4LQZA

Crystal structure of a duf4909 family protein (sav1798) from staphylococcus aureus subsp. aureus mu50 at 1.92 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
131
structure length
131
Chain Sequence
b'ENLYFQGQRFEIQQHNETIGSIYFSADYAHIRGIEKGTAKYFIDKVGSKRYLFIEYIPDNVLNCKPDFWKTLKYKKDKVTYYVYLIENLDDEVFHLSALQDMNRIPIDIADDVATMGKSPHQNDRMTLKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (SAV1798) from Staphylococcus aureus subsp. aureus Mu50 at 1.92 A resolution
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
total genus 26
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16253 DUF4909 Domain of unknown function (DUF4909)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.570 Mainly Beta Beta Barrel Lipocalin Lipocalin 4lqzA00
4LQZA
chains in the Genus database with same CATH superfamily
1I9HA 2GJ5A 3DSZA 2RN4A 1LF7A 1VWNB 3P6FA 1D3SA 1MX8A 3WVMA 3WJGA 1KGLA 1Y55X 3NPOA 3NP1A 1OBUA 2ACPX 1HXZA 1ALBA 1SRJA 3EBWA 3EM0A 5H8TA 2OVSA 4PSQA 2R73A 3TGCA 1JJXA 1SWJA 5F7GA 3VG7A 3WJCA 1JZUA 4HWMA 1A18A 1VWBB 1HBPA 1Y52X 1ZNEA 5HA0A 1OEKA 4U8UO 3X00A 2FHLA 1SWAA 2OF8A 2OVEA 3FW4A 5AQ6A 5EZ2A 4CPHA 1LDOA 2A5BA 3EMMA 1PBOA 3FDCA 4YVBA 2CAMA 1NDJA 2N93A 3D96A 3FA7A 1XKIA 2EU7X 4OELA 4ZCBA 4QAEA 2ANSA 4ON1A 5HZ6A 4YCEA 4BJ8A 5LJEA 1IW2A 5FAZA 2WPUA 1SWNA 4LZVA 2CZUA 3WJEA 3PQSA 1ML7A 3KFFA 1HMRA 3P24A 1N4JA 5LKFA 1STPA 2HKDA 1U0XA 3SZJA 2K23A 3PDFA 4K19A 1CJ5A 4QGVA 1VYFA 4QGWA 2JMBA 1D2UA 2X56A 3JS1A 4TJZA 1SY2A 3PEDA 1JV4A 2E4JA 4YH0A 3WZNA 4GDAA 1FDQA 2RA6A 1PBYA 2R56A 3V8UA 4CSBA 2L9CA 1FEMA 1EI5A 1XCAA 2FWVA 4JGLA 3KFHA 5HCEC 2RTKA 3RDSA 4UU3A 4BX7A 4MVIA 4KC7A 3E3CA 3FA8A 4U8UM 3D95A 1DZPA 4BQUA 2BS6A 5HZ9A 1S44A 3L4RA 3CBCA 1O1VA 4IB8A 1EUOA 1SRFA 1SWCA 3VHHA 1LUQA 4CPIA 2FKJA 1QY1A 1I05A 4ZJ0A 2OL8O 1R0UA 1K3BA 2RCTA 2IZCB 3CWKA 1OPAA 4FBVA 4WFVA 4ZGUA 3LTWA 4A8ZA 4OMWA 2KW1A 1QG5A 2OY7A 3P6HA 1PEEA 4CDCA 5HWZA 1PTSA 1W5RA 1QFTA 3OD9A 1Y9TA 5HAEA 2OF9A 3S5VA 1ACDA 4IB7A 1MM9A 4U9CA 5BYPA 4GRJA 2G78A 4IAXA 1E2TA 1PM1X 2NNQA 2ASNX 1G74A 1T0VA 4YGHA 3PQUA 4Z6JA 3PH6A 4JNJA 3WXQA 2NNDA 1UREA 2KT4B 4KCAA 2F73A 3P6DA 1K24A 5D48A 4IABA 2A2GA 3GAQA 4Y0SA 5B29A 1N43A 2IZLB 1GT5A 1VWHB 1N9YA 2W2FA 5EDCA 3IFBA 5B5GA 2WWPA 5F2BA 2OYBO 5LJKA 1BLRA 1H91A 4GH7A 1NBXA 2JGSA 2JU3A 2X32A 4QZTA 4AZRA 5H9KA 1SRGA 2I5VO 4O4SA 1QY2A 3APWA 4GNWA 2Q39A 4I3BA 3EYCA 2HNXA 1QY0A 1BSOA 2NNEA 3PH5A 4QZUA 5EPQA 3RDXA 3TGBA 1AELA 1SWQA 1YP6A 2BS5A 1X71A 1ZNHA 3FENA 3WBGA 1EIOA 1B56A 1FTPA 3MG5A 3F9DA 2O62A 3RY1A 2ZAGA 1X8PA 5C0NA 1T8VA 2FS6A 2VFBA 2PI3O 3S60A 3BX7A 5LJHA 3ZQ3A 1X8NA 2X45A 3U0DA 1W4TA 2X55A 3P6GA 1N0SA 2A0AA 4ORXA 1RXHA 3WYPA 1G7NA 1A2DA 5KIDA 4HPDA 2FLJA 4WBKA 3OE3A 3HWGA 4I3CA 3P6CA 2L67A 3BLGA 2Z4IA 4O3YA 2QO6A 4AZMA 2RQ0A 4WHIA 4YFPA 1TW4A 3ZUOA 2Y3FA 1SXYA 1NQNA 1GXAA 1MVGA 2JN3A 1VWPB 4XMFA 1SWPA 2RTAA 3HWFA 3NQ9A 1NC9A 4Z28A 4MIRA 5DG4A 1VWJB 2RTPB 3APVA 3ELZA 5LJCA 2WQAE 1EPAA 4GNYA 4QYPA 3RDUA 5D47A 1ERXA 2X34A 3B2LA 5CYBA 4Z27A 1VPRA 2MJIA 4EXZA 4MEEA 3HK1A 1EW3A 4NV7A 2K62A 4DQ4A 4IB9A 3O22A 4LQZA 1LCVA 1DV9A 2AL0X 2LB6A 4BGFA 5L8OA 2JU8A 3NX1A 4HPAA 2GC9A 3EW1A 1SWKA 2A3FX 3VHMA 1JIWI 5BVSA 2OFMX 4AZNA 4ZHHA 2JW1A 3I0AA 1DZMA 3DTQA 3P02A 3STKA 1U17A 5H9AA 1HBQA 1LIEA 1GT1A 2Q9SA 2PY1A 1X8OA 4XMHA 1GM6A 1GT3A 2IFBA 2ACOA 1VYOA 2NP1A 2X8FA 3B2HA 1LNMA 1SXWA 4NW4A 5IO6A 3FLLA 4YFQA 1ICNA 4ZH6A 1LFOA 5H9NA 3JSQA 2GTFX 4I95A 1STRB 1JMZA 2FS7A 1B4MA 1KL4A 3RY2A 2XKLA 5DPQA 1QFVA 3ZW2A 4GGRA 1IKEA 4O9SA 4BX6B 1VWIB 5JD2A 3HPEA 2L68A 3VG6A 2X46A 4ZHCA 2ZAIA 1HQPA 1GKAB 3RE6A 4QNIA 1LIBA 1UZ2X 1TOUA 3FIDA 3FMZA 3C77X 4NLJA 4O4XA 4OEMA 2CZTA 4CDDA 4Z2OA 3NQ3A 4YDAA 3BY0A 5F6ZA 2FR3A 4QYNA 1SY1A 2RD7C 1AB0A 4L3RA 2VFCA 4TKJA 5L8NA 1JJJA 2C1SA 2AT0X 1VWRB 4ORYA 5IRWA 2LA7A 4AZQA 2CBRA 1OBQA 1MUPA 2C4IA 3NBXX 3STNA 1CRBA 1RAVA 4OMXA 4FQBB 4NNTA 5HA1A 1VWAB 2IZKA 4ML7B 2RTHB 1O8VA 2BHVA 2RTJA 4BCSA 5K06A 1JQPA 2AT3X 2G5LA 3BSZE 1NQMA 5HZ5A 2WEWA 4ORSA 3D97A 4I60A 4RUNA 3KVNA 2ALLX 3T6LA 1SLFB 1T68X 1JYJA 2MF6A 4Y0QA 5B3MO 2VDFA 1TOWA 3WZOA 2CM9A 1P6PA 2RTOB 2FKGA 5F58A 2AKQA 2C1QA 3NQKA 1EQDA 1EIIA 1ZNLA 3U9PC 2M4LA 1GX9A 1RBPA 2RTRB 4ZHGA 5JR8A 4MVKA 1KFFA 1HQQA 1QABE 2W2BA 3SLJA 1Y9LA 2P8GA 2POAA 3F8AA 3FA6A 3HWDA 4Y59A 4MISA 1OBPA 2XSTA 3SZIA 5F1EA 3QKGA 4O3WA 2Q4NA 3JQOA 4ZHDA 1ZNKA 1SWOA 3CKFA 2Y3EA 3WJFA 2YMSA 4BX6A 2QO5A 2A8GA 2OFAA 2QOMA 3UAQA 4YFRA 3GE2A 2W2AA 3FA9A 2Q2PA 4GKCA 1SXXA 3ELXA 4YCHA 1VWMB 3B2IA 3BRNA 3IA8A 4QQ1A 1LCWA 1DZKA 1GX8A 2HZRA 1BBPA 3NR3A 3PECA 3NX2A 1CBIA 2RTDB 1SRHA 4U46A 2JU7A 3C78X 4Z2VA 4BVMA 4ZGFA 3ZW1B 1JYDA 1L6MA 4M6SA 4N7CA 1LELA 3AEHA 2UYWA 2X4MA 4ZFXA 1DZJA 1FENA 1N7YA 4YKOA 1SY0A 3OJYC 2AT8X 3VG3A 2LBAA 3WJBA 3ZZVA 2FT9A 1IKJA 3RZYA 5B11O 4ALBA 1OEJA 3TGAA 3APXA 1E06A 2RCQA 1KXOA 3MVFA 2OFBA 1LICA 2RTCB 2AF5A 1LIFA 1DFVA 4D6AA 4IAWA 2I5ZO 1KT6A 5FQ8E 4Y0PA 5AEOA 3UEXA 1Y53X 2A5CA 2KTSA 4BX5B 2IZJA 2IZAA 3VG2A 1JMXA 4CV7A 2CBSA 4NYRA 4A1HA 4OS8A 2KTDA 1I78A 1HN2A 1SLEB 2AVIA 3BDRA 4LZUA 4O3XB 1MX7A 4I9RA 1Y0GA 5LJGA 4KIIA 3WZQA 3MM0A 4CK4A 1IFBA 1VYGA 1IIUA 2RTEB 1X8UA 2LFOA 3P6EA 1HMSA 1X89A 4ID2A 4DNEA 4YGGA 1U18A 3FELA 4XMGA 4TKHA 3WJDA 3KQ0A 1GX3A 4Y5DA 2QCBA 4I9SA 1FJ1E 2MO5A 4IRWA 3UEVA 4XMEA 4UU2A 2OZQA 5BVTA 4COTA 4GD9A 4Z2PA 1B0OA 1LDQA 2X8SA 4NV8A 2QOSC 4QRLA 1HXLA 4A60A 1LPJA 1SY3A 1Z24A 3BU9A 1SWFA 3FYFA 4AYHA 4GJVA 1BSQA 3KFIA 5HBSA 1BM5A 1QWDA 2QM9A 1ADLA 1MDCA 1VWDB 1SWLA 3RSWA 2QMIA 2OY1O 3O19A 1YWBA 2IZDB 4TQ2A 4MVEA 4CDEA 1KT3A 1KT7A 3G7XA 1VWGB 4GZVA 4HPCA 4PJ2A 5CHKA 4BBOA 1HY2A 3FR2A 5IRAA 2OL7A 1TVQA 1E5PA 2RTQB 4NNSA 4CPFA 3KFGA 2OFRX 5B2AO 4AZOA 4TLJA 5EDBA 2LKKA 3FIQA 1S7DA 2IZHB 2OVAA 3APUA 3CQRA 4IMOA 5B27A 4ORUA 1JBHA 1OSPO 3K3LA 4XMDA 4EFGA 1BWYA 2RTFB 1DF8A 1B8EA 2RTIB 2AT5X 2MHDA 1BSYA 2GTLM 3FR4A 1RSTB 2MM3A 2X8TA 3AKNA 1ZNDA 2IZEB 2AH7X 3VG4A 3VE2A 2BSZA 4ZR2A 1AQBA 2IZIA 2Y32A 1BEBA 3WZPA 1EPBA 4GJSA 1IFCA 1RXKA 4XMCA 3SOTA 1SWRA 1SRIA 3T6FA 1GT4A 5B10O 1CBSA 1G5WA 4LKPA 4LKTA 5LJDA 3SAOA 2IZBA 2UZ2A 3O2YA 1STSB 3FW5A 3QQ2A 2DJFA 2WEXA 3N91A 2AMMX 4M7MA 3TF6A 3VE1A 1MOYA 3ZI8A 1YWAA 5D45A 4AW8A 1I06A 4GU8A 1SLGB 4WFUA 1ZNGA 2HZQA 2DJGA 1JJUA 1IJ8A 1RXJA 3EW2A 1LIDA 2WSJA 3H3IA 3VPJE 3RBYA 1A57A 1KQXA 1YWDA 4ODDA 1BRQA 2GTLN 3PPTA 4IMNA 4U3QA 5EEEA 3WYQA 5L8IA 2F09A 1YWCA 3MX7A 3LV4A 1SMPI 3EC5A 2A13A 4ORRA 3ZUIA 4ZH9A 3LHNA 4ES7A 3T1DA 5HTEA 2RTLA 1OPBA 1S2PA 4FGIB 2Q2MA 1I04A 5AJBA 4GETA 4YBPA 3SLOA 5FFHA 1VWEB 2L5PA 4OKAA 1VWQB 4O4UA 3RKGA 3FR5A 2WUTA 4NP1A 1UYNX 4I6SA 5AJCA 3HTYA 5EEDA 4R0BA 2LBVA 1YIVA 1KT5A 5BVQA 2GH7A 1SLDB 2FTBA 3F6ZB 4HFOA 1KZWA 4FBOA 2RTMA 5CE4A 3BX8A 5F6BA 5IXGA 1I4UA 3PP6A 3EBKA 4KT5A 1DC9A 1VWLB 4FBRA 2G79A 2FGSA 3AUMO 4KH8A 1KQWA 2BT9A 2F01A 1DF3A 4IB6A 3VU1A 2OY8A 2R74A 5K68A 1GKAA 1KOIA 3PK2A 4I3DA 1CBQA 1MEPA 4CPEA 1AVDA 3S5XA 5KICA 4GUZA 1WUBA 1O1UA 3CQNA 4O4OA 3STMX 5IO5A 3CKGA 1X8QA 3T2WA 1VWKB 2G8CO 3TZSA 1W6FA 5CSEA 1SXUA 2AT6X 3WOVA 3KZAA 3CR6A 3HWEA 1NGLA 4OS3A 1BJ7A 4EQAC 3NADA 2RTNB 1UYOX 2IZGB 3I17A 1RSUB 5LJBA 4RUUA 5FQ6E 3FEKA 1E02A 1NP4A 4ORWA 3BS2A 1SWBA 1YUPA 2OY5O 5L3YA 2A2UA 5D8JA 1SWTA 1OEEA 1EALA 1SREA 1ERBA 5H9LA 3RDQA 4L1NA 1VWFB 2KD2A 1AVEA 4NYQA 1G85A 1N9MA 3AKMA 4BOEA 3ZW1A 4KC8A 1PMPA 4U8UN 1VWOB 4EEJA 5FENA 1SWDA 3ZWEA 2QO4A 3B2JA 2BLGA 4DQ3A 4O3ZA 2WQ9A 1SWEA 3FEPA 3BU1A 4JHQA 4N7DA 3RE5A 5B5FA 4JO6A 4YKMA 1KL3A 1SWGA 2GTLO 2FRSA 5HZQA 3UEUA 3UEWA 4C5PA 3RDOA 4Y0RA 3B2KA 2FHNX 2HLVA 3C76X 3ZW0B 3CBSA 2HMBA 1RLBE 1HMTA 1SA8A 1TXLA 1EXSA 2YG2A 2HYSA 3D9WA 1VWCB 3HOEA 2G7BA 5D4AA 5KHPA 4YMYA 4O49A 1FELA 3U03A 4EDEA 3MBTA 1FE3A 3Q6LA 4AZPA 5K67A 1QQSA 3CMPA 5HZ8A 1SWUA 4MVLA 3SZHA 4CPHB 1KT4A 2CM4A 5IRUA 1SWSA 4GGZA 4DCBA 5HTDA 5HCDC 1A3YA 4IBAA 4HPBA 4D6BA 3D4RA 4CDFA 2WR6A 2OL6O 1LKEA 2JOZA 5LKEA 4OS0A 4ZHFA 4INNA 4QGXA 4B55A 4YDBA 1NP1A 4EKVA 3SLTA 2MWHA 3RWXA 4BX5A 4TNNA 1KL5A 3HOLA 3Q34A 1E00A 4GK9A 4YGZA 2BC3A 3S26A 1CBRA 3VGWA 1BRPA 3VG5A 2DM5A 2ZSCA 2RTBB 4TKBA 4A1YA 5HCCC 1ZRYA 1GGLA 2RTGB 4GE1A 4ALOA 4YBUA 3T2XA 3RDMA 5IO7A 1KZXA 4GGTA 2FR2A 1WBIA 2Z4HA 3VHIA 1LCZA 1ICMA 1YP7A 1SWHA 2OVDA 3OBLA 4BX7B 1AVGI 1MK5A 4GDZA 2IZFB 5FQ7E 4ARHA 3ZW0A 4NLIA
chains in the Genus database with same CATH topology
2GJ5A 3DSZA 2RN4A 1LF7A 3P6FA 1D3SA 1MX8A 3WVMA 3WJGA 1KGLA 3NPOA 3NP1A 1OBUA 2ACPX 1ALBA 3EBWA 3EM0A 5H8TA 2OVSA 4PSQA 2R73A 3TGCA 1JJXA 5F7GA 3VG7A 1JZUA 4HWMA 1A18A 1HBPA 1ZNEA 5HA0A 1OEKA 4U8UO 3FW4A 5EZ2A 2OVEA 5AQ6A 3EMMA 1PBOA 3D96A 2N93A 3FA7A 1XKIA 2EU7X 4ZCBA 4QAEA 2ANSA 4ON1A 5HZ6A 4YCEA 5LJEA 1IW2A 5FAZA 4LZVA 2CZUA 3WJEA 3PQSA 1ML7A 3KFFA 1HMRA 3P24A 5LKFA 1U0XA 2K23A 4K19A 1CJ5A 4QGVA 1VYFA 4QGWA 2JMBA 1D2UA 4TJZA 3JS1A 1SY2A 3PEDA 1JV4A 2E4JA 4YH0A 1FDQA 2RA6A 2R56A 3V8UA 4CSBA 2L9CA 1FEMA 1EI5A 1XCAA 2FWVA 4JGLA 3KFHA 5HCEC 4UU3A 4MVIA 4KC7A 3E3CA 3FA8A 4U8UM 3D95A 1DZPA 4BQUA 2BS6A 5HZ9A 1S44A 3L4RA 3CBCA 1O1VA 4IB8A 1EUOA 1QY1A 1I05A 4ZJ0A 1R0UA 2RCTA 3CWKA 1OPAA 4FBVA 4WFVA 4ZGUA 4A8ZA 4OMWA 2KW1A 1QG5A 3P6HA 1PEEA 5HWZA 1QFTA 3OD9A 1Y9TA 5HAEA 3S5VA 1ACDA 4IB7A 4U9CA 5BYPA 4GRJA 2G78A 4IAXA 1PM1X 2NNQA 2ASNX 1G74A 1T0VA 4YGHA 3PQUA 3PH6A 3WXQA 2NNDA 1UREA 2KT4B 4KCAA 2F73A 3P6DA 5D48A 4IABA 2A2GA 3GAQA 4Y0SA 5B29A 2W2FA 1GT5A 5EDCA 3IFBA 2WWPA 1BLRA 5LJKA 1H91A 4GH7A 2JU3A 4QZTA 4AZRA 5H9KA 4O4SA 1QY2A 3APWA 4GNWA 2Q39A 4I3BA 3EYCA 2HNXA 1QY0A 1BSOA 2NNEA 3PH5A 4QZUA 5EPQA 3TGBA 1AELA 1YP6A 2BS5A 1X71A 1ZNHA 3FENA 3WBGA 1EIOA 1B56A 1FTPA 3F9DA 2O62A 2ZAGA 1X8PA 5C0NA 1T8VA 2FS6A 3S60A 3BX7A 5LJHA 3ZQ3A 1X8NA 2X45A 3U0DA 3P6GA 1N0SA 2A0AA 4ORXA 1G7NA 1A2DA 5KIDA 4HPDA 2FLJA 4WBKA 3OE3A 3HWGA 4I3CA 3P6CA 2L67A 3BLGA 2Z4IA 4O3YA 2QO6A 4AZMA 2RQ0A 4WHIA 4YFPA 1TW4A 3ZUOA 1SXYA 1MVGA 1GXAA 2JN3A 4XMFA 3HWFA 3NQ9A 4MIRA 5DG4A 3APVA 3ELZA 5LJCA 2WQAE 1EPAA 4GNYA 4QYPA 5D47A 1ERXA 3B2LA 5CYBA 1VPRA 2MJIA 4EXZA 3HK1A 1EW3A 2K62A 4DQ4A 4IB9A 3O22A 4LQZA 1DV9A 2AL0X 2LB6A 5L8OA 2JU8A 3NX1A 4HPAA 2GC9A 2A3FX 1JIWI 5BVSA 2OFMX 4ZHHA 2JW1A 3I0AA 1DZMA 3DTQA 3P02A 3STKA 1U17A 5H9AA 1HBQA 1LIEA 1GT1A 2Q9SA 2PY1A 1X8OA 4XMHA 1GM6A 1GT3A 2IFBA 2ACOA 2NP1A 2X8FA 3B2HA 1LNMA 1SXWA 4NW4A 5IO6A 3FLLA 4YFQA 1ICNA 4ZH6A 1LFOA 5H9NA 3JSQA 2GTFX 4I95A 1B4MA 2FS7A 2XKLA 5DPQA 1QFVA 3ZW2A 1IKEA 4O9SA 3VG6A 2L68A 2X46A 4ZHCA 2ZAIA 1HQPA 1GKAB 4QNIA 1LIBA 1UZ2X 1TOUA 3FMZA 3C77X 4NLJA 4O4XA 2CZTA 3NQ3A 4YDAA 3BY0A 5F6ZA 2FR3A 4QYNA 1SY1A 2RD7C 1AB0A 4L3RA 4TKJA 5L8NA 1JJJA 2AT0X 4ORYA 2LA7A 4AZQA 2CBRA 1OBQA 1MUPA 3NBXX 3STNA 1CRBA 4OMXA 4FQBB 4NNTA 5HA1A 4ML7B 1O8VA 2BHVA 5K06A 2AT3X 5HZ5A 3BSZE 2WEWA 4ORSA 3D97A 4RUNA 2ALLX 1T68X 1JYJA 4Y0QA 1TOWA 2CM9A 1P6PA 5F58A 2AKQA 3NQKA 1EIIA 1EQDA 1ZNLA 3U9PC 2M4LA 1GX9A 1RBPA 4ZHGA 5JR8A 4MVKA 1QABE 2W2BA 1Y9LA 2P8GA 2POAA 3F8AA 3FA6A 3HWDA 4MISA 1OBPA 2XSTA 5F1EA 3QKGA 4O3WA 2Q4NA 3JQOA 4ZHDA 1ZNKA 3WJFA 2YMSA 2QO5A 3UAQA 4YFRA 3GE2A 2W2AA 3FA9A 2Q2PA 4GKCA 1SXXA 3ELXA 4YCHA 3B2IA 3BRNA 3IA8A 4QQ1A 2HZRA 1DZKA 1GX8A 3NR3A 1BBPA 3PECA 3NX2A 1CBIA 4ZGFA 2JU7A 3C78X 4BVMA 1JYDA 1L6MA 4M6SA 4N7CA 4ZFXA 1DZJA 1FENA 3VG3A 4YKOA 1SY0A 3OJYC 2AT8X 3WJBA 2LBAA 3ZZVA 2FT9A 1IKJA 3RZYA 4ALBA 1OEJA 3TGAA 3APXA 1E06A 2RCQA 1KXOA 3MVFA 1LICA 1LIFA 1DFVA 4D6AA 4IAWA 1KT6A 5FQ8E 4Y0PA 5AEOA 3UEXA 2KTSA 3VG2A 4CV7A 2CBSA 4NYRA 4A1HA 4OS8A 2KTDA 3BDRA 1HN2A 4LZUA 4D6BA 4O3XB 5LJGA 1MX7A 4I9RA 4CK4A 4KIIA 1IFBA 1VYGA 1IIUA 3P6EA 1X8UA 2LFOA 4ID2A 1HMSA 1X89A 4YGGA 1U18A 3FELA 4XMGA 4TKHA 3WJDA 3KQ0A 4I9SA 3UEVA 2MO5A 4XMEA 4UU2A 2OZQA 5BVTA 4COTA 1B0OA 2X8SA 2QOSC 4QRLA 4A60A 1LPJA 1SY3A 1Z24A 3BU9A 3FYFA 4AYHA 1BSQA 3KFIA 5HBSA 1BM5A 1QWDA 2QM9A 1ADLA 1MDCA 3RSWA 2QMIA 4TQ2A 3O19A 1YWBA 4MVEA 1KT3A 1KT7A 3G7XA 4GZVA 4HPCA 4PJ2A 3FR2A 1TVQA 1E5PA 4NNSA 3KFGA 2OFRX 4AZOA 4TLJA 5EDBA 2LKKA 3FIQA 1S7DA 2OVAA 3APUA 4IMOA 3CQRA 5B27A 4AZNA 4ORUA 1JBHA 3K3LA 4XMDA 4EFGA 1BWYA 1B8EA 2AT5X 2MHDA 1BSYA 2GTLM 3FR4A 2MM3A 2X8TA 3AKNA 1ZNDA 2AH7X 3VG4A 3VE2A 4ZR2A 1AQBA 1BEBA 1EPBA 1IFCA 4XMCA 3SOTA 1GT4A 1CBSA 1G5WA 4LKPA 4LKTA 5LJDA 3SAOA 3O2YA 3WJCA 3FW5A 2WEXA 3N91A 2AMMX 4M7MA 3TF6A 3VE1A 3ZI8A 1YWAA 5D45A 4AW8A 1I06A 4GU8A 4WFUA 1ZNGA 2HZQA 3H3IA 3VPJE 1LIDA 2WSJA 1A57A 3RBYA 1KQXA 1YWDA 4ODDA 1BRQA 2GTLN 3PPTA 4IMNA 4U3QA 5EEEA 5L8IA 2F09A 1YWCA 3MX7A 3LV4A 1SMPI 2A13A 4ORRA 3ZUIA 4ZH9A 3LHNA 4ES7A 3T1DA 5HTEA 1OPBA 1S2PA 4FGIB 2Q2MA 1I04A 5AJBA 4GETA 4YBPA 5FFHA 2L5PA 4O4UA 3RKGA 3FR5A 2WUTA 4NP1A 5AJCA 4I6SA 5EEDA 3HTYA 2LBVA 4R0BA 3ZW1B 1YIVA 1KT5A 5BVQA 2FTBA 3F6ZB 4HFOA 1KZWA 4FBOA 5CE4A 3BX8A 5F6BA 1I4UA 3PP6A 3EBKA 4KT5A 1DC9A 4FBRA 2G79A 4KH8A 1KQWA 2BT9A 1DF3A 4IB6A 3VU1A 2R74A 1GKAA 1KOIA 4I3DA 1CBQA 3S5XA 5KICA 1O1UA 3CQNA 4O4OA 3STMX 5IO5A 1X8QA 3TZSA 1SXUA 2AT6X 3WOVA 3KZAA 3CR6A 3HWEA 1NGLA 4OS3A 1BJ7A 4EQAC 3NADA 3I17A 5LJBA 4RUUA 5FQ6E 3FEKA 1E02A 1NP4A 4ORWA 3BS2A 1YUPA 2A2UA 5D8JA 1OEEA 1EALA 1ERBA 5H9LA 4L1NA 2KD2A 4NYQA 1G85A 3AKMA 4BOEA 3ZW1A 4KC8A 1PMPA 4U8UN 4EEJA 5FENA 3ZWEA 2QO4A 3B2JA 2BLGA 4DQ3A 4O3ZA 2WQ9A 3FEPA 3BU1A 4N7DA 4YKMA 2GTLO 3UEUA 5HZQA 2FRSA 3UEWA 4Y0RA 3B2KA 2HLVA 3C76X 3ZW0B 3CBSA 2HMBA 1RLBE 1HMTA 1SA8A 1TXLA 1EXSA 2YG2A 2HYSA 3HOEA 2G7BA 5D4AA 5KHPA 4YMYA 4O49A 1FELA 3U03A 4EDEA 3MBTA 1FE3A 3Q6LA 4AZPA 1QQSA 3CMPA 5HZ8A 4MVLA 1KT4A 2CM4A 5HTDA 5HCDC 1A3YA 4IBAA 4HPBA 3D4RA 2WR6A 1LKEA 2JOZA 5LKEA 4OS0A 4ZHFA 4INNA 4QGXA 4YDBA 1NP1A 2MWHA 3RWXA 4TNNA 3HOLA 4YGZA 1E00A 4GK9A 3S26A 1CBRA 1BRPA 3VG5A 2DM5A 4TKBA 4A1YA 5HCCC 1ZRYA 1GGLA 4GE1A 4ALOA 4YBUA 5IO7A 1KZXA 2FR2A 2Z4HA 1ICMA 1YP7A 2OVDA 3OBLA 1AVGI 4GDZA 5FQ7E 4ARHA 3ZW0A 4NLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LQZ A; 
#chains in the Genus database with same CATH topology
 1I9H A;  2GJ5 A;  3DSZ A;  2RN4 A;  1LF7 A;  1VWN B;  3P6F A;  1D3S A;  1MX8 A;  3WVM A;  3WJG A;  1KGL A;  1Y55 X;  3NPO A;  3NP1 A;  1OBU A;  2ACP X;  1HXZ A;  1ALB A;  1SRJ A;  3EBW A;  3EM0 A;  5H8T A;  2OVS A;  4PSQ A;  2R73 A;  3TGC A;  1JJX A;  1SWJ A;  5F7G A;  3VG7 A;  3WJC A;  1JZU A;  4HWM A;  1A18 A;  1VWB B;  1HBP A;  1Y52 X;  1ZNE A;  5HA0 A;  1OEK A;  4U8U O;  3X00 A;  2FHL A;  1SWA A;  2OF8 A;  2OVE A;  3FW4 A;  5AQ6 A;  5EZ2 A;  4CPH A;  1LDO A;  2A5B A;  3EMM A;  1PBO A;  3FDC A;  4YVB A;  2CAM A;  1NDJ A;  2N93 A;  3D96 A;  3FA7 A;  1XKI A;  2EU7 X;  4OEL A;  4ZCB A;  4QAE A;  2ANS A;  4ON1 A;  5HZ6 A;  4YCE A;  4BJ8 A;  5LJE A;  1IW2 A;  5FAZ A;  2WPU A;  1SWN A;  4LZV A;  2CZU A;  3WJE A;  3PQS A;  1ML7 A;  3KFF A;  1HMR A;  3P24 A;  1N4J A;  5LKF A;  1STP A;  2HKD A;  1U0X A;  3SZJ A;  2K23 A;  3PDF A;  4K19 A;  1CJ5 A;  4QGV A;  1VYF A;  4QGW A;  2JMB A;  1D2U A;  2X56 A;  3JS1 A;  4TJZ A;  1SY2 A;  3PED A;  1JV4 A;  2E4J A;  4YH0 A;  3WZN A;  4GDA A;  1FDQ A;  2RA6 A;  1PBY A;  2R56 A;  3V8U A;  4CSB A;  2L9C A;  1FEM A;  1EI5 A;  1XCA A;  2FWV A;  4JGL A;  3KFH A;  5HCE C;  2RTK A;  3RDS A;  4UU3 A;  4BX7 A;  4MVI A;  4KC7 A;  3E3C A;  3FA8 A;  4U8U M;  3D95 A;  1DZP A;  4BQU A;  2BS6 A;  5HZ9 A;  1S44 A;  3L4R A;  3CBC A;  1O1V A;  4IB8 A;  1EUO A;  1SRF A;  1SWC A;  3VHH A;  1LUQ A;  4CPI A;  2FKJ A;  1QY1 A;  1I05 A;  4ZJ0 A;  2OL8 O;  1R0U A;  1K3B A;  2RCT A;  2IZC B;  3CWK A;  1OPA A;  4FBV A;  4WFV A;  4ZGU A;  3LTW A;  4A8Z A;  4OMW A;  2KW1 A;  1QG5 A;  2OY7 A;  3P6H A;  1PEE A;  4CDC A;  5HWZ A;  1PTS A;  1W5R A;  1QFT A;  3OD9 A;  1Y9T A;  5HAE A;  2OF9 A;  3S5V A;  1ACD A;  4IB7 A;  1MM9 A;  4U9C A;  5BYP A;  4GRJ A;  2G78 A;  4IAX A;  1E2T A;  1PM1 X;  2NNQ A;  2ASN X;  1G74 A;  1T0V A;  4YGH A;  3PQU A;  4Z6J A;  3PH6 A;  4JNJ A;  3WXQ A;  2NND A;  1URE A;  2KT4 B;  4KCA A;  2F73 A;  3P6D A;  1K24 A;  5D48 A;  4IAB A;  2A2G A;  3GAQ A;  4Y0S A;  5B29 A;  1N43 A;  2IZL B;  1GT5 A;  1VWH B;  1N9Y A;  2W2F A;  5EDC A;  3IFB A;  5B5G A;  2WWP A;  5F2B A;  2OYB O;  5LJK A;  1BLR A;  1H91 A;  4GH7 A;  1NBX A;  2JGS A;  2JU3 A;  2X32 A;  4QZT A;  4AZR A;  5H9K A;  1SRG A;  2I5V O;  4O4S A;  1QY2 A;  3APW A;  4GNW A;  2Q39 A;  4I3B A;  3EYC A;  2HNX A;  1QY0 A;  1BSO A;  2NNE A;  3PH5 A;  4QZU A;  5EPQ A;  3RDX A;  3TGB A;  1AEL A;  1SWQ A;  1YP6 A;  2BS5 A;  1X71 A;  1ZNH A;  3FEN A;  3WBG A;  1EIO A;  1B56 A;  1FTP A;  3MG5 A;  3F9D A;  2O62 A;  3RY1 A;  2ZAG A;  1X8P A;  5C0N A;  1T8V A;  2FS6 A;  2VFB A;  2PI3 O;  3S60 A;  3BX7 A;  5LJH A;  3ZQ3 A;  1X8N A;  2X45 A;  3U0D A;  1W4T A;  2X55 A;  3P6G A;  1N0S A;  2A0A A;  4ORX A;  1RXH A;  3WYP A;  1G7N A;  1A2D A;  5KID A;  4HPD A;  2FLJ A;  4WBK A;  3OE3 A;  3HWG A;  4I3C A;  3P6C A;  2L67 A;  3BLG A;  2Z4I A;  4O3Y A;  2QO6 A;  4AZM A;  2RQ0 A;  4WHI A;  4YFP A;  1TW4 A;  3ZUO A;  2Y3F A;  1SXY A;  1NQN A;  1GXA A;  1MVG A;  2JN3 A;  1VWP B;  4XMF A;  1SWP A;  2RTA A;  3HWF A;  3NQ9 A;  1NC9 A;  4Z28 A;  4MIR A;  5DG4 A;  1VWJ B;  2RTP B;  3APV A;  3ELZ A;  5LJC A;  2WQA E;  1EPA A;  4GNY A;  4QYP A;  3RDU A;  5D47 A;  1ERX A;  2X34 A;  3B2L A;  5CYB A;  4Z27 A;  1VPR A;  2MJI A;  4EXZ A;  4MEE A;  3HK1 A;  1EW3 A;  4NV7 A;  2K62 A;  4DQ4 A;  4IB9 A;  3O22 A;  4LQZ A;  1LCV A;  1DV9 A;  2AL0 X;  2LB6 A;  4BGF A;  5L8O A;  2JU8 A;  3NX1 A;  4HPA A;  2GC9 A;  3EW1 A;  1SWK A;  2A3F X;  3VHM A;  1JIW I;  5BVS A;  2OFM X;  4AZN A;  4ZHH A;  2JW1 A;  3I0A A;  1DZM A;  3DTQ A;  3P02 A;  3STK A;  1U17 A;  5H9A A;  1HBQ A;  1LIE A;  1GT1 A;  2Q9S A;  2PY1 A;  1X8O A;  4XMH A;  1GM6 A;  1GT3 A;  2IFB A;  2ACO A;  1VYO A;  2NP1 A;  2X8F A;  3B2H A;  1LNM A;  1SXW A;  4NW4 A;  5IO6 A;  3FLL A;  4YFQ A;  1ICN A;  4ZH6 A;  1LFO A;  5H9N A;  3JSQ A;  2GTF X;  4I95 A;  1STR B;  1JMZ A;  2FS7 A;  1B4M A;  1KL4 A;  3RY2 A;  2XKL A;  5DPQ A;  1QFV A;  3ZW2 A;  4GGR A;  1IKE A;  4O9S A;  4BX6 B;  1VWI B;  5JD2 A;  3HPE A;  2L68 A;  3VG6 A;  2X46 A;  4ZHC A;  2ZAI A;  1HQP A;  1GKA B;  3RE6 A;  4QNI A;  1LIB A;  1UZ2 X;  1TOU A;  3FID A;  3FMZ A;  3C77 X;  4NLJ A;  4O4X A;  4OEM A;  2CZT A;  4CDD A;  4Z2O A;  3NQ3 A;  4YDA A;  3BY0 A;  5F6Z A;  2FR3 A;  4QYN A;  1SY1 A;  2RD7 C;  1AB0 A;  4L3R A;  2VFC A;  4TKJ A;  5L8N A;  1JJJ A;  2C1S A;  2AT0 X;  1VWR B;  4ORY A;  5IRW A;  2LA7 A;  4AZQ A;  2CBR A;  1OBQ A;  1MUP A;  2C4I A;  3NBX X;  3STN A;  1CRB A;  1RAV A;  4OMX A;  4FQB B;  4NNT A;  5HA1 A;  1VWA B;  2IZK A;  4ML7 B;  2RTH B;  1O8V A;  2BHV A;  2RTJ A;  4BCS A;  5K06 A;  1JQP A;  2AT3 X;  2G5L A;  3BSZ E;  1NQM A;  5HZ5 A;  2WEW A;  4ORS A;  3D97 A;  4I60 A;  4RUN A;  3KVN A;  2ALL X;  3T6L A;  1SLF B;  1T68 X;  1JYJ A;  2MF6 A;  4Y0Q A;  5B3M O;  2VDF A;  1TOW A;  3WZO A;  2CM9 A;  1P6P A;  2RTO B;  2FKG A;  5F58 A;  2AKQ A;  2C1Q A;  3NQK A;  1EQD A;  1EII A;  1ZNL A;  3U9P C;  2M4L A;  1GX9 A;  1RBP A;  2RTR B;  4ZHG A;  5JR8 A;  4MVK A;  1KFF A;  1HQQ A;  1QAB E;  2W2B A;  3SLJ A;  1Y9L A;  2P8G A;  2POA A;  3F8A A;  3FA6 A;  3HWD A;  4Y59 A;  4MIS A;  1OBP A;  2XST A;  3SZI A;  5F1E A;  3QKG A;  4O3W A;  2Q4N A;  3JQO A;  4ZHD A;  1ZNK A;  1SWO A;  3CKF A;  2Y3E A;  3WJF A;  2YMS A;  4BX6 A;  2QO5 A;  2A8G A;  2OFA A;  2QOM A;  3UAQ A;  4YFR A;  3GE2 A;  2W2A A;  3FA9 A;  2Q2P A;  4GKC A;  1SXX A;  3ELX A;  4YCH A;  1VWM B;  3B2I A;  3BRN A;  3IA8 A;  4QQ1 A;  1LCW A;  1DZK A;  1GX8 A;  2HZR A;  1BBP A;  3NR3 A;  3PEC A;  3NX2 A;  1CBI A;  2RTD B;  1SRH A;  4U46 A;  2JU7 A;  3C78 X;  4Z2V A;  4BVM A;  4ZGF A;  3ZW1 B;  1JYD A;  1L6M A;  4M6S A;  4N7C A;  1LEL A;  3AEH A;  2UYW A;  2X4M A;  4ZFX A;  1DZJ A;  1FEN A;  1N7Y A;  4YKO A;  1SY0 A;  3OJY C;  2AT8 X;  3VG3 A;  2LBA A;  3WJB A;  3ZZV A;  2FT9 A;  1IKJ A;  3RZY A;  5B11 O;  4ALB A;  1OEJ A;  3TGA A;  3APX A;  1E06 A;  2RCQ A;  1KXO A;  3MVF A;  2OFB A;  1LIC A;  2RTC B;  2AF5 A;  1LIF A;  1DFV A;  4D6A A;  4IAW A;  2I5Z O;  1KT6 A;  5FQ8 E;  4Y0P A;  5AEO A;  3UEX A;  1Y53 X;  2A5C A;  2KTS A;  4BX5 B;  2IZJ A;  2IZA A;  3VG2 A;  1JMX A;  4CV7 A;  2CBS A;  4NYR A;  4A1H A;  4OS8 A;  2KTD A;  1I78 A;  1HN2 A;  1SLE B;  2AVI A;  3BDR A;  4LZU A;  4O3X B;  1MX7 A;  4I9R A;  1Y0G A;  5LJG A;  4KII A;  3WZQ A;  3MM0 A;  4CK4 A;  1IFB A;  1VYG A;  1IIU A;  2RTE B;  1X8U A;  2LFO A;  3P6E A;  1HMS A;  1X89 A;  4ID2 A;  4DNE A;  4YGG A;  1U18 A;  3FEL A;  4XMG A;  4TKH A;  3WJD A;  3KQ0 A;  1GX3 A;  4Y5D A;  2QCB A;  4I9S A;  1FJ1 E;  2MO5 A;  4IRW A;  3UEV A;  4XME A;  4UU2 A;  2OZQ A;  5BVT A;  4COT A;  4GD9 A;  4Z2P A;  1B0O A;  1LDQ A;  2X8S A;  4NV8 A;  2QOS C;  4QRL A;  1HXL A;  4A60 A;  1LPJ A;  1SY3 A;  1Z24 A;  3BU9 A;  1SWF A;  3FYF A;  4AYH A;  4GJV A;  1BSQ A;  3KFI A;  5HBS A;  1BM5 A;  1QWD A;  2QM9 A;  1ADL A;  1MDC A;  1VWD B;  1SWL A;  3RSW A;  2QMI A;  2OY1 O;  3O19 A;  1YWB A;  2IZD B;  4TQ2 A;  4MVE A;  4CDE A;  1KT3 A;  1KT7 A;  3G7X A;  1VWG B;  4GZV A;  4HPC A;  4PJ2 A;  5CHK A;  4BBO A;  1HY2 A;  3FR2 A;  5IRA A;  2OL7 A;  1TVQ A;  1E5P A;  2RTQ B;  4NNS A;  4CPF A;  3KFG A;  2OFR X;  5B2A O;  4AZO A;  4TLJ A;  5EDB A;  2LKK A;  3FIQ A;  1S7D A;  2IZH B;  2OVA A;  3APU A;  3CQR A;  4IMO A;  5B27 A;  4ORU A;  1JBH A;  1OSP O;  3K3L A;  4XMD A;  4EFG A;  1BWY A;  2RTF B;  1DF8 A;  1B8E A;  2RTI B;  2AT5 X;  2MHD A;  1BSY A;  2GTL M;  3FR4 A;  1RST B;  2MM3 A;  2X8T A;  3AKN A;  1ZND A;  2IZE B;  2AH7 X;  3VG4 A;  3VE2 A;  2BSZ A;  4ZR2 A;  1AQB A;  2IZI A;  2Y32 A;  1BEB A;  3WZP A;  1EPB A;  4GJS A;  1IFC A;  1RXK A;  4XMC A;  3SOT A;  1SWR A;  1SRI A;  3T6F A;  1GT4 A;  5B10 O;  1CBS A;  1G5W A;  4LKP A;  4LKT A;  5LJD A;  3SAO A;  2IZB A;  2UZ2 A;  3O2Y A;  1STS B;  3FW5 A;  3QQ2 A;  2DJF A;  2WEX A;  3N91 A;  2AMM X;  4M7M A;  3TF6 A;  3VE1 A;  1MOY A;  3ZI8 A;  1YWA A;  5D45 A;  4AW8 A;  1I06 A;  4GU8 A;  1SLG B;  4WFU A;  1ZNG A;  2HZQ A;  2DJG A;  1JJU A;  1IJ8 A;  1RXJ A;  3EW2 A;  1LID A;  2WSJ A;  3H3I A;  3VPJ E;  3RBY A;  1A57 A;  1KQX A;  1YWD A;  4ODD A;  1BRQ A;  2GTL N;  3PPT A;  4IMN A;  4U3Q A;  5EEE A;  3WYQ A;  5L8I A;  2F09 A;  1YWC A;  3MX7 A;  3LV4 A;  1SMP I;  3EC5 A;  2A13 A;  4ORR A;  3ZUI A;  4ZH9 A;  3LHN A;  4ES7 A;  3T1D A;  5HTE A;  2RTL A;  1OPB A;  1S2P A;  4FGI B;  2Q2M A;  1I04 A;  5AJB A;  4GET A;  4YBP A;  3SLO A;  5FFH A;  1VWE B;  2L5P A;  4OKA A;  1VWQ B;  4O4U A;  3RKG A;  3FR5 A;  2WUT A;  4NP1 A;  1UYN X;  4I6S A;  5AJC A;  3HTY A;  5EED A;  4R0B A;  2LBV A;  1YIV A;  1KT5 A;  5BVQ A;  2GH7 A;  1SLD B;  2FTB A;  3F6Z B;  4HFO A;  1KZW A;  4FBO A;  2RTM A;  5CE4 A;  3BX8 A;  5F6B A;  5IXG A;  1I4U A;  3PP6 A;  3EBK A;  4KT5 A;  1DC9 A;  1VWL B;  4FBR A;  2G79 A;  2FGS A;  3AUM O;  4KH8 A;  1KQW A;  2BT9 A;  2F01 A;  1DF3 A;  4IB6 A;  3VU1 A;  2OY8 A;  2R74 A;  5K68 A;  1GKA A;  1KOI A;  3PK2 A;  4I3D A;  1CBQ A;  1MEP A;  4CPE A;  1AVD A;  3S5X A;  5KIC A;  4GUZ A;  1WUB A;  1O1U A;  3CQN A;  4O4O A;  3STM X;  5IO5 A;  3CKG A;  1X8Q A;  3T2W A;  1VWK B;  2G8C O;  3TZS A;  1W6F A;  5CSE A;  1SXU A;  2AT6 X;  3WOV A;  3KZA A;  3CR6 A;  3HWE A;  1NGL A;  4OS3 A;  1BJ7 A;  4EQA C;  3NAD A;  2RTN B;  1UYO X;  2IZG B;  3I17 A;  1RSU B;  5LJB A;  4RUU A;  5FQ6 E;  3FEK A;  1E02 A;  1NP4 A;  4ORW A;  3BS2 A;  1SWB A;  1YUP A;  2OY5 O;  5L3Y A;  2A2U A;  5D8J A;  1SWT A;  1OEE A;  1EAL A;  1SRE A;  1ERB A;  5H9L A;  3RDQ A;  4L1N A;  1VWF B;  2KD2 A;  1AVE A;  4NYQ A;  1G85 A;  1N9M A;  3AKM A;  4BOE A;  3ZW1 A;  4KC8 A;  1PMP A;  4U8U N;  1VWO B;  4EEJ A;  5FEN A;  1SWD A;  3ZWE A;  2QO4 A;  3B2J A;  2BLG A;  4DQ3 A;  4O3Z A;  2WQ9 A;  1SWE A;  3FEP A;  3BU1 A;  4JHQ A;  4N7D A;  3RE5 A;  5B5F A;  4JO6 A;  4YKM A;  1KL3 A;  1SWG A;  2GTL O;  2FRS A;  5HZQ A;  3UEU A;  3UEW A;  4C5P A;  3RDO A;  4Y0R A;  3B2K A;  2FHN X;  2HLV A;  3C76 X;  3ZW0 B;  3CBS A;  2HMB A;  1RLB E;  1HMT A;  1SA8 A;  1TXL A;  1EXS A;  2YG2 A;  2HYS A;  3D9W A;  1VWC B;  3HOE A;  2G7B A;  5D4A A;  5KHP A;  4YMY A;  4O49 A;  1FEL A;  3U03 A;  4EDE A;  3MBT A;  1FE3 A;  3Q6L A;  4AZP A;  5K67 A;  1QQS A;  3CMP A;  5HZ8 A;  1SWU A;  4MVL A;  3SZH A;  4CPH B;  1KT4 A;  2CM4 A;  5IRU A;  1SWS A;  4GGZ A;  4DCB A;  5HTD A;  5HCD C;  1A3Y A;  4IBA A;  4HPB A;  4D6B A;  3D4R A;  4CDF A;  2WR6 A;  2OL6 O;  1LKE A;  2JOZ A;  5LKE A;  4OS0 A;  4ZHF A;  4INN A;  4QGX A;  4B55 A;  4YDB A;  1NP1 A;  4EKV A;  3SLT A;  2MWH A;  3RWX A;  4BX5 A;  4TNN A;  1KL5 A;  3HOL A;  3Q34 A;  1E00 A;  4GK9 A;  4YGZ A;  2BC3 A;  3S26 A;  1CBR A;  3VGW A;  1BRP A;  3VG5 A;  2DM5 A;  2ZSC A;  2RTB B;  4TKB A;  4A1Y A;  5HCC C;  1ZRY A;  1GGL A;  2RTG B;  4GE1 A;  4ALO A;  4YBU A;  3T2X A;  3RDM A;  5IO7 A;  1KZX A;  4GGT A;  2FR2 A;  1WBI A;  2Z4H A;  3VHI A;  1LCZ A;  1ICM A;  1YP7 A;  1SWH A;  2OVD A;  3OBL A;  4BX7 B;  1AVG I;  1MK5 A;  4GDZ A;  2IZF B;  5FQ7 E;  4ARH A;  3ZW0 A;  4NLI A; 
#chains in the Genus database with same CATH homology
 2GJ5 A;  3DSZ A;  2RN4 A;  1LF7 A;  3P6F A;  1D3S A;  1MX8 A;  3WVM A;  3WJG A;  1KGL A;  3NPO A;  3NP1 A;  1OBU A;  2ACP X;  1ALB A;  3EBW A;  3EM0 A;  5H8T A;  2OVS A;  4PSQ A;  2R73 A;  3TGC A;  1JJX A;  5F7G A;  3VG7 A;  1JZU A;  4HWM A;  1A18 A;  1HBP A;  1ZNE A;  5HA0 A;  1OEK A;  4U8U O;  3FW4 A;  5EZ2 A;  2OVE A;  5AQ6 A;  3EMM A;  1PBO A;  3D96 A;  2N93 A;  3FA7 A;  1XKI A;  2EU7 X;  4ZCB A;  4QAE A;  2ANS A;  4ON1 A;  5HZ6 A;  4YCE A;  5LJE A;  1IW2 A;  5FAZ A;  4LZV A;  2CZU A;  3WJE A;  3PQS A;  1ML7 A;  3KFF A;  1HMR A;  3P24 A;  5LKF A;  1U0X A;  2K23 A;  4K19 A;  1CJ5 A;  4QGV A;  1VYF A;  4QGW A;  2JMB A;  1D2U A;  4TJZ A;  3JS1 A;  1SY2 A;  3PED A;  1JV4 A;  2E4J A;  4YH0 A;  1FDQ A;  2RA6 A;  2R56 A;  3V8U A;  4CSB A;  2L9C A;  1FEM A;  1EI5 A;  1XCA A;  2FWV A;  4JGL A;  3KFH A;  5HCE C;  4UU3 A;  4MVI A;  4KC7 A;  3E3C A;  3FA8 A;  4U8U M;  3D95 A;  1DZP A;  4BQU A;  2BS6 A;  5HZ9 A;  1S44 A;  3L4R A;  3CBC A;  1O1V A;  4IB8 A;  1EUO A;  1QY1 A;  1I05 A;  4ZJ0 A;  1R0U A;  2RCT A;  3CWK A;  1OPA A;  4FBV A;  4WFV A;  4ZGU A;  4A8Z A;  4OMW A;  2KW1 A;  1QG5 A;  3P6H A;  1PEE A;  5HWZ A;  1QFT A;  3OD9 A;  1Y9T A;  5HAE A;  3S5V A;  1ACD A;  4IB7 A;  4U9C A;  5BYP A;  4GRJ A;  2G78 A;  4IAX A;  1PM1 X;  2NNQ A;  2ASN X;  1G74 A;  1T0V A;  4YGH A;  3PQU A;  3PH6 A;  3WXQ A;  2NND A;  1URE A;  2KT4 B;  4KCA A;  2F73 A;  3P6D A;  5D48 A;  4IAB A;  2A2G A;  3GAQ A;  4Y0S A;  5B29 A;  2W2F A;  1GT5 A;  5EDC A;  3IFB A;  2WWP A;  1BLR A;  5LJK A;  1H91 A;  4GH7 A;  2JU3 A;  4QZT A;  4AZR A;  5H9K A;  4O4S A;  1QY2 A;  3APW A;  4GNW A;  2Q39 A;  4I3B A;  3EYC A;  2HNX A;  1QY0 A;  1BSO A;  2NNE A;  3PH5 A;  4QZU A;  5EPQ A;  3TGB A;  1AEL A;  1YP6 A;  2BS5 A;  1X71 A;  1ZNH A;  3FEN A;  3WBG A;  1EIO A;  1B56 A;  1FTP A;  3F9D A;  2O62 A;  2ZAG A;  1X8P A;  5C0N A;  1T8V A;  2FS6 A;  3S60 A;  3BX7 A;  5LJH A;  3ZQ3 A;  1X8N A;  2X45 A;  3U0D A;  3P6G A;  1N0S A;  2A0A A;  4ORX A;  1G7N A;  1A2D A;  5KID A;  4HPD A;  2FLJ A;  4WBK A;  3OE3 A;  3HWG A;  4I3C A;  3P6C A;  2L67 A;  3BLG A;  2Z4I A;  4O3Y A;  2QO6 A;  4AZM A;  2RQ0 A;  4WHI A;  4YFP A;  1TW4 A;  3ZUO A;  1SXY A;  1MVG A;  1GXA A;  2JN3 A;  4XMF A;  3HWF A;  3NQ9 A;  4MIR A;  5DG4 A;  3APV A;  3ELZ A;  5LJC A;  2WQA E;  1EPA A;  4GNY A;  4QYP A;  5D47 A;  1ERX A;  3B2L A;  5CYB A;  1VPR A;  2MJI A;  4EXZ A;  3HK1 A;  1EW3 A;  2K62 A;  4DQ4 A;  4IB9 A;  3O22 A;  4LQZ A;  1DV9 A;  2AL0 X;  2LB6 A;  5L8O A;  2JU8 A;  3NX1 A;  4HPA A;  2GC9 A;  2A3F X;  1JIW I;  5BVS A;  2OFM X;  4ZHH A;  2JW1 A;  3I0A A;  1DZM A;  3DTQ A;  3P02 A;  3STK A;  1U17 A;  5H9A A;  1HBQ A;  1LIE A;  1GT1 A;  2Q9S A;  2PY1 A;  1X8O A;  4XMH A;  1GM6 A;  1GT3 A;  2IFB A;  2ACO A;  2NP1 A;  2X8F A;  3B2H A;  1LNM A;  1SXW A;  4NW4 A;  5IO6 A;  3FLL A;  4YFQ A;  1ICN A;  4ZH6 A;  1LFO A;  5H9N A;  3JSQ A;  2GTF X;  4I95 A;  1B4M A;  2FS7 A;  2XKL A;  5DPQ A;  1QFV A;  3ZW2 A;  1IKE A;  4O9S A;  3VG6 A;  2L68 A;  2X46 A;  4ZHC A;  2ZAI A;  1HQP A;  1GKA B;  4QNI A;  1LIB A;  1UZ2 X;  1TOU A;  3FMZ A;  3C77 X;  4NLJ A;  4O4X A;  2CZT A;  3NQ3 A;  4YDA A;  3BY0 A;  5F6Z A;  2FR3 A;  4QYN A;  1SY1 A;  2RD7 C;  1AB0 A;  4L3R A;  4TKJ A;  5L8N A;  1JJJ A;  2AT0 X;  4ORY A;  2LA7 A;  4AZQ A;  2CBR A;  1OBQ A;  1MUP A;  3NBX X;  3STN A;  1CRB A;  4OMX A;  4FQB B;  4NNT A;  5HA1 A;  4ML7 B;  1O8V A;  2BHV A;  5K06 A;  2AT3 X;  5HZ5 A;  3BSZ E;  2WEW A;  4ORS A;  3D97 A;  4RUN A;  2ALL X;  1T68 X;  1JYJ A;  4Y0Q A;  1TOW A;  2CM9 A;  1P6P A;  5F58 A;  2AKQ A;  3NQK A;  1EII A;  1EQD A;  1ZNL A;  3U9P C;  2M4L A;  1GX9 A;  1RBP A;  4ZHG A;  5JR8 A;  4MVK A;  1QAB E;  2W2B A;  1Y9L A;  2P8G A;  2POA A;  3F8A A;  3FA6 A;  3HWD A;  4MIS A;  1OBP A;  2XST A;  5F1E A;  3QKG A;  4O3W A;  2Q4N A;  3JQO A;  4ZHD A;  1ZNK A;  3WJF A;  2YMS A;  2QO5 A;  3UAQ A;  4YFR A;  3GE2 A;  2W2A A;  3FA9 A;  2Q2P A;  4GKC A;  1SXX A;  3ELX A;  4YCH A;  3B2I A;  3BRN A;  3IA8 A;  4QQ1 A;  2HZR A;  1DZK A;  1GX8 A;  3NR3 A;  1BBP A;  3PEC A;  3NX2 A;  1CBI A;  4ZGF A;  2JU7 A;  3C78 X;  4BVM A;  1JYD A;  1L6M A;  4M6S A;  4N7C A;  4ZFX A;  1DZJ A;  1FEN A;  3VG3 A;  4YKO A;  1SY0 A;  3OJY C;  2AT8 X;  3WJB A;  2LBA A;  3ZZV A;  2FT9 A;  1IKJ A;  3RZY A;  4ALB A;  1OEJ A;  3TGA A;  3APX A;  1E06 A;  2RCQ A;  1KXO A;  3MVF A;  1LIC A;  1LIF A;  1DFV A;  4D6A A;  4IAW A;  1KT6 A;  5FQ8 E;  4Y0P A;  5AEO A;  3UEX A;  2KTS A;  3VG2 A;  4CV7 A;  2CBS A;  4NYR A;  4A1H A;  4OS8 A;  2KTD A;  3BDR A;  1HN2 A;  4LZU A;  4D6B A;  4O3X B;  5LJG A;  1MX7 A;  4I9R A;  4CK4 A;  4KII A;  1IFB A;  1VYG A;  1IIU A;  3P6E A;  1X8U A;  2LFO A;  4ID2 A;  1HMS A;  1X89 A;  4YGG A;  1U18 A;  3FEL A;  4XMG A;  4TKH A;  3WJD A;  3KQ0 A;  4I9S A;  3UEV A;  2MO5 A;  4XME A;  4UU2 A;  2OZQ A;  5BVT A;  4COT A;  1B0O A;  2X8S A;  2QOS C;  4QRL A;  4A60 A;  1LPJ A;  1SY3 A;  1Z24 A;  3BU9 A;  3FYF A;  4AYH A;  1BSQ A;  3KFI A;  5HBS A;  1BM5 A;  1QWD A;  2QM9 A;  1ADL A;  1MDC A;  3RSW A;  2QMI A;  4TQ2 A;  3O19 A;  1YWB A;  4MVE A;  1KT3 A;  1KT7 A;  3G7X A;  4GZV A;  4HPC A;  4PJ2 A;  3FR2 A;  1TVQ A;  1E5P A;  4NNS A;  3KFG A;  2OFR X;  4AZO A;  4TLJ A;  5EDB A;  2LKK A;  3FIQ A;  1S7D A;  2OVA A;  3APU A;  4IMO A;  3CQR A;  5B27 A;  4AZN A;  4ORU A;  1JBH A;  3K3L A;  4XMD A;  4EFG A;  1BWY A;  1B8E A;  2AT5 X;  2MHD A;  1BSY A;  2GTL M;  3FR4 A;  2MM3 A;  2X8T A;  3AKN A;  1ZND A;  2AH7 X;  3VG4 A;  3VE2 A;  4ZR2 A;  1AQB A;  1BEB A;  1EPB A;  1IFC A;  4XMC A;  3SOT A;  1GT4 A;  1CBS A;  1G5W A;  4LKP A;  4LKT A;  5LJD A;  3SAO A;  3O2Y A;  3WJC A;  3FW5 A;  2WEX A;  3N91 A;  2AMM X;  4M7M A;  3TF6 A;  3VE1 A;  3ZI8 A;  1YWA A;  5D45 A;  4AW8 A;  1I06 A;  4GU8 A;  4WFU A;  1ZNG A;  2HZQ A;  3H3I A;  3VPJ E;  1LID A;  2WSJ A;  1A57 A;  3RBY A;  1KQX A;  1YWD A;  4ODD A;  1BRQ A;  2GTL N;  3PPT A;  4IMN A;  4U3Q A;  5EEE A;  5L8I A;  2F09 A;  1YWC A;  3MX7 A;  3LV4 A;  1SMP I;  2A13 A;  4ORR A;  3ZUI A;  4ZH9 A;  3LHN A;  4ES7 A;  3T1D A;  5HTE A;  1OPB A;  1S2P A;  4FGI B;  2Q2M A;  1I04 A;  5AJB A;  4GET A;  4YBP A;  5FFH A;  2L5P A;  4O4U A;  3RKG A;  3FR5 A;  2WUT A;  4NP1 A;  5AJC A;  4I6S A;  5EED A;  3HTY A;  2LBV A;  4R0B A;  3ZW1 B;  1YIV A;  1KT5 A;  5BVQ A;  2FTB A;  3F6Z B;  4HFO A;  1KZW A;  4FBO A;  5CE4 A;  3BX8 A;  5F6B A;  1I4U A;  3PP6 A;  3EBK A;  4KT5 A;  1DC9 A;  4FBR A;  2G79 A;  4KH8 A;  1KQW A;  2BT9 A;  1DF3 A;  4IB6 A;  3VU1 A;  2R74 A;  1GKA A;  1KOI A;  4I3D A;  1CBQ A;  3S5X A;  5KIC A;  1O1U A;  3CQN A;  4O4O A;  3STM X;  5IO5 A;  1X8Q A;  3TZS A;  1SXU A;  2AT6 X;  3WOV A;  3KZA A;  3CR6 A;  3HWE A;  1NGL A;  4OS3 A;  1BJ7 A;  4EQA C;  3NAD A;  3I17 A;  5LJB A;  4RUU A;  5FQ6 E;  3FEK A;  1E02 A;  1NP4 A;  4ORW A;  3BS2 A;  1YUP A;  2A2U A;  5D8J A;  1OEE A;  1EAL A;  1ERB A;  5H9L A;  4L1N A;  2KD2 A;  4NYQ A;  1G85 A;  3AKM A;  4BOE A;  3ZW1 A;  4KC8 A;  1PMP A;  4U8U N;  4EEJ A;  5FEN A;  3ZWE A;  2QO4 A;  3B2J A;  2BLG A;  4DQ3 A;  4O3Z A;  2WQ9 A;  3FEP A;  3BU1 A;  4N7D A;  4YKM A;  2GTL O;  3UEU A;  5HZQ A;  2FRS A;  3UEW A;  4Y0R A;  3B2K A;  2HLV A;  3C76 X;  3ZW0 B;  3CBS A;  2HMB A;  1RLB E;  1HMT A;  1SA8 A;  1TXL A;  1EXS A;  2YG2 A;  2HYS A;  3HOE A;  2G7B A;  5D4A A;  5KHP A;  4YMY A;  4O49 A;  1FEL A;  3U03 A;  4EDE A;  3MBT A;  1FE3 A;  3Q6L A;  4AZP A;  1QQS A;  3CMP A;  5HZ8 A;  4MVL A;  1KT4 A;  2CM4 A;  5HTD A;  5HCD C;  1A3Y A;  4IBA A;  4HPB A;  3D4R A;  2WR6 A;  1LKE A;  2JOZ A;  5LKE A;  4OS0 A;  4ZHF A;  4INN A;  4QGX A;  4YDB A;  1NP1 A;  2MWH A;  3RWX A;  4TNN A;  3HOL A;  4YGZ A;  1E00 A;  4GK9 A;  3S26 A;  1CBR A;  1BRP A;  3VG5 A;  2DM5 A;  4TKB A;  4A1Y A;  5HCC C;  1ZRY A;  1GGL A;  4GE1 A;  4ALO A;  4YBU A;  5IO7 A;  1KZX A;  2FR2 A;  2Z4H A;  1ICM A;  1YP7 A;  2OVD A;  3OBL A;  1AVG I;  4GDZ A;  5FQ7 E;  4ARH A;  3ZW0 A;  4NLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...