4LQSB

Crystal structure of the cbk1-mob2 kinase-coactivator complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
168
structure length
156
Chain Sequence
KTIVQLPKYVDLGEWIALNVFEFFTNLNQFYGVVAEYVHTDYLWLDANNRQVSLPASQYIDLALTWINNKVNDKNLFPTKNGLPFPQQFSRDVQRIMVQMFRIFAHIYHHHFDKIVHLSLEAHWNSFFSHFISFAKEFKIIDRKEMAPLLPLIESF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase CBK1
publication title The Structure of an NDR/LATS Kinase-Mob Complex Reveals a Novel Kinase-Coactivator System and Substrate Docking Mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transferase activator
total genus 33
structure length 156
sequence length 168
ec nomenclature
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03637 Mob1_phocein Mob1/phocein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.30 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 MOB kinase activator 4lqsB00
4J1VA 1PI1A 4JIZA 4LQSB 1R3BA 4LQQB 5BRKA 5B5WA 2HJNA 5B5VA 5BRMA 5B6BA
chains in the Genus database with same CATH superfamily
2R03A 2OEXA 4KSFA 2YYIA 1K90A 2CJ4A 3SF6A 4AI6A 1Y8OA 4AKHA 1XFUA 2R02A 3VKGA 3CRLA 5BRMA 2Q8GA 4MPCA 4Q5BA 4Q0TA 3GM6A 2E0AA 3D1IA 4HKRA 4Q17A 4MP2A 2WBIA 3BNFA 2LFWA 1EGDA 2DDHA 3TZ4A 2VF1A 3N0RA 2YGWA 3LG1A 3TZ5A 1EGEA 3D9FA 4V25A 3NF4A 4P79A 2EC5A 4L38A 4P13A 1R3BA 2BU5A 1EGCA 4F0XA 5M4MA 1W07A 2Q8IA 1RJ4A 1PK0A 2VIGA 2PNRA 4ZXVA 3VKHA 1WS9A 4KSAA 1K93A 1R2JA 1XFVA 4HKSA 2C0UA 2FP1A 3D9GA 3GNCA 2PO4A 4L1FA 3TTBA 3UU9A 4E00A 3D2RA 3X0YA 2RDZA 5B5WA 4H85A 4HR3A 4Q5CA 3TORA 2QR4A 4Q1OA 1XFWA 4L3XA 5GJVE 3Q24A 3C46A 1PI1A 4X28C 3TZ2A 4O5MA 2JBSA 4JEKA 2YYKA 4W9UA 2JBTA 2OEVA 3FCJA 2CJ8A 4RM7A 4FF3A 3B96A 2R05A 4MPEA 3X29A 3MDDA 1T9GA 2YYMA 2BU8A 3II9A 2XS8A 3L1TA 2Q8FA 4FF4A 4KCFA 1S26A 1SIRA 1UKWA 2EBFX 5J6AA 1X90A 1RP3A 4JIZA 5M4NA 1QDBA 4MPNA 4OO2A 2FP2A 3MDEA 4LQQB 2UXWA 2ZO5A 3OIBA 2OT4A 3S7WA 1U8VA 1SK6A 1Y0VA 2ZKJA 1IS2A 2CJ6A 3MKHA 3R7KA 3RKHA 5M4PA 3BNGA 3HWCA 4ZYJA 2YYJA 2YYLA 4WJYA 2RF7A 3D6BA 5GJWE 3SWOA 4E01A 4L3YA 5B6BA 2JIFA 3F29A 2Q8HA 2IX6A 4FF2A 5K3JA 2IX5A 3OWMA 1FS8A 3CRKA 2JBRA 2PG0A 3MXLA 3EOMA 4XVXA 4IRNA 4E02A 4N5FA 1OAHA 4AKGA 2ZDXA 1X8ZA 3UBRA 2YYGA 5K3GA 5K3HA 2E81A 3TZ0A 4DZYA 2OR0A 3Q0AA 1JQIA 1XFYA 3D9EA 3P4TA 3OWAA 5B5VA 4U83A 3C3LA 1GJVA 4G97A 4NXLA 2J7AA 4M9AA 3AFFA 5J71A 3EONA 2BU7A 3FO3A 4AKIA 2HJNA 3MPJA 3BNJA 1UDYA 3C2PA 2A1TA 2REHA 2ZDYA 4J1VA 1RX0A 3D9DA 2Z1QA 2OJQA 1IVHA 1RJ1A 1K8TA 2XS1A 4QICA 4L3ZA 2E80A 5M4KA 2R0MA 2BU6A 1FS7A 4MP7A 3MPIA 2BU2A 1XFZA 2C12A 1JM6A 4H81A 2CX9A 3X0XA 1SC5A 2R0NA 5BRKA 3SCEA 3SXQA 2EBAA 4H7QA 2FONA 4FF1A 3PFDA 4Q4UA 1BUCA 3BNHA 3LGQA 1XG2B 2AO2A 2F6LA 4KS9A 2CJ5A 3Q22A 1GU6A 4V26A 5K3IA 2BTZA 3KMLA 3CE2A 3MMOA 3GQTA 1Y8NA 2RFQA 2GBBA 1LVCA 4G5EA 2EBHX 1GKXA 4FZ4A 4X28A 2VR0A 4IV6A 3VADA 4LQSB 3M9VA 3Q23A 1GKZA 1SIQA 1X91A 1XFXA 1FS9A 1Y8PA 2D29A 2DVLA 2XQRB 2AZEA 2ZAFA 2CJ7A 3AFEA 4KTOA 4DOYA 4JIOA
chains in the Genus database with same CATH topology
4J1VA 1PI1A 4JIZA 4LQSB 1R3BA 4LQQB 5BRKA 5B5WA 2HJNA 5B5VA 5BRMA 5B6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J1V A;  1PI1 A;  4JIZ A;  4LQS B;  1R3B A;  4LQQ B;  5BRK A;  5B5W A;  2HJN A;  5B5V A;  5BRM A;  5B6B A; 
#chains in the Genus database with same CATH topology
 2R03 A;  2OEX A;  4KSF A;  2YYI A;  1K90 A;  2CJ4 A;  3SF6 A;  4AI6 A;  1Y8O A;  4AKH A;  1XFU A;  2R02 A;  3VKG A;  3CRL A;  5BRM A;  2Q8G A;  4MPC A;  4Q5B A;  4Q0T A;  3GM6 A;  2E0A A;  3D1I A;  4HKR A;  4Q17 A;  4MP2 A;  2WBI A;  3BNF A;  2LFW A;  1EGD A;  2DDH A;  3TZ4 A;  2VF1 A;  3N0R A;  2YGW A;  3LG1 A;  3TZ5 A;  1EGE A;  3D9F A;  4V25 A;  3NF4 A;  4P79 A;  2EC5 A;  4L38 A;  4P13 A;  1R3B A;  2BU5 A;  1EGC A;  4F0X A;  5M4M A;  1W07 A;  2Q8I A;  1RJ4 A;  1PK0 A;  2VIG A;  2PNR A;  4ZXV A;  3VKH A;  1WS9 A;  4KSA A;  1K93 A;  1R2J A;  1XFV A;  4HKS A;  2C0U A;  2FP1 A;  3D9G A;  3GNC A;  2PO4 A;  4L1F A;  3TTB A;  3UU9 A;  4E00 A;  3D2R A;  3X0Y A;  2RDZ A;  5B5W A;  4H85 A;  4HR3 A;  4Q5C A;  3TOR A;  2QR4 A;  4Q1O A;  1XFW A;  4L3X A;  5GJV E;  3Q24 A;  3C46 A;  1PI1 A;  4X28 C;  3TZ2 A;  4O5M A;  2JBS A;  4JEK A;  2YYK A;  4W9U A;  2JBT A;  2OEV A;  3FCJ A;  2CJ8 A;  4RM7 A;  4FF3 A;  3B96 A;  2R05 A;  4MPE A;  3X29 A;  3MDD A;  1T9G A;  2YYM A;  2BU8 A;  3II9 A;  2XS8 A;  3L1T A;  2Q8F A;  4FF4 A;  4KCF A;  1S26 A;  1SIR A;  1UKW A;  2EBF X;  5J6A A;  1X90 A;  1RP3 A;  4JIZ A;  5M4N A;  1QDB A;  4MPN A;  4OO2 A;  2FP2 A;  3MDE A;  4LQQ B;  2UXW A;  2ZO5 A;  3OIB A;  2OT4 A;  3S7W A;  1U8V A;  1SK6 A;  1Y0V A;  2ZKJ A;  1IS2 A;  2CJ6 A;  3MKH A;  3R7K A;  3RKH A;  5M4P A;  3BNG A;  3HWC A;  4ZYJ A;  2YYJ A;  2YYL A;  4WJY A;  2RF7 A;  3D6B A;  5GJW E;  3SWO A;  4E01 A;  4L3Y A;  5B6B A;  2JIF A;  3F29 A;  2Q8H A;  2IX6 A;  4FF2 A;  5K3J A;  2IX5 A;  3OWM A;  1FS8 A;  3CRK A;  2JBR A;  2PG0 A;  3MXL A;  3EOM A;  4XVX A;  4IRN A;  4E02 A;  4N5F A;  1OAH A;  4AKG A;  2ZDX A;  1X8Z A;  3UBR A;  2YYG A;  5K3G A;  5K3H A;  2E81 A;  3TZ0 A;  4DZY A;  2OR0 A;  3Q0A A;  1JQI A;  1XFY A;  3D9E A;  3P4T A;  3OWA A;  5B5V A;  4U83 A;  3C3L A;  1GJV A;  4G97 A;  4NXL A;  2J7A A;  4M9A A;  3AFF A;  5J71 A;  3EON A;  2BU7 A;  3FO3 A;  4AKI A;  2HJN A;  3MPJ A;  3BNJ A;  1UDY A;  3C2P A;  2A1T A;  2REH A;  2ZDY A;  4J1V A;  1RX0 A;  3D9D A;  2Z1Q A;  2OJQ A;  1IVH A;  1RJ1 A;  1K8T A;  2XS1 A;  4QIC A;  4L3Z A;  2E80 A;  5M4K A;  2R0M A;  2BU6 A;  1FS7 A;  4MP7 A;  3MPI A;  2BU2 A;  1XFZ A;  2C12 A;  1JM6 A;  4H81 A;  2CX9 A;  3X0X A;  1SC5 A;  2R0N A;  5BRK A;  3SCE A;  3SXQ A;  2EBA A;  4H7Q A;  2FON A;  4FF1 A;  3PFD A;  4Q4U A;  1BUC A;  3BNH A;  3LGQ A;  1XG2 B;  2AO2 A;  2F6L A;  4KS9 A;  2CJ5 A;  3Q22 A;  1GU6 A;  4V26 A;  5K3I A;  2BTZ A;  3KML A;  3CE2 A;  3MMO A;  3GQT A;  1Y8N A;  2RFQ A;  2GBB A;  1LVC A;  4G5E A;  2EBH X;  1GKX A;  4FZ4 A;  4X28 A;  2VR0 A;  4IV6 A;  3VAD A;  4LQS B;  3M9V A;  3Q23 A;  1GKZ A;  1SIQ A;  1X91 A;  1XFX A;  1FS9 A;  1Y8P A;  2D29 A;  2DVL A;  2XQR B;  2AZE A;  2ZAF A;  2CJ7 A;  3AFE A;  4KTO A;  4DOY A;  4JIO A; 
#chains in the Genus database with same CATH homology
 4J1V A;  1PI1 A;  4JIZ A;  4LQS B;  1R3B A;  4LQQ B;  5BRK A;  5B5W A;  2HJN A;  5B5V A;  5BRM A;  5B6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...