU 2E7XA 4USJC 4M5HA 2HQFA 5FLXY 2XMWA 5LJ5Y 3GYXB 4ZP9A 1RAAB 3QO9B 3ONQA 4JOUA 4EK2A 2EXUA 1JXLA 1RJJA 4RUBA 1HPZA 2LQ8A 2RS2A 3G9CA 4J9VA 1LFPA 2OPQB 3LP2B 5BYSA 5JVHQ 1XQIA 2LVWA 4DDFA 1FJCA 1ZTTA 2L9NA 4IUFA 2HQ3A 2C2RA 4LFCF 5ETLA 5ITHA 1S1XB 4CQ1A 3RBDA 2G0IA 3I82A 2IDLA 2XMAA 3SZ2A 1AA1B 2J0QD 4NLXA 4ZP8A 1R8PA 2LYVA 2HNDA 3IXQA 4LIRA 4CO4A 4TU8A 2EKYA 2BM0A 2QLFB 5HVGA 4DLEA 3TZYA 2HNYA 1YKWA 3CJRA 2M8DB 2ZBIA 4C8LA 2MZRA 3CB4A 5GAEU 1QUPA 4EYIB 1S10A 4M1KA 1EQ0A 4PWUA 4D3GA 4PXEA 1JB0C 1JLBA 2E7WA 2C3PA 4BC7A 4ZCMA 1OHNA 4YP3A 1IR0A 5CCMA 4YB1P 2A6MA 2J9DE 2OAUA 4P75A 2WONA 4NX9A 2XHWA 3H87C 2V1TA 1K8AT 4Z37A 1WC0A 4NLRA 5IWAJ 1ZTWA 4DF4A 2FQQB 1CQMA 3N5BA 2ZM6F 5KFMA 1SV5A 1CSJA 2XMKA 3A8IA 3FEXB 4Y34A 5KT2A 4NYZA 4NZ0A 3HVRA 2RUSA 1PO6A 1RWNB 3U1LA 4JV0A 1NDLA 1V9OA 2UZAA 4FVCA 4QU7A 2EI5A 2N7YA 4HI1A 5GVQA 1HR0J 2IHR1 3ET6A 3H59A 3CNQP 1TR0A 2OPQA 4EU0A 1OPIA 1QTGA 2J9CA 2XSFA 4DS5A 1NB7A 3M8RA 1KLMB 2UXDJ 2CAXA 2IBKA 1R8BA 2CDRB 3W2VA 1H6KX 2AYMA 4RPFA 2ROGA 5SZTA 3QFHA 3UCZP 2FVQA 1WOSA 2KJWA 1RT3B 2DY9A 2OD4A 1CQNA 2CQBA 2E1RA 4P9SA 1RHRB 2OELA 3GYGA 5KG4A 3W64A 1I6JA 2I2YA 2EC2A 2Z2ZA 1SH2A 3DGVA 2JXGA 1VI7A 4TN2A 3SMZA 5M2UA 5KFKA 2QX0A 3V6HA 3JB9k 4FXDA 1F5CA 4I6AA 4OHZA 3ZZZA 3NGRA 3G8QA 4GC6A 2CQ3A 2GIFA 2XLKA 1XR7A 1CJTA 1N88A 4OZ3A 1D8YA 4JI3J 3BDEA 3AH6A 2AJ0A 4KC5A 4LFBF 2V6AA 5L38A 2UUAJ 5EWGA 3GJSB 3CD0A 3MECA 4I4BA 3VVUA 1S0MA 3AX5A 2OEKA 3PHTA 2NXCA 2YNFB 2V2ZA 1HPZB 1JNZB 3DOMB 4N77A 1VBKA 2QL9B 4OJ1A 3W5XA 2H3AA 3C16A 4CNYA 4JI7F 3I55S 1T9YA 4KHPJ 2DNGA 4N7TA 2K3IA 3IBCB 4AL5A 2Z4PA 3ET6B 5KFQA 3VALA 1T05B 3POTA 3RW7A 1S9EB 1WEZA 5JMNA 2X51A 2HGNA 1UZDA 2ZC4A 1EKRA 2EFVA 2V69A 3C14B 3O5TB 4B3OB 3P49B 2ZJQQ 4MK9A 2HHQA 4IH5A 2IA0A 2QZ8A 2F8MA 4O4RA 2I8EA 3CCRS 3NO7A 1UP1A 2IM0A 1D8ZA 3K2YA 1EARA 5LMNF 4HR2A 1UA0A 3NBPA 4F0MA 1ZBTA 4JB8B 4F4YA 4FYDA 2WVEA 3BH6B 2GFFA 4DV1J 3UDVA 3CCMS 1B0VA 3ZZTA 2YH0A 2MYFA 1MN9A 5E3CA 1HQ2A 3NNEA 3V81A 1KWMA 2VH7A 3BH7B 1U6FA 1SVDA 2MQ8A 2LXUA 4C8OA 4P72A 3QGGA 4ED5A 4RW9B 4Y3CA 4MYTA 3EXCX 3F41A 1NSQA 2FGOA 3L9ZA 2BOPA 1T9TA 3SFGA 4LR9A 2HBZB 3N01A 4O0IA 3KK3B 1NUEA 3CCSS 3BDPA 1LK5A 2BMBA 3UD5A 3I56S 2BW2A 4U6PA 2PEBA 3OTDA 2X1AA 4IG0A 2FIUA 1RDRA 2R7QA 3BGRA 4ZIVA 1HNIB 4UUWA 1RKJA 3CO9A 2JLEA 4Y28C 3K5PA 1KFDA 2OMOA 1KOOA 2RKIA 2A2DA 1PYSB 3EVOA 1FDDA 1RZMA 3M8PB 4K8RA 2GMLA 1RTHB 2C1EB 2EFPA 3QSIA 4URQU 4Z7CA 3OTCA 3KHGA 2MQOA 2HHHJ 3PKYA 4HL9A 2L41A 2XI2A 3M8SA 3K58A 2BJ9A 2Y3YA 4DV3F 4ILMA 1VRUA 4L3KA 3HXMA 2ZJPQ 1LW2B 3BYPA 1X93A 4LJMA 1CJKA 1DTQA 4OI2A 5HROB 3OHAA 1TV6B 2OPRA 4U9RA 2V8DA 2KVQE 3SCKE 4ZA1A 4GKKF 3W2WB 1E6VA 1NPRA 2D74B 3KKFA 4OYAA 3OUYB 2R2SA 1VQLS 2YNHB 1U0HA 3DLKA 5EWEA 1O8BA 1BE4A 4E2FB 3V81B 2J9DA 5HBMB 1D9AA 1SH0A 5F8IA 1IWGA 1LQ9A 3PCOB 2CQIA 3UVJA 4IR9A 2KFYA 1UVLA 2KU7A 1FWPA 3GU0A 4I2PA 1HW9A 1K9MT 2Y8YA 2GJ2A 2WAQD 1WUUA 3RU0A 5GAHI 2HVZA 3KMSA 2D7SA 2MLYA 4DU7A 4I2QA 4GVLA 2DRDA 1NEEA 3CD5A 4ZLNA 2NLWA 4M63A 2HGLA 2D68A 2LDIA 2CQ0A 2ZBPA 2BVZA 4M5DB 3K5MA 1L3TA 5F8NA 3R2CJ 3OR1A 1NO8A 3MEDA 2GVZA 4OX6A 2Z8QA 2JEGA 4YS2A 2JFDA 3VHQA 1R0AA 4CZCA 1XR6A 2DKOB 2W7PA 4ED7A 3DYAA 4MJKA 2ZH8A 2HAFA 3IWNC 1RHQB 2CFXA 2G2YA 1YRTA 5LSOA 2FJXA 3EDRB 2ACMA 2DXEA 2JZ5A 1KKHA 1S1WB 1AB8A 2EFNA 2ZC3A 4KIAA 3AAWB 4WE1A 2IM3A 3BREA 4X4TA 1FA0A 2M70A 2QMWA 5IT0A 1TL3A 3W5ZA 3BO2A 2V0NA 4UOGA 4JI6J 2K3KA 4RW8B 3N5FA 3O44A 3FMTA 2VBWA 2VFUA 2HS3A 2M5YA 4U7UD 3TA2A 3MFIA 1RT3A 1DZ5A 3CCQS 2QL7B 1RAOA 4FYXB 1NK6A 3Q8VA 2KG0A 3VQTA 1T05A 3OFHA 1J5OA 3RR8A 3GFYA 3UPFA 4IDKB 3RB0A 4GKJJ 4WZQA 4DX6A 3P5BP 1QTNB 2DNOA 5KFXA 4F25A 1WD6A 5I3UB 2BNWA 3MMBA 1D1UA 4PG6A 4DR3F 1MNTA 3H5UA 2AX1A 2O3DA 2Y1IA 5LT5A 1V6HA 3SQGA 3FKBA 4N76A 3MMAA 4DV6J 5E3QA 2XG8A 3HD1A 4P6QA 4FNIA 2YKMA 2BJ8A 1VQNS 2FD2A 2DBBA 2MZTA 4ZPBA 2YNGB 3LAKA 1TK5A 4GO5X 4K7QA 4LRAA 3PW4A 1D0EA 1VMBA 2QN6B 4O44A 4JV5F 5GADU 3NOCA 1Q78A 3JYTA 3AD9C 5HROA 4PPDA 3TWZA 1KHVA 2NSBA 3CDEA 2DK2A 1ZZFA 2H65B 4RNHA 4CLUA 3BO4A 4F4XA 3QIDA 3Q8PB 4LF6J 4L75A 3ZTQA 2RD5C 4IFVB 2V4RA 2FLPA 1HMVB 2ZKUA 4HTJA 2KYZA 3VZIA 1YIJS 2DR6A 4G3IA 1OSDA 1Y0HA 1IKWB 2P9EA 3O8WA 2QJ3A 3NRBA 4I69A 8AT1B 1JXEA 2HEKA 2M9KA 2CRLA 2BKPA 4WTYA 1Q86T 2EKNA 2F8HA 4RW6A 1S49A 4ZLJA 1WKJA 1GH8A 1GMVA 1Y4ZB 4JI4F 3HSDA 2JC0A 2EBGA 3S01A 5J2MA 1TL1B 3MM7A 4LVNP 1TKTA 2O5DA 3TZXA 1KQSR 2FJAB 4B3TF 1WELA 4KPYA 1TKXA 4LQ9A 4WTOB 4PEOA 1IBMJ 4B3SJ 1GNKA 1WKLA 2V8VA 1YJNS 2IY5B 1NK4A 1UZHA 2CG8A 3DDNA 4ZLLA 3G86A 3US5A 4K4SA 1ZPWX 3D9BA 5HL7Q 1NK7A 1N56A 2HQDA 4YOEA 4TU9A 1P1LA 1VQ5S 2FHJD 2AF6A 2XHCA 3BBCA 2KXFA 2YWKA 3QATA 3M32B 4ZVSB 3SDEB 4RU9A 4EYHB 1Q82T 3PKMA 4TNOA 3A3OB 3M9MB 1X5OA 1CJVA 1IKVA 2DIVA 3Q2TC 3FT7A 2XTDA 2W2NP 4X4QA 2RT3A 2R8GA 3W3SA 2ASDA 1S1TB 3PYGA 1FO1A 1CLFA 4DL3A 2WZ1A 1EP4A 5LXRA 1OYDA 2R8IA 5CYJA 4CO2A 3RAQA 5HMXA 1M5SA 5L1IA 2E7VA 3I96A 2M52A 4UZCA 2VQFF 4DUZF 4DL7A 1WHVA 2VU5A 2KRRA 2U2FA 3AQPA 4HT7A 5KFLA 1A7GE 3RAMA 5HJYA 5L9NA 4GO7X 2IVFB 5DG9A 2EPIA 2CQ4A 1V3SA 4G1QA 4GVBA 4MFBB 2YWHA 3IS9A 4Q7AA 3CJ3A 3IRXA 4BDPA 4FYWB 2CIMA 1RWWB 1KDNA 2GQCA 2IAJB 3KK3A 1IWAA 2B8QA 3VGTA 4CLWA 5C7PA 1Y9OA 1SC4B 3K89A 3DM2A 3M8ZA 4RUAA 2VFTA 1QAJA 3K0JA 3QPIA 2W25A 7FDRA 1GMWA 3N79A 3AX2A 1A6LA 1DQAA 2F40A 3B4DA 3BBFA 3ISZA 3R5DA 3UDLA 2RHQB 1NNDA 1XNQF 3QO9A 5B09A 4ES3A 2XYGB 4K4WA 5A8WB 3V6JA 1S1UB 2CADA 2CVIA 3A13A 3I4HX 2RQMA 1Q8BA 1R89A 1D09B 2W01A 3HF5A 2B8PA 3KG0A 4YUDA 4O23A 4ECVA 1NSPA 4NZ6A 4CYUB 2UUWA 2H4WB 3MM9A 1WORA 4PQAA 2W9CB 4MKYA 4LF2A 3UI3A 2OSQA 2KXNB 2LLZA 3HHLB 3TO8A 2DB1A 2ZOFA 3MF5A 1KTVA 2ERRA 2A3JA 5HANA 4JV2A 3QRQA 4KPCA 2MLXA 3EICA 1RQ0A 4HACA 3D54A 1LKZA 2F9DA 5LM7E 2XBPA 4K50A 5D4NA 5C5JA 4R8UA 2V2VA 2YKAA 4OX8A 3IS9B 1VRTB 3GIIA 2FGCA 1HARA 4WWSA 4UZBA 1MMNA 2M4MA 3FRYA 4DHVA 2FVRA 4LF1A 1LWCA 2QMUB 4WIIA 3T9ZA 4YQWA 4ZK7M 1SUQB 1RWUA 2CQ1A 2RS8A 3DOLB 2IYIA 3M1VA 4OYXA 3TZWA 1FX2A 1FRIA 4NYOA 4ECWA 3TQ1A 4WFXA 1RT7B 5D15A 2XGPA 5HLFB 1QTMA 2CJKA 4TQSA 5CYQA 4IRKA 1T94A 4OJ3A 2C3MA 1BLUA 3LTOA 2WVDA 3THVA 2J7UA 1FEHA 3MM5A 4IFVA 4YR3A 3ENQA 3V4MA 2QYGA 3RBEA 4NI2B 4ZVTB 5HI7A 1IBKJ 2NYIA 1FKPB 2B51A 4LBPA 5LL6d 4QWDA 4ECUA 3ZZYA 3QWPA 5C24A 2F4VJ 4LFBJ 1ZPVA 2Z2MA 3DLGA 1OG7A 1PG5B 4NXNJ 4USIA 3VAHA 1GXTA 4BLGA 1KN6A 2YNIA 2OEJA 1ULRA 1I94F 2K9IA 5EX0A 5L39A 4JV5J 1N36J 3O2IA 1FWKA 4F8RA 3P45B 2HAIA 1LW2A 4CO0A 2A0FB 4P2MA 5ADZA 4UF4A 1YK9A 2J8AA 4B3RJ 2R7TA 3TNVA 3DDKA 1TK0A 2J7KA 2EW9A 1HQEA 4YB6A 4ZPWR 5E0OA 1DURA 3VAMA 1L3VA 1J5OB 2H54B 1E6YB 5J1EA 5D0HA 1NH7A 3H7HB 2VJVA 3TAQA 1T03A 3BM7A 2HHWA 4FPRA 3PO5A 2CAJA 1L3SA 1N34F 2YPYA 3WC0A 1G4CA 5ETKA 1KVIA 3IO1A 4IOBA 4IG0B 3TZZA 1NDPA 2E1PA 2ZDPA 4TQRA 2DNQA 1BC6A 1JLQA 2A2CA 3IGVA 3I0SA 2HFVA 2CNOB 2JH3A 3D3CJ 4H4KC 2ZM6J 3NNCA 1N36F 1FI4A 2V67A 2RBFA 4O44B 4QPTA 2V8GA 4DX8H 2VONA 2E44A 3NGUA 1WF1A 2MQMA 2GO9A 2B9WA 2WOMA 1VRUB 2VKRA 4H4MB 3H4BA 3MTKA 3PV8A 1F5AA 2VDIA 4B9TA 5F0UA 1M5KC 1UVIA 1CJKB 1UA1A 4ZIWA 3GFXA 4DR5J 4F50A 4M5NA 5KFVA 2HHPA 4URGA 5KAKA 4ECTA 3A8EA 2GNKA 2PN6A 3WIUA 4RU2A 5KT5A 1XMQF 1K73T 3UCGA 1U6BA 3AOAA 3N0VA 5AXMA 4LF4F 5K20B 1HI1A 4ZN3A 3PJ9A 3CJ2A 3MEEB 3DLBA 3OJSA 4LIWA 3KJVB 3GWCA 3I0RB 1H98A 1ZYQA 1R6YA 4DI6A 1VQOS 4F3OA 2NSCA 2B4VA 5D78A 2LU1A 2VIHA 3KLEA 4DG1A 5DQIA 3BEGB 4IO1A 4OZ0A 8RUCA 3GFHA 3NNHA 1TK8A 4I6YA 4ZPTR 1KVKA 2RQ4A 2HNZB 4U96A 3VZHA 3IG1B 3M2RA 2ZBQA 3LJPA 3KNGA 4O0NA 2W9CA 4OZJA 4OL8A 4KSEB 4EBCA 3GXQA 2EFGA 3OTEA 1AT1B 1L3UA 2MQPA 2Q43A 4OZ1A 1UVNA 2UVWA 1N34J 4OHVA 4LFAJ 2JVRA 4OIXA 4DFPA 2BKOA 2B7CB 5KFAA 1PJ7A 3J81U 3H5XA 3EDQB 1EAYC 1EX8A 2CNNB 4M5GA 5L1JA 2UUAF 5CQGA 2CYYA 4DS4A 4ED0A 1X7VA 2Q1LA 5F9NA 4LRBA 3BQ0A 4EGLA 4ZVQB 3TJ9A 1KONA 1G7CB 1RT1B 1S12A 3VWSA 4AAIA 2K06A 2Y1JA 1ZOTA 2BQ3A 2B5JB 2AKWB 1EQMA 1HQEB 1SBRA 3WBZA 3GIKA 3M1VB 1U8WA 3R27A 4OV6A 1TL7A 4Y0FA 1T3OA 2DHAA 4XDDA 1JLCB 3EXYA 4YEAA 1UETA 5DG8A 1KLMA 3EGWB 3FC9A 1IBLJ 1K0VA 1KVJA 1UMJA 1RA6A 3PHEA 2ZH9A 4URSA 1RT4A 2KFZA 1VIXA 1MMDA 3MGJA 2AU0A 2K7JA 3MR6A 2OUGA 1N32F 2VJUA 4J91A 2EEYA 2WBRA 1XN9A 2OPPB 1SCJB 3BR9A 1T9WA 3I5CA 1X4FA 3O6QA 4K0KF 3LALA 1IJFB 5AE1A 4DQPA 4DR1J 1R31A 2ZD1B 1KFSA 3U1MA 3G96A 1Q8IA 3DMJB 3GJTB 1VQSA 2FY8A 1LEOA 5D3GA 1TZ0A 2H5IB 3CW2C 4RJVA 3ZZRA 3IMQJ 3MM8B 3N6MA 1NU4A 2C2NA 2BJ3A 1VJWA 2CQGA 1O0PA 2XZTB 4JBCA 4UOHA 1BXNA 4ES2A 4OX9J 4LSNA 3NBPB 1U09A 2XYPB 5ETQA 2ZNYA 3TEHB 1HBOB 3J7Z5 4DSFA 3M32A 3SDEA 4EI2A 3QRPA 1Q7LB 1Q8LA 2RILA 1RT2A 2VFSA 3VGUA 2ZWPA 3CGIA 1E6YA 1MW7A 4ZVEA 2H9ZA 3JYTB 4EEYA 1GMUA 5IT9Y 1GAOA 3HDSA 4C2MA 2B43A 5CA5A 5KT6A 1SC3B 1S9EA 3AODA 2DGQA 1OY6A 4K0KJ 2CPDA 3M05A 1NXIA 1BWVA 3CCJS 4GKKJ 2AJQA 1NJYA 3MR7A 2FB0A 3W9JA 4DCJB 4X66F 4J9PA 1YBUA 2OPSA 1Q53A 5D0GA 4B17A 4LF5F 2J8SA 1TUGB 1UJ6A 2QA4S 3LP1A 1L3KA 2DHXA 2WONB 1HBMA 4XO0A 4RNOA 2GHPA 2EBEA 1IRQA 1SJ4P 1FNMA 4IFYA 4JI0F 4DPUA 3BGUA 3W8PA 2XS5A 3B82A 2HRUA 2ZBRA 5IV3A 4ED2A 1XMBA 1U0SA 2YKNB 4ED3A 1N5VA 3R97A 5DG7A 3ZZ0A 3H25A 1IQTA 2YVSA 1GXLA 4W98A 3SSSA 3B54A 3BPDA 3QLHB 3CIZA 3QGHA 1PILA 4RBTA 3OL9A 2IIHA 4N56A 3K5NA 4DSLA 2NQPA 2AYGA 4BWJA 2IJFA 2X1BA 4OI4A 4PPZA 3TA0A 3H42A 2Q2KA 1VQ4S 2AY0A 1G2EA 2Y1LB 2RH3A 3WX8A 5J1NA 4DN9A 1I1GA 3J7YU 2R7XA 2KRBA 4DUZJ 2OFGX 3F73A 4AQYF 3G8SA 2CPZA 3PXGa 2VPZB 2XYHB 4R25A 2XULA 3QIPA 4ZITA 1FJGF 5HN0A 2W1BA 1JJHA 5B0AA 2YKOA 4LREA 5J1EB 3GIRA 3DCAA 1TL1A 4XDCA 3A8KA 5DQGA 4IH6A 1N6QA 4LF9J 2PA8D 5CABA 2O1PA 2BRKA 2JXIA 1FTCA 3CMES 2VUGA 4B3MF 1F9FA 2F3JA 5CYMA 3M7VA 3WDOA 1C4AA 2FC8A 4TLQA 5HLFA 4DV4J 1F2GA 2VOOA 2FHOB 4Y6IA 3BSCA 1BQMA 2JEIA 2BV3A 1FE0A 4XK8C 1M5HA 1H2TZ 3AQOA 4ZS6A 2R7OA 3R3TA 3VTIA 4JI6F 4HEA9 4AT1B 2BDPA 2KELA 4KKOA 1VC6A 2UUBJ 1PKUA 4DR5F 1RTIA 3CCVS 1D9FA 1RCOB 2WVCA 1UFLA 3KK2B 1W2BR 3QJPA 1S4EA 1P1TA 3VCDA 3EMTA 2R9LA 5DGAA 3GG1A 3MWBA 3M6XA 4NLUA 2CNKB 4TVAB 2AP6A 2CJBA 2JC1A 2HHHF 1WTFA 5IT9U 4NEZA 1JLFB 1GK8A 3M6VA 3MM6A 4C3MA 3PJWA 5E3PA 2HMIB 3CULA 3PM9A 5IT4A 2OTJS 3OR1B 1FK9B 3KDNA 3TUJC 2CPEA 3SSRA 3HZEA 2HIQA 3ETMA 3N28A 3WIVA 3PVXA 3HMJG 3V4IB 1DRZA 2FVPA 1SL1A 2VOPA 1WHXA 3D67A 4USVA 2H1OE 2KYXA 1H73A 2VB6A 4B02A 4CO5A 4ZHRA 4QWAA 4ECZA 3W9HA 2MKYA 4C3KA 2B0GA 1FKOB 2L3MA 1YSJA 3BPSP 3K5OA 2QRRA 4DX7A 2OFHX 1PJ5A 2XCPA 2KT5A 2QSFA 2DXFA 1SH3A 1DTTA 3ZNUA 3Q8QB 3JSMA 3QMQA 5LSLA 3PYEA 2DGTA 1ZZNA 3NP5A 3CC2S 1UL3A 1OO0B 2YWGA 4MTPA 5FIIA 3RGIA 3PFEA 4ANEA 4F0KA 1K44A 5HP1A 1YBTA 1NPPA 4ZVRB 2DNKA 2ZEJA 2ADLA 3GZ7A 2UUTA 2UV8G 2GPEA 2IJRA 3EVMA 2FTRA 4WYLA 2HZAA 5EUHA 2UV8A 3ZTOA 5IS2A 1NHUA 2A18A 2GJFA 1YDLA 2Z2YB 2K1RB 2V5HG 2X7IA 2YX7A 3C15B 3DNCA 3FRZA 2VG7B 3UDCA 4CLSA 2XWXA 3HJVA 3ISNC 4Y2AA 2LKZA 3OBIA 1XWLA 4OI6A 1RAHB 1V3ZA 1EB0A 1B01A 4C98A 2Z57B 1JLFA 5EGYA 2KT2A 3PG9A 4OFZA 4QW9A 3GMGA 2HMIA 3F44A 2DNHA 4J9SA 3M2UB 5K9FA 1I94J 2MY7A 5JUMA 1QM9A 3TARA 4TKTA 5DLGA 2VFRA 1ARRA 4YDXA 2MGZA 3EJMA 4G1IA 5KFSA 3CCWA 4KV8B 5DM6Q 1QLNA 4PQUB 5F0WA 1WC6A 1HNWF 1AZSB 1S1WA 3QT7A 4RWWA 4H4KA 3SQOP 4DCOB 5A2QU 1M5PC 2CPXA 3BKUA 2KHCA 1MNEA 2C22A 5CAAA 4ITSA 2KHDA 1NJIT 2CPFA 2H3EB 2J9EA 3OXFA 1CS4B 5C25A 4NLSA 1X9MA 2PI4A 3L7OA 4LF7F 1EHWA 3KHRA 3LW5C 4CCHA 4CTAB 5DJBA 1S7HA 4K4XA 1REVB 1Y7PA 2F5GA 2PDAA 2YBVA 3DLJA 3OPKA 4F3QA 1BGXT 5HP1B 2BR0A 2V2QA 1C0TA 2VZ9A 4PAAA 2LEPA 2QLBB 4TYAA 4A46A 1HYSA 5ETNA 5JVGQ 1T0TV 4F4AA 4LF9F 2NXJA 2MZQA 4TY8B 2AGPA 5LJ3Y 3TUPA 2BSQE 2ZDOA 3ZXWA 1VS3A 5I42B 2E9ZA 3BKFA 1VQ8S 4WP8A 3SIPB 1KNZA 1JNRB 1PARA 2BQRA 1X5PA 4OYPA 2MXYA 4OQJA 1EZZB 2NREA 2BANB 2NPFA 1BDTA 2C3OA 2KFNA 3Q8UA 2BACA 3MM6B 4F7VA 1CC7A 1HWLA 1RT5A 4PXDA 3U27A 4DR4J 4USKA 2FDNA 2N4DA 4I7FA 4DQQA 1YJ7A 2ZH4A 1U47A 4LBHA 1V5VA 3PYDA 3ZTRA 3I4PA 4E0DA 2Q6CA 4AYBD 4ZPCA 4CLLA 1YLXA 2IAJA 3D1OA 5DETA 1TFWA 1UEKA 4WE1B 4NL5A 2W24A 1NKEA 3MAAA 1TKZA 2POKA 5K8NA 2RJZA 1CJUB 4W4MA 2UU9J 1DTTB 2BZ2A 3P8BB 5D0EA 4KKOB 3H2VE 4KGMA 5E2QA 4C0OC 3GQCA 4PABA 3NL0A 3PX6A 1DQ8A 3LA0A 1LV5A 1YJUA 1HBMB 4ES1A 3E01B 1VYAA 3ZFVA 4ETXA 1KQFB 3BQ2A 1LWFA 5KFNA 3HCXA 4EO6A 3C2PA 3MUMP 3HM9A 2XMMA 4DR7J 2GHVC 4L6V3 4QR2A 2VV5A 3FFIB 3HVTA 2BRLA 3W2VB 3UD3P 4B3OA 1C0UA 2BJ7A 3MPDA 2RRNA 1BAZA 2GGPA 5CYQB 1MU2A 3R1LA 4JV1A 1IM4A 1RAGB 3PRBA 4C8MA 4KGXB 3BZQA 2MKJA 2NS1B 1YGYA 3I6PA 4NYPA 1D3WA 1S6QA 4CH1A 3P6YC 2PE8A 2UVUA 4KBIA 1BHNA 2COLA 3RW6A 1IR2A 3H20A 4CT9A 2NYHA 1U1KA 2OHDA 2OSRA 1U1RA 1CBKA 3GIJA 3MMJA 2WW4A 2CG4A 1HNVA 2RB7A 2BJDA 1VBXA 5A0YA 1MWYA 4B08A 3OTOF 2FJWA 4NLYA 1LNQA 1VRTA 2HW3A 4Q2MA 1U1NA 3DLGB 1WHYA 3T5KA 5J2NA 1TL7B 1K1QA 1FRMA 1GX6A 2IDEA 3OFEA 4ED1A 3T1YJ 3MXHP 5KOXA 4IDKA 3LF0A 3Q0AA 4A8FA 4ED8A 2DGVA 4WFYA 2C2EA 2QO3A 2HS0A 1T9UA 1LWEB 1RE1B 1TUWA 2BA3A 1Y5LB 4U8YA 1P9YA 3PR4A 3T3FA 1HA1A 5KG0A 1TAUA 1IKYB 4FXWA 3CJKA 5F9LA 2DR7A 4E98A 3LQVA 2O66A 2VG5B 3OHBA 3D66A 2QMXA 3HHDA 4M5LA 4UOCA 5D0RA 2B3TB 2ZD1A 2H5JB 4KO0B 1OM2A 1LXJA 4Q2LA 3R9LA 1KC8T 3WC2A 7AT1B 4FS2A 1C4CA 3IC1A 4WU2A 1OQ3A 1YX2A 4DPOA 3FZBA 3THPA 1MG7A 1XBWA 2QV6A 2R42A 3M30B 4K2XA 5LSRA 2XM3A 5I4MA 3QRRA 1RU1A 2DISA 3UO0A 1QSLA 2RQKA 4Y2KA 1VDHA 1W25A 4PG7A 4R8UB 2VQEJ 3TYTA 3BB5A 3PW0A 4U7CA 1ELOA 2AW0A 3FMBA 2ZHOA 3KUEA 3TRGA 5KFZA 1EKSA 4YB7A 3MUVP 4DSJA 1BMQB 2VPXB 3G82A 4O3PA 3DRSA 1LK7A 4JI0J 3TANA 3PR5B 2ROPA 3K8WA 2RRAA 1YQHA 1Q8KA 2YQ3A 4WFZA 4FF4A 1URNA 1TELA 4DFMA 3KMQA 2VPWB 1T9XA 3LGHA 1WWHA 2HHXA 5B0CA 1NHVA 2CPGA 4Q44A 5K5MA 3JQMA 4V19J 4CH7A 8ATCB 5IC4B 4MYUA 4DSIA 4B9UA 5CCLA 3LGNA 2HSEB 4X66J 2X3DA 5DM7Q 1WJ9A 2VC1A 2RDJA 3Q22A 2ZH5A 1F2HA 3E01A 5HQLA 1KLNA 4W92B 1MYLA 2Y1RI 2NZCA 4A8SA 5IXUA 1QVGR 2XQCA 3SYZA 2QFIA 3FJ2A 3FVYA 2C28A 1JWWA 3DM2B 4DL6A 1S99A 4FVMA 4DV1F 2FLLA 2LXFA 4Y00A 4JI2J 2JNJA 5FLXU 5KG6A 1FNOA 4F4ZA 2KZMA 2JJ4D 4QQBA 2DR8A 4QIVA 3M2RB 3G4SS 3AA8A 3S7RA 1OYEA 2Z58B 4FF3A 4C0BA 1SV5B 4P2SA 3M8PA 4C6AA 1RT2B 5A2QY 3VAJA 4BBYA 3S8SA 2JWNA 2KDOA 2K2PA 4O3QA 4I67A 4ATNA 3QZ7A 2RHSB 1UUJA 3D6TB 4FF1A 4USUA 3VAIA 3DKDA 3QZ8A 4J9MA 2XO7A 1PIEA 3RZAA 3CD7A 2RRBA 1N5YA 3M9NB 2AN7A 4WZMA 5KG7A 4AL7A 2JEJA 1OS5A 2EG1A 3NKYA 5E33A 4CNZA 2V4QA 4OJGA 2MB0B 1VQPS 2NZ4A 3GE9A 5KFPA 4J5OA 2CQPA 4X65J 4IYQA 3IN5A 2FVCA 2W4PA 1SJ1A 1CS4A 2DO0A 5C25B 1FNXH 4KRWA 5B0FA 1BD6A 1HWJA 2E5HA 2XTEA 2OI2A 1DLOB 2MHNA 3D0HE 3L09A 4AUKA 2WB1D 3DDIA 2BX6A 5GMKa 2IPOB 1BQMB 5C42A 2R2TA 2HKEA 5EN1A 1RP5A 3GSDA 4IOAQ 3BBBA 4KJIA 3QT6A 2GA7A 1YJVA 1R27B 1Z2LA 5CYMB 3MMAB 1FESA 1RSCA 4MIWA 2EK1A 1F5BA 5AXNA 2R7WA 2DRAA 3OXLA 1NJWA 2AHOB 3M8YA 3NNAA 3FDSA 1RAIB 4P2XA 3RBXA 2D3OR 1U48A 3DFEA 4PRFA 3W62A 1NRKA 1U26A 3G87A 3KLGB 3T41A 5F3ZA 2BANA 1SKSA 4R5PB 2K8GA 3MEEA 3R8YA 3SV4A 1NJXA 3ETOA 3HVTB 4USWA 2KKEA 2RF2B 1UVKA 1N5QA 1IKWA 3D1QA 3R5BA 2DT9A 1O51A 3C15A 2HZVA 2I9SA 4LBIA 4RBUA 5B0GA 5U47A 4CH0S 3PTWA 4IOCQ 3T5LA 2XY6A 2ZZMA 5EHHA 1U2CA 2DNMA 2FJDB 3DXSX 3ICLA 2XZWA 3DU5A 2WB4A 3HHKA 4JP8A 1X4EA 4EUVA 5BR8J 3DLKB 4F2SA 3AT1B 2A1BA 2MKKA 4DPWA 1JKHA 2YTCA 5RUBA 1TKZB 1G6BA 4HHUA 3SI8A 4G6VB 1CJTB 3C8YA 1Q16A 3NY0A 3J7ZT 4OHWA 5KFRA 4P2FA 2M2BA 3CE8A 2DR5A 4JI5F 3QYYA 4WF9Q 3I5AA 3UQSA 4CLPA 1WEXA 3PZPA 3LP2A 3H8YA 4MMOA 5AE3A 2V1SA 1FWLA 1Q7YT 1UVJA 4I2QB 3P96A 4MJWA 2IYGA 1B4SA 4RW7B 1X5TA 4X84A 4J7CA 2HBRB 3BGOP 5KG3A 4KTQA 2W7OA 3PO4A 3TR5A 2B5JA 4C8NA 1KS2A 1NDKA 1RWMB 4ZCLA 4S0MA 2IVYA 1TL4A 4XPCA 2AEJA 3CJTA 1J27A 1GTEA 3J80Y 4C97A 1VR6A 1RCXB 4YFUA 3OW2R 1SQFA 4TY8A 3FSYA 2L9WA 3LP0B 1NBEB 4KE5A 4QIGA 5D77A 4K4TA 4OYZA 1WSVA 5J2QB 3CC4S 1FJ7A 2E1AA 3T1AA 4DR2J 2PMWA 3VAKA 3HHLA 2IMOA 1IQZA 3IR7B 1SL2A 5IV4A 1FD8A 1HI0P 2MKSA 3KK1B 4OX7A 4DXLA 5HSPA 1U1LA 1JXVA 1DHMA 1VK3A 3B8HA 3PEJA 1N33J 2YQ0A 2YKQA 1J5EF 3TW0A 2Q3PA 2AIRB 2BXJA 2RUGA 4LSNB 1VK8A 2B4PA 5HVFA 2PD1A 3PW7A 1LW0A 1U2RA 3C6TA 5C2GA 1B0TA 2MJUA 5J2PB 3MM8A 1S1VA 2JL9A 4A8QA 2BW7A 2YWEA 2MSSA 2GX8A 5IOLA 4QIEA 1VJQA 3CJKB 1S97A 1RLDA 1FJGJ 2D9PA 5CZXA 3VAGA 1FXLA 2ZITA 4IFYB 1C2PA 1KQGB 2FLOA 1FFWB 4YDDB 3PW5A 5EWFA 2NR0A 1JMTA 3CDBA 1S76D 3HHEA 4KYZA 2HFOA 5J1PA 1QUVA 2W8KA 2LQ9A 3QFWA 2Z0GA 1DFDA 2LEAA 1FRHA 2DGSA 2BEFA 1VBZA 4DL4A 4HH0A 2WVFA 3S1TA 3VF0B 3AX3A 3FQKA 3RBZA 4CO1A 1AXQA 1SQGA 4XPEA 3FK4A 4NCAA 4JYAJ 2HK2A 5MLCV 3R7BB 2VODA 1UAWA 2W8LA 1RBAA 3A3PB 4ERDA 5BXIA 1Q81T 4BWMA 2CZ9A 2KB2A 3KK2A 4MFBA 3MI7X 5D6GA 3A12A 3MAHA 2CXEA 3N6NA 2RIJA 1XNRJ 2DVIA 1FDBA 2YX4A 2RU3A 1JLAA 1GXUA 1T9VA 1B28A 1U25A 2G1HA 2QSWA 4UUXA 5IQ6A 1UTAA 2CJYB 3KJNB 1R8HA 5E3RA 2AD9A 3N6LA 2AYEA 3A1YG 3BSAA 3NS7B 5DDOC 4A4JA 1K0TA 3AOCA 1ARQA 1X5SA 2GMHA 1RACB 2EFQA 2LXIA 3FBCA 3M8QB 3O1LA 5E41A 1FT8A 2R7RA 1QD1A 1FJEB 2DRBA 3HJFA 1BQNA 1PAEX 3FEYB 3EWGA 2ZE2B 4FN5A 3CJ4A 1SKRA 2DCLA 4ICLB 4QIFA 1UWBB 3WHIA 4EWTA 3KLGA 3KLFA 1ZETA 1D9DA 2J0SD 3C14A 4M5KA 3NGDA 1MWQA 2NCKL 3RUBL 1YHQS 4DV2J 4FF2A 4X64F 5EDWA 3OLAA 4DEZA 1Z2ZA 5I3QA 1UJ4A 2IA6A 1YJWS 1P94A 2IM2A 2E9TA 3IFEA 3KFWX 1V5IB 4RWXA 4EZ9A 2GGPB 4OI1A 2G13A 1RT6A 3DLEA 1LOUA 2NUUG 4YHHJ 2DD8S 2BJEA 5A8RA 3VGSA 3W65A 4C11B 2K5JA 3UN5A 4NEYA 2DY1A 3PX4A 2UUBF 1F60B 1JJCB 3UD4P 1EETA 1C1CA 2VPYB 5JJBA 2R8JA 1VFJA 2D3O1 2LEBA 3K8VA 2UUCJ 1G3OA 2H48B 3ZZUA 1NK0A 4W90B 1ZH5A 2KXHA 3NAHA 1F9EB 1Q79A 1XEZA 4B9LA 3EGZA 2Z30B 1RLCL 2DNLA 4LFCJ 1B70B 3MAAB 4NMXA 1JLEB 4RO0A 3OXGA 4DV7F 5B0EA 3GJQB 2DGOA 4CTAA 4A47A 2WSFC 4YR2A 4DQIA 1X4CA 1Z1ZA 2N82B 5GAHU 4RX6A 2ZHAA 4KFBA 4LF8J 4NLVA 1OQ6A 4AD6A 1H38A 2UUCF 2GS8A 2F65A 4KH0B 3CSKA 4LRVA 4ALZA 4F4WA 1CVJA 4PWDB 3CF5Q 2DTJA 3NWRA 3C16B 2OPSB 3OTBA 4L76A 3R5JB 5K14B 3HK2A 2RVJA 3DOMA 2H4YB 2EG2A 3ITHA 2ZOMA 4FYVB 2CQHA 3ZZPA 4CRJA 1OY9A 2B7BB 3GR1A 4Z2XA 2GHWA 5K8OA 1WC1A 4HYKA 1H2VZ 3D28A 3IR6B 1ZAWA 1T7PA 2LQ5A 2ALYB 3DRYA 1WC3A 4TXSA 1PJ6A 4M8LA 2RSQA 3VV2B 3MR5A 3G6VA 2VG6B 5KFFA 2ASYA 2F4VF 3G6ES 1VQ6S 5ETTA 3OL6A 4ZVFA 3R1HA 2FJBB 2E5JA 2OD6A 2XNRA 3V6DA 1Y10A 2I5JA 3E3XA 4O4GA 2LCWA 4Q0BA 1MSWD 2JSXA 3OL7A 1KR4A 1LWXA 3NAIA 2HNDB 2DNPA 3OVBA 5IFMA 3FMWA 2DPIA 2QC3A 3RRKA 3P3DA 1HL6A 1MROA 1GEHA 5CHCB 4WBFA 2JHEA 2CPHA 1X4DA 1NPKA 1MLAA 4K2JA 5GADI 3QT8A 5ETPA 2Q66A 4I64A 4OZNA 3IBWA 4PYAA 1H7WA 2ZZTA 3OSNA 5KFDA 1URRA 3IWXA 2E1CA 1KTQA 2ZJRQ 1ZM4A 2GVZB 3KLIA 4QZVB 3MM7B 2E5LJ 2NUHA 3LPYA 3MD1A 2O01C 4F36A 4KR0B 1Y3JA 2YKPA 3NMAA 1SQEA 4CLKA 5KTQA 1H7XA 2KM8C 2OTLS 1RTDB 3CCES 5ETSA 5B0DA 1PGZA 4ER8A 3KJQB 3M4XA 3BJYA 2JDJA 3MHYA 4PQUA 4N41A 1WI6A 4DV0F 4LF6F 2HRTA 2KVIA 3G8TA 2VASA 5HMZA 2AGQA 3P4UB 2MDAA 1WSRA 2HGMA 2ROEA 4X65F 2UXCJ 1SC1B 1TL5A 2LU2A 4TLRA 3UE2A 3CIMA 3EE3A 4USTA 5M2RA 3GCXP 3OTOJ 3QAEA 3FQLA 2E5LF 1TL3B 1RT1A 4NLOA 4Q43A 3RRHA 4ZLPA 2ZOGA 1QVFR 3MCSA 1N0VC 2IRYA 2E5IA 1LXNA 5KT3A 3U7JA 1CULB 1WI8A 4WP3A 3W2WA 3KNAA 2WBMA 3HSJA 4OJHA 4RKUC 4WXOA 3UN2A 2N3OA 5H9EJ 1U0HB 2XEXA 2YNIB 2B6AB 2G9OA 4PCQA 2X1GA 1E6VB 4RNNA 3OUYA 2C2DA 4LVOP 2FC9A 2XC9A 1XNQJ 1SPBP 3ILIA 1RT4B 1S48A 2E5GA 1I3OB 1U4BA 5H9FK 3AB2B 3AOBA 2MTLA 3QGPA 1NLAA 4TY9A 3VQSA 4DOZA 3JXOA 5A0YB 2HURA 3D4JA 1T02A 3FBBA 3SCLE 3MOJB 3GV5B 2F1FA 4DCPB 4KAIA 3HVAA 2ZUGA 2MZSA 1TKTB 2VBXA 4OYIA 3I9ZA 5L8RC 2DGWA 4ANCA 4F67A 2W7AA 4I68A 5A6WA 1WC4A 3GJRB 5GAEI 4RNMA 2UU9F 2KN4A 1RISA 1IM6A 2UXBF 2HFNA 3D7SB 5BYQA 2XI3A 3T9NA 3OVSA 3CCZA 3BGFA 3N9UC 3EYZA 2ZH7A 1NK8A 4OX9F 2CNLB 3OV7A 2ACYA 2HIYA 3K59A 3IP0A 1NSKL 3EVWA 4Z7YA 4F26A 2Z56B 3TVYA 3Q8SB 4DR4F 3HFZB 2WOMB 2V9WA 3IR5B 2R7SA 3H2LA 1Z4UA 3R5GA 5L9XA 1CJUA 3ILLA 1NKCA 5LOQA 3JS9A 5K8PA 1SKWA 1MROB 2DGUA 3G2XA 5F41A 4K4YA 5AJ3F 2ABYA 2BQUA 2FZCB 4FXEA 3AB4B 1SI9A 2PC6A 1HBNA 1RXOB 1ZM9A 6AT1B 3T1HJ 3LOUA 4A8WA 2U1AA 3EPIA 1IBMF 4B3SF 3W63A 2M8HA 2FUG9 1IBLF 2MPUA 2Y8WA 2BOAA 2CJ9A 1UEVA 2VFVA 1IJEB 3IM8A 3NG8A 1FE4A 4QOTA 5KFTA 3DXBA 5KFHA 4ED4A 3LP1B 1QDUB 2NXUA 3RG6A 2ILZA 3DRXA 4QCLA 1N5SA 4DQRA 2VG6A 4E8UA 2HBYB 2LDYA 1WKKA 1HNZF 1PAUB 2AYBA 2LQBA 3U1NA 1KQKA 1U1PA 5DDPC 2Z2LA 4P71A 1S9GA 2IRXA 3J81Y 3POTB 2KL8A 1U49A 3GONA 3QNWB 2P9CA 3QLHA 3GV7B 3PDNA 1ZM3A 4H4MA 4NA3A 4U7UK 5F8JA 3TAMB 5KFOA 4DV2F 1VQ7S 3DI6B 4JI3F 1AFIA 2ASJA 1TU0B 3QT5A 1Q95G 2MQLA 2EVZA 5ETMA 2G0CA 2RMLA 2XTCA 4MH8A 3M9OB 1GTHA 3GCWP 1V3RA 4OLOA 1CULA 3HP6A 1C0UB 3MM9B 1FVSA 1VHIA 1VLYA 1JLQB 1UFKA 2MMYA 1HNXF 2W2QP 1BUXA 1VQ9S 2AJ4A 4LFAF 1DBDA 4U67Q 4WXWA 2WK4A 4M5MA 1HWIA 4N8OA 2Q79A 1U1OA 2PFFB 4D3HA 3KTQA 2CPIA 2IBOA 4CM2A 4ANDA 2XS7A 4NPOA 2FHKA 4NMLA 3CDUA 3T5JA 2MKCA 3JSBA 4FDFA 1UPMB 3EZUA 5KG2A 3HHLD 4UQTA 3B6BA 4ID8A 1ZA2B 2BABA 2JBVA 3IAS9 5K8MA 4X4VA 4HVZA 4ECQA 1U1MA 4G1PA 3G82B 3GSIA 5K14A 3BV8A 1VLOA 3GYNA 5KG5A 2G2ZA 1AUSL 2B4UA 4MAKA 1NDCA 4JI5J 4A8KA 1Q0NA 3B4MA 1TVRB 5IWAF 3AJDA 4ELUA 3TQEA 3HHLC 1BQNB 1EJ7L 2IJNA 1DAXA 1RHUB 3KJFB 2F8EX 3AA9A 4ICLA 3QSYB 4A8XA 3CD6S 4WU3A 4MK7A 4Y65A 1S4FA 4QWEA 2VICA 2HRYA 5A76A 4ELTA 2M88A 4WK1A 3CTRA 2G2OA 2R8KA 4NI2A 1ZS6A 1RI7A 1M1HA 2YWFA 2HVDA 4FXVA 4IG3A 3IBFB 1U02A 1FHTA 4NASA 4J90A 4DV6F 4AXJA 3MD3A 5A8WA 2HVIA 4DU8A 3AXMA 5DZ7A 3QWUA 4NLDA 2AT1B 3FBEA 4KB7A 1UCNA 3NEKA 2HNYB 4X4UA 4OZ5A 1GMWD 2WTFA 4EZ6A 3OR2B 1PCAA 3DRPA 3EPGA 4X62F 4HDHA 1W26A 2GV1A 3R6LB 2FHJA 2XZDB 2ZNZA 2D41A 2RNEA 4IH7A 5T7LA 2JX2A 2FLNA 2MZ1A 3C6UA 5HAOA 4ECYA 1FX4A 2HFZA 5B0BA 2ZH3A 4LR7A 3IRWP 4GMKA 4U8VA 5BR8F 1KP6A 1WG1A 1X9SA 1C1BB 1WDDA 1YJRA 2K6LA 2PEHA 4LQ3A 2D3ZA 3ZO7A 2J6TA 5KFYA 1SXLA 3ZC4A 4BS2A 2VA2A 3CJ5A 4RW9A 2WRMA 4YMEA 4YY3F 3EX7B 1RYSA 1BQXA 3JAMY 4RW6B 4B9VA 4M5JA 3LPEA 4LR8A 2C2MB 4B9SA 4NLGA 3VEBA 2IFXA 2IC3A 1UWBA 3SCJE 3H40A 4MIAA 4CLZA 2VF3A 4ED6A 5FJ4A 2KKHA 2XMJA 2HQIA 3C3LA 1HBOA 2QIFA 3FZ2A 2OO4A 4CYUA 4L74A 2MJNA 4P7VA 2K1RA 3Q23A 2DHSA 5I42A 2A6OA 1CC8A 1QE1B 4DZ6A 1NJZA 4UY8T 1G1XA 4KQZA 3GB0A 4X4NA 1Y5NB 4DR1F 4NXNF 3PIPQ 3DHWC 2C3UA 2LFVA 2B6AA 1PYOB 4HDGA 1UVMA 1RU2A 5LXYA 1KHWA 1OY8A 2GIRA 2Q6BA 3KWMA 2K1OA 1S59A 2V94A 4M5IA 1XMOF 1IBKF 3OJUA 4QYZK 3B78A 3ADAC 1Q5VA 1NCLA 1YJTA 4JI1F 3HT0A 3BQ1A 1B64A 3IR7A 2UVVA 3ENWA 3OVAA 4H4OB 3EM1A 4DX5A 1S9GB 1JLCA 5KFBA 3E51A 2BNZA 4JI1J 3D3BJ 3KJVA 2VKZG 3MAQA 3SCIE 1MMLA 1SB6A 4RUCA 3MEGB 2QLWA 5KFGA 2V2KA 4J9LA 4RNFA 4YR0A 4OYOA 4MT1A 3QOQA 4U95A 5ETOA 1YBAA 3GR0A 5D4OA 1NMEB 4NOHA 2N7CA 1ACMB 3Q8RB 2ZZNA 2AJ1A 2L48A 3HFKA 2HHTA 3CWJA 1APSA 3HZGA 3HI9A 3VR1A 2PO4A 4ZP6A 4DSEA 4FZVA 3BN4A 4JI2F 1HBUB 3PEHA 1CPZA 1RTIB 1BY9A 2DNNA 1QJHA 1EETB 4AL6A 2W4CA 4KHRA 4ZCKA 3NWGA 4JUZA 1RHMB 4ECXA 3D6MB 3M2VB 3OFFA 5L1KA 4J9NA 1RB0A 2M3DA 1Q16B 2B56A 1O5JA 3F0NA 1UWAA 2L08A 3MMCA 4G65A 4N8NA 5DDRC 4C4WA 4NLQA 2J6SA 1U6ZA 1S57A 3RB4A 3UR0A 2R4FA 1J5EJ 4FYYB 3KLEB 2N4CA 3CCUS 1S0NA 2XNQA 2XMUA 1RKIA 2GIQA 5DS7A 2UVRA 5E3AA 2PGCA 5HQMA 3L4BC 1MWZA 4QJVA 4IRCA 1H2UX 1I51B 3MMBB 2X1FA 4F4KA 2G0JA 5J2MB 4F0HA 4J9OA 2K7KA 5EX3A 1OPZA 3SQGB 1WDTA 2DNZA 2B9XA 3KUGA 3PRDA 2LP4A 3ZZOA 3BGLA 4A48A 3TI0A 1T3NA 2CZ4A 1VBYA 4L72B 5KT4A 2DNRA 4WP9A 1T8EA 1T03B 2CWXA 5GAGI 4ZJQA 1WF0A 4PZVA 5CZVA 4EBEA 3CEDA 2FZKB 4UQGA 5LMNJ 1LWFB 3D2WA 4CLFA 2D69A 3CMQA 4BHQA 4B9MA 2YNFA 2PIIA 4K5RA 2WCXA 4B3MJ 3V6KA 5HO4A 5KFIA 1M5OC 4N5SA 5HMWA 2ZH6A 1L5UA 1HYSB 3T6BA 1RUSA 1VCTA 2LA6A 4LRCA 3THTA 3KK1A 1VQMS 1JLGA 3RRGA 1Q4RA 4DN0A 2P6TA 4MKVA 3OLBA 2VBYA 5E7OB 3TUZC 1R0AB 4M95A 1XK8A 1B99A 2MLZA 3M2VA 3ZTPA 1TV6A 2C2OB 2OPRB 4KY3A 5KOWA 1VC0A 4OYMA 3Q2SC 1OIAA 2MKHA 2AV5A 4FBUA 1I5OB 2QL5B 4LF7J 4KT0C 2P8IA 3MPVA 1QY7A 1IUJA 1ZA1B 4ILLA 1FRLA 4N47A 4OYWA 4QWCA 2AQ4A 1SC6A 4OV1A 1FVQA 1N52B 1DJ0A 1C1CB 2RE1A 1F0XA 3DGPB 3MEKA 4KGKA 2OLWA 1NM2A 1P8GA 5CD4H 1QSYA 2B9EA 2JFKA 5CD4A 4TYBA 3KLHB 3MPYA 1N4LA 2H5EA 2HPUA 2QG9B 5H9EK 3MTJA 2PFDA 3KLIB 1FCAA 3I31A 4USHA 3MEGA 1NK5A 3UWTA 5HBMA 1J2VA 3W5YA 1VQKS 2IM1A 3BN7A 4QYRA 3UVJB 3FSXA 1MYKA 4ECRA 1LW0B 2RU9A 3D5MA 3CDAA 4BC9A 4RUHA 5J2PA 2KZZA 1VC5A 1NAQA 1H3DA 1REVA 2E66A 2V8PA 3T19A 3BS9A 3NGKA 3U02A 6FD1A 4IO9Q 4KGZB 4R0JA 3GTYX 4PWDA 3W7BA 4WKYA 4HT5A 3MMCB 4P73A 3NCPA 2UXDF 4WFNQ 3CO0P 4OI3A 2XY5A 2DEIA 2VDHA 1M5VC 1HLWA 3M8QA 4F3MA 5T14A 2FHMA 4UW2A 3JSMB 4DPTA 4K4VA 2P5VA 5HVHA 2LMIA 3DLHA 3TP2A 2CPJA 3G71S 1BWEA 1X0PA 4FKXA 3Q89A 3W8GA 5FD1A 3WQPA 1S72S 3M6UA 1RTZA 3DMJA 3MCNA 3MDFA 4OHXA 3BF4A 4CT8A 3LAMA 2XS2A 2AJ2A 2QA4G 3SEOA 1HWUA 3NS6A 3RJMB 1RWXB 1U7LA 2Y0SD 3CVKA 4L73A 3T1YF 2HWIA 2R2UA 4B9NA 4ZN1A 4K4ZA 3PJXA 1JIHA 1N5TA 2DCUB 5L1LA 2M0GB 3PYFA 4WKRA 2QGFB 3DLEB 1M0SA 1RWPB 1S6UA 1KOHA 1H72C 3HSZA 5A6PA 2JOQA 2KM8B 1X8DA 2GJIA 5ETRA 2HK3A 4HTIA 5IZHA 3H90A 4GVBB 4P74A 3M8WA 3Q86A 4NA2A 4YB5A 1RBLA 4DUYF 3AD8C 4NXMF 3D6HB 3HKWA 2A2BA 3NCQA 3H5SA 1U9PA 2D3UA 2OP5A 3J7A1 3IGNA 1F6TA 1LFWA 5DZ6A 3I0SB 3W66A 1X4BA 1JLEA 2GC8A 2ALZA 4ILRA 2XSJB 1TFYA 3FFIA 2NXEA 5KFWA 4C8KA 4K4UA 2F7VA 2V50A 5C2CA 1WF2A 5ETVA 2B4OA 3V6DB 2FJEB 3JSYA 1PBUA 2HWHA 3UNYA 5CH7B 1S1UA 2SXLA 3HKZD 2C42A 1JK9B 2DYAA 3QIPB 2I38A 1HR0F 2P9GA 2HLUA 5B08A 2R7VA 3DLLQ 1TQLA 5A8KB 5KFEA 2HQCA 2DPJA 3ITHB 1N6QB 1KD1T 3LUYA 4ZCIA 1ZAVA 2KO1A 4CDIA 2OGUA 1HNVB 4X4PA 3DRSB 3ENAA 3GPAA 3PRVA 2YX1A 1T95A 2F4FA 3EZOA 3RB3A 4YN3B 1S5ZA 1RABB 3TOQA 1HHTP 1QAIA 2VL1A 2ZBCA 4DPXA 2NPIA 2CWKA 3GLJA 4LT6A 2CJQA 2HLTA 3EGNA 1MN7A 2AMCB 2VBZA 4LSLA 1AROP 3NMRA 1TKXB 4ME7E 2FYXA 5JXSA 1NK9A 3DN9A 3A3NB 1FD2A 1QAXA 3S6EA 3BKTA 3X1LB 1SIZA 2H1YA 3WZ0A 3C46A 3CT9A 1YWXA 1FKPA 1RTJB 4KFBB 4LF8F 4NLTA 2I5JB 4O4GB 4DQSA 4IKAA 2ZVSA 4Q0BB 3LH2S 4J9QA 4USMA 3O3LA 2LECA 1ROFA 4JI8J 2YKNA 4ZDNA 1BDVA 3FEZA 3FUYA 2HVHA 3HULA 1IKVB 2YNGA 4O3SA 1S1TA 3C66A 3FCVA 2OPPA 3Q83A 4IG3B 3E2EA 3OL8A 3KLFB 2R2RA 1QAYA 2ZKTA 3OSPA 4K59A 3PW2A 1K47A 2YQ1A 2V9KA 1YG0A 3CJQA 1AYEA 2HZCA 4A8YA 4FNHA 2HHUA 4DV3J 1NZAA 2DJWA 4F04B 2ATCB 4PUOB 5G0RB 3JSRA 4I7FB 4RLEA 4GKJF 5KFUA 1RAEB 2FPHX 3LANA 5T7LB 2MGZB 3MECB 2GAHC 2XB2D 1XIQA 2MQNA 3I0RA 1FFSB 5D8HB 2GQ2A 1XTZA 1ZM2A 5G4DA 2A10A 3RYLA 1O6XA 2RDIA 2OKQA 1GX5A 3TEGA 2HYIB 2RQCA 1RWVB 2XSJA 1S1VB 2ZFHA 3DGPA 4Q5VA 4ZJOA 4MKBA 2BJ1A 4C3LA 1JLBB 3K5LA 4WJBA 1ITPA 1AFJA 4I2PB 2VG7A 2OEMA 5DQHA 3G5OA 2AX0A 2DO4A 3H4DA 1T11A 5AXKA 1R7IA 5BYRA 1RK8A 1YZ7A 6FDRA 4KH1B 5CXTA 5IQQA 2W2MP 1TP7A 2HFUA 3NS5A 2HBQB 3TX0A 3T1HF 4V19X 2GVDB 1IBCB 4DV5J 1S6OA 2AEFA 2JXHA 3IM9A 3SFUA 4D8JA 1DY3A 1S1XA 3EUNA 5J2QA 3L3CA 4ID5B 2HQGA 1FF2A 3QJLA 1P6TA 1TUVA 3AFGA 3JQJA 1YZ6A 2W4DA 3W9IA 2E9RX 4V1Ak 1NHKL 3TAMA 3Q24A 4JI7J 2YWWA 1A9NB 2MKIA 2EFOA 1S6QB 4J9KA 2DHGA 1Y11A 2AZ3A 3LWLA 3T5HA 1EIYB 3TA1A 1FTRA 4QIWD 4XTTA 3M30A 1HIYA 1HWKA 2MY8A 4FP9A 2QT7A 4WCEQ 4P7TA 2V4JB 3KLHA 4QR1A 3GV8B 1FK9A 2VA3A 1KEKA 1RHJB 2PT0A 1SJRA 2DITA 3HLUA 4C7QA 3DU6A 1M1KT 4UOFA 2GQQA 1PYTA 4PG8A 1RHKB 4MKAA 3FNNA 1SIWA 1VRQC 2BE2B 3F56A 3TVKA 2VQEF 4M94A 3LWMA 4IRDA 3X3UA 4F2RA 4B3TJ 1LWEA 1ZAXA 2YY3A 5DO2A 1JJ4A 4ZVPB 5HJXA 4RBVA 2CJXB 2XWYA 4O3RA 2FZGB 2WHOA 3DI6A 2G1DA 2QA1A 4RZRA 3EZ5A 4EBDA 1QSSA 4FKYA 2V8HA 3D0IE 1IXKA 3LP0A 2PMZD 1YRXA 2ADCA 2HNZA 2HHVA 3DYAB 4ZPDA 1R43A 1RADB 1HBUA 2XMTA 1TMMA 2XTJP 3GFZA 4GRSA 5H9FJ 3K17A 4KGVB 4Q45A 4X4OA 1SJFA 4DR7F 5SUHA 3SBMA 4DJBA 3MCMA 2R8HA 2HWTA 4DFJA 1S9FA 4EO8A 1S0VA 5AE2A 3KDOA 3MR2A 2Y0BB 4R5PA 1FXRA 2M7SA 1DARA 2GAGC 3LO3A 3J80U 1N54B 4C48A 4GC7A 4CO3A 1N5YB 5F8HA 2ZUAA 3H5YA 5F3TA 4HLBA 4LUBA 4O3OA 5HATA 3JTOA 4AE5A 5F8LA 1HHQA 5DRKA 1WOOA 1U45A 4HHHA 3JTPA 2CA9A 3G6YA 7FD1A 3FCWA 2XCAA 1HNIA 2DH9A 2N3LA 2QA2A 1JQGA 4OYBA 5E5NA 5HK4A 3SXLA 3IRXB 3CCTA 4PR6A 3SSQA 3CJSA 3ENVA 1X60A 5C42B 1RYRA 4WFAQ 1P27B 2ILYA 2KH9A 1B7YB 4RW4B 1HQUB 2DHHA 4ZVHA 2J6UA 4NZ7A 1F3VA 3HD2A 3IG1A 1F1BB 3NCRA 1N32J 1DTQB 1AUDA 1VGYA 1FKAF 2WW8A 3JTNA 1S79A 3GIMA 3GILA 1CEZA 4J37A 3W61A 1DQ9A 1R0BG 2C2KB 1OWXA 3J7YI 1FKOA 4LSZB 1WOPA 2QFJA 1YTYA 4Q8FA 2V68A 2BE7D 1VISA 1RT7A 2XZ2A 3BYRA 1PBAA 3M2UA 1GT8A 2RKIB 2ZH2A 5L46A 1RTJA 4QR0A 3KHHA 1XC9A 2W9BB 5IM0B 4DV4F 1W2IA 2APOA 2PI5A 5KT7A 5LMUJ 2V4JA 5B7WA 4FPIA 4LF5J 4UY85 4KHPF 1HD0A 5DDQC 2BUNA 2QEXS 2E1MC 4PG5A 3DOKB 4PXBA 1F3FA 2XY7A 3J7AN 4LMZA 3QBCA 4NWBA 3DHXA 3K57A 2OMLA 5THWA 2O67A 2CKWA 1FXDA 2LQJA 4MIBA 4UT4A 1YRUA 2E29A 3ISND 1C1BA 5M2PA 3OD2A 4F02A 2I0XA 1S6PB 4DUTA 1R3NA 3P5TL 2PA3A 1WEYA 1HKAA 2BYCA 3OT9A 2F63A 1HW8A 1GQEA 2ASLA 5DLFA 9ATCB 1VQYA 4R0EA 1AW0A 1Q5YA 1Y5IB 2GVDA 2RDDA 3R7NB 1U1QA 4AFFA 3I5BA 3UCUP 1WNEA 3OR2A 2CPYA 4DSKA 1AZSA 2KT3A 4ZVOB 1S7IA 3BR8A 2GZOA 3MM5B 4JI4J 3QGIA 2WVBA 4HKQA 1VHFA 3KUHA 3CCLS 1REGX 1HNZJ 4C11A 2GW8A 1UEUA 4M5DA 2J7WA 3N4WA 1HFEL 4WFBQ 1NH8A 3RR7A 3KXDA 4ZJLA 3AY0A 2GMJA 1HI8A 2RAQA 1RAJA 3PNIA 4RR5A 3UDEA 4BCAA 3A8JA 4NRTA 3L7PA 4RL1A 1R0CB 1NB2A 3VEAA 5A8RB 3NGSA 4ID5A 2MQQA 1ICEB 1YITS 1JX4A 3ZNJ1 2AWZA 4NA1A 5GMDA 5G0RA 1RAFB 3AWRA 1X4HA 3I9V9 3TJAA 4Q8EA 1X4AA 5I3UA 4H4OA 4ECSA 1X31C 2AZ1A 3D1HA 3CMAS 5A8KA 4FBTA 5F8MA 1R8CA 4ZPVR 5GAGU 2Y9HA 4LF4J 2FJVA 2OJ3A 2XLIA 1NSAA 3DRPB 4O3NA 1KBRA 5F8GA 2HVEA 1JJ2R 3MFHA 3R5AA 2CZVC 1OJ4A 1P9QC 4CLYA 3D6FB 1SJQA 2MEWA 2VG5A 2DIUA 1SL0A 1QE1A 3WX4A 3RB6A 4DUYJ 4Y2CA 5I3PA 2YXLA 1RBOB 2DXDA 2B9YA 2CQ2A 3TUIC 3FCHA 1CJVB 5D3GB 3KG4A 5HQ8A 2BM1A 1NLKL 2DGXA 2X3GA 4P10A 5LMUF 1U8SA 1TVRA 3MURP 1XNRF 5AXLA 4OZLA 2D9OA 3TAPA 3E8OA 4DR2F 4DF8A 2VHGA 1HNXJ 4CLTA 3FBFA 1RGVA 4Y2IA 2YKMB 2DH7A 2JRSA 4DL2A 1Y3KA 3HT3A 4HH1A 3HSGA 1TTHB 1WC5A 4X62J 1M1GA
chains in the Genus database with same CATH topology
3KHLA 1N8RT 3H98A 4C9DA 5H1SV 2HG4A 2KG1A 1WTBA 4QW8A 4C8ZA 4C8YA 1MU2B 2G4BA 4NLPA 2KOEA 1IKYA 2MZJA 2I1RA 2VD3A 3KYLA 3GG0A 2LA4A 3QAUA 2OH2A 1HMVA 4PG4A 3IAM9 3UFCX 2FVSA 5BJRA 1R8AA 2XLJA 5FDLB 4QYZJ 4B3RF 1X0FA 1Q1KA 4DFKA 1EP4B 4DWIA 5D4LA 2C3YA 2D1CA 3KG1A 1N48A 2J0XA 2QYCA 1K1SA 3CPWR 5J2NB 5KFCA 2KI2A 2CQDA 3G6XA 4LSLB 1YI2S 1C0TB 3FSIA 4PXCA 3CJ0A 1KRPA 2BBEA 3TVZA 2EWHA 4K5SA 1JLGB 4ZVGA 2GO8A 4J9RA 1FDAA 2J5AA 1FRXA 1FEEA 3K7RA 2ATLA 2MSTA 4NCBA 3TX8A 1WHWA 1B7FA 3HHNB 1N33F 4QBUA 3MR3A 3DC2A 1RTHA 4I0WA 4G1QB 1X9WA 1NKBA 1M90T 3UR3C 3FGVA 2WSCC 1SJ3P 4KV8A 1RT5B 4FS1A 1PC4A 1IKXB 1VIOA 4KHMA 4NCGB 2J0WA 5T41A 4DL0C 1UW4A 1S77D 4H54A 1B0PA 3PX0A 1H0HB 3M6WA 4QU6A 2F9JA 4ZKAA 5KFJA 2IRUA 1HBNB 3QJJA 4OLPA 1WG4A 3PACA 2ADBA 1UKUA 3CC7S 3UNGC 3OFGA 3V5RA 1HQUA 4RW4A 4WK3A 3MOZA 3CDWA 1DLOA 4IQMA 4MK8A 3PIOQ 2BA9A 2MHEA 3BSNA 3R5CA 4ETZA 3RTVA 1S6PA 3HO1A 2JEFA 3ULHA 2EC0A 3MEDB 3SV3A 2WSEC 1OSCA 4DG1B 3MUTP 2KJVA 4IR1A 4I6WA 3I87A 2XMVA 3KOAA 2PMHA 1TKDA 2DH8A 5IM0A 2W9BA 4DL5A 4QPXA 4XIUA 2JLFA 3DRRB 5KG1A 1SUQA 3DOLA 2L9DA 2RF2A 4YHHF 1S0OA 4RW7A 3DOKA 3VAFA 2KTQA 3BSOA 4WYWA 1LWCB 2CQCA 4ELVA 2HS4A 2QLXA 1WACA 4PUOA 3C6TB 3CUNA 4I56A 4NRUA 4RW8A 2P6SA 4PKDB 3KLVA 1IN0A 2JVOA 3PFOA 1KSPA 3BO3A 3HVWA 2OIHA 2XS2A 2FY1A 1FRJA 4ZPAA 5C24B 4X2BA 1JKHB 4X4SA 1CG2A 4TU7A 1UFWA 4CI0B 4OHYA 4AXIA 4XAKA 2XGQA 2UXCF 3L95X