4LQ9A

Crystal structure of human norovirus rna-dependent rna-polymerase in complex with naf2
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
501
structure length
501
Chain Sequence
b'GTYCGAPILGPGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFTQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEGGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYKYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFKISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-dependent RNA-polymerase
publication title Naphthalene-sulfonate inhibitors of human norovirus RNA-dependent RNA-polymerase.
pubmed doi rcsb
source organism Norovirus
molecule tags Viral protein/replication inhibitor
total genus 163
structure length 501
sequence length 501
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 4lq9A02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4lq9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lq9A03
3N6NA 4RW4B 4HKQA 5I3UB 1JXLA 3H4BA 2BQUA 3PR5B 4RNNA 1REVB 3DM2A 1DLOB 1S1VB 3IN5A 1JLGB 3KLIB 1QE1A 1KHVA 1SH2A 3KLFB 2RKIA 2IM1A 3GV5B 3IG1A 5DQGA 3EZUA 4U7CA 2R8IA 2V9WA 2HNZA 1JLCA 4MIBA 1SH3A 3FFIA 1UWBB 3BQ1A 3V6KA 1JLQA 4KO0A 4MFBA 5F8JA 1SH0A 4H4OA 5J2NB 3NMAA 2R8GA 3QGGA 3KLFA 5KG5A 3JYTB 3BQ0A 3Q8PB 1MU2B 1DTTA 1RT6A 3T1AA 5KT3A 4O4GA 4DEZA 3HVWA 1REVA 1IM4A 3TAMA 3DYAB 4ZVHA 4DG1B 2RF2A 3QIPA 3Q8SB 4R8UA 3KK1A 2FJWA 3PW5A 2ZE2B 5C24B 3IRXB 3QYYA 5KG1A 5DQHA 2OPPB 3TQ1A 5KFNA 3N6LA 3OL7A 4QWEA 3PZPA 4IRCA 1UWBA 1RT3A 5DGAA 1T03B 4IKAA 2UVUA 4G1QB 3Q8RB 3MTKA 3OLAA 2EC0A 5J2NA 2D7SA 1HQUB 2ASJA 1NHVA 4KAIA 1D0EA 4F50A 4DG1A 2IM3A 2HWHA 1KLMB 4K4ZA 2IAJB 2ZE2A 1EETA 3E51A 5C24A 3KK2B 4X2BA 1S1TB 2VA3A 2OPPA 3CJ0A 3QLHB 2XI3A 4F4YA 4ZP8A 4K50A 3KHGA 4NLWA 5KFTA 4OL8A 4PQUB 3DDKA 4WZMA 4JV0A 3PJWA 4H4MA 2JC1A 1HQUA 3CO9A 2ILZA 2V4RA 3MEDB 2AWZA 4HYKA 1CSJA 2IM2A 3KLVA 4RNOA 4ECXA 2IBKA 3DRPB 3M8QB 1S97A 3OL8A 3OL9A 2VG7B 2JEFA 5KFWA 3NAIA 5KFQA 4RW7A 3QLHA 3MR5A 1JKHB 4KKOB 3KLEB 2QE5A 1N6QA 4YR0A 4EEYA 3KK3A 4JV2A 4PQUA 1I6JA 4B3OB 5KFSA 3KJVB 4ECTA 1TKZA 1TV6B 4RNMA 1LWCB 1TKXB 4I2QB 1R0AB 3NBPA 1XR5A 3MFIA 3DRPA 3M8QA 2B43A 1K1QA 4J9QA 5EUHA 2WHOA 2VG7A 1KHWA 2ZD1B 2FVCA 4MH8A 2IJNA 3M8PB 3DMJA 3UR0A 4NLVA 3KLEA 3CVKA 1HPZB 1RT5A 3H5YA 3IS9B 2W9CB 2R2UA 1MMLA 3KMQA 4KE5A 2J6UA 5KG6A 2XGQA 1RA7A 4B3OA 3NGDA 4EYIB 3RAXA 1EP4B 3ITHA 4ID5A 4Q45A 3OSNA 3KJVA 1N5YA 3G6VA 5KFVA 1LWEB 4R5PA 1FK9A 1OS5A 4RU9A 1RA6A 1S48A 2WK4A 3G6YA 1QAJA 2YNFA 4IFYA 4IH7A 5L9XA 2ZD1A 1RYRA 1C1BA 3M8PA 2D3UA 4MKBA 2XCAA 4ZP9A 1HYSA 5KFXA 4IOBA 2IA6A 3FDSA 4NCGB 2CJQA 1RTHB 1N48A 1JLAB 3DI6B 1RTIB 1T94A 2WCXA 2YNHB 3LANA 4ZP7A 2JEJA 4KV8B 2YKMB 4MK8A 4RW8B 1ZTWA 4F4WA 1WNEA 4K4SA 1JLBA 3HVTB 2GIQA 4IFVA 2YNIB 2RDIA 1TVRB 2W8KA 4Y2AA 1C2PA 3BQ2A 4J9MA 1ZTTA 1N56A 3RB6A 4ZMMA 4ECZA 5F8NA 4RUAA 1S10A 5DG7A 1QE1B 2OPRA 3QZ7A 3I0RB 2HMIB 4URQU 2RKIB 3IG1B 4LQ9A 4NLRA 2HNZB 1JLCB 4NCGA 5KG0A 5HBMA 3FFIB 4QW8A 1JLAA 3VQSA 2FVRA 3I5AA 1LW2B 1JLQB 1C0TA 2YNHA 5KFZA 4KV8A 4H54A 3H5XA 1S1UA 4URSA 3HVTA 2YKNB 1T05A 2YNIA 2C22A 1TKTA 3QGHA 4Q8FA 1DTTB 1RT6B 3BGRB 2J6TA 4O4GB 2AGQA 1RYSA 3TAMB 3IGVA 2UVWA 3KK1B 4ZP6A 2RF2B 3QIPB 4R8UB 3HKWA 3DRRB 5KG4A 3PW7A 5F8MA 3OSPA 2HMIA 3I0RA 4O3QA 1TL1A 2O5DA 4IR9A 4ZVGA 2DPIA 1BQNB 1RT3B 1LW2A 5CYQB 2XGPA 1IKWA 3CDUA 5J2PA 4IRDA 2YKNA 2IC3A 3KNAA 2XI2A 3BGRA 4RZRA 2W7PA 2BANB 1TP7A 2E9ZA 5JUMA 4O3PA 3DRRA 4NLUA 4NLXA 1EETB 4NLDA 5KFMA 2ALZA 5KFBA 4TN2A 4WXOA 1U09A 3CJ2A 5KFIA 3CJ3A 4ECWA 4K4WA 1BQNA 3MEGA 4KFBB 1NHUA 4ECVA 5HP1A 5CYQA 1LWFA 5JXSA 3DLGB 3C6UA 3H4DA 4NLGA 2IM0A 3HVAA 4Y3CA 1J5OB 4NLQA 1IKYA 4H4MB 1RT4B 3PJXA 5C25B 2ATLA 5KFEA 4IDKA 3KHRA 3PW0A 5HLFB 2IMWP 2BR0A 2BANA 5T14A 3GV8B 2XCPA 4PUOB 4WFXA 5CYMB 1S6PB 3LP1B 3H40A 4YR3A 4RW7B 4RW9A 1S9FA 1N6QB 4KFBA 4FS2A 4ECRA 4IG0A 2WONA 4Y2CA 3DLGA 3KK3B 1J5OA 2ASDA 1HNIA 2I5JA 3JSMB 3KOAA 2YNGB 5KFDA 1JLEA 1RT4A 4RW6A 2HNDB 5C25A 1TKZB 3MFHA 3T5KA 4MK7A 5HLFA 2AQ4A 3DLKB 5L1IA 4PUOA 3CJ4A 3NBPB 5CYMA 4M94A 4NLYA 1LW0B 1S6PA 3LP1A 4TQRA 3NAHA 4LSLA 1VRUB 5DLGA 5DGBA 3DMJB 1SUQA 3LALA 3OLBA 1RT5B 3SFGA 2R8KA 3DLEA 1S9GB 3JSMA 2YNGA 2ZKUA 5J2MA 3PR4A 1SV5B 1XR6A 2HNDA 3ITHB 4I2PB 4ID5B 4DL4A 3E01A 4ZPAA 3BJYA 2D41A 4KHRA 1S6QA 5KT2A 3DLKA 3CJ5A 4R5PB 2IJFA 3GILA 4F4XA 3V6DA 2C28A 2FVSA 1FK9B 2R8HA 2HWIA 3ISND 1LW0A 4O3NA 2JEGA 3QO9A 3C6TA 1S9EA 2YNFB 3GYNA 4IFYB 3KMSA 4TYBA 5KFGA 1VRUA 3HHKA 3UDLA 1C1BB 3KLGB 3RB3A 4Y34A 4IR1A 1HYSB 4ECUA 1S9GA 2OPQA 4QPXA 3DRSA 3Q8QB 5DG8A 5DQIA 1HQEB 1SV5A 3MECB 4I2PA 2FJVA 5F8HA 2E9TA 3CDWA 5KFCA 2BRLA 4ED7A 3RAQA 5KFRA 4J9OA 4IRKA 3QGIA 5F9NA 1JLBB 5C42A 4IFVB 4IG3B 4JV1A 2WB4A 1QAIA 3KLHA 3M9MB 2W9BA 4MK9A 3FRZA 4U6PA 4K4UA 2JEIA 3GV7B 3UQSA 1IKVA 3KLGA 2FLLA 3T19A 4RNFA 4ED8A 3OL6A 2OPRB 1RDRA 5KFOA 3MR2A 2QV6A 5KG2A 2V0NA 5L1LA 4WZQA 3NKYA 4K4TA 1HQEA 4ZHRB 3MECA 5HBMB 2R8JA 2R2RA 1C0TB 3BREA 5L1KA 4YQWA 3PVXA 3UPFA 4DL3A 1S1UB 5D3GA 4J9NA 4NRTA 4IG3A 1T05B 5F8GA 1TKTB 2UVRA 2B5JA 4WXWA 5KFKA 4M95A 2CKWA 3MEEA 3MR3A 2UVVA 2FVPA 4KHMA 3QZ8A 1YVFA 5HROA 4ECQA 4EO8A 1C1CA 1TL1B 1VRTB 5KFLA 4F4ZA 5J2QA 2W8LA 3PW2A 4ZHRA 4YP3A 3G6XA 3BSOA 2W9BB 5L1JA 4MIAA 1IKWB 5J2PB 3SI8A 2IC3B 4O4RA 2HNYA 3T5JA 2OH2A 1HNVB 4DL7A 4YMEA 5EDWA 2XC9A 2VG5B 1RT2A 1JIHA 1RT1A 4TXSA 3DOLA 5EWGA 2JC0A 3I5BA 2WTFA 3FQKA 1FKPB 2HAIA 1VRTA 1S1XA 2F8EX 4TLRA 4XPCA 1HMVB 3RB0A 3MEGB 4DL2A 5HP1B 4ICLB 4O44B 2ILYA 1LWFB 2VG6A 3LP2A 3C6UB 1S0OA 3TVKA 1IKYB 2B6AB 5KFPA 1DTQA 1JLFA 1HNVA 3FQLA 3D5MA 2I1RA 4IDKB 2AGPA 3BSNA 1RTDB 3BSAA 4JUZA 2VG5A 4O3SA 3GIKA 3RBEA 3LP0B 4I7FA 1C0UA 1TQLA 1HARA 1S1WA 2OPSA 2GC8A 3I0SB 4WYLA 1FKPA 4URGA 3ICLA 5KFYA 4IQXA 3EPGA 3FSIA 1HMVA 4KB7A 4RW9B 3LAKA 4NYZA 4ICLA 4O44A 4IG0B 4EO6A 5KT5A 5F8IA 2WONB 4QW9A 1IKXA 1T3NA 1HNIB 2I5JB 3SFUA 2B6AA 3M9OB 4QWCA 1JLEB 4RW6B 5KFUA 1W25A 4J9RA 3H59A 1RTDA 3DOKA 3V81A 4NLOA 3CWJA 4DL6A 2AX1A 3LP0A 2XWYA 4RW4A 5I3UA 1N4LA 3ISNC 1S4FA 4ZPCA 1DLOA 1S1VA 3I0SA 2UUWA 1JLGA 4ZPBA 3KLIA 4LSLB 5KG3A 4TY9A 4WYWA 3V6HA 1SUQB 2BE2B 4NRUA 3V4IB 3DLEB 3I5CA 3H2LA 3KHLA 5J2MB 4Q43A 1S49A 5I42B 3BR9A 2WRMA 2BQRA 3E01B 5DLFA 1S6QB 1S0NA 5KFHA 4K4VA 3JYTA 1K1SA 3D28A 4EYHB 1GX6A 3V6DB 1MU2A 5J1EB 3H98A 3EPIA 5KFJA 5KT7A 3DYAA 3QO9B 2FLPA 4TY8B 3C6TB 1S9EB 4J9SA 4ZVFA 3IRXA 2FJXA 4PWDB 2BE2A 4WE1B 3V4IA 2OPQB 4QWAA 3DRSB 2FLNA 1T03A 2W9AA 4G1QA 4YR2A 5I42A 4NLSA 4IH5A 2BQ3A 4FBTA 5KT6A 5C42B 5J1EA 1Z4UA 5KFAA 4ED0A 3RB4A 3V6JA 4TY8A 3KLHB 1KLMA 2IAJA 3KK2A 1IKVB 4PWDA 1S1TA 4WE1A 1XR7A 1NNDA 4ECYA 2ASLA 4Q8EA 4ED3A 2BRKA 3QIDA 4J9LA 3MR6A 2UUTA 5KG7A 4EBCA 4KBIA 3IGNA 2R2TA 4GC6A 3N6MA 4DL5A 5D3GB 3MEDA 4IH6A 4RNHA 2GIRA 2C2RA 2B5JB 2J6SA 2V4QA 1RT7B 4FBUA 4LSNB 1FKOB 3MEEB 4XPEA 1BQMB 2W7OA 3G86A 3GIJA 5HROB 4QWDA 5KT4A 4Q0BB 4NLTA 1C1CB 1JKHA 2AX0A 4KKOA 4ED2A 5J2QB 1GX5A 5EWEA 3PHEA 2C2DA 2D3ZA 1TL3B 3LAMA 1JX4A 2RDJA 3M9NB 4RUCA 1TV6A 4MKAA 1LWCA 4WFYA 1TKXA 4I2QA 4ZVEA 2HNYB 5K14B 4Q44A 4ECSA 1R0AA 5DG9A 1RT7A 4LSNA 4R0EA 3OHAA 1RT2B 1FKOA 4TYAA 1RT1B 4ED6A 3DOLB 1BQMA 4K4YA 2C2EA 3MF5A 4FS1A 1QUVA 4Q0BA 5KFFA 3KHHA 3CIZA 1S1XB 1S0MA 3IS9A 1HPZA 2W9CA 4ZPDA 3BSCA 4XO0A 3PW4A 2FVQA 4TQSA 1RTJB 2E9RX 1TL3A 2VG6B 3LP2B 4KSEB 2WOMB 5C5JA 1EP4A 3H5SA 4J9PA 5K14A 4GC7A 1DTQB 3CDEA 1JLFB 5FDLB 3H5UA 1LWEA 4EBDA 4LQ3A 2DPJA 4EBEA 1ZETA 2JLEA 4I7FB 2R2SA 1C0UB 2OPSB 3T5LA 1S1WB 3NL0A 3GIMA 3DM2B 1D1UA 5EWFA 3T5HA 4O3OA 1RAJA 4QWBA 1RTJA 1N5YB 4NZ0A 3OHBA 4NLPA 4G3IA 1IKXB 2WOMA 1RTHA 4J9KA 2VA2A 3DI6A 4WFZA 1RTIA 4O3RA 2AU0A 4K4XA 5F8LA 4KO0B 3GQCA 2AGOA 5FDLA 2YKMA 4RW8A 4ED1A 4MFBB 3GIIA 3DOKB 4H4OB 3V81B 5F9LA 3RBDA 1TVRA
chains in the Genus database with same CATH superfamily
3P45B 4MTPA 4Z7YA 1JLGB 2UUAJ 3DRXA 2YQ1A 2V9WA 2Q6BA 4XDCA 4DX5A 3V6KA 3MMBA 4B9TA 3KLFA 1PIEA 3D67A 4CLWA 2ZE2B 1LKZA 1N5VA 4G65A 2C1EB 2GPEA 3FEZA 5GAEI 2WVEA 4FXEA 4WIQA 1PILA 1VIOA 1Y7PA 1LQ9A 5IC6B 1GXTA 2UU9J 4Y2IA 1XJWB 4KC5A 1OM2A 2JNJA 5BYSA 1GQEA 2ILZA 1IVZA 4LJMA 1S97A 1SL2A 5F3ZA 3L7UA 4I1TA 2XQCA 4BLGA 3KJVB 4LR9A 4Y2MA 2XS5A 4FNIA 1J27A 2MJNA 4B02A 1K1QA 2WHOA 4NASA 2BQUA 3J80Y 3HO1A 5KG6A 4I69A 1XMBA 3CSKA 2WK4A 4CH7A 1CJUA 2V4JA 4RW8B 1MLAA 1MROA 2EG1A 2H1OE 1ELOA 1SC3B 1HBMA 3OXFA 4ES1A 4HTJA 5KG0A 4QR2A 2MZRA 1TUWA 4C8OA 2YNIA 4MKVA 1FESA 2DISA 3HCXA 4K59A 2GVDA 3W62A 1EX8A 4ILLA 5AXMA 2L48A 3BZQA 1EA4A 3GZ7A 1VISA 1IQZA 3PKYA 4NA2A 3AJDA 3BGRA 4OX8A 4QBUA 4I6AA 1OYEA 5HQLA 2Z0GA 1VQ8S 1L3VA 4HH1A 3R1HA 2QLJB 7AT1B 2ZFHA 3OXGA 3PW0A 3J7ZT 4KJIA 3C19A 4DV1F 1KLNA 2DNPA 4WFXA 4J9UE 2BJDA 2UUCF 2XSFA 1RSCA 4Y2CA 1HNIA 3T5KA 1NDKA 1HHTP 1HBOA 4DX8H 3C2PA 2KZZA 3MGJA 4MT1A 2YNGA 4KPCA 3A8EA 4CNYA 1N5YB 4KHRA 4F4XA 4KT0C 2DTJA 3M4XA 2FVSA 3HT0A 4TYBA 3HHKA 1C1BB 3B82A 3PG9A 2K1RA 3DRSA 1KFSA 4YB5A 4I2PA 3VW4A 1HWLA 2BRLA 3RAQA 2G13A 1RU1A 2ZKTA 4CTAB 5E7OB 4DZDA 4C8LA 4DX6A 3K5MA 2YPYA 3CUNA 2RQMA 5KFOA 2BMBA 2JHEA 2YWWA 4F36A 3CCWA 2HIYA 3CULA 4BBYA 3PW2A 2HRYA 4ZCLA 3R8YA 1X4BA 3BDEA 4Y65A 5EWGA 3FQKA 2KN4A 1S0OA 1WC5A 2HQFA 1WEYA 1JLFA 3QRQA 4RBTA 1WC1A 4O3SA 1HI8A 3L4BC 4NYZA 1CVJA 1Q53A 1X4HA 4RW6B 4GMKA 4NI2B 4CO3A 1N4LA 3QT5A 3DHWC 2JLGA 3EMTA 4HACB 3ZXWA 3QWPA 3I5CA 3I6PA 1QJHA 3E01B 2H5EA 6AT1B 1FCAA 2R7QA 2BJ7A 2VQEF 4B9VA 2FHJD 4G1QA 2YX7A 2H5IB 3W63A 4F4KA 5GAHU 4Z37A 4TY8A 2IAJA 3VEAA 1HHQA 3MZIA 4J9LA 2Y8YA 1R0BG 2QT7A 1VMBA 2GIRA 2POKA 1K8AT 1VC0A 3WIVA 3LAMA 4Y00A 3C46A 4PABA 3OVBA 4JI6F 3GB0A 2ZH9A 3NG8A 2PFFB 4KGXB 4OJ1A 5A8KA 3T5HA 3OXLA 2DK2A 1XMQJ 3P3DA 4JI4F 3IMQJ 3GQCA 3KLFB 3NS7B 3TX0A 2E1CA 2VONA 1Y5IB 4USVA 4CDIA 5ETTA 2AJ2A 2CQ1A 3T1AA 1ICEB 1S10A 1T9XA 3AOBA 4JI2F 2GVZA 2NXNA 3GMGA 4IRCA 1U2CA 2CVEA 1FFSB 1PYTA 2CJAA 3OD2A 1X9SA 4WK3A 8RUCA 3IR7A 3MAAB 4CNZA 4AT1B 1M5SA 1V3ZA 2IM2A 1UVLA 3KLVA 4ECXA 1AXQA 4NCAA 4AUKA 5E33A 2KELA 4EEYA 4G1IA 2NYIA 4N8OA 2CQBA 3MFIA 3L7PA 2HZVA 1RHMB 1T9UA 1X5OA 1EZZB 2KT5A 4KE5A 3NO7A 1KNZA 5KAKA 4B3TF 5KFVA 1RWWB 5LL6d 2AZ3A 4YUDA 2XMVA 1RCXB 3GWCA 2YX4A 3TUZC 4ES2A 1RTIB 2RH3A 1X4AA 2YNIB 4J9MA 1N56A 3RB6A 2W4DA 3I4HX 1T0TV 4TVAB 5DG7A 4DR7J 2VOPA 2AZ1A 2HFVA 2XULA 3RJMB 4URQU 1P94A 1KTQA 1JLCB 1JLAA 2C3MA 3CCUS 3ZTRA 4URSA 3DU6A 1WORA 3BGRB 4C8KA 2WSCC 4CT8A 2O66A 4X65J 3TW0A 3T1YJ 3CDUA 5J2PA 5K8MA 3EM1A 1RAOA 2ZVIA 5JUMA 4NLUA 1Q95G 1J5EF 2HQDA 2N4DA 3EGVA 4UQGA 4PG8A 2MQLA 4I56A 3I87A 4U7UD 4K0KJ 3IWLA 1RP5A 4OMFG 4JI8J 1UW4A 1F5AA 2H1YA 4P72A 2YNGB 4F4AA 4X4SA 4PAAA 5A6WA 3CJ4A 3J7A1 2HWTA 1Y5NB 2V69A 2FZGB 1APSA 2K1RB 3JSMA 4D3GA 1QSSA 3THVA 4I2PB 4ID5B 1NSAA 2UXBF 4ZPAA 1WUUA 2ZWPA 3JAMU 2V9KA 2JEGA 3Q83A 3KMSA 4DI6A 2KJVA 1PGZA 2GHVC 2LU2A 2OLWA 1OPZA 1YITS 3TYTA 2G1DA 3EJMA 2ZJPQ 2AKWB 2W9BA 1TR0A 2JEIA 3GV7B 2HQIA 2G4BA 2OPRB 1RDRA 3EGNA 2D3OR 4WBFA 3NGUA 3SQGB 2V8GA 5HBMB 2R8JA 4DL3A 2YKQA 1LK7A 1K0TA 2DR6A 2OI2A 3CJKA 1FDNA 2DRDA 1VQKS 1EHWA 3QZ8A 2QO3A 1WOSA 2YXLA 3UD5A 2ZITA 3M7VA 2XY6A 3VR1A 1FJGJ 2CPJA 3I55S 5IWAJ 4EI2A 2RSQA 1IQTA 2XO6A 4OI0A 1UJ6A 3EVWA 3H7HB 5LM7E 3D5MA 3GIKA 4I7FA 3D0GE 4FYWB 3HJVA 4IQXA 2HHPA 2OD4A 2DIVA 5D4PA 1UUJA 3I96A 2CQ0A 2JSXA 3TVZA 1FEHA 1NCLA 4QWCA 3W7BA 3CWJA 2MKKA 3Q8UA 5EX3A 1S1VA 4F8RA 3QPIA 2NSBA 2HSEB 5EGYA 3GCWP 4OHYA 1K1SA 3QO9B 4P52A 4TY8B 1E6YA 4L76A 4QWAA 1KTVA 4UW2A 2W9AA 4X4QA 3C14B 4B9NA 1ZS6A 2HBZB 1KLMA 1RCOB 2RE1A 4DDFA 1NNDA 3EDRB 5J1NA 3IGNA 2CPXA 3IR5B 5BJRA 2AYMA 3DLJA 4IYQA 2Z2MA 4NLTA 2ADLA 2DR5A 4MKAA 5A8KB 1NH7A 5DZ7A 5THWA 1RT1B 1BQMA 5GAGU 4Q0BA 2W4PA 4TQSA 1AROP 3LP2B 5B0EA 3OUYB 2KHDA 4DPTA 4LF9F 5GMEA 2WW4A 1P8GA 3DGVA 1S76D 4FKYA 3HDSA 2YKMA 4ED1A 2Q66A 2IBOA 4JB8B 1JXLA 4RNNA 4HI1A 2GVZB 1SH3A 3FFIA 5DZ6A 3O8WA 1NH8A 2V67A 1SH0A 1FE0A 3BQ0A 2RU9A 2AJFE 3TAMA 4DR4J 2AJQA 4JYAJ 4X4UA 4KGKA 1XMOF 4OHZA 3SSQA 4P6QA 2ROEA 3UVJB 1U1PA 4A46A 4C98A 4ZP8A 4CM2A 5GAEU 2WBMA 1V3RA 2DB1A 4KYZA 3PJWA 3CO9A 3HM9A 1QM9A 2IBKA 4ILMA 4CIOA 1CS4A 3MR5A 2DKOB 2RUGA 4QIFA 4LF2A 2XMWA 3CD5A 2VZ9A 1HPZB 1RT5A 1UFLA 1IUJA 3MAHA 3ETMA 2NUUG 3OSNA 1KWMA 4QR1A 5AJ3J 1FX4A 3G6YA 5GADI 1H6KX 2OO4A 2K9IA 3FDSA 1JLAB 3M8RA 1F0XA 4MK8A 2CG4A 3A1YG 2F40A 4R0JA 3AT1B 3QOQA 5K20B 2LYVA 1VDHA 4BWMA 1NHKL 2HHWA 4OIXA 2AYEA 1VQLS 3IGVA 3K5PA 3NEKA 4O3QA 1TL1A 4AD6A 2XTDA 3MM8A 3AB4B 4ZVSB 3A8KA 4M5DA 2W7PA 4AQYF 4ZITA 2DNMA 1UVJA 2D1CA 3VAHA 2NYHA 3CJ3A 4YB6A 5HP1A 2ATLA 4HI2A 1P27B 3BN7A 4DCPB 4LR7A 1DJ0A 1HNXF 1YRTA 4IG0A 3KK3B 3JSMB 1JJ4A 1NZ8A 1BMQB 1H98A 4ILRA 1S6PA 4HTIA 3CJ8A 2A1BA 3E8OA 1MN9A 2HVZA 2EK1A 1FNOA 4USHA 3BJYA 2CPGA 1YWXA 4DR3J 3UCGA 2W9BB 4IFYB 1C4CA 1H74A 3EXYA 5HAOA 5MAOA 1MG7A 4CRJA 1RISA 4ZK7M 2MSTA 2OFGX 3FBCA 1ROFA 2BACA 3JSYA 4ED8A 3VGTA 2XZWA 3CB4A 4QU6A 2N3LA 1T9WA 2OEMA 3KYLA 1C0TB 4DMZA 5L1KA 1T05B 5F8GA 1VFJA 1URNA 3NGKA 2OSRA 3TA1A 3KWMA 1C1CA 5ETMA 2UUCJ 3ZNJ1 5H9FK 4HV0A 1AZSB 2LKZA 2V94A 1HWIA 4FYYB 4LRCA 1RU2A 3W9IA 2CNLB 2HAIA 2VFRA 4AL6A 1MWZA 3NLCA 1WD6A 3KDOA 2JLFA 1C0UA 1X60A 4DXLA 4NOHA 4ZIWA 4AFFA 4FXVA 3L7OA 4RW9B 2ZWOA 3H42A 5KT5A 2CNOB 2KFZA 4P2XA 1FRLA 1HBNA 4KTQA 3ISNC 1FWPA 4TY9A 4GO5X 1RAEB 1VC5A 2VBYA 2HG4A 2WRMA 2GAGC 4F26A 1BY9A 3AQPA 5KFJA 4ZVFA 3IRXA 1ARQA 4LF8F 1DURA 3ZZPA 1M5HA 4YR2A 2FHOB 2HFSA 1RI7A 4E0DA 1QY7A 1PO6A 1SJFA 4LMZA 5LSLA 4Q8EA 1F2HA 4ECYA 2MQMA 3AA9A 5FJ4A 3NCRA 5KG7A 3IC1A 2O1PA 2B9WA 4KBIA 3MCOA 3MEDA 2C2RA 2BX6A 2WAQD 3UN2A 2KXNB 1Q16A 1FDAA 4XPEA 4PG7A 2M0GB 1BQMB 2W7OA 3NOGA 4Q0BB 1JKHA 2F65A 4NXNF 4RUCA 4K2JA 1FVQA 2Q79A 1XIQA 2Y0SD 3F41A 1B0PA 5KFFA 1S0MA 2BW7A 2XLKA 5HMYA 2CDRB 1EP4A 2AJ0A 4XDDA 5L46A 1S1WB 4Y28C 4EWTA 3OHBA 3H0PA 2BOPA 3GIIA 2DHGA 3NNAA 5U47A 4KH0B 2NXJA 5EHHA 4LBPA 2SXLA 4OYWA 3VAFA 2YTCA 2HKEA 4DR6J 3MTJA 2MEWA 1SL0A 1DTTA 1IM4A 1N8RT 4J7CA 2R7RA 4CO0A 3HHLB 3N6LA 4LFCF 4QWEA 2UVUA 2EC0A 3FMBA 3OR1A 4USJC 1D9DA 4JI6J 3DNCA 2QL9B 1UVNA 2XI3A 2HIQA 4PXEA 3CC4S 2E1AA 4GVBA 1XEZA 2QA2A 4H4MA 5BXIA 4OYOA 4HYKA 5B0FA 3UW1A 3HFKA 3D4JA 4ECTA 5JVGQ 3TZXA 4USMA 2G9OA 4ZJLA 2BM1A 2XMMA 2IJNA 4CLYA 3UR0A 2DEIA 4LF1A 3ITHA 3HT3A 1LWEB 1VBZA 2IY5B 1FK9A 3KJFB 1SJ3P 2RHQB 4CH0S 1RYRA 2D3UA 2OJ3A 4RUBA 3ZZTA 3SDEB 2BA3A 2JEJA 4F4WA 2KFNA 3HSDA 1FI4A 2MY8A 2QA1A 1H3DA 1U1MA 3IG1B 4LIWA 4USKA 3I5AA 2V2ZA 3MM8B 1YJUA 1WF1A 4L75A 2B4OA 4LF6J 3R5GA 2GIFA 2DPIA 1LW2A 4CLZA 2ZH3A 2BM0A 2B51A 1NPKA 4TN2A 4WXOA 5LXYA 1NK0A 2VICA 4P73A 1S6PB 1WHXA 1NXIA 4EU0A 2J8SA 3JSBA 2QJ3A 4M5NA 3KOAA 5C25A 2AQ4A 1U1LA 4A4JA 2QTWA 2CWKA 3DMJB 3GFZA 1NJIT 2ZKUA 4DF4A 1LW0A 1I94J 1MMNA 4OZ3A 1B0TA 2F9JA 2D74B 1WG5A 3CDWA 3ZZUA 3CCZA 2DHHA 3M9MB 2OSQA 3DU5A 1J5EJ 2W01A 1BXNA 2Y8WA 3MECA 4ZLLA 1WC3A 2ATCB 1PKUA 2N7YA 5KOWA 1A6LA 2APOA 1MNEA 2CKWA 3MEEA 3US5A 1FA0A 2GMJA 1HNWF 3RBXA 2V6AA 4CLUA 1NDLA 2YBVA 2DR9A 2HVIA 4DR2F 1RT2A 3DOLA 1QD1A 3NMRA 3EWGA 3MD3A 2GCFA 3QWUA 1FWLA 2UXBJ 5DM6Q 5L38A 4IDKB 3FMTA 5CZVA 1NK9A 3O3LA 2GC8A 1FKPA 3TAQA 3CCES 2J76E 2R3VA 2QSFA 3AA8A 3S8SA 2E5LF 2BJ1A 3PX6A 2MYFA 1KQKA 2UUWA 3CTRA 3DGPA 4PCQA 1FNMA 1AB8A 3N4WA 4QOTA 3B78A 4FZVA 4YDXA 4DBQA 3M2UB 4B3MF 4K4VA 3THTA 3BYPA 2CQGA 2VODA 2OD6A 4QIEA 1WTFA 1AUDA 5D0HA 1WOPA 4L6V3 2F4VF 4IH5A 5GVQA 5C42B 2JDJA 1TKDA 4P75A 4X4TA 3GJSB 3UDEA 4HDHA 1A9NB 4DL5A 2A6MA 4JI1J 2DHSA 2IRXA 3GIJA 4CLSA 3FBEA 1NJZA 2VC0A 4KHPJ 2VDHA 3KKFA 3GIRA 1WACA 3IS9A 4LUBA 5K14A 1O0PA 1DTQB 1NUEA 2L3MA 2QYCA 3OVAA 3LA0A 2Y3YA 4FF4A 1GNKA 1SQFA 3DOKB 3JQKA 3C8YA 3H4BA 4V1Ak 4L3KA 1DLOB 1Y9OA 4C48A 1DAXA 3TOQA 2RS2A 4WTYA 5T7LA 2HHSA 2CZ4A 4USTA 2GJ2A 4F02A 1FERA 1REVA 6FD1A 3KK1A 3QIPA 5A2QU 1VOMA 3TQ1A 2XMKA 1RT3A 1OY6A 4ELVA 3M8SA 4GVBB 3OLAA 4FP9A 4L73A 4OYZA 2GNKA 2VBWA 3MOJB 3P8BB 3FNNA 1U2RA 1EARA 1KONA 1WWHA 4YOEA 3OL8A 3OL9A 2P9CA 2QE5A 3IAS9 1NM2A 4YR0A 3TI0A 2GW8A 1J2VA 3TQEA 4B9LA 1W2BR 4AE5A 3NBPA 3W1YC 3D6TB 4MH8A 4QJVA 1VCTA 3RR7A 3KMQA 1RACB 2A18A 2ZBIA 3G71S 4KR0B 1T02A 2FY1A 3KDNA 2KB2A 3G96A 2J7WA 1RHRB 1XMOJ 5IT0A 2RDIA 2KTQA 1RADB 1ZPWX 2GZOA 5GADU 4WFNQ 3QZ7A 4Y2KA 3K89A 5IT9Y 2WVBA 2M88A 3PDNA 3VQSA 1GK8A 3Q22A 3CMAS 1LW2B 3H5XA 1TKTA 3OTOF 1NK8A 1RT6B 4FYDA 2RF2B 3SMZA 4ER8A 4IR9A 1NZAA 2H3EB 4KIAA 1KVKA 1MYKA 5M2RA 1BLUA 4DU7A 3L3CA 1SJRA 1WDTA 4NLGA 5C25B 1UWAA 1CC8A 3ZTQA 2L9NA 2EKNA 1P1LA 4YR3A 3CIMA 1S9FA 3MEKA 2ASDA 2Z56B 1SB6A 4C3KA 3I9ZA 3MDFA 5L1IA 3Q89A 4L72B 1LW0B 4WF9Q 2FHKA 4F0MA 2DGSA 2J8AA 2DNYA 4LSLA 2VB6A 3AOCA 3PYFA 5DGBA 1SUQA 2KHCA 1SCJB 1YRUA 1W26A 2E5IA 5J2MA 2HVEA 4QIWD 2R8HA 5IM0A 1FO1A 2YWEA 3MUVP 4P7TA 1M90T 4Z2XA 3MECB 5A2QY 3D9BA 4IFVB 1N33J 2PMZD 2WB4A 4F25A 1W2IA 2GX8A 3MR2A 1YBAA 2VPYB 3NKYA 3T9NA 4PZVA 2PO4A 2BW2A 4NRTA 3RYLA 4ZPTR 4GKJF 4CZCA 3A8JA 1T95A 1HNXJ 1VQNS 2QFIA 3EZ5A 1PARA 9ATCB 3AJ2A 3R7BB 3GFHA 5CYJA 4ZVUB 4YS2A 4YMEA 8AT1B 1OPIA 1FKPB 3RB0A 2NPFA 3R5DA 1ZZFA 1DARA 2M9KA 1IKYB 5HL7Q 4DSFA 5LOQA 1TQLA 1HARA 4DUZF 4WYLA 2C2OB 4PRFA 4ICLA 4P2MA 3R1LA 4OX6A 1SKWA 3IBWA 1T3NA 2HBQB 5D4NA 4NE9C 2I5JB 3ZZOA 5DJBA 3V81A 2R7XA 5I3UA 3CCLS 1OY9A 5CZXA 4WYWA 3KJQB 2O67A 3MM5B 4NMXA 2EBEA 3PTWA 2HFUA 4DSEA 4QQBA 5A8RB 1RWVB 1XNRF 5JVHQ 3DXBA 3TUPA 3LQVA 3TWZA 1TK0A 2V8VA 4RLEA 2MKCA 2VU5A 3ISZA 3MR6A 3MUTP 1I1GA 5LJ3Y 5D3GB 3LF0A 5AXNA 4XAKA 1KS2A 5D4OA 3W2WA 2B4VA 1IBKF 4KH1B 4DV6F 5EWEA 3R9LA 4DPXA 5K14B 1LWCA 4Q44A 4WTOB 3WC2A 2J7UA 2IYGA 3OHAA 2UXCF 3G82A 4ZPDA 3BSCA 2VG6B 1VQ4S 1HD1A 4A8YA 2GO9A 3CDEA 4RO0A 1NKEA 3GP9A 2K5JA 3NL0A 4RJVA 3IRWP 2L9DA 2J5AA 4LF8J 5LSRA 3F0NA 4J9KA 3RBDA 4HKQA 1U1QA 4DSLA 1WHVA 2PI4A 1UPPA 1REVB 4DWIA 3BPSP 3IN5A 1QE1A 3PXGa 2E29A 2AP6A 4PXBA 1JLQA 1JB0C 1IBMF 3R5BA 4CYUB 4DFPA 2WB1D 2ZNZA 4CH1A 7FDRA 1KKHA 1N0UA 3M30A 4C0OC 1S99A 4W92B 1NHVA 1D0EA 2F8MA 1EETA 2O01C 2KG0A 4X2BA 2BNZA 3H2UB 1VIXA 4NLWA 4OL8A 2JXIA 1YGYA 1CULB 5K8PA 3H87C 1CSJA 4R25A 4ZDNA 4TLQA 1X9MA 5I3PA 2AIRB 2DHXA 3CD7A 1UEKA 4J91A 5CAAA 2LA6A 1TKZA 3SCJE 3CMES 2P5VA 3ADAC 5F3TA 3G8QA 3CVKA 4FXDA 3FGVA 2J6UA 1F1BB 1TK8A 4A8KA 1PJ6A 3K59A 1Q7YT 3R2DJ 1OS5A 1FJ7A 1QAJA 4X66F 2M8DB 2Q43A 1WTBA 5KFXA 3PFOA 1SPBP 2A3JA 4LFCJ 1K47A 2H5JB 2HK3A 1IBLJ 1RGVA 1ZTTA 4ECZA 4BHQA 2MZSA 1DZ5A 2QA4S 2Y1LB 1XNQF 2RKIB 4LQ9A 3C15A 2XWXA 2MKSA 3HVTA 3JSRA 1Z1ZA 4YHHF 5CCMA 4DV7F 4R8UB 2FC8A 3PYGA 3GYXB 1B64A 2XO7A 1YSJA 5HVFA 3X3UA 1U0SA 2VASA 2XSJA 1WF2A 1M5KC 1FJCA 3RUBL 3C6UA 1NDCA 5T14A 3ET6B 4DQIA 2C2NA 3U1MA 3W8PA 1P6TA 2LDIA 1N6QB 2LXFA 1WSVA 2VD3A 3VV2B 1GMVA 5LMNJ 2J9CA 4AAIA 4ZCIA 3L9ZA 5IM0B 2HHHF 3DLEA 4A8XA 4DS4A 2K3IA 5KT2A 3DLKA 2MLZA 2PFDA 2DGVA 3J81j 4A8FA 3C6TA 5A8WB 2Z2YB 1F60B 1ULRA 3Q8QB 2FJVA 3IR6B 2GMHA 3VWSA 4RNFA 1PAUB 5KG2A 2E66A 3NS5A 3BGUA 2DGTA 1DY3A 3Q86A 4C97A 5ETLA 1YJTA 1NLAA 4Q2LA 1VK8A 5C2CA 3MM6A 2W2PP 1NB2A 1LOUA 3DOMA 3T5JA 1YJ7A 2XC9A 1JIHA 2K1OA 3ELHA 4XPCA 4ICLB 1OMSA 2XZTB 3K17A 3BSNA 3RBEA 2QYGA 4ANCA 1QDUB 2VJUA 3BF4A 2C3OA 3EPGA 2BKNA 5DM7Q 3TA2A 2AY0A 2H51B 1JLGA 3BR8A 2X7IA 4B17A 3BM7A 4X4NA 5BR8F 1WI6A 2BQRA 4L3NA 1PCAA 1HW9A 3M6XA 3EPIA 2M3DA 2WW8A 4J9SA 1VHFA 2BE2A 4AL5A 1JXEA 2H9ZA 1HNWJ 3B8HA 2BZ2A 4JI7J 1H7XA 4DR2J 3ILLA 1IKVB 2NXCA 2DBBA 3N6MA 4OYBA 2IDLA 1HFEL 2CADA 1KN6A 3QFHA 3ZTSA 2NSCA 2JVRA 3GE9A 1Y4ZB 3G86A 3EVMA 3G82B 2RS8A 2DITA 2ZZTA 2KYZA 2E5LJ 2V8PA 3OPKA 1JX4A 2OKQA 2FGOA 3FZBA 4HT7A 4Q7AA 5D0GA 2UXDF 3MF5A 2DH9A 2RVJA 2QLFB 2H65B 1S1XB 5JJBA 4C8ZA 2BNWA 1VJWA 5LXRA 3FJ2A 1H0HB 2QX0A 4PWUA 4B3MJ 2IHR1 2R2SA 3EGWB 2R7VA 4FPIA 1HL6A 1RAJA 3HHNB 4NLPA 4LT6A 1CJKB 3CNQP 5FDLA 1WDDA 4RW8A 3Q2TC 3ONQA 3KJNB 4QYRA 1E6VA 1NLKL 3FK4A 2R8IA 4K7QA 4I67A 3NMAA 3ZTPA 4NXMJ 1MU2B 2AJ4A 5KG1A 4B08A 4ZJQA 1MSWD 4U96A 3MTKA 4DV3F 4KAIA 4ANEA 3E51A 3KK2B 1S1TB 3JXOA 4PXCA 2RD5C 2F8HA 1G1XA 3KHGA 3G8SA 2VFVA 1HNZJ 4LRAA 2R7UA 1G6BA 4X84A 3HD2A 2RQCA 2MGZA 4NYOA 4J9VA 2HHVA 4KKOB 4FF3A 1NBEB 3K8WA 4PQUA 1FD8A 3D6FB 2N4CA 2QA4G 4D3HA 4CO5A 5M2PA 4ELUA 4HL9A 1Q78A 2VC1A 1N5YA 2I8EA 2EFPA 4RU9A 2XB2D 1S48A 2CZVC 4H4KC 1C1BA 5BYRA 2CXEA 1GXUA 3DI6B 3T1HF 3KUGA 4CLPA 3C15B 4CTAA 3HVTB 1S12A 4PWWA 3MOZA 1DHMA 4QW8A 2VL1A 1VQYA 3ENQA 2JFKA 2J6TA 1EQMA 3QFWA 4N8NA 2W25A 4KGVB 2O5DA 2XSJB 2XGPA 4C11B 4DLEA 3GFYA 2V2QA 2V8DA 4ME7E 1TP7A 4LF7J 5CYQA 1WG1A 2NZCA 2HBYB 4M5JA 2LXUA 3CCSS 2M70A 1TL5A 4X64F 3FCVA 4KFBA 4ECRA 2JVOA 1HD0A 2GJFA 4RW6A 1X5TA 4CO2A 1JQGA 3DLKB 4A48A 5CYMA 3LP1A 3NAHA 4HACA 2J9DA 3TP2A 3EVOA 1L3KA 2C3PA 3E01A 2C28A 2XYGB 4MJWA 2YNFB 1FX2A 4EMDA 4TU9A 4IRKA 1R6YA 2FIUA 4EFAC 1JLBB 1F9EB 2BE9B 1BUXA 3CJRA 2KDOA 3MM6B 5GAGI 4NCBA 2QSWA 1KVIA 4UOHA 1MN7A 3OJSA 2Q1LA 3MM7B 4GKKF 1RHKB 1S7HA 4V19X 3G6XA 4DU8A 1X4GA 4DV5F 3ILIA 1H72C 3MEGB 3C16B 3QMQA 2Z57B 3VCDA 1CJTA 3GCXP 4AL7A 1HNVA 2G0CA 3UCUP 3G9CA 1VQ5S 1UETA 4QIVA 4LRBA 4QW9A 2WONB 3GJRB 2Z2ZA 1JLEB 3H59A 2DXFA 2YH0A 2XWYA 2H4YB 4ZPBA 5KG3A 4JI5F 2CJBA 2BE2B 2BOAA 3KUHA 4NZ7A 1S0NA 4N7TA 3W2VA 2I9SA 4DQQA 3V6DB 4OLPA 2G1HA 3W64A 2OPQB 1Q5YA 1HWUA 2ZJRQ 1B7FA 1RWUA 5KFAA 3KLHB 3WDOA 2DGOA 5HANA 3MUMP 4OYAA 4PWDA 3H2VE 1XR7A 2ASLA 3LPEA 4RPFA 1XK8A 3MAAA 4U7UK 1RZMA 1NPPA 2XMJA 2V4QA 2RIJA 3IP0A 4DUZJ 2X3GA 2FJEB 2AHOB 5J2QB 2R7SA 2KZMA 2CPIA 5DG9A 1RT7A 2HFOA 2DRBA 4WKRA 1OYDA 4NA1A 3PW4A 2E9RX 5D0EA 3H5SA 1VC6A 5FDLB 1UVKA 1ZETA 4HT5A 5LT5A 3TJAA 1SIZA 2HQGA 1UFKA 1NAQA 1QSYA 1XNRJ 4G3IA 3CCQS 1E6VB 1QSLA 2AYBA 1RTIA 5KOXA 2C2KB 1X4DA 4MJKA 4C0HA 2RMLA 4RW4B 1P9YA 5E3AA 7FD1A 1JLCA 1Q82T 3BQ1A 1U24A 1NK4A 4KO0A 5FLXU 4H4OA 2R8GA 3AD8C 3W5ZA 2VIHA 2BKPA 1MWYA 2B8QA 3DYAB 2HZCA 2DYAA 1S59A 5DQHA 1IBKJ 3PZPA 4ID8A 4DV6J 2W7AA 3UNYA 1YKWA 1H7WA 3DCAA 4K4ZA 4A8SA 1KFDA 2MGZB 2UXCJ 3AH6A 4J5OA 2G0IA 3D3BJ 5KFTA 3V5RA 2A10A 4PQUB 4YN3B 2J7KA 2V4RA 4M5LA 4RNOA 3BGOP 3PO5A 2FB0A 3AX5A 2HRTA 3P5TL 2OTJS 2UUBF 3WBZA 1TV6B 2LQJA 4RNMA 3IWNC 1R0AB 4P71A 1XR5A 3V2UC 3BBBA 2YQ3A 5EN1A 2R2UA 4DCJB 3PY8A 2XGQA 2RJZA 4ID5A 3BH7B 3D1QA 2K8GA 2ZH6A 2ZD1A 4N41A 4ZCKA 1CJVA 4DOZA 1RTHB 3LANA 1T94A 2Y1IA 4CQ1A 1D9FA 1MW7A 3UNGC 4ZMMA 4DV0J 1UMJA 3P4UB 4OJHA 2DJWA 2OPRA 2B9EA 3SQGA 4NLRA 2HNZB 4NCGA 5HBMA 1RWNB 2JFDA 4LR8A 2KU7A 2ASYA 2MHEA 2UVWA 4OZNA 2M2BA 4ZN1A 5CYQB 2GQ2A 1T9TA 3JTNA 1NK5A 3CC2S 5KFBA 1U09A 4ALZA 1BQNA 4KFBB 1NHUA 4YB1P 3HVAA 2CQ4A 2X51A 3TARA 3DLLQ 4I0WA 5CYMB 3CCMS 3LP1B 2K06A 3GU0A 1IXKA 3NGTA 3X1LB 4ZOSA 5KFDA 3PIOQ 3M2VB 1DBDA 1AFIA 3UI3A 5DLGA 3RR8A 1B99A 5ETQA 2P8IA 1XR6A 4CP5A 3H8YA 4R5PB 1U26A 4YHHJ 3QO9A 4L74A 4DV7J 1S9GA 3V4MA 5DG8A 1SV5A 4LFBF 4U9RA 4ED7A 3C14A 2V8HA 2DXDA 3KG0A 1KOOA 3FRZA 3KLGA 2HYIB 5HQMA 2QV6A 5HVHA 2JL9A 3A3OB 3O6QA 3LTOA 1OQ3A 1RAFB 4I64A 3AB2B 3OFFA 1PBAA 1ACMB 5B7WA 3MURP 3DHXA 4ZHRA 3LGHA 1CJTB 4TU8A 3I56S 3POTB 1HNVB 3RRKA 1RT1A 4U8VA 5IOLA 2HHHJ 2WTFA 3SQOP 5AXKA 2PA3A 1N0VC 2C2ZB 3LP2A 1UZDA 1M5PC 2PT0A 3TVKA 3OUYA 5KFPA 2ZH4A 2MZ1A 1R8HA 3S1TA 3LWMA 4IO1A 3GG0A 3FCWA 1SKSA 2XS2A 3SYZA 3FMWA 4EO6A 2B6AA 4DPYA 3CGIA 3W2VB 4GVLA 1UAWA 1B0VA 3NGRA 4LREA 3PYEA 1ZA2B 2DRAA 2B4UA 4ETZA 4OYIA 3KHLA 2K2PA 3QSYB 1S6QB 3TEGA 4ZIVA 2ZUAA 5FD1A 1S9EB 4PWDB 4FBTA 3KG1A 2IIHA 1X7VA 3RB4A 2ROGA 3IXQA 2OEKA 3UVJA 5F0UA 4OX7A 4PXDA 2EFNA 4RNHA 1RBLA 3T6JA 2B5JB 1RT7B 3QQCD 2KVQE 2B7BB 2RDJA 4JI3F 4ZVEA 2Y1JA 4RL1A 2N7CA 1CEZA 2GAHC 4WU3A 4XIUA 1Q86T 2KT3A 1HPZA 5I4MA 2YQ0A 2QC3A 3IBFB 3NNHA 4B9UA 1RBAA 1YBUA 1VQPS 3ENVA 1S4EA 2C2MB 2RNEA 1PJ7A 1WKLA 4EBEA 3AQOA 2OPSB 5EWFA 2KRBA 2MJUA 4O3OA 4D8JA 1RJJA 1TUVA 1IKXB 2K7KA 2WOMA 3ZZRA 3Q2SC 3R3TA 2HURA 4KO0B 3P6YC 4H4OB 3CF5Q 2EVZA 3N6NA 3RW6A 3OFHA 3KLIB 5DQGA 2F4FA 5D8HB 3JYTB 1GH8A 3QYYA 2JRSA 4LF5J 2C3YA 3M32B 3VZHA 5KFNA 4CM0A 1M1GA 5D77A 2YX1A 5H9EK 2ASJA 3UDCA 3VTIA 3LUYA 2IRUA 3UDVA 4TNOA 2UXDJ 3I31A 3UD3P 4CLFA 2FGCA 3CJ0A 1K44A 2K6LA 1K9MT 4WZMA 1X9WA 1R8CA 4HHHA 1ZPVA 2Z4PA 3TUJC 2ROPA 3KK3A 4G1PA 3M6VA 4S0MA 4P2FA 5JMNA 4DZ6A 1YJWS 2ERRA 4I2QB 2W24A 4TU7A 2PE8A 1W7WA 2ZD1B 2EWHA 2L08A 3KLEA 1H38A 1CJVB 2QGFB 2KJWA 3TEHB 1X4CA 1N54B 4IFYA 2CQIA 5IV4A 4ZP9A 1VGYA 2KYXA 2VUGA 4NCGB 3CCVS 3CCJS 1O6XA 1WNEA 2YKOA 4DV3J 1TVRB 2P6TA 1Q1KA 3VAGA 5F8NA 1FXDA 1V9OA 1SVDA 1UW9A 4QCLA 4BC9A 1C0TA 1T05A 2PEHA 2AGQA 2W2MP 1CC7A 5KG4A 2X1BA 1BQNB 1AZSA 4CLLA 2OELA 1YZ6A 2XI2A 4P10A 1WC6A 4O3PA 3QJJA 1S7IA 2DNNA 3UR3C 4X4RA 5JXSA 5IC4B 3PJXA 3CCTA 1HKAA 4DR7F 1NO8A 3NRBA 3UO0A 1NK6A 4RW9A 5A6PA 1J5OA 4LSZB 3T1HJ 1X5SA 5HSPA 4DL0C 4TQRA 4ETXA 1RWOB 4X65F 2FTRA 3LALA 5LJ5Y 3SFGA 2MB0B 1S9GB 1SV5B 2D41A 4KPYA 4OZLA 3L95X 2YWFA 4DJBA 2PIIA 1VRUA 3KLGB 1R3NA 2RUSA 4IR1A 1SBRA 1HYSB 3D3CJ 3R5CA 1YK9A 1RAIB 4J9OA 2PI5A 4NX9A 3DDNA 1JMTA 1O5JA 4U6PA 2G2OA 3OL6A 2LQBA 2V0NA 5MLCV 4ZHRB 1S1UB 1TU0B 2P9EA 4OV6A 4WXWA 4M95A 1SIWB 1KOHA 4Q2MA 5CD4H 4X64J 2ZEJA 5KFLA 5IV3A 2HGLA 3UWTA 5L1JA 2M5YA 2VBZA 1SC6A 2IC3B 1RABB 3OBIA 4DL7A 2OTLS 2EPIA 2HW3A 2L9WA 3UN3A 2ZUGA 2BABA 3PX4A 2B56A 4CT9A 3JAMY 3W61A 2B6AB 2ABYA 1FVSA 1OSDA 1S1WA 3Q23A 5AT1B 1Y0HA 1DQ9A 4UZBA 1OY8A 2GMLA 3FRYA 1W25A 2OUGA 2QLWA 1RB0A 4NLOA 4OHWA 3I0SA 3NWGA 4A47A 1Q8LA 2MQOA 2KOEA 4J90A 2DGWA 2ZDOA 4LF4F 1BDVA 1VI7A 2P9GA 5IWAF 3HHLA 3GSDA 1LFPA 5CCLA 2FLNA 3ZTOA 4OYPA 2BQ3A 1ZAVA 4HHUA 3V6JA 1HR0F 3HSGA 4USUA 3DRYA 2WVFA 4WE1A 4DFKA 2BRKA 1JWWA 1KD1T 4IH6A 1QVFR 4KRWA 1WKJA 2F63A 2ADBA 2HEKA 5D15A 5HROB 4OI6A 1U7LA 4EZ9A 2B7CB 2CJ9A 3PHEA 4JI0F 2D3ZA 3WC0A 4DUTA 3OR2A 2HNYB 2E7WA 1R6VA 3SXLA 1FWKA 1H2UX 4JI5J 3CIZA 3K0JA 3JQMA 1BGXT 4XO0A 1A0OB 2WOMB 2HS3A 4GC7A 2NXEA 5IXUA 1LWEA 1YJVA 1TFYA 2JH3A 3GG1A 3SDEA 2VA2A 3W9JA 2AGOA 4K4XA 1B4SA 4K5SA 5HMXA 4F2SA 1FJEB 2VKRA 3PR5B 3DM2A 4MYTA 5ITHA 1XC9A 1GXLA 1Y5LB 1FRXA 3IG1A 3BKUA 4OI4A 2ZOMA 5KT3A 4ZVHA 5HVGA 3NGSA 2HGMA 3MPUB 1JNRB 4RUHA 1YX2A 4OX9F 1UWBA 1T03B 1U25A 3BBFA 4OFZA 1WJ9A 1RUSA 5J2NA 1OO0B 4FYVB 4WP9A 1M5VC 5C24A 3K2YA 4DR5F 1SJ4P 4F4YA 4K50A 1L3UA 4JV0A 1VQ6S 1HQUA 3WHIA 2ZM6F 5F0WA 3FCHA 2KXHA 3K7RA 2MZQA 3DKDA 3KLEB 1IBCB 2LP4A 2RBFA 2CQPA 3AWRA 5E3CA 1TKXB 4DR4F 3S7RA 3ENWA 2B43A 4DN9A 3DMJA 2W9CB 4FYXB 1MMLA 2BE7D 2HAFA 4B3OA 3QBCA 2XLIA 2Y1RI 5CXTA 1CQNA 1HWJA 1T9YA 2M7SA 1X4FA 3TJ8A 2DNQA 2IA6A 1X93A 4F3QA 3CD6S 1N48A 1RHJB 2EFGA 2XYHB 4DUYF 5CHCB 4DV1J 4RUAA 1N88A 4NEYA 4H54A 2ADCA 1DQAA 3HJFA 2CVIA 2YWGA 4O4GB 5SUHA 4J37A 3OSPA 2MQPA 5F8MA 2J9DE 1S6UA 2Z30B 3TA0A 5AJ3F 2UUBJ 3O1LA 2H54B 3MD1A 2MLYA 4K5RA 3RGIA 3DRRA 4QYZJ 1KBRA 2FYXA 3U7JA 1VBKA 2KM8C 2IM0A 1J5OB 1AA1B 1WC4A 4I68A 5KFEA 4IDKA 2BANA 2OHDA 1F3VA 4RW7B 4ZS6A 2K29A 3RU0A 1KVJA 1RT4A 2CPYA 2XNQA 3PJ9A 2DGQA 1FTRA 4NL5A 1VRUB 1YHQS 4CCHA 4MMOA 4N76A 4JP8A 3M2UA 4UOGA 1WHYA 4G6VB 4O3NA 3HP6A 2IDEA 5D6GA 3TZZA 2OEJA 5GMKa 5DQIA 1TAUA 1FFGB 1D3WA 5ETRA 5C42A 1O8BA 4ZJOA 5I3QA 3HVRA 3Q8VA 3H20A 1HBUB 1XERA 2FUG9 3FC9A 1YG0A 3BREA 4IG3A 3ILJA 1FHTA 4KHMA 2JOQA 4F4ZA 2VFTA 3BSOA 2I6WA 5CABA 1IKWB 4BS2A 5ETKA 4DR3F 4TXSA 1VRTA 2VQEJ 4W98A 4DL2A 1D9AA 3L09A 1LWFB 2WZ1A 1IM6A 2F1FA 1R8AA 1RHQB 2AEFA 1DTQA 2I1RA 4QR0A 4MKYA 2CRLA 3NCPA 4HR2A 4YY3F 1U0HB 3I0SB 3ICLA 5KFYA 5CD4A 3HHLC 3F44A 4RU2A 3MPWA 4WFBQ 1EKRA 3SFUA 3D2WA 4LFBJ 1JXVA 4LRVA 3P96A 3DOKA 3K8VA 4DL6A 3JTOA 4ZPCA 1DLOA 1PSDA 4CO4A 4AYBD 4NRUA 5RUBA 3FBFA 3TANA 4OZ0A 2V63A 1UCNA 2KKEA 4EYHB 4KGMA 3H98A 4P7VA 1Y3JA 2B4PA 3MMCB 1LEOA 3PYDA 3A12A 4WE1B 2RT3A 1RTZA 3MWBA 1RWXB 5CA5A 4USIA 4ED0A 2WBRA 3U02A 3GLJA 3PRVA 3IM9A 3QIDA 4K8RA 5DDQC 4DQRA 2FZCB 4JI4J 3AFGA 4GC6A 2MXYA 3B4DA 2DR7A 3OR2B 2OFHX 2B9YA 1RE1B 2DNKA 4OZ1A 2CA9A 3FEXB 1D09B 2PMWA 1BWEA 4PG6A 5DS7A 1V5IB 1YJ9S 2V50A 2PN6A 2MZJA 4JI2J 3OQ2A 1UFWA 3N0VA 3MCMA 4LQ3A 3DM2B 2Z58B 1U49A 3HXMA 1RTJA 1GFWB 1YQHA 4O3RA 2DY9A 2MPUA 3CT9A 1Q79A 3MPDA 4KGZB 5LMUF 4UQTA 1KHVA 4GO7X 3SIPB 4DV2F 1BQXA 1UWBB 4M5GA 5B0BA 5F8JA 5J2NB 2W2NP 1RT6A 3Q8SB 2RF2A 1ZM2A 5C24B 1P9QC 2HQCA 2CIMA 3BO3A 4IKAA 4HH0A 3WX8A 1YTYA 2D7SA 4JI3J 4I6WA 1HQUB 3K5NA 4B3TJ 2IM3A 4DX7A 2OPPA 2XBPA 3GR1A 2ZBRA 3EX7B 3UD4P 2AWZA 1U2FA 4K2XA 3OTEA 3D68A 4WKYA 5KFQA 4DR6F 3R5AA 4B3OB 1U8WA 1ZZNA 5ETVA 1VRQC 4I6YA 2E1MC 2LVWA 3W8GA 4EYIB 5E3QA 4NEZA 5B0AA 1VYAA 4YB7A 1Q81T 4M5MA 5ETNA 1PYSB 2CQ2A 4F7VA 3M8PA 3FT7A 3AJ1A 2HPUA 1GMWA 2QZ8A 3D0HE 4IFVA 2W8KA 3HD1A 3G6ES 3QT6A 1G3OA 3RZAA 1N5SA 2QMWA 2PA8D 2LEPA 2FVRA 1YRXA 5KTQA 1NSQA 1B7YB 3MMBB 2RRAA 3GTYX 1LXNA 2KH9A 1M0SA 3TVYA 1S79A 3HKWA 3DRRB 5ADZA 4WU2A 3FSYA 2VHGA 4ZVGA 3PEHA 1U1KA 1T7PA 3OT9A 4PYAA 1RLCL 2FC9A 1GT8A 2XG8A 2BANB 1N5QA 1FTCA 3BGFA 2ALZA 2IYIA 3CJ2A 5HI7A 1VQ7S 4Y3CA 1IKYA 1RT4B 2FY8A 1AYEA 3BKTA 3H40A 1F9HA 2F7VA 2I5JA 3LPYA 2X1GA 3MFHA 1R89A 4NLYA 4LF6F 1I5OB 3TNVA 3MM5A 1YJRA 2IA0A 2EC2A 2HNDA 4UUXA 3QT7A 2LECA 4DPUA 5AXLA 3T9ZA 5A8RA 2FQQB 4ZVPB 4Y34A 3D6HB 3R7SB 1CJUB 2V4JB 5F8HA 5KFCA 3LJPA 1MROB 3MM9A 5F9NA 3SV4A 4IG3B 1AT1B 2WSEC 3NWRA 2VQFF 1HBMB 4HHJA 2XM3A 3W3SA 2D68A 2MQQA 3UPFA 5D3GA 3EUNA 4J9NA 1OJ4A 2PSZA 3MMAA 5IQQA 1S57A 2GVDB 2IFXA 1QAYA 1VRTB 1IR0A 4C4WA 4YP3A 5EX0A 3G2XA 3T3FA 2MDAA 2OH2A 3HZEA 1I94F 5EDWA 3SZ2A 5L8RC 2J9EA 1SJ1A 2A2BA 4AXIA 1WF0A 1K73T 2VG6A 1L3SA 2B8PA 2VG5A 3CJSA 5G0RA 2DXEA 2JX2A 2VPXB 5B0CA 3S6EA 4Q5VA 4M1KA 3B54A 1HNIB 2HS0A 3M9OB 3HSJA 3E2EA 2IVYA 1HBOB 1OHNA 3R6LB 5DETA 2YH1A 2Y9HA 2IVMA 5HMWA 3LO3A 1ZM9A 1LWXA 3H2LA 4Q43A 2CUYA 4UF4A 1ZM3A 2CPDA 2AT1B 3ILOA 1U6FA 3DN9A 4CYUA 1FXLA 2XY5A 5H9EJ 2D69A 2YWKA 4N47A 3DRSB 5I42A 2AEMA 5KT6A 1D8ZA 2V1SA 1Z4UA 4LF9J 1CLFA 5ETPA 3TUIC 4ED3A 4EBCA 2R2TA 4AXJA 1L3TA 4DSKA 1CULA 5HQ8A 1UEVA 1Z2ZA 4MYUA 2GQCA 5ETOA 2ZOFA 2VBXA 2PD1A 3J81U 2HVDA 2C2DA 2VJVA 2NPIA 1R27B 4O0IA 4LSNA 4R0EA 1KQFB 2RB7A 1FRHA 1JJHA 3HFVA 1KQSR 2FVQA 3PEJA 1RTJB 1U6ZA 4ATNA 4J9PA 2DVIA 1JLFB 2ZHAA 2IVFB 3CJQA 4LF4J 1UJ5A 4OJ3A 5HATA 3GIMA 5DDRC 1N32F 2M4MA 3D6MB 3VHQA 3CDBA 1N34F 2Z2LA 4DHVA 3DLBA 4WFZA 2DH8A 1G7CB 2KRRA 4KQZA 2DNLA 2W2OP 4JI1F 1HR0J 2RRNA 1SH2A 2RKIA 3JS9A 4MFBA 2HLUA 5KG5A 4KHPF 1F3FA 4DEZA 3HULA 2FJWA 4R8UA 2MKYA 2OPPB 3PV8A 4Z7CA 4G1QB 4JI0J 3A8IA 4DG1A 2HWHA 2IAJB 2LLZA 2H3AA 4O0NA 3VZIA 3UN5A 4PG4A 1ZOTA 2NLWA 5D4LA 4W90B 1ITPA 4FF1A 2NCKL 3VVTA 4ZVTB 4ED4A 3R5JB 1B3TA 3DXSX 3ET6A 5HO4A 4RWXA 3D7SB 2JEFA 3NAIA 2AW0A 1K0VA 1N6QA 3FVYA 1KC8T 1TTHB 5DRKA 5ETSA 4J9QA 2BXJA 3M8PB 3WIUA 2E7VA 3NGDA 1TZ0A 4AQYJ 1GEHA 5A8WA 4ZCMA 1PAEX 3AXKA 2XCAA 1VK3A 4OX9J 5D78A 4C8NA 2QFJA 4ZPVR 1BC6A 4C8YA 4I4BA 3EGZA 2AF6A 4DR5J 2QLBB 5E0OA 4JV5F 3CXCR 2HS4A 3KUEA 1FF2A 2ZJQQ 4ZP6A 2ZM6J 2BBEA 2HMIA 1GTHA 2FDNA 2LFVA 4M5IA 2VV5A 4ZVOB 4E8UA 3N5FA 2YKNA 3J81Y 4C2MA 3GXQA 2BYCA 1FRJA 4DS5A 3OTDA 3IR7B 1NPRA 2CPZA 3G8TA 1UEUA 2VDIA 3H4DA 4NLQA 2A0FB 4YDDB 1B01A 3KHRA 2G0JA 4NMLA 4P9SA 4ZVRB 3GPAA 2GA7A 5B09A 2ZBPA 2HNDB 4RWWA 5SZTA 3T6BA 1NKBA 1HA1A 4DUYJ 2HQ3A 2V5HG 3NS6A 4V19J 2EXUA 4X62F 4DL4A 4NYPA 3VGVA 3VGUA 3MM9B 2RU3A 3BDPA 2HWIA 2R7WA 1X4EA 2XLJA 3DC2A 3DFEA 4ECUA 2FJBB 4A8OA 4F04B 3QGIA 3ZZYA 3MMAB 2HFZA 1IKVA 2FLLA 4ZA1A 2V2KA 3SCIE 5L1LA 2OMLA 2QMUB 3AY0A 3QRPA 1AUSL 2QL7B 3GONA 3HX9A 1N52B 4OYMA 5KFKA 1IN0A 3MR3A 2FVPA 4UUWA 1UVMA 4EO8A 1U9PA 1RHUB 2W8LA 3QJPA 3WQPA 3AD9C 3IBCB 4MIAA 5J2PB 1U8SA 4O4RA 1SKUB 1HI1A 2VG5B 5G0RB 2JC0A 2R7OA 1S1XA 2MHNA 5DDPC 2KKHA 1NDPA 4B9MA 2KFYA 1N33F 2AGPA 2LCWA 2R9LA 5E41A 3F73A 2RAQA 1H2VZ 1ZAWA 1Z2LA 3RTVA 2DNRA 1CJKA 1Y10A 2E5HA 3EXCX 4RX6A 1RTDA 3HMJG 3M8YA 3LP0A 2BV3A 2BVZA 1EKSA 1KSPA 4WCEQ 3VVUA 2HHUA 2K7JA 4NXNJ 5I42B 1MU2A 2R42A 3RG6A 2FJXA 4N77A 2W2QP 1NMEB 3OV7A 2U2FA 4UOCA 3TR5A 4OHXA 3R6GB 4ZLJA 5C2GA 5J1EA 2O3DA 2MMYA 3KK2A 1S1TA 4IUFA 2RHSB 3Q24A 3CJKB 1UJ4A 4LSNB 3MAQA 4F67A 4YY3J 3MXHP 4M5HA 3RAMA 4KKOA 1L5UA 3AAWB 4DSJA 4X4VA 1U1RA 2E5GA 3DLHA 1GMUA 2I38A 5C7PA 3C66A 3J7AN 1TL3A 4KSEB 3QRRA 1FDBA 3W9HA 2VOOA 2ZBQA 4I7FB 3VGSA 1D1UA 4USWA 4CI0B 5HMZA 3DI6A 1Q4RA 4MFBB 2N3OA 1EB0A 1U6BA 1S1VB 3BPDA 4CLTA 1SXLA 2X1AA 3GV5B 3EZUA 1OQ6A 2ZH7A 3R7NB 1ZBTA 1UPMB 3VAJA 1OG7A 2I0XA 3Q8PB 4DG1B 2DT9A 4BCAA 1LK5A 1PC5A 1E6YB 1RBOB 3AODA 4NWBA 2KM8B 1BD6A 2BDPA 4C11A 1QLNA 3W5YA 1KLMB 1IR1A 2CDQA 1WHWA 1BHNA 5B08A 2JBVA 1IJFB 2JC1A 2ZH8A 2J0SD 1RKIA 2BUNA 2M8HA 2MY7A 3CW2C 3QLHA 4OV1A 1EIYB 4ZLPA 1HQ2A 1OWXA 2JXGA 3GR0A 1Q8BA 2CAXA 5E3RA 1FFWB 5LMUJ 2NUHA 4NLVA 2HGNA 3H5YA 4DV2J 2GGPA 4E2FB 1RA7A 1DFDA 4UTGA 2ZHOA 1VHIA 2BA9A 1RK8A 5CQGA 2FJDB 1BDTA 2LU1A 5L9NA 2YNFA 1HI0P 3HK2A 3RW7A 3CDAA 1DQ8A 2EG2A 4WFAQ 4FNHA 1X0FA 2DGUA 2YKMB 1JLBA 2C3UA 4DF8A 4PKDB 1VJQA 2GHPA 2MQ8A 2HMIB 2OP5A 1SQEA 3FFIB 4LRFA 1I3OB 2YKNB 1MMDA 3MM7A 1RYSA 3TAMB 3PW7A 3QT8A 1FD2A 1M1KT 2HFNA 2AMCB 4FPRA 3VEBA 1N36F 1M1HA 4X4OA 3M2RA 2E9ZA 3AOAA 4NLXA 1T11A 3FUYA 5KFIA 3MEGA 2CQCA 3C16A 1SQGA 5D0RA 3SSSA 1IBLF 2CG8A 4U67Q 2IMWP 3M6UA 4ZVQB 3OTBA 2CFXA 1CS4B 2FHJA 1VBYA 2WONA 4NPOA 1XTZA 1JLEA 3NXZA 4ERDA 3HKZD 5HK4A 5HLFA 2AEJA 1F6TA 2XS7A 1RT5B 2ZNYA 2ZZMA 4C9DA 4DLGA 2UZAA 2P6SA 1NK7A 4EUVA 3CJ5A 3V6DA 5T41A 2BJ9A 3OW2R 1SI9A 2XTEA 2OPQA 2QN6B 3BGLA 3K57A 3BKFA 5H1SV 5KFRA 2CAJA 4CWBA 2ALYB 1BWVA 3K58A 1QAIA 3KLHA 4K4UA 2HHXA 5L39A 4QPTA 1HQEA 3NOCA 1QTMA 5K8NA 4ZLNA 3PKMA 5LMNF 2XMUA 5A0YA 1R7IA 2KO1A 1YVFA 2DNOA 4ECQA 5J2QA 1TL1B 2ZZNA 1JNZB 3SI8A 4M5DB 2DCLA 4M63A 4DPWA 3P49B 2KXFA 3C3LA 3NNCA 3HHDA 4TLRA 4WWSA 1YJNS 5HP1B 2WVDA 2HBRB 3NCQA 1TK5A 2F4VJ 1S5ZA 1RTDB 1VLYA 3LP0B 1T9VA 4GRSA 4URGA 2Q2KA 4O44A 4IG0B 1NU4A 1IRQA 1S0VA 2AX1A 4RW4A 2BEFA 2VQFJ 3V6HA 2KG1A 4FDFA 1IR2A 1ZYQA 2V2VA 4ZN3A 2Q3PA 3D28A 3BO2A 5J1EB 3DYAA 4F0HA 1QVGR 2QLXA 4WP3A 1WC0A 1Y00A 2LEBA 1R43A 5E3PA 1WSRA 4CO1A 3OVSA 3SV3A 4HDGA 1C1CB 3O5TB 4LFAF 1TL3B 3G5OA 3PO4A 1TV6A 1R0AA 1TL4A 2GO8A 1FKOA 1GAOA 1UTAA 4WJBA 3LGMA 1NRKA 4ENOA 3TJ9A 4IO9Q 4JI7F 4OI1A 3R97A 2UP1A 1C0UB 3GJTB 2EK6A 1RTHA 4ES3A 3SBMA 2AU0A 4UY85 1HBNB 5F9LA 2WSFC 4OZ2A 3A3NB 2B0GA 4ED5A 2IM1A 1QAXA 2HNZA 3SCLE 3SCKE 4DR1F 2ZOGA 2FJAB 2XTJP 3FEYB 3IWXA 3IRXB 2KL8A 2IPOB 5DGAA 5M2UA 3GJQB 1ZAXA 4OZJA 4XK8C 1Y3KA 4PPZA 2MZTA 2VA3A 3QLHB 3UCZP 3VAKA 1R8BA 3MEDB 5IT9U 3KXDA 2MKIA 1Q16B 2W1BA 4DQPA 1NJYA 1N32J 5KFWA 1JKHB 1TL7A 4F0KA 2GGPB 3HHLD 3J7YI 1N34J 4JV2A 4OI3A 3N79A 4NXMF 3M2VA 3OTOJ 4IOCQ 1U02A 2B9XA 2FVCA 3M8ZA 1WKKA 2GJIA 2DH7A 1O51A 1EP4B 2XZ2A 4Q45A 4R5PA 2VKZG 2WVCA 2RQKA 1YLXA 1VQMS 1HNZF 1ZTWA 3CEDA 1RWPB 2OIHA 1C2PA 4JBCA 1YZ7A 1IJEB 3QSIA 3M1VA 2EFVA 1LV5A 4KV8A 2LA4A 5HN0A 3CJTA 1DTTB 2E1PA 3M2RB 3I4PA 3JQJA 2XNRA 2HRUA 4PG5A 2HHQA 4IRDA 3OR1B 3POTA 1X5PA 4QYZK 2JWNA 3I9V9 1HHSA 5F41A 1VLOA 2ZHBA 1SC1B 4H4MB 2XMAA 5HLFB 2XCPA 2QG9B 3DDIA 1RAGB 2VFSA 3IAM9 4B3RF 4YFUA 3VQTA 2EFOA 4GKJJ 2JXHA 1QTGA 1RLDA 2MSSA 3HZGA 4E98A 3JTPA 3BBCA 3WX4A 4JV5J 3ITHB 1X8DA 2XMTA 1S6QA 3IM8A 2IJFA 2CQHA 4LF7F 1FK9B 3PRDA 3GYNA 1S9EA 2CWXA 2LMIA 3RB3A 3A3PB 3P5BP 4WIIA 4QPXA 3D0IE 1HQEB 2P2CB 4XTTA 5A0YB 4JV1A 4DV4F 3T19A 1I51B 2MKJA 2DCUB 1S77D 2DNGA 2YVSA 4C7QA 4YQWA 2UVRA 1M5OC 2B5JA 3ETOA 3K5OA 1F2GA 2AJ1A 1ZA1B 1N5TA 2F5GA 3OTCA 2V1TA 1SKRA 3FSXA 2DD8S 4QU7A 1LFWA 2NR0A 4B3SF 3I5BA 1SL1A 3N28A 4O44B 2ILYA 4X62J 2DY1A 2XYPB 3O44A 2EBGA 2KI2A 2GHWA 2ZH5A 2QEXS 3AXMA 3FQLA 3TAPA 3M6WA 2OPSA 1XN9A 2LQ9A 1FRKA 2VPZB 4KB7A 1NSKL 3MCSA 2HK2A 1IKXA 4FVCA 4J9RA 1BE4A 3W60A 1U1NA 2A6OA 2E44A 2YKAA 2QIFA 2BKOA 3KLIA 3ZC4A 3MMJA 2CQDA 1DRZA 3H25A 3UE2A 3RRHA 2KT2A 2VFUA 3BR9A 3VALA 5KFHA 3JYTA 4A8MP 1U4BA 4Y6IA 1RQ0A 3M32A 3Q8YA 1FEEA 1R8PA 4NLSA 3TZWA 4OZ5A 2ACMA 1FDDA 2EKYA 4F2RA 2UUAF 3HF5A 1RWMB 2UV8A 3Q0AA 4DN0A 3E3XA 3HI9A 4FF2A 1FKOB 3MEEB 2H4WB 2DR8A 1YIJS 2JZ5A 5KT4A 4ED2A 2MLXA 2CJYB 4C3MA 3M9NB 5CH7B 3ZFVA 4WFYA 1FRMA 4I2QA 1IBMJ 2CJXB 3NY0A 4P2SA 1RT2B 4TYAA 4ED6A 3DOLB 4OJGA 4FS1A 2YWHA 3D1OA 2UU9F 4MIWA 3KHHA 2R4FA 1B28A 1JK9B 4MAKA 2LQ5A 4EBDA 4EZ6A 2DPJA 2JLEA 4C0BA 1U45A 3SSRA 2DGXA 1WEXA 1KP6A 5F8LA 1EQ0A 4RBUA 2EFQA 1CQMA 1TVRA 1OIAA 3QJLA 4FXWA 3DGPB 3U1NA 2H48B 4X4PA 4OHVA 2J0WA 1HWKA 3QGGA 1V5VA 3HVWA 2E5JA 3PW5A 3IO1A 3O2IA 2GS8A 3OL7A 1WI8A 3Q8RB 2CNKB 5IQ6A 1TUGB 3HHEA 5K5MA 2Y0BB 5E2QA 4X66J 2I2YA 2HLTA 1TL7B 2NS1B 3QAEA 2BJ3A 2AV5A 5IZHA 4P74A 1XNQJ 4F3OA 5KFSA 4WK1A 2LXIA 2FLOA 1QUPA 2E7XA 3OJUA 3DRPA 3M8QA 5EUHA 2VG7A 2B3TB 5FLXY 3IS9B 1Q8IA 1VS3A 2D9OA 3VAMA 3D1HA 1D8YA 3NNEA 1RA6A 5AE2A 2X3DA 4IH7A 2GV1A 2RRBA 1PBUA 4MKBA 1HIYA 3F56A 1HYSA 3M1VB 2FHMA 2CJQA 2WCXA 2DEJA 4KV8B 3BEGB 2X1FA 3BQ2A 2BSQE 1QTNB 3UFCX 5AE3A 4LVOP 1UZHA 5T7LB 2U1AA 2YNHA 4WP8A 5KFZA 1S1UA 4F3MA 2C22A 2A2CA 3QGHA 4Q8FA 2ACYA 1NKCA 3KK1B 3QIPB 2CYYA 1SIWA 3I0RA 1TAQA 1IWGA 1MWQA 1RT3B 3EYZA 2FZKB 1CBKA 4IOAQ 2IC3A 2DO0A 2EEYA 2Q6CA 3EE3A 2XTCA 1WG4A 3AHPA 2D9PA 1H2TZ 4ECWA 4HLBA 4ECVA 1TMJA 3CPWR 1PC4A 2KVIA 3KTQA 2UV8G 4PR6A 3LGNA 4DV0F 5IFMA 1KRPA 2DIUA 3QGPA 4DCOB 4FS2A 1A7GE 3DLGA 1KQGB 2C42A 3GFXA 1RKJA 5IS2A 4PUOA 3NBPB 3MHYA 1LNQA 3MPVA 4FKXA 3VAIA 4YEAA 2RILA 3I82A 1UP1A 1GTEA 2R8KA 4C3LA 3PR4A 2BJEA 2OMOA 3TO8A 3HFZB 2YKPA 4N5SA 4OLOA 5KFGA 3VF0B 3UDLA 9RUBA 4OYXA 1N36J 1S72S 3TX8A 4MK9A 4QIGA 2F3JA 4ZPWR 2CNNB 1FNXH 3AX2A 2R2RA 4EK2A 1MYLA 3NP5A 1V3SA 1TKTB 3ZZZA 4UY8T 1FKAF 5HROA 1S6OA 5H9FJ 4DFMA 3AX3A 5BR8J 1GMWD 1XWLA 2HNYA 4IQMA 5DDOC 1ZM4A 4UT4A 4H4KA 2VPWB 2Z8QA 4LBIA 2IJRA 2PMHA 2CPFA 3EDQB 2J0QD 4PQAA 3MCNA 3BV8A 4JUZA 3FKBA 3PRBA 3B6BA 1UVIA 3QATA 3PNIA 4BDPA 3FSIA 1RWKB 1HMVA 3A4TA 3LAKA 3QNWB 3A13A 4QZVB 2CZ9A 5FIIA 1U1OA 5KFUA 2E1RA 2YPZA 5J1PA 3U27A 4FVMA 2PDAA 4LSLB 4RKUC 5K8OA 1SUQB 3BYRA 1G2EA 3SEOA 1UA0A 5J2MB 5DLFA 2D3O1 1H73A 2EI5A 5GAHI 5KT7A 2R7TA 2FLPA 3R2CJ 3HSZA 1UA1A 2LDYA 3OFGA 1XMQF 3V4IA 2XEXA 8ATCB 5AE1A 1Q7LB 1T03A 4HVZA 4N56A 1V6HA 3J7Z5 3LWLA 3PHTA 3RBZA 3GSIA 4JOUA 2L41A 3PX0A 1VQOS 4TKTA 1LXJA 4OQJA 2MTLA 2ZC3A 4FN5A 3H90A 4WPAA 2AYGA 1REGX 2J6SA 3HLUA 4A8QA 4QWDA 2AX0A 4CLKA 1C4AA 2CPEA 4ANDA 1TKXA 4ECSA 2CQ3A 3BH6B 1PYOB 2QRRA 1QUVA 3JB9k 2W9CA 1OSCA 4KY3A 4W4MA 1EJ7L 1VR6A 1YBTA 2MQNA 4M8LA 1AFJA 5C5JA 2AN7A 2IRYA 4QWBA 1AW0A 4NZ0A 2GFFA 2QL5B 1B70B 2PGCA 2RQ4A 2DHAA 2COLA 1HW8A 3V81B 1WELA 5I3UB 1PG5B 1TMMA 5HJYA 1NSPA 3PACA 2W4CA 5E5NA 5K9FA 4U7CA 4MIBA 2NZ4A 1P1TA 3W5XA 4DPOA 2RDDA 1VBXA 3R27A 4O4GA 1F5BA 3G4SS 6FDRA 4B9SA 4LFAJ 1T3OA 4F50A 1FRIA 1TFWA 1Y11A 1F9FA 2ZE2A 3RRGA 3PFEA 2BJ8A 2OAUA 3DDKA 3CC7S 1SC4B 3DRPB 4LVNP 3M8QB 2VG7B 3W2WB 1NB7A 3W66A 4RW7A 3T1YF 5BYQA 1VQ9S 1I6JA 1LWCB 5DO2A 4UZCA 3HPOA 4LF5F 1KHWA 1X0PA 2DNZA 4HEA9 3J7YU 3RAXA 3KJVA 1FT8A 3G6VA 4DR1J 2OGUA 2V68A 2QMXA 3W65A 3T41A 4K0KF 2IMOA 5L9XA 3EZOA 3MPYA 1XBWA 4JI8F 2N82B 5GMDA 4IOBA 3M8WA 2YY3A 4DSIA 2YNHB 4ZP7A 4K4SA 2GIQA 3ZNUA 4Y2AA 3KG4A 1JJ2R 1RXOB 1QE1B 3I0RB 1HBUA 3N01A 2G2YA 1KR4A 1JLQB 3IFEA 3MI7X 3EICA 3ZZ0A 2XHCA 4C8MA 3CCRS 2UVVA 1G4CA 2FD2A 3BS9A 4U95A 3U1LA 3M30B 1UKUA 3CE8A 3THPA 3N9UC 5B0DA 1IKWA 1R31A 3FBBA 3KNAA 1R0CB 1JJCB 1CPZA 4RZRA 4PPDA 1FXRA 1EETB 4NLDA 5KFMA 4A8WA 2J0XA 4K4WA 4OI2A 1LWFA 3DLGB 2XZDB 2VH7A 2CPHA 2HZAA 2M52A 2BR0A 3GV8B 4PUOB 4RR5A 1U0HA 1YDLA 1Q8KA 2MKHA 3CD0A 1FJGF 1TKZB 4MK7A 4UOFA 1U47A 2EW9A 3ZO7A 4M94A 1U48A 3PCOB 2NREA 2PEBA 1URRA 3CMQA 3CO0P 1PJ5A 3S01A 4GKKJ 3OLBA 4ZKAA 2GQQA 2F9DA 4M5KA 3BO4A 3GILA 1MNTA 2HHTA 3ISND 2LEAA 2CJKA 3MMCA 5HJXA 4DV5J 3TRGA 3D66A 1TELA 2DNHA 2E9TA 4BC7A 4LRDA 3PIPQ 5LSOA 2ZVSA 2XY7A 3I32A 3UQSA 1ARRA 1EAYC 4NZ6A 1Q0NA 1VQSA 4WZQA 4K4TA 3PVXA 2G2ZA 2K3KA 1RAHB 1CG2A 1T8EA 3M05A 4LIRA 4LBHA 3G87A 2LQ8A 3LW5C 4DFJA 2ZH1A 4B3RJ 3OFEA 2F8EX 1WOOA 2FPHX 1HMVB 2DO4A 3C6UB 2NXUA 4RBVA 3WZ0A 3BSAA 3LH2S 1NJWA 1HLWA 2A2DA 2PC6A 1X31C 5F8IA 3GYGA 3J80U 4PYDA 4DV4J 1S4FA 3D54A 3V4IB 3DLEB 3K5LA 1S49A 4NI2A 1Q5VA 2VF3A 1WEZA 3B4MA 4Y0FA 1GX6A 2V34A 3LOUA 2ZH2A 3C6TB 4DQSA 4U8YA 3FZ2A 3ULHA 4B3SJ 3PM9A 1UL3A 2UUTA 2AD9A 3BN4A 5IT4A 3QAUA 1FE4A 4FBUA 3BB5A 1NEEA 2XHWA 1YI2S 1GX5A 1ZH5A 4JYAF 3KFWX 3IA0A 4O23A 5B0GA 3DOMB 1KEKA 2HVHA 3MR7A 4K4YA 4BWJA 2C2EA 2ZC4A 3TZYA 2ZBCA 5A76A 1BAZA 1KDNA 1XQIA 1SJQA 2JJ4D 3N5BA 4NA3A 1NJXA 3H5UA 4PEOA 3T5LA 3KNGA 2ZDPA 3ENAA 1RAAB 4EGLA 1F5CA 3AD7C 4ITSA 4ELTA 5G4DA 4C6AA 2NQPA 1IWAA
chains in the Genus database with same CATH topology
3N6NA 3C8YA 4MTPA 3H4BA 3RW6A 1DLOB 1S1VB 3OFHA 1JLGB 1Y9OA 3KLIB 1U6BA 3DRXA 1DAXA 1SXLA 2X1AA 3GV5B 2V9WA 5DQGA 3EZUA 3TOQA 2RS2A 1OQ6A 2Q6BA 4WTYA 2ZH7A 4XDCA 5T7LA 3V6KA 2HHSA 2CZ4A 1ZBTA 3MMBA 5D8HB 2GJ2A 4B9TA 3KLFA 3VAJA 3JYTB 1OG7A 2I0XA 3Q8PB 4F02A 1FERA 1REVA 4DG1B 6FD1A 2DT9A 4BCAA 3KK1A 3QIPA 1GH8A 1LK5A 2ZE2B 1LKZA 3QYYA 2JRSA 1N5VA 1E6YB 1PC5A 2C3YA 4NWBA 1VOMA 3M32B 3TQ1A 2XMKA 3VZHA 5KFNA 2KM8B 1BD6A 1RT3A 5D77A 4ELVA 2YX1A 3FEZA 5GAEI 3M8SA 3OLAA 4FP9A 2BDPA 2GNKA 4C11A 2ASJA 3UDCA 1PILA 2VBWA 1VIOA 3VTIA 1QLNA 1Y7PA 1LQ9A 3LUYA 2IRUA 3MOJB 1KLMB 4TNOA 3I31A 3UD3P 1GXTA 4Y2IA 2FGCA 3CJ0A 2CDQA 1WHWA 4KC5A 3FNNA 5B08A 1K9MT 1U2RA 2JBVA 1IJFB 4WZMA 1X9WA 1KONA 2JC1A 1R8CA 5BYSA 1GQEA 2ILZA 1WWHA 2ZH8A 1ZPVA 4YOEA 2J0SD 4LJMA 2Z4PA 1RKIA 2BUNA 2M8HA 2MY7A 1S97A 3OL8A 3OL9A 1SL2A 3QLHA 2P9CA 4OV1A 3TUJC 5F3ZA 2QE5A 4ZLPA 3IAS9 4YR0A 3TI0A 2GW8A 2ROPA 4I1TA 3KK3A 1J2VA 4G1PA 3M6VA 3KJVB 4B9LA 1YJWS 4Y2MA 4I2QB 2W24A 2ERRA 1W2BR 2XS5A 4AE5A 4TU7A 3NBPA 4FNIA 1OWXA 4B02A 2MJNA 3GR0A 2PE8A 1K1QA 1Q8BA 2WHOA 5E3RA 2ZD1B 2EWHA 2NUHA 4MH8A 4QJVA 2L08A 3KLEA 4NLVA 2HGNA 2BQUA 1H38A 3J80Y 3H5YA 3RR7A 2GGPA 3KMQA 3HO1A 5KG6A 1RA7A 1DFDA 4I69A 2KJWA 2ZHOA 1XMBA 2A18A 2ZBIA 3G71S 1X4CA 2BA9A 4KR0B 1T02A 1RK8A 5CQGA 2FJDB 3CSKA 2FY1A 2WK4A 2LU1A 4CH7A 5L9NA 2KB2A 1N54B 2YNFA 4IFYA 3G96A 2J7WA 2CQIA 1HI0P 3RW7A 3HK2A 4ZP9