4LQEA

Crystal structure of mepb
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
149
structure length
148
Chain Sequence
MYKSKILLKYIFSEESEVKDLTEEKYNQDYEALTFSFKEETYQSRLAKKTPTKAGYFVTCWTKDENNCNQPYSKEAFADYLMIIVIDEELSGYFLFPRELLVEKGILTTFEHKGKMAFRVYPKWNQLNKTAGQTQKWQCKYFLNTNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of MepB from Staphylococcus aureus reveals homology to endonucleases.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
molecule keywords MepB
total genus 34
structure length 148
sequence length 149
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08877 MepB MepB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1350.140 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 4lqeA00
4LQEA
chains in the Genus database with same CATH superfamily
2OSTA 2CV8A 3P1YA 2VS1A 2FCOA 2WCWA 3FOVA 3P1ZB 4DA2A 4QBOA 2INBA 2WJ0A 1RZNA 2FKCA 1R0VA 2Z0RA 2FLCA 4ZQUA 4DAPA 1HH1A 3BT7A 2WCZA 1OB9A 4DAVA 3DNXA 2VLDA 2CZRA 5FDKA 2OKFA 2GW6A 4QBNA 3IEYA 2DBSA 1RLVA 4LQEA 1ZP7A 1GEFA 4TKDA 1F1ZA 2W8MA 1UWVA 4QBLA 2GJWA 1IPIA 1YNMA 1Y88A 3IF0X 4TKKA 1T0FA 3IEYB 1Y1OA 1A79A 2FL3A 3AJVA 2IXSA 1OB8A 1R11A 2FKHB 2ZYZB 2BH2A 3P1ZA 4E6ZA 2JJQA 4G6UA 2ZYZA 4EV1A 2WIWA 2WIZA 4G6VA 1XMXA 2EO0A 3AJVB
chains in the Genus database with same CATH topology
2OSTA 2CV8A 3P1YA 2VS1A 2FCOA 2WCWA 3FOVA 3P1ZB 4DA2A 4QBOA 2INBA 2WJ0A 1RZNA 2FKCA 1R0VA 2Z0RA 2FLCA 4ZQUA 4DAPA 1HH1A 3BT7A 2WCZA 1OB9A 4DAVA 3DNXA 2VLDA 2CZRA 5FDKA 2OKFA 2GW6A 4QBNA 3IEYA 2DBSA 1RLVA 4LQEA 1ZP7A 1GEFA 4TKDA 1F1ZA 2W8MA 1UWVA 4QBLA 2GJWA 1IPIA 1YNMA 1Y88A 3IF0X 4TKKA 1T0FA 3IEYB 1Y1OA 1A79A 2FL3A 3AJVA 2IXSA 1OB8A 1R11A 2FKHB 2ZYZB 2BH2A 3P1ZA 4E6ZA 2JJQA 4G6UA 2ZYZA 4EV1A 2WIWA 2WIZA 4G6VA 1XMXA 2EO0A 3AJVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LQE A; 
#chains in the Genus database with same CATH topology
 2OST A;  2CV8 A;  3P1Y A;  2VS1 A;  2FCO A;  2WCW A;  3FOV A;  3P1Z B;  4DA2 A;  4QBO A;  2INB A;  2WJ0 A;  1RZN A;  2FKC A;  1R0V A;  2Z0R A;  2FLC A;  4ZQU A;  4DAP A;  1HH1 A;  3BT7 A;  2WCZ A;  1OB9 A;  4DAV A;  3DNX A;  2VLD A;  2CZR A;  5FDK A;  2OKF A;  2GW6 A;  4QBN A;  3IEY A;  2DBS A;  1RLV A;  4LQE A;  1ZP7 A;  1GEF A;  4TKD A;  1F1Z A;  2W8M A;  1UWV A;  4QBL A;  2GJW A;  1IPI A;  1YNM A;  1Y88 A;  3IF0 X;  4TKK A;  1T0F A;  3IEY B;  1Y1O A;  1A79 A;  2FL3 A;  3AJV A;  2IXS A;  1OB8 A;  1R11 A;  2FKH B;  2ZYZ B;  2BH2 A;  3P1Z A;  4E6Z A;  2JJQ A;  4G6U A;  2ZYZ A;  4EV1 A;  2WIW A;  2WIZ A;  4G6V A;  1XMX A;  2EO0 A;  3AJV B; 
#chains in the Genus database with same CATH homology
 2OST A;  2CV8 A;  3P1Y A;  2VS1 A;  2FCO A;  2WCW A;  3FOV A;  3P1Z B;  4DA2 A;  4QBO A;  2INB A;  2WJ0 A;  1RZN A;  2FKC A;  1R0V A;  2Z0R A;  2FLC A;  4ZQU A;  4DAP A;  1HH1 A;  3BT7 A;  2WCZ A;  1OB9 A;  4DAV A;  3DNX A;  2VLD A;  2CZR A;  5FDK A;  2OKF A;  2GW6 A;  4QBN A;  3IEY A;  2DBS A;  1RLV A;  4LQE A;  1ZP7 A;  1GEF A;  4TKD A;  1F1Z A;  2W8M A;  1UWV A;  4QBL A;  2GJW A;  1IPI A;  1YNM A;  1Y88 A;  3IF0 X;  4TKK A;  1T0F A;  3IEY B;  1Y1O A;  1A79 A;  2FL3 A;  3AJV A;  2IXS A;  1OB8 A;  1R11 A;  2FKH B;  2ZYZ B;  2BH2 A;  3P1Z A;  4E6Z A;  2JJQ A;  4G6U A;  2ZYZ A;  4EV1 A;  2WIW A;  2WIZ A;  4G6V A;  1XMX A;  2EO0 A;  3AJV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...