4LR8A

Phosphopentomutase s154a variant soaked with ribose 5-phosphate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTAADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 141
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lr8A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr8A01
2XR9A 2D1GA 3WAVA 5DLVA 4ZGAA 1ZEFA 2IUCA 4LRAA 2X98A 4UPLA 2W5RA 4KAYA 3UN3A 1E33P 1ELYA 4KJGA 2GSOA 2ZKTA 3OT9A 1KH7A 3TWZA 1EW9A 5C66A 5GOVA 2GA3A 4NWJA 5L0EA 1ELXA 3UN2A 4LRFA 4LREA 4LQYA 4LR8A 3BDGB 5DLWA 4FDIA 3DYCA 3M7VA 5LQQA 5K4PA 1ALKA 4UOPA 5GRRA 4TN0A 5LIAA 1URAA 1ANIA 3A52A 1EQJA 3IGYB 4LRDA 3TX0A 4UPKA 4CYSA 4ZG7A 3ED4A 5DLTA 3BDFA 4UPIA 3NKOA 1AJBA 1KHKA 5LRNA 1SHQA 3WAWA 3NKNA 3UO0A 1EW2A 5IJSA 1B8JA 3SZYA 2VQRA 4ZG6A 4N7TA 3NKMA 4GTXA 1SHNA 4UORA 4LR9A 4KAVA 3SZZA 3NVLA 5KXAA 2W5WA 3KD8A 2W5VA 1KHLA 3CMRA 1AJCA 1AUKA 1KHNA 1N2KA 3IGZB 4LRBA 4LR7A 4KM4A 4ZG9A 3WAXA 2RH6A 3TG0A 2W5XA 2GLQA 5INHA 4GTYA 5HRTA 1KH5A 5LRMA 3BDGA 4GTZA 1E2SP 1KH9A 1ANJA 5TJ3A 5EGEA 3T01A 3M8WA 1N2LA 3T00A 1HJKA 4LRCA 1HDHA 3MK0A 5IJQA 4YR1A 1EW8A 2W5QA 3DPCA 1ZEDA 3E2DA 3UNYA 1AJAA 2W5TA 1ED9A 1ZEBA 1FSUA 4B56A 4GTWA 2W5SA 1HQAA 3NKRA 3MK2A 1ELZA 1Y6VA 4FDJA 4CXUA 4MIVA 1ALJA 3MK1A 2IFYA 4NWXA 2IUCB 3NKQA 1ED8A 2G9YA 1KHJA 3LXQA 3M8ZA 1P49A 4KJDA 3B5QA 4MHXA 4UPHA 3UN5A 2W8DA 5AJ9A 5L0KA 1Y7AA 4CXKA 2GSUA 3NKPA 1URBA 1E1ZP 4MY4A 4CYRA 3WBHA 2W8SA 1K7HA 1EJJA 2GSNA 3WAYA 4LR2A 1E3CP 1ALHA 1ALIA 3Q3QA 1EI6A 3T02A 2QZUA 1O99A 1O98A 3BDHA 5EGHA 4CXSA 2XRGA 3M8YA 2ANHA 4UOOA 5L0BA 1AJDA 3IDDA 4QAXA 1KH4A
chains in the Genus database with same CATH superfamily
2XR9A 4UQGA 2R8JA 2B43A 2KO1A 4XDCA 4ZGAA 1R8HA 2DNNA 3FSYA 4TU8A 1RWUA 2W8LA 1H38A 4QR1A 1NDLA 3MM6A 4ZDNA 5KFHA 5IC6B 4RBTA 2UU9J 3MM9A 4TXSA 1CSJA 1RT7A 2A6MA 3DU5A 4YN3B 3DI6A 1NHUA 3MMBA 2AJ2A 3ENVA 5DO2A 4PR6A 1V3ZA 3J80U 3SI8A 5H9EK 4DPWA 2HHHF 4K4ZA 3TW0A 3VAGA 4OLOA 2XG8A 3W5ZA 3OHAA 2HYIB 2R7UA 2J0XA 4KPCA 3MEDA 2FJEB 2GIQA 1IKXA 1RWOB 4YP3A 1S0VA 1GTEA 2HHWA 1HQ2A 4NI2A 2LQ5A 3PIPQ 1QUPA 4FF3A 4K4UA 3LAKA 2E7XA 3HHLD 3A3PB 4KSEB 1RT1A 2DD8S 3NS7B 3PW4A 3BREA 4ED4A 5I42A 1SC6A 1URNA 2VICA 1KTVA 2GS8A 1RLDA 3JSMA 4ETXA 3EYZA 1FEEA 2I2YA 2ROPA 1X4HA 2XLKA 1KVJA 3TX0A 3IGYB 4C6AA 1T3OA 4ZP9A 3H2VE 3OXGA 4TY8B 3FEXB 5A8KB 3CO9A 1U1NA 2IIHA 1S97A 4MIWA 4UOHA 1ACMB 4LSLA 2UVWA 1RP5A 1V9OA 3GG1A 2MQQA 4IDKA 1KONA 4DQPA 3UR0A 4X4TA 1DFDA 5HMZA 2L08A 3N9UC 2C42A 4YOEA 2NS1B 2CQDA 3HHDA 4FXVA 1IWGA 2HS0A 2VG7B 2HK2A 3LGNA 3OTBA 4PG8A 2IA6A 4ZIVA 2UV8G 2BOPA 5GVQA 1SHNA 2DEIA 2MQMA 3H5XA 1PO6A 2KM8C 1KOHA 3VALA 4DF4A 3W5XA 2DH7A 4R8UB 4NLYA 5IT9Y 5IM0B 2YKNB 1KWMA 3IR5B 3J80Y 4ZVSB 2QLJB 4BS2A 4MH8A 4OI6A 4TYBA 1T9TA 1S4EA 2HSEB 3QIPA 5K14A 3M9OB 1VQSA 4ICLA 3SEOA 3UD4P 1PC4A 1Y3JA 1AW0A 4NZ6A 2GJ2A 4DSKA 2RVJA 1REVB 1WC6A 4LF8J 3BSCA 1S1XA 3EZUA 1FJGJ 1ZH5A 1R43A 5KFTA 5K8NA 4PPZA 2ADCA 1CJKB 3NS6A 2F4VF 5BYSA 1NM2A 5D6GA 5C42B 2ALZA 2UVRA 2BKPA 2VUGA 4N56A 1HLWA 4M5LA 2XLIA 1O0PA 3T1YJ 3BPSP 4LF6F 1XNQF 2FUG9 3WX8A 1S1WB 1SH0A 5G4DA 1HHSA 4CO5A 1N5QA 1IWAA 4MKVA 5AE1A 2HHSA 4USJC 2HNZA 1JK9B 3M6VA 3PDNA 2GVZA 4MIVA 4WFNQ 2DCUB 3BGRB 3H8YA 2N7YA 4U7UK 5C25A 4DL2A 2ZZMA 3S8SA 4JI4F 3UCUP 3HD2A 3DRXA 2Q3PA 3H59A 1X4BA 3L7UA 4A8YA 2AGPA 2O67A 2AX0A 2CFXA 3NAIA 4RNFA 3AOCA 4DS5A 3MAAA 4IQMA 3R2CJ 3ILJA 1TMJA 4ZVRB 5BR8F 1G2EA 3GCXP 2YKOA 4ZKAA 2M0GB 3HKWA 4I7FA 5THWA 4LF8F 5IV4A 1EJJA 3KK2A 1VDHA 2DTJA 4MYTA 1FDBA 3ZZYA 4G6VB 1NJYA 1FNXH 3JTOA 1RTHB 4ITSA 1KLMA 2YX1A 2DEJA 1JLCA 3LUYA 5KFOA 2LEBA 5ETNA 1U2FA 2ZJQQ 2VG7A 2XNRA 1ZTWA 3DM2B 4FYWB 5LMUF 3X1LB 3BDHA 2Y8WA 2J5AA 3ZTRA 1V5VA 2IJNA 3CEDA 2CPIA 4FZVA 2FGOA 1A0OB 1PJ7A 4YDDB 3OVBA 4UOOA 1C1CB 1V3RA 1AJDA 4ECSA 1S1VA 4CO0A 3FRYA 4I2PA 4KE5A 2VJUA 1XMQF 3UW1A 1D9FA 1CQMA 2DHAA 2M2BA 1NDPA 3I0SA 5A8WB 5C7PA 1TELA 1FCAA 1RXOB 4YB1P 1FNMA 2B4OA 4F4YA 4NA1A 1CJTB 4LF2A 2MGZB 1RWPB 2UXCJ 3THVA 4R5PB 2N3OA 2KZZA 1VQLS 1QAYA 5IT0A 3VCDA 5BR8J 1JWWA 1J5OB 4B9MA 5K5MA 4RW6B 2QMXA 2YNHB 3DLGB 4ETZA 3PHEA 4H4KC 2GQQA 5A76A 1NBEB 3HSZA 1B7FA 2BQRA 1IKXB 4X4RA 1GEHA 2N4DA 1YITS 4PCQA 5KG0A 1TUWA 4A48A 1BWEA 1IBLJ 5DLWA 2Z2YB 3RJMB 2BR0A 4UQTA 2DXFA 3G87A 3TP2A 1IQTA 4O3NA 3BSNA 2H9ZA 2IBOA 2VKRA 4X62F 3LWLA 2XYPB 4FN5A 5F9NA 1OO0B 1TL7B 2XZDB 2MSSA 1ZETA 3M4XA 2EG1A 2FD2A 4JI3J 2W2NP 3DOMB 2ZUAA 5CZXA 2I9SA 5KFEA 3P5TL 1Y10A 2MZSA 4QWCA 3G6ES 4DS4A 1B7YB 2QE5A 2HHPA 3BDFA 3R1HA 3NKOA 2XO7A 1YIJS 4ZPTR 1L3UA 2F8EX 2VFSA 3L95X 1LKZA 3R9LA 2MQOA 4FF4A 2B4UA 1LXJA 2WSEC 4R25A 4C97A 1N52B 3UD3P 2ZHAA 2YNIB 2Y9HA 2EFGA 2LA4A 2HHHJ 4ZPAA 4Y2IA 3C6TA 2ZDPA 3I5BA 2PMWA 1HNVA 1GT8A 4H4MA 1GQEA 3M2UB 1CJUB 4HACA 4LUBA 4Y6IA 5KFAA 5CHCB 3RB0A 3K7RA 4NXNF 1N33F 2GO8A 3M8PB 3VR1A 2FQQB 5J1EA 5H9FK 2RT3A 3FMBA 4HHHA 4K4XA 4DX5A 2YQ1A 1RA7A 4TU7A 3L9ZA 4YMEA 1R8AA 4R0EA 2C2KB 2XGQA 4J9PA 1U1PA 1N8RT 3QRPA 2K8GA 4L74A 9RUBA 1KKHA 5KT3A 2I8EA 4KGMA 1PAUB 1B64A 1KH5A 4E98A 3PJWA 5BXIA 2IDEA 3RR8A 3K89A 2VQEF 4DPUA 3GWCA 5KT4A 3M8WA 3W2WA 3BV8A 1JLGB 1X31C 2YQ3A 1HHTP 3TVKA 3UVJB 2OPQB 3UNYA 2R7XA 3HP6A 2DYAA 3OFGA 5E3QA 4C3MA 7FD1A 1XJWB 5I3UB 1EIYB 3H40A 2D3ZA 3T3FA 4WFYA 3EGNA 5D8HB 1SKSA 1DARA 1HQUA 2AJ0A 3T5HA 5D0RA 2JVRA 5F9LA 2IUCB 1ED8A 2AV5A 3NBPB 2YWKA 3OLAA 4OZJA 5HVGA 4X64F 3BGLA 1KQKA 1ZM2A 4KHRA 2W9AA 1BQMA 1XK8A 1X4CA 3KDOA 2HBQB 4XDDA 1UVJA 4CYRA 1DTTA 1SH3A 3D6TB 4ED8A 2BJ7A 1FTRA 1H98A 5E3CA 5DGAA 2ZH7A 3VQSA 4AT1B 1I5OB 3W1YC 4U6PA 3PW5A 3PFOA 2MKCA 2MMYA 1YJVA 1K73T 2LXUA 3G2XA 3DRYA 1SJ4P 2AJ1A 4OI1A 1VOMA 2V63A 1C1BA 3HI9A 4FYYB 4XPEA 1VQ9S 2ROEA 2VDHA 4TVAB 3SCIE 2B56A 3T00A 1C0TA 3QLHA 5HAOA 3DDIA 2EVZA 1KQFB 2KXFA 5DLVA 2XY5A 1E6VB 1P9YA 4N76A 1AUSL 3TVYA 3CCUS 1VRTA 1ICEB 2Q79A 2E9ZA 1XNRF 1W2IA 2HHVA 1PG5B 4RBUA 2VQFJ 1U02A 4ANEA 6AT1B 1T02A 2JHEA 1YLXA 2B5JB 2DNYA 3CJ0A 3MI7X 2K7KA 3N5FA 3W8PA 4B9TA 3UQSA 1KFDA 2JJ4D 3WBZA 2UZAA 2FHOB 3N6LA 3SQGB 5KT2A 2AIRB 4JP8A 1KD1T 3ZZTA 3EZ5A 4LMZA 2ZDOA 2FYXA 2ZNZA 3P49B 3FZBA 3I9V9 4NRUA 2O1PA 5HN0A 1ZM3A 3MFHA 3V6KA 2HGNA 3SQOP 2G0IA 1BQMB 2IRXA 4I2QB 4PPDA 3OTOF 3POTB 4AL7A 5K4PA 5M2UA 3CC4S 1HNWJ 4X4UA 1G7CB 3BGUA 2C3OA 3H98A 3OFFA 1FX4A 2AQ4A 2ZZNA 2DIVA 2PFDA 1C4CA 1QE1B 1HFEL 2V94A 3EVWA 3KG4A 3NGRA 3C6UB 4O3PA 3HO1A 3EVOA 2PMHA 5JVGQ 3QATA 3CB4A 2KH9A 1N5TA 3SDEB 3V81B 2BA9A 2BKOA 4CTAB 2B8PA 2M9KA 4NXNJ 3EGZA 4B3SF 1JLAB 4WU3A 4WU2A 1F5BA 3DNCA 3M6WA 1N5VA 4C0HA 5LSLA 4X4OA 4A8MP 3BEGB 3UR3C 4EFAC 1SB6A 1XC9A 1KS2A 2AYMA 2DNLA 2HFUA 3GP9A 2EC2A 1SKWA 3BBBA 4Y0FA 1MWYA 1WC5A 2OGUA 3GIIA 2E29A 2E9TA 2QG9B 4WFAQ 2JC0A 4ZG6A 1F1BB 3AD7C 4QWEA 3TJ9A 3C15A 1R7IA 3DLKB 1VQPS 4F0MA 5DQGA 3CCZA 1WEYA 2MB0B 5J1EB 1S6PA 2RHQB 2UVUA 2J9DE 2J0WA 2OFGX 3DLEA 3MFIA 5CH7B 1I94F 3R5DA 3M2UA 4LBHA 2HZCA 3CWJA 3GFHA 4RUBA 1RYRA 2L9NA 1Q7YT 3V2UC 1DLOA 2RQMA 1H74A 2IHR1 3K8WA 5IZHA 1H2TZ 3ET6A 2UUCJ 4FBUA 3PKMA 3HKZD 2E7WA 2VZ9A 3M32B 2OUGA 3DRPB 4Y34A 4TNOA 3FBCA 1HQUB 2V2VA 3DKDA 2MJNA 3JS9A 3NXZA 3WIVA 1Q95G 1SQEA 2ZJRQ 4JI0F 1YJUA 3WDOA 2AEMA 2EBGA 2HIYA 4IG0A 5AE2A 5LJ5Y 1ED9A 4HDHA 1FSUA 2D7SA 2JL9A 2W5SA 3M2VB 3W63A 4Q8EA 3TUPA 2OEKA 4ERDA 3RRKA 5KFXA 1ALJA 4TN2A 3OXFA 2EFNA 4OI0A 1GK8A 1UJ5A 3PRVA 4LVOP 2IJRA 3TA0A 1F0XA 2FJAB 2NCKL 2NXEA 3AD9C 5HL7Q 2RB7A 3LXQA 2ZJPQ 1HWUA 5I4MA 1W25A 4TLRA 2HQ3A 4K4TA 1U48A 4CNYA 5KT5A 2RRBA 4DPXA 1BXNA 4OZNA 5EWGA 1FXDA 2M70A 1DRZA 2PI5A 2EK1A 3Q8RB 5KFRA 4M94A 2RDDA 3TZWA 2FJWA 2UXCF 4O0IA 2GSNA 4M5MA 1H6KX 2XWXA 3LOUA 4L72B 5FIIA 2YNHA 2CIMA 1IM6A 4FNIA 3PCOB 1VJQA 1IQZA 1LK7A 2YWEA 4CLYA 4ZLLA 1EI6A 5LQQA 5F0UA 5HROB 2XSFA 2VONA 2RS8A 3U1NA 4HT5A 3ISZA 3M05A 3DHWC 3HJVA 1VRUB 4KKOA 4B3SJ 1K8AT 1G4CA 1C0TB 2WHOA 2Z4PA 3Q0AA 2AEJA 1GMVA 3NGTA 2KXNB 2D1GA 2CKWA 2QLBB 3H4DA 1S9EA 2K1RA 4BWJA 4JV0A 4AXIA 3KK3A 3CXCR 4ID5B 3GYGA 1NK7A 4DR5F 5J1NA 2LYVA 3ENWA 2XS5A 2BQUA 2B51A 5E0OA 1WG1A 4ID8A 1TKZB 2BANA 2CPYA 5DQIA 5HSPA 1HNZF 2P6SA 1S6OA 4CH1A 3C19A 4DFJA 4V19J 4KJGA 4K8RA 3GCWP 3WIUA 3OT9A 2RE1A 4LF6J 2WONA 4KFBB 1AZSA 3NCQA 5KAKA 2GA3A 2JLEA 4DU8A 5L0EA 1HI1A 3C14B 2NYHA 3E01B 4OI4A 4EBCA 1KHVA 1EARA 2G9OA 2QL9B 4IRDA 2UXDF 4LQYA 5IFMA 1N6QB 5E3PA 3RBEA 3D6HB 1LQ9A 1HWLA 2I38A 3US5A 3M7VA 3NBPA 3RGIA 4Q45A 2C2EA 2V4QA 4OHYA 3D7SB 2DGVA 1Y3KA 3LW5C 2KFZA 2RDIA 3DLGA 4CYUB 5C25B 1WF2A 2GIRA 1Q8LA 1SV5A 1SKRA 5LL6d 4P72A 3FC9A 2GGPB 4CI0B 4NMXA 2M8HA 1Z2LA 5AE3A 4YY3F 2OPQA 2UUCF 9ATCB 2HS4A 4GVBB 2ZH8A 2RILA 3DCAA 3Q23A 4X4VA 1IXKA 1U0HA 4GMKA 1BE4A 4OYWA 2IJFA 3CIZA 2Z0GA 3AJ2A 3UPFA 3PACA 5HANA 1WORA 5LRNA 1CS4A 2QLFB 5F8JA 1EP4B 2ZH3A 2IM2A 1NLKL 1TL4A 3C14A 3E01A 4CO1A 4DL7A 2WK4A 4J9QA 5F8NA 1VBYA 4OZ2A 1SQFA 2OFHX 2H5JB 4NX9A 1CBKA 1WF0A 2O5DA 3UCZP 4F02A 2HGMA 4IG3B 3JQJA 4ZLNA 5KG2A 3J81j 4FS1A 2C3MA 2XMTA 3VZIA 2M3DA 2BW2A 4AUKA 3RTVA 2QEXS 1M5HA 3MCSA 3ZNJ1 1KQGB 1UL3A 3MHYA 3C6TB 1AA1B 1K47A 2WVDA 2GVDB 3FBBA 3H2LA 3Q8VA 4LR7A 4ZK7M 1H3DA 4OV1A 5HK4A 5CA5A 3TG0A 2W5XA 2J7UA 5HQ8A 5GADU 5INHA 4M5IA 5T41A 3BDGA 5ETKA 4J5OA 2EKNA 2OSRA 2YTCA 3HSDA 1N2LA 2OD6A 3TZYA 1MWQA 5HROA 4AQYF 3IRXB 2JZ5A 3OW2R 2IA0A 2CUYA 2WBRA 5DDRC 1RT6B 2FY8A 4YHHF 3CF5Q 2J7WA 4MKYA 3QJPA 1FK9B 3HX9A 1E6YB 2XHWA 2A6OA 1PIEA 1H73A 3DMJA 3NGKA 2UV8A 2HHTA 4PWWA 2VPYB 5L38A 4C8OA 1QLNA 1YDLA 4KYZA 5KOXA 3JSMB 4Z37A 1SL0A 2GMJA 2CAJA 2EK6A 2LQBA 2JSXA 4DPTA 5DLGA 1RHJB 3HF5A 5LMNF 2X3DA 2FY1A 2M7SA 5AJ9A 4RL1A 2VV5A 2W4DA 3VGVA 1RDRA 1YGYA 3GSDA 4ICLB 5H9EJ 5C24B 3AD8C 3DOLA 5CYMA 2DY9A 4M5DA 3M2VA 3JAMU 4XTTA 1NK9A 2DGOA 3R7NB 3UI3A 3I6PA 2MZJA 5ETPA 4WZMA 1YJTA 4WK1A 2AJFE 5DG8A 3PRDA 1BHNA 2GC8A 4S0MA 5U47A 3NKYA 3G86A 2ZH1A 3DRPA 5HQMA 1AXQA 4L6V3 3RG6A 3BN4A 3MD1A 1JIHA 2KU7A 2L41A 5L0BA 3IDDA 4EO6A 3DGPA 3HSJA 4KQZA 5I3PA 3OUYB 1YWXA 1Q0NA 4NLDA 1DQ9A 4DG1B 5KG5A 5IWAF 5J2MA 1V6HA 2ZNYA 1RT4A 2E44A 4KH0B 3KJVB 1FFGB 1SC3B 3I4PA 3EVMA 2OPRB 3GLJA 4NYPA 4OV6A 3K57A 2JEGA 2ROGA 3IR6B 4FF1A 2CG8A 3BDPA 2KRBA 1WHXA 4ZVOB 2CNNB 4ZP6A 2QX0A 3C15B 3PW0A 4BBYA 2DNPA 2MKJA 2UUTA 5E5NA 1Q1KA 4R0JA 4DSFA 1S72S 4WJBA 1AFIA 1PC5A 2IY5B 1L3VA 1ELXA 4DHVA 1WG4A 4NLPA 1S59A 2WB4A 3T5KA 3SCJE 4QQBA 4WE1B 3PJXA 2DNMA 2OLWA 3K5LA 3KOAA 1T94A 4WFZA 1E3CP 4NEZA 2H3EB 4PXBA 5GRRA 2GVZB 4OI2A 2MZTA 3IGNA 1K1SA 1Q5VA 2CQ1A 2HURA 2MKSA 2V2KA 4L3KA 3EDRB 3KK1A 1URRA 5JJBA 5M2RA 1Q8IA 2GZOA 3MCMA 4B9UA 1MSWD 2ZUGA 3Q8QB 2XMUA 1AT1B 1UJ6A 2KT2A 2WW8A 2C1EB 2M8DB 1OSCA 1L5UA 3M30A 4UPIA 2DNRA 2FHKA 4WTOB 1FVQA 3OR2A 2IFXA 3NY0A 4UUXA 4C8LA 2ZVSA 4UY8T 3HK2A 4CLWA 2HWTA 4KPYA 4EZ9A 2VFRA 4RUHA 4FKYA 3UO0A 1P27B 2F65A 2IVYA 4H4OA 5E41A 1OY9A 2P9GA 3EMTA 3FKBA 3O6QA 3LA0A 4KR0B 4ZIWA 2R3VA 5HLFA 4ELUA 2UXBJ 1YBUA 3V4IA 3MEEB 3TRGA 4UORA 2M88A 4KAIA 3D54A 3FFIB 4HT7A 3THPA 2B5JA 1TAQA 3CC7S 2ZBRA 3CMQA 4FXDA 1P1TA 1YZ6A 1Y5IB 2Z2MA 3TAQA 1AUDA 2FVQA 2IDLA 1KBRA 1RBLA 2HG4A 2YQ0A 3HVAA 3KHLA 1VRTB 3SV4A 1SUQA 3D2WA 2VA2A 3GJSB 3WZ0A 4P74A 1NXIA 3R5BA 3GZ7A 3ISNC 4IH7A 4OYXA 4MTPA 1HIYA 1C0UB 2G1DA 3QLHB 3FEYB 2YPZA 2CJKA 1RTJB 1UW4A 2DITA 2DR6A 3CNQP 4ALZA 5KTQA 2IMWP 3R7BB 1R8CA 3W3SA 1BC6A 2AJ4A 3OSPA 4DV0J 5TJ3A 2ZH6A 3BO2A 4CLFA 1CQNA 2GMLA 1X8DA 3GIRA 4LRCA 2E9RX 3GJRB 1HPZB 3TARA 1HA1A 2CADA 1FA0A 2COLA 5JMNA 1B99A 3RW7A 1TL1B 3CD5A 3SCLE 1X5PA 2HNYB 4IFYA 1NEEA 1ZPWX 2QLXA 1CC8A 2PA3A 1ZOTA 3AHPA 4O44B 2KXHA 5EUHA 2NPFA 5KFFA 3NGDA 4D3HA 1FKAF 3EICA 4W98A 3SXLA 4ZHRA 5KFJA 3VAJA 3ENQA 3CCTA 1APSA 3MMAA 3NKPA 4UOGA 4MIBA 1ZM4A 1MROA 4CTAA 1U0SA 1VHIA 3CJRA 1N88A 2Y1RI 3IWNC 3CCRS 2R7VA 4NLRA 2GO9A 2GA7A 3MM8A 1QUVA 3G6YA 1WI8A 2HNDB 1VQMS 1M5VC 2KG1A 1FTCA 4KFBA 2WONB 4P2FA 1QE1A 2L3MA 5HJXA 4O3SA 2HVDA 3VVUA 4WK3A 4Y00A 1RQ0A 5FD1A 1S5ZA 3HSGA 1RAEB 1FRXA 2VQEJ 2BE7D 1VMBA 2V8DA 3HZGA 5RUBA 6FD1A 1A9NB 4DCPB 2KFYA 1YBTA 3DOKB 1PBAA 2XULA 1IN0A 1UETA 1U1KA 1PILA 2P6TA 1I94J 2WVCA 4QAXA 3CD0A 3KMQA 3FDSA 1RAIB 3OSNA 4DZDA 4RX6A 2DR9A 4B3RF 4YB7A 3MURP 4MAKA 4AE5A 3OJSA 4PWDA 3JXOA 1XMOF 1OY6A 4FXWA 3IG1A 5A8RB 1N34J 1JLFB 1HBMB 3KLHB 1E33P 4NA2A 1NDCA 2XMAA 2BOAA 3QGHA 2HAFA 4UT4A 3N28A 1FKOA 2VKZG 1IBMF 2FHJA 3CCSS 1LV5A 5A2QY 3FQKA 4KB7A 1RAAB 4OZ5A 1S1UA 4ES2A 4J9VA 3V6HA 4AYBD 2SXLA 2VC1A 1NKEA 3DYCA 4DOZA 4QIFA 2NXJA 5HI7A 4KRWA 3ONQA 4JI1F 3FBFA 2NZ4A 3IC1A 4U67Q 4K7QA 1S1TA 3R5GA 4B02A 4LFCF 1FDNA 3QIDA 2LDIA 2XWYA 4OX9J 1ANIA 2ZBQA 4O4RA 4ANDA 4XIUA 4DV0F 4M5NA 2R8KA 2ZFHA 3SSSA 1SC1B 1SJRA 5ETMA 1S6QA 4DN0A 3CMES 3L7OA 3F56A 4C0BA 3HVRA 4A8FA 3BS9A 1NJIT 1EX8A 1Q81T 2VQFF 3M32A 2DGUA 2J6SA 1HYSA 5ETVA 3T6BA 4CNZA 1IBMJ 4J9KA 4C4WA 3LP1A 1PGZA 1M5PC 2HQIA 4KHPJ 2KVQE 2FC8A 2D3UA 4Y2MA 1HBOA 5KG3A 1RT2A 4HH0A 2BRKA 5HP1B 1NB7A 1LWXA 4FVCA 4N7TA 4EUVA 3SCKE 5KFCA 2XLJA 3T5JA 2RRNA 4D3GA 5A2QU 5I3UA 3EXYA 4FYVB 3TQEA 1GH8A 1SH2A 5LXYA 1CJTA 3D1OA 5A0YA 2C2NA 4EGLA 4IFVB 4KJIA 2HRYA 1S99A 2IM0A 4A8WA 3BBFA 4P75A 4DR6J 2PGCA 2B9YA 2AKWB 2J7KA 4M5HA 4C8YA 2J8AA 5IC4B 1WC1A 5KFBA 5HRTA 1WHVA 4M1KA 5SUHA 5BYRA 2XMWA 5EGEA 3EGWB 4I56A 4JI3F 4XK8C 5MLCV 2CPJA 3KXDA 1RBOB 4DXLA 3CJ3A 4JV1A 3CE8A 5GAHI 5GAGU 4LFCJ 3MK0A 5IJQA 4J37A 2W5TA 3R3TA 4CT9A 1ZEBA 3N4WA 2B9XA 2QMUB 2ASYA 2Q1LA 4B9VA 1OPZA 1CJUA 3KK2B 2DGWA 4X4NA 3KJNB 3GSIA 2I5JA 4RNNA 2C2ZB 4Q2MA 3HHEA 4IH6A 1MROB 3RB6A 4GC6A 5E3RA 4OQJA 1QDUB 4IO9Q 1VQ5S 4QYZJ 4MIAA 4JI4J 3MR3A 4YR2A 2OTJS 3VAKA 3B5QA 4USUA 3J7ZT 2W8DA 2R7SA 2XMVA 5AXKA 3A8KA 5HATA 3GMGA 2D9PA 3HVTA 3IWLA 2FVCA 1J2VA 1SIZA 2PDAA 4C11A 4O3RA 2E5JA 2AGQA 3VF0B 2NYIA 4WBFA 1JLQA 2LFVA 4A47A 1RT5B 5KFWA 4JV5F 4WIIA 1VQYA 3KLEA 1CJVA 4AQYJ 1I3OB 3QWUA 5GMEA 1HW8A 3LP2A 1XMQJ 1HPZA 1WC0A 3M8QA 4GO5X 4M95A 2FIUA 2ACMA 4CXSA 3CW2C 1UAWA 3IAM9 4G65A 4PXCA 1RA6A 3VQTA 1MNEA 2FJVA 1REVA 3PX0A 5GMDA 2YXLA 5B0EA 3S7RA 3VHQA 3WAVA 1X9SA 1QTNB 2OH2A 3CJ5A 2W4CA 1R8BA 1MG7A 2MKYA 3M8RA 1FDDA 3KHRA 4LFAF 4LRAA 1TKTA 2VG5B 1U24A 3CULA 1NK4A 2W24A 2W5RA 2XMMA 4URGA 2HNYA 4DR7J 3JQMA 1JLFA 1YRTA 2LEAA 3W5YA 1GNKA 4LF7F 1HMVA 2ZH5A 1ELYA 3IBCB 3V4IB 4PQUB 1RABB 2LQJA 1NK6A 1Y7PA 1Y5NB 2KB2A 4W4MA 3SFGA 3AXKA 4X64J 4JI5F 2GHWA 2OPRA 1DAXA 4EK2A 4EU0A 1N5YB 2HVHA 3QGGA 5GOVA 3BSOA 3TAPA 1FJ7A 2F40A 3E51A 1N36J 4IUFA 5J2MB 1KEKA 2YNGA 4OHZA 2J9DA 2YKQA 1U49A 2RQ4A 2PSZA 3MM7B 4LSLB 4U8VA 1T11A 2Z2LA 4QWDA 3G6XA 3T1HF 3OD2A 1Q86T 2C2OB 2QSFA 2RS2A 1TR0A 4X65F 2VIHA 2MEWA 3HFZB 3GTYX 4K2JA 3V6DA 2FVPA 1UVIA 5DZ7A 2V4JB 3VAHA 4CYSA 3KHHA 3MEEA 1JX4A 3KTQA 3NL0A 1QAXA 3U7JA 5DLTA 2DVIA 3A8EA 5CCMA 4N5SA 4ZJLA 4ZVQB 5T14A 3C16B 3SSQA 1S4FA 3D0GE 2VFTA 1N48A 1N34F 3J7YI 2BM1A 2NXCA 4ES1A 3W2WB 4LF5J 4PUOB 4LFBJ 3K5OA 2VBYA 3CVKA 2J6TA 4K4SA 4OX8A 3MEKA 2VASA 1FDAA 3MEDB 4URSA 5E3AA 3Q8PB 3OL7A 4JI5J 5CYQA 4CWBA 2HNZB 1RAHB 4NLSA 4U96A 4N47A 5A6PA 1U1MA 1RTDA 1PAEX 4JI8J 3QSIA 3TI0A 1H0HB 2VU5A 5KFIA 2E1AA 2E1RA 2IAJA 3FQLA 4DUZJ 4A8SA 1NSPA 1MU2A 2ZD1B 5AT1B 3ZZRA 2XYHB 2XO6A 3DXSX 1R0AA 2B6AA 2W25A 3KD8A 4RWWA 5F8IA 2G13A 1X9MA 1VQKS 3KLFA 3MDFA 2CZVC 1HWIA 2QV6A 1HBUB 4HHJA 4CLZA 4JV5J 3UNGC 2B8QA 4DV4J 3WAXA 2FDNA 4NE9C 1C0UA 2GLQA 1JLEB 2BRLA 4EI2A 3D67A 2MPUA 3MWBA 3KJFB 4GTZA 4NRTA 4YY3J 2B9WA 5L9NA 3OTOJ 2D9OA 4WKYA 2V50A 3OL8A 3CMAS 3WC2A 2VG6A 4GKKJ 2HVIA 2HK3A 2R2UA 4IOCQ 5C2CA 2W5QA 2CWKA 4DLGA 4USHA 1L3KA 5AXNA 2ZH4A 1HD1A 2FPHX 3MPDA 4I6YA 3WHIA 2R8IA 2DISA 3W62A 3KUHA 5F0WA 3PYGA 4FDJA 3SIPB 2AYBA 1VC6A 2QSWA 2B4PA 4JV2A 4P7VA 1VBXA 4OYOA 4CRJA 4ZCMA 3KJVA 4LF4F 2V68A 1P49A 2HBZB 3OUYA 1HQEB 2K2PA 2G1HA 2E1CA 3CJ4A 2R8GA 1Y7AA 2HZAA 3D0HE 4C3KA 4ILLA 1WNEA 4PG4A 3S1TA 1WKKA 2ZEJA 5CCLA 5I3QA 3PEHA 3QYYA 1U0HB 5J2NA 1F9HA 2CJAA 1TU0B 1KOOA 1U2CA 2UVVA 4NLGA 3ZFVA 5D4OA 4TQRA 4L76A 1GXUA 3HHKA 3QBCA 2BUNA 3NEKA 1RT6A 2HQDA 4NZ0A 5KG1A 1CULB 4QPTA 1RACB 3R5CA 1HR0J 3HVWA 5C24A 1VQ8S 2ANHA 2P5VA 2ZOMA 4CLTA 3MOZA 3BO4A 1YQHA 4GO7X 3BYRA 2FHMA 3CDAA 4I2PB 1TL5A 4M63A 2W9BB 4ED2A 2AZ1A 1RK8A 4DJBA 4UZBA 2XY6A 2YY3A 3QRQA 2ERRA 4QCLA 1FXLA 2RKIA 1RTZA 4UTGA 3T41A 2IVMA 1AZSB 2QA2A 1GTHA 5HVFA 3F44A 1VGYA 3LF0A 1WJ9A 3UN3A 3EM1A 4F04B 3DM2A 4DV3J 3RAQA 1QAJA 1TKXB 4QOTA 3FGVA 1TV6A 4DR4F 4CZCA 1D9DA 4KHPF 1UVMA 2XBPA 3MM7A 4IRCA 1ITPA 1ELOA 1MMLA 1M0SA 2QZ8A 3C3LA 2ATLA 4ID5A 3TOQA 1SBRA 2YWFA 2WSFC 4DCJB 4DDFA 4DBQA 2GV1A 2EI5A 2BZ2A 2LLZA 3H42A 5AXMA 3CCLS 1CS4B 2G2OA 1IKVA 2PEBA 3RRGA 1ULRA 5KOWA 1F2HA 2ZBPA 1NKCA 5DLFA 2R4FA 1J5EF 4F8RA 4JI6J 2BKNA 4HLBA 3T1YF 2KDOA 1EKRA 1HMVB 1K1QA 4OHVA 1IJEB 2EBEA 4A8OA 5D15A 1JQGA 4Y28C 4KV8B 3R5JB 3LP0B 4CLUA 4B3TJ 4OX9F 4DFPA 1EQJA 1PJ5A 4LRDA 4ZG7A 2MXYA 1TKTB 2XTJP 3SBMA 4AXJA 2NR0A 2KT3A 3TX8A 4DR1F 4NYZA 1R3NA 3DOLB 3ZZPA 2X1GA 4MK9A 3QO9B 4DUZF 3PZPA 2HFVA 2BABA 4LT6A 5J2NB 1UEKA 2PI4A 5L1LA 1R27B 1Q5YA 3BPDA 2IM3A 1VS3A 1X0PA 3AB2B 5CD4A 3ZZ0A 1HW9A 2F1FA 1HQEA 3ELHA 1JNZB 2JC1A 3JB9k 5IJSA 1B8JA 4C8MA 1Q53A 1VQ4S 4MJKA 1D0EA 2AHOB 3OR1A 2VQRA 4Q2LA 2P9CA 1RT3B 3PYFA 3Q8YA 4I67A 4GTXA 3BSAA 3MMCB 4DF8A 3IO1A 1U4BA 4L73A 4F0KA 5LMUJ 5AJ3F 1U7LA 3HJFA 3OV7A 3KK3B 3NMAA 1M5SA 2EW9A 2AMCB 4X65J 3NLCA 1UA0A 1CG2A 2N3LA 1YRXA 2KHCA 3UD5A 2AP6A 1WSRA 3A3NB 3S6EA 3CJQA 1IKVB 3DDKA 4KT0C 2KN4A 4PAAA 1NRKA 1PSDA 1VRUA 2I0XA 2PA8D 3LPYA 1H72C 1HL6A 3GJTB 4DR2J 3DLLQ 4CO3A 4ECYA 1FHTA 4CO4A 5KFQA 1Q7LB 5HO4A 2N7CA 1X4AA 1AJAA 1KDNA 2VDIA 1MW7A 2GAHC 1TV6B 1RKIA 2V8GA 4NOHA 5H9FJ 2K3KA 5A8KA 3EX7B 1JJ2R 2LMIA 2WVBA 1TKZA 2BANB 3CGIA 3W8GA 4F36A 2KHDA 3DLKA 2IAJB 4QWBA 3GR1A 2R7RA 3PO5A 3MF5A 4NASA 3MXHP 4Q0BB 3MK1A 5B0BA 2CJQA 1NZAA 4OIXA 3KLVA 2NREA 5CYQB 3R6LB 1UWBB 2OI2A 4P9SA 5L0KA 2W7PA 2Q6BA 3HFKA 2GJFA 2HKEA 4HI2A 4RW7A 3QPIA 1Q78A 5KFLA 1NCLA 4NI2B 2HRTA 2OHDA 4FPIA 1UA1A 1E1ZP 3Q86A 3QSYB 1HNWF 2W8SA 4FP9A 3WAYA 4DR5J 3H5SA 5CABA 1FJCA 1T0TV 3BDEA 1YRUA 2DGSA 2LXIA 2RF2A 4HHUA 4CYUA 3B54A 2OELA 4RW4A 2MKKA 3L3CA 1RT7B 3MTKA 3GQCA 3V6DB 4OZLA 3NGSA 4HH1A 4JI8F 1Q82T 3NOGA 4ECQA 1O51A 1KLNA 2DXDA 4DSLA 1T9XA 2IYGA 3CD7A 1IVZA 3RAMA 1N32J 3AA8A 5IS2A 3L7PA 3CCES 2VJVA 4O4GB 1UMJA 4WP8A 4F50A 4QIVA 2WOMA 2IC3B 4NXMF 3H20A 4WP9A 2ZH2A 5KFDA 4UPLA 4KAYA 3G8QA 1CPZA 4PYAA 4J9LA 1FERA 1SJ3P 1ZBTA 1KVIA 6FDRA 5EGYA 2RUGA 3FEZA 3G9CA 4BDPA 3R5AA 4HKQA 2MQLA 3N79A 2ZITA 4HTJA 2ZKTA 4B17A 3CIMA 5LJ3Y 2ZM6J 5L8RC 5DM7Q 3RU0A 1QTMA 5C66A 3PTWA 3JAMY 5KFYA 3AFGA 4JI0J 4LF5F 1SI9A 1CC7A 2B4VA 2XCPA 1E6VA 2J0QD 2C22A 5CQGA 5D78A 2L9DA 2QIFA 3B4DA 5BYQA 4J9UE 2RH6A 3LQVA 4YQWA 2Z30B 3W7BA 2LQ8A 4CM2A 5CAAA 5LIAA 3BN7A 1Q16B 2M4MA 2QYGA 3I0RA 1VQOS 2VD3A 3K59A 3C6UA 3ISND 4M5JA 1RWWB 2AYGA 4QIEA 3ZTOA 4RU9A 3HLUA 3KLEB 3ICLA 5DZ6A 4J90A 3K58A 2FLPA 2ZBIA 1FNOA 1FKPA 3EZOA 3M2RB 2PIIA 2V2ZA 4U9RA 5D4NA 5ETRA 2IVFB 1HNIB 4WFBQ 3JYTA 2AWZA 1U6FA 4DV4F 1NHKL 5L39A 2PFFB 1AJBA 4I2QA 2BJ1A 4OYZA 3J7YU 4OX6A 1SL2A 1ALIA 1D8ZA 1QM9A 3GV5B 1YJ7A 4CLPA 3WQPA 2AW0A 4JBCA 5IQ6A 3B82A 2HFOA 1NPRA 3DYAB 3MUVP 4OJ1A 3C16A 4N8NA 2VBZA 1G6BA 3AB4B 4IOBA 1LW2B 3VAIA 1K9MT 3SZYA 4USTA 1Y4ZB 2EFVA 4QZVB 7AT1B 3P4UB 4KO0A 3SDEA 4F7VA 4DUYF 4UY85 2HNDA 3NKMA 4KAVA 2QT7A 2GW8A 3FJ2A 2V4JA 4DFKA 1NH7A 1RCOB 3D66A 4LVNP 2Z58B 5KFKA 3GV7B 2YKMB 2J8SA 3IM8A 2UUAF 1VQ6S 3ED4A 2LCWA 4B08A 1AUKA 3GIKA 1HHQA 4G1PA 1ZAXA 4LRBA 3DYAA 2JFDA 4W90B 2J9CA 3PNIA 2DR7A 1GXTA 1X60A 2XSJA 1UJ4A 2ILYA 3D28A 4P6QA 4G1QA 3T01A 1T8EA 3VAFA 4MFBA 4JUZA 4NWBA 2H48B 3N0VA 1NJZA 3A12A 4WYLA 1HJKA 3MTJA 3FBEA 4OFZA 2Q66A 3TJ8A 5LMNJ 4IFVA 4LQ3A 1U6BA 1YJ9S 2IM1A 1NAQA 3SYZA 1EQ0A 5B08A 3K17A 2X1AA 1WHYA 1IKYB 2E5LF 4RZRA 4KTQA 1OMSA 3BKUA 3HFVA 5E2QA 4ZN1A 4RUAA 1UP1A 1PBUA 2DNHA 2DHHA 3SZ2A 2DR5A 2RHSB 1MMNA 2XSJB 4LSNA 2CQPA 1J27A 2DGQA 3R97A 3IM9A 3WC0A 3GPAA 3LP1B 2DIUA 4ZP8A 2DB1A 2CNOB 4F4KA 1RAOA 1X5SA 3KJQB 3NCPA 1JLAA 4NLOA 2CVEA 2GSUA 2F63A 5IWAJ 4DQSA 4EWTA 1VBZA 2DRBA 3RW6A 1XMBA 2WCXA 1R89A 4CP5A 2CPEA 1B70B 3KG0A 3MPUB 3CO0P 2HHXA 2JFKA 2QC3A 1S6QB 4YDXA 4LFAJ 4KO0B 5L1JA 3DLBA 1P8GA 4USIA 3TUJC 2F9JA 2YX7A 1TMMA 2HW3A 1U8WA 3OJUA 4PKDB 3GIJA 1RT3A 3RRHA 1WTBA 3CJTA 2DR8A 3K5MA 3MD3A 4WIQA 2MDAA 5EGHA 3D1HA 3MMJA 2RSQA 1BGXT 1H2UX 4UOFA 3CCWA 3DXBA 4X66F 3FUYA 3AY0A 4ES3A 3M6XA 1YBAA 4KHMA 3IA0A 4ECVA 1FKPB 3SQGA 2HFNA 2IUCA 1JXEA 2PEHA 2XC9A 4JB8B 1RU2A 2E7VA 2RF2B 1EZZB 3G82A 3I0RB 3O44A 3RYLA 1ZZFA 4P2MA 4ZVEA 2YWHA 5GAGI 2MYFA 2VF3A 5A6WA 2YVSA 1X5OA 4ZVFA 4BCAA 3VAMA 3KLGB 4KV8A 3NGUA 4A8KA 3PVXA 1SXLA 2A3JA 4NLXA 3AJDA 3THTA 3TWZA 2FJBB 1T03B 1PJ6A 1JJHA 4PWDB 3JTNA 4RW7B 4UZCA 2R2TA 2XMJA 3I0SB 3UDCA 5KG6A 2JRSA 5DQHA 3U27A 2E66A 3E3XA 3KFWX 4LR8A 4I69A 3CDEA 5B0DA 5ITHA 3QJLA 2A10A 1RGVA 1UZHA 4OMFG 5D0EA 5DGBA 2B7CB 1DY3A 3D9BA 1VBKA 1NNDA 1M1KT 2O66A 2GHPA 1Z1ZA 2ASJA 1YJWS 2O01C 2HHQA 4Q8FA 1U47A 2H54B 2R7WA 1RCXB 3A8IA 1KLMB 1Y0HA 2NUUG 4O3OA 2WOMB 1S7IA 1JLBA 4J9RA 1XR7A 3CSKA 2XS7A 2DHXA 1F3FA 1V5IB 2IRUA 2R42A 1REGX 3S01A 4UW2A 2QGFB 1T9WA 1WOOA 2GAGC 4OI3A 5K8OA 1H7WA 3G71S 3RR7A 3NNHA 2DNGA 1NZ8A 2YX4A 1SVDA 3GYXB 2W9BA 3MAQA 1XMOJ 1HYSB 2A0FB 1RU1A 2JNJA 3JQKA 1D09B 3WAWA 3GONA 1S12A 5D4PA 2H4WB 3JSYA 3T9NA 3ULHA 4RNMA 1QSSA 2UXBF 1BWVA 4IFYB 1GMUA 1TP7A 8AT1B 1LW0B 1QSYA 4DWIA 3NVLA 2W7OA 4DR1J 3RB3A 2W5WA 2WW4A 2RQKA 1TL7A 2BACA 4YB5A 4AD6A 4ZITA 5C5JA 3NNCA 4OYBA 2FC9A 1WEZA 1KHLA 3KDNA 1IR0A 2CQCA 3NP5A 4DV2F 2D1CA 1N0UA 2I1RA 2HLUA 3V4MA 1VRQC 1OPIA 1UW9A 3ZO7A 1C1CA 4X62J 3F73A 1S1XB 1NPPA 2CJYB 4Y3CA 4KH1B 2EFPA 3M9MB 1S1UB 3K5NA 1IKWA 4I6AA 1NUEA 5D4LA 1Q8BA 1NH8A 3IGVA 4NLQA 1VQNS 1R8PA 2CDQA 4ZVTB 1VC0A 3E2DA 4F3QA 4K4VA 1FK9A 2OD4A 2OMOA 1RISA 4GRSA 3BKTA 4NCGB 2W9CA 3HHNB 1NU4A 1JJCB 3EE3A 2EPIA 3OTEA 1LK5A 1MLAA 5A8RA 3UDVA 1KNZA 1ELZA 4V1Ak 5ADZA 3NKQA 2HRUA 2YNIA 5KFSA 1T3NA 4V19X 1KHJA 1CLFA 3QFWA 4HVZA 4ZPBA 5HVHA 3QZ7A 3M8ZA 2BE9B 1OYDA 3LAMA 1VIOA 2GVDA 4LF9F 4OYMA 3DOKA 3NAHA 1X0FA 8ATCB 4IDKB 4IRKA 3FSIA 1LWEA 2LQ9A 4DX7A 3OR2B 3C2PA 1R6YA 1LXNA 1LWFA 2DHSA 2X1FA 2HVZA 1K7HA 2DY1A 1L3TA 1N5SA 1SJQA 1PYTA 1ZYQA 4WWSA 4ECRA 1R31A 1OWXA 3OTCA 1MN9A 1RTHA 3U1LA 4F25A 4YUDA 2FJXA 1PYOB 1K0VA 1YTYA 3CUNA 5C42A 4MMOA 1T9VA 3R6GB 5F3TA 4C2MA 3I55S 3MECA 4X84A 4GKJJ 2F8MA 3HULA 3FK4A 3EWGA 5GAEI 1RTIB 4PG6A 5H1SV 4N41A 2KI2A 4DSIA 1X4DA 1MN7A 2O3DA 1RT1B 2ZWPA 1RHKB 3MAAB 3IRWP 1VHFA 5L1IA 4ZHRB 4JOUA 2AX1A 3LPEA 4DR3J 4CLKA 1R0CB 4M5KA 1SL1A 5DDPC 1VIXA 3QIPB 5K14B 2C3PA 3D68A 1OYEA 1RSCA 3AODA 4QIWD 3UWTA 3H7HB 2W2QP 4IR9A 3QFHA 2MJUA 3LP0A 4R5PA 4IKAA 3MECB 1T95A 1VLOA 2DBBA 3D5MA 1OJ4A 3OFEA 3W2VA 3HT3A 2ZH9A 4HYKA 2K7JA 1AYEA 1K0TA 2GSOA 3MM9B 1KFSA 2WRMA 3O1LA 1UKUA 4WXWA 1FWPA 1EW9A 2FLNA 3MM6B 1F6TA 2P2CB 3BKFA 3LWMA 2R7OA 3OHBA 2UUWA 4EBDA 3J7A1 2IRYA 3AA9A 1FX2A 4LREA 1LWEB 4NLVA 4U7UD 2V9KA 1F2GA 4XPCA 4U8YA 3FRZA 4OYPA 4ED3A 1FJGF 1RWXB 2VB6A 4IYQA 2BE2A 2HEKA 2RQCA 1WACA 2ZE2B 1SUQB 1N5YA 2N4CA 5HJYA 2DRDA 1IUJA 4U95A 4R8UA 1B4SA 1S48A 1GX5A 2QTWA 1FFSB 3DRSA 2DJWA 2VPXB 1QJHA 4I7FB 5AXLA 4J9OA 4UUWA 3VVTA 3PG9A 3FMWA 2J0SD 2VG6B 1S0OA 1LFPA 2CPHA 4H4OB 2W4PA 4LBPA 4DI6A 3GIMA 1T7PA 2NUHA 1FWLA 3PJ9A 4KKOB 4JI2J 1KC8T 4PWUA 1RB0A 1CULA 1U25A 4KBIA 4RW8A 1U1QA 2NSCA 3ILIA 4ATNA 2CG4A 4G1IA 1TK0A 2WVFA 1NK8A 1N33J 2J9EA 2K06A 5FDLB 1OQ6A 1YZ7A 1NB2A 3KLFB 2W7AA 1S1WA 4QR0A 1WHWA 3KYLA 4ZVUB 2RNEA 3DI6B 2ZD1A 1Z2ZA 2W2PP 3MMBB 1O5JA 2CQ0A 2JLFA 3I5CA 2BEFA 2V8HA 4NPOA 3ZTPA 5L46A 1XEZA 3DN9A 4CCHA 1FFWB 3V5RA 1E6YA 1JLQB 2YWWA 5M2PA 1BUXA 2DNZA 2AYEA 2AZ3A 2EG2A 4ELTA 1WKJA 3IRXA 3R8YA 4ZLJA 4RW8B 2KZMA 2QN6B 4FKXA 4WE1A 5K8MA 3T1HJ 3OXLA 4B9SA 4DV5J 1IBKJ 3VGTA 4ZPCA 1JJ4A 5F8GA 1YK9A 4GKJF 2DNKA 3Q8SB 1TAUA 1RAGB 1IR1A 5D0HA 5IM0A 2VC0A 4YR1A 2E5HA 2W2MP 3NMRA 1HI8A 4PEOA 4F4AA 1VI7A 4OZ3A 4DU7A 2CQHA 2G2YA 4NCGA 2W9CB 4FYXB 1YHQS 1HBNB 3P8BB 1NHVA 4CIOA 3SFUA 3MK2A 2VPWB 3DDNA 4DX8H 5KFNA 2A18A 1N54B 1FRJA 2B7BB 2BE2B 1KVKA 2HQGA 2MY8A 3P45B 5LT5A 5DETA 2MHEA 4ECUA 3MR7A 4ZPVR 3QAUA 2GNKA 4RW9B 1RT4B 1WI6A 1LWCB 3DGVA 2I6WA 2AGOA 2G9YA 1FWKA 1S77D 1DQ8A 3GG0A 2RH3A 4A4JA 1UVNA 4GKKF 4WF9Q 1HBUA 1EP4A 1WDDA 2EWHA 3A3OB 3AJ1A 2VOPA 3IR7B 1SQGA 4ED6A 1N32F 4HI1A 1S79A 2X7IA 5B09A 4J9MA 4FF2A 3HZEA 4DV5F 1IBKF 1P9QC 2ZM6F 4A8QA 4PQUA 2ASLA 1LNQA 2MKHA 2HPUA 4ED7A 4HDGA 5KG7A 1WUUA 4HTIA 2PC6A 4DQRA 1SV5B 2WVEA 3ETMA 3DLHA 1RT2B 1TQLA 2B9EA 2EEYA 3G4SS 2GQCA 1UFWA 2ZHOA 2NLWA 1S6UA 3H2UB 2PMZD 4CH7A 2R2RA 4F4WA 1TUGB 3RZAA 4C9DA 2CQ4A 1FI4A 1XBWA 3KG1A 5DG9A 4Q44A 3HMJG 4K4WA 2Y1JA 2XS2A 3ITHB 2M52A 1RLCL 3KMSA 4OHWA 3NRBA 2X98A 1VR6A 3M8QB 1SPBP 2FGCA 4EO8A 1LEOA 2MLYA 1N4LA 1MWZA 4ELVA 2CJBA 3RBXA 3HHLB 3DMJB 3T9ZA 3PR5B 4WKRA 4BLGA 1FJEB 1VK8A 1D3WA 1NKBA 4WPAA 3CDWA 4GC7A 2VOOA 2HGLA 2KFNA 3POTA 4QWAA 1KH7A 4RPFA 2ASDA 2UP1A 4IQXA 3MPWA 2KVIA 4F4XA 1F3VA 2C2MB 2K1RB 1S9EB 1WF1A 2ZWOA 4LJMA 1UFLA 2EXUA 4KIAA 4ZPWR 2Z57B 3BDGB 2PN6A 4DV7F 1L3SA 1A6LA 2UUAJ 2POKA 5T7LA 5G0RA 2HVEA 1NK5A 2CZ4A 1U8SA 1T05B 4K0KF 5KFVA 3NOCA 4OYIA 2BXJA 1U26A 1XN9A 1Y00A 2N82B 1ALKA 3M6UA 3D0IE 3CDBA 2KJWA 5EX3A 1RHQB 3IBFB 1FKOB 4MT1A 4RBVA 2MY7A 4RU2A 1K44A 4LBIA 3CDUA 3CCVS 4X4QA 1TL3B 2VG5A 4TU9A 1IKYA 5D77A 2HQFA 2XQCA 1RZMA 3K5PA 4AFFA 2E5GA 2H4YB 2Z56B 3R7SB 4DPOA 5HMWA 3MR6A 4O23A 5D3GB 3Q2SC 4MFBB 2XM3A 3FCWA 4P2SA 2RU3A 1Q8KA 3TAMB 1FRHA 1RWMB 3BGFA 2XCAA 3OQ2A 2JX2A 1AFJA 3CJKA 2CRLA 4ENOA 3Q8UA 4PXEA 2W8KA 3PX6A 2QA1A 4Z7CA 2BBEA 2KTQA 2R7TA 2GCFA 1M1HA 2XY7A 2H5IB 4F0HA 2J6UA 1BQNA 1DTTB 4TLQA 1FT8A 1TK8A 3O5TB 5CYJA 4FBTA 1T9UA 4KGZB 1KHNA 2HQCA 2QA4S 1WEXA 4I68A 4O3QA 3TUZC 4I1TA 2ALYB 5KT7A 4YR3A 3R1LA 4UOCA 1U45A 2LKZA 1FF2A 4N77A 3ZZOA 4P73A 1Q79A 4FVMA 5GAEU 4JI7F 3NNAA 3MGJA 1WOSA 1RWNB 4USKA 3D6FB 5C2GA 1N6QA 2FVSA 1DLOB 4DL4A 3MUTP 4ILMA 1X9WA 2NQPA 3TZZA 3D1QA 3MAHA 4LSNB 3DU6A 2I5JB 4TKTA 3CJ2A 4XO0A 2HLTA 3OVAA 2VL1A 1IBCB 5IOLA 2QYCA 2DGXA 1QD1A 1WELA 1BQNB 1SKUB 3IBWA 1RWKB 1WTFA 1M1GA 4OJGA 4OZ0A 4PG7A 4H4KA 4CLSA 2MQPA 3M2RA 1BY9A 3VGSA 1TL1A 2RMLA 3UVJA 3DHXA 1KSPA 3HCXA 1GMWA 3EXCX 4DZ6A 1IBLF 2X1BA 3M1VA 4P7TA 8RUCA 2HBRB 3Q22A 3A13A 5LSRA 4NWXA 4KGXB 5JXSA 3TAMA 3NG8A 3U1MA 4DV6F 1X4EA 2BJDA 5DM6Q 2HZVA 2AF6A 2H51B 1HKAA 4G1QB 2OSQA 4RUCA 1BQXA 4NL5A 4LF4J 4UPHA 1PCAA 3MM5B 1RTJA 4LF1A 2XB2D 1SCJB 2OP5A 5DS7A 5E7OB 4FPRA 1B0PA 3A8JA 1EAYC 5F3ZA 2VHGA 4DV1J 1ZTTA 4MY4A 2HBYB 2Z2ZA 2CPXA 3WBHA 2EKYA 1ZA2B 3UE2A 3KLGA 2P8IA 2YKMA 2VH7A 3GFYA 4HEA9 2RJZA 4C98A 3PW2A 1HI0P 4B3RJ 4A8XA 3IG1B 1EHWA 3J81Y 1QAIA 3PY8A 4ZJQA 5EDWA 5HLFB 1O98A 4LIRA 5D0GA 3A1YG 4JI7J 1GX6A 3BR9A 1UZDA 2MZRA 1SC4B 3I87A 3TUIC 4YFUA 2BQ3A 4F2RA 3K2YA 2FZKB 1JXVA 1DQAA 4TYAA 3AOAA 5EHHA 4NCBA 1KH4A 4O4GA 4BC9A 2B0GA 2OTLS 1FO1A 2G4BA 4K0KJ 5CZVA 2MTLA 1EJ7L 1ZEFA 4WFXA 1TK5A 3G8SA 2Y0SD 1TUVA 2LU1A 2IYIA 4EMDA 2MZQA 3SMZA 5KFZA 1RUSA 1Y5LB 3OVSA 4CT8A 1ZPVA 2IMOA 1EETB 2Q6CA 4M5GA 2D74B 2MZ1A 1R0BG 4ER8A 4ED0A 2LP4A 4NYOA 1KN6A 5E33A 4DQQA 3ITHA 2XHCA 4ILRA 2X3GA 1GFWB 3IN5A 3UFCX 2VBWA 3DLJA 1S57A 2DT9A 1NSQA 4JI2F 2LVWA 7FDRA 4NWJA 3UN2A 2OMLA 4LRFA 5ETOA 3DC2A 3E2EA 4B9LA 3TR5A 5CD4H 2E5IA 1JNRB 3G96A 2B3TB 4GVLA 1GXLA 2DNQA 2ZC4A 3KLIB 2RRAA 3C8YA 3I9ZA 3LO3A 1J5OA 2XI3A 1YJNS 1URAA 1S6PB 4B3TF 3ZZUA 3N01A 4K50A 3BBCA 3Q89A 3T1AA 3TZXA 2E1PA 3C46A 5F8MA 4QPXA 1UCNA 4F26A 2V0NA 4H54A 4ZVPB 2ZE2A 1FD8A 2GMHA 1T9YA 4Y2AA 1S1VB 1VJWA 2CXEA 4C3LA 5KT6A 3FVYA 1G3OA 4W92B 2G0CA 2JVOA 3KUEA 5DJBA 2OKQA 3DGPB 4QW8A 4ECTA 2HWHA 4CH0S 3NKNA 2FHJD 4RKUC 4USWA 3MR2A 2AD9A 1RI7A 1JLCB 4O0NA 2BDPA 1DTQB 5ETSA 4DR7F 3LGHA 2BV3A 2OPSA 1S9FA 4I0WA 3TNVA 2CVIA 3W2VB 3HDSA 3O2IA 2DXEA 3EDQB 3RUBL 3LANA 3BH6B 2UU9F 1YJRA 1TVRB 2WAQD 2Y1LB 2VFUA 3D3CJ 2FZGB 3MMCA 2Q43A 5HMXA 5CYMB 4KY3A 2BYCA 2BJ8A 4J7CA 2NXUA 2XNQA 2V69A 3FCVA 3H90A 1MMDA 3L09A 5B0FA 2GQ2A 3TYTA 1U1LA 4IO1A 5LRMA 5ETTA 1XR5A 4WP3A 4DEZA 4O44A 4P52A 1UPMB 2OAUA 3BQ0A 3O3LA 2YH1A 1HNIA 2OEJA 1I51B 1Z4UA 1AB8A 1VLYA 3DPCA 4E2FB 4I64A 4MYUA 1M5KC 5J2QA 2C3UA 4CXUA 4ZMMA 1B0TA 4USMA 3C66A 4OYAA 3KHGA 4X4SA 3DRRA 4KGVB 4CQ1A 3P6YC 2LECA 1RYSA 3TJAA 1ZAWA 4WCEQ 3QGPA 4XAKA 3PW7A 4KJDA 2CQBA 4YHHJ 2ZKUA 3W9IA 3MPYA 3D4JA 1GMWD 1JXLA 1B3TA 2YKNA 3FSXA 3JSRA 1D8YA 3JYTB 3Q83A 4F67A 3PRBA 4RR5A 3B6BA 3H5UA 4TY9A 3MCNA 2LDYA 3ZNUA 4ZP7A 2R9LA 1HR0F 4EZ6A 1QVFR 2F9DA 2F5GA 2WZ1A 4PXDA 4EEYA 1TZ0A 2VFVA 3GYNA 5KFMA 2KG0A 1SJFA 2F4VJ 4L75A 3RB4A 2CNLB 4URQU 1TFYA 2PT0A 3HHLA 2KM8B 2UUBF 3IS9B 2DPJA 1YX2A 3AH6A 3EUNA 2V8PA 1O99A 1UEVA 1RKJA 1H7XA 3ENAA 2NPIA 3HM9A 2ZHBA 1XIQA 2RUSA 3HPOA 1S9GB 4AL5A 4DR6F 4U7CA 2VPZB 4OLPA 1ZZNA 3FCHA 5B0AA 3KUGA 4ZPDA 2X51A 1W26A 2CA9A 2CPZA 2LXFA 2ZZTA 4OJ3A 2RAQA 5GADI 3QO9A 1ZAVA 3NWGA 3TVZA 3RAXA 4RW4B 3IAS9 4DV6J 2OIHA 1U09A 3PYEA 1DHMA 4GVBA 3AQOA 1NPKA 1I6JA 4JYAJ 2C2DA 2ZOGA 1RAJA 4MK7A 4BC7A 5I42B 5IQQA 3MR5A 3GILA 2V8VA 1YG0A 2WTFA 2YNFA 1S0NA 2LEPA 1KP6A 1JLGA 2MHNA 3QT6A 4ZCKA 2R2SA 1P6TA 3GFXA 2DK2A 4P2XA 4ZN3A 5IT4A 1NK0A 4B3MJ 2GX8A 4F3MA 1RWVB 3MUMP 1UWBA 3EGVA 4HL9A 1DURA 2W1BA 4CM0A 4DUTA 3PR4A 2BW7A 2JLGA 1U6ZA 3J7Z5 1GAOA 1WD6A 1S7HA 1VFJA 2CQGA 2CPFA 4G3IA 4Q0BA 4NCAA 4TN0A 2F8HA 5EX0A 3PFEA 3PV8A 2G2ZA 1QY7A 3KWMA 2YPYA 1HBNA 3PHTA 1W2BR 4BHQA 1DJ0A 1IM4A 1O8BA 2APOA 2QL7B 3AXMA 3NCRA 4QIGA 1KR4A 3W61A 1A7GE 4IH5A 3B8HA 4HACB 5FLXU 4DG1A 4H4MB 1FRKA 3GJQB 2FZCB 1I1GA 2F4FA 4ZCLA 4Z2XA 4B3MF 1OQ3A 2Z8QA 5FLXY 2GJIA 2GHVC 2QFIA 1X4FA 4PQAA 3TA2A 1ZA1B 2FLOA 4EYHB 4ECZA 3O8WA 3G6VA 2YKPA 1JLEA 1UPPA 1WG5A 1F9EB 2ACYA 4RWXA 1T03A 2RU9A 3K0JA 3P5BP 1AROP 3QT7A 4DV3F 2XMKA 2EFOA 2K3IA 5KFPA 2CDRB 1RAFB 4LR9A 4DQIA 1RHRB 4IG3A 3T19A 4M5DB 3TEHB 5J2QB 4PG5A 3TQ1A 1WSVA 1DBDA 2B6AB 2NZCA 1R0AB 4QU6A 3VWSA 5KXAA 4DSEA 1RADB 4OHXA 4DLEA 3T5LA 1OS5A 2CZ9A 3UDEA 4FYDA 5EWFA 1X4GA 2CNKB 1NJWA 3R2DJ 4RO0A 5FDLA 3QAEA 4YEAA 4GTYA 3I5AA 5F8LA 2WSCC 1M5OC 2DO4A 1C2PA 2UUBJ 1V3SA 4UF4A 1KRPA 3ZC4A 1M90T 5HMYA 1EB0A 1ROFA 2JWNA 3LTOA 4DV7J 3IS9A 3W65A 2KRRA 3GV8B 5B7WA 4ANCA 3VZHA 1IJFB 2QJ3A 1YSJA 1HD0A 2GGPA 3BYPA 2BJ9A 1LFWA 3LGMA 2QL5B 5DG7A 1J5EJ 2DPIA 2FVRA 3KNAA 3NKRA 2NXNA 4ZOSA 3B78A 5ETLA 3VV2B 4LF7J 2ZC3A 1NJXA 4LF9J 2IFYA 3AAWB 3GU0A 4QYZK 4P10A 1FD2A 2Y1IA 3KNGA 3IWXA 2A2CA 2BX6A 4MHXA 1S9GA 2RD5C 5KFUA 1UEUA 2YNGB 1F60B 2KL8A 4QU7A 3TO8A 1NDKA 1JLBB 2QFJA 1URBA 1B0VA 1BLUA 2QO3A 3ZXWA 4K4YA 2V9WA 2W2OP 4BWMA 4KGKA 3W66A 2ZBCA 4DX6A 4PRFA 3N5BA 4CO2A 2HHUA 4YS2A 4LR2A 2HS3A 1YVFA 3K8VA 2YH0A 1MU2B 3Q3QA 4OX7A 5DDQC 3D3BJ 4DPYA 3T02A 4CLLA 3BF4A 1NO8A 2RKIB 4YB6A 3T6JA 3KKFA 1UTAA 5GMKa 2MLZA 1RTDB 2FJDB 1C4AA 2EFQA 2PE8A 2QZUA 2KKHA 2XRGA 4EBEA 1Q4RA 3ETOA 1O6XA 2HIQA 2KT5A 2ZVIA 3I82A 2A1BA 4FDFA 4PUOA 5AJ3J 2YNFB 3BZQA 3H0PA 3LALA 2DGTA 3PM9A 4HR2A 2MSTA 3DRRB 3UDLA 4TQSA 2CPDA 4MK8A 1BD6A 4USVA 3RBZA 4B9NA 5IXUA 1RTIA 3HXMA 2DRAA 1WC4A 4QW9A 2AU0A 5HQLA 3QZ8A 4DV1F 4DL6A 1N56A 2E1MC 1VYAA 1Y9OA 1DTQA 1FE0A 3AT1B 1RT5A 1TFWA 1HWJA 2LU2A 2FB0A 1RJJA 2MQNA 4X4PA 1VCTA 1LWFB 4NZ7A 4RNHA 1HARA 3M8SA 2XGPA 3EPGA 2RDJA 4DFMA 2ABYA 3HVTB 3EPIA 2C3YA 4DR2F 2QLWA 4DL0C 2CYYA 3FZ2A 4DL5A 2IBKA 4UOPA 4NMLA 4ECWA 1HWKA 1WWHA 4JI1J 3TEGA 3ZZZA 1WDTA 1D9AA 4Z7YA 5B0CA 4RJVA 3F41A 4NLTA 1N36F 4NLWA 1TVRA 4L3NA 1XERA 3CJ8A 2UXDJ 3A52A 2Y8YA 4IG0B 1U1OA 3GR0A 4E0DA 2V2QA 3CCMS 1SJ1A 4WZQA 3U02A 2VODA 3KLIA 2U2FA 3PYDA 4PYDA 2EC0A 3ET6B 5CXTA 4DV2J 2W01A 4OZ1A 3TA1A 1D1UA 1IKWB 1X5TA 2G0JA 1Y11A 1ZM9A 3B4MA 3JTPA 2NSBA 3QGIA 4WXOA 4K2XA 3MM5A 4QJVA 4C7QA 4NXMJ 1C1BB 2BJ3A 2YBVA 3MOJB 2QMWA 3H4BA 1LOUA 5L1KA 3RBDA 3OL6A 1VQ7S 2MLXA 4TY8A 3M1VB 2MKIA 4J9NA 3SZZA 3CC2S 1CJVB 1VISA 1JKHB 4C8ZA 4QBUA 3FNNA 2HFSA 2DHGA 2W5VA 2KJVA 1YI2S 4DR4J 1LW0A 3Q2TC 3L4BC 1N2KA 3IGZB 2LA6A 3X3UA 4KM4A 2R7QA 4ZS6A 1F5CA 1S10A 4Y65A 5DRKA 3I32A 3MPVA 2V5HG 3IMQJ 1SIWB 2Y0BB 1KH9A 4YR0A 4Y2KA 2RIJA 2DCLA 2VBXA 4ZJOA 1FE4A 2BVZA 2D3O1 4LQ9A 3MEGB 1NSKL 5J1PA 3QWPA 5J2PA 2OEMA 1HDHA 4ZVHA 5IV3A 2M5YA 3Q24A 1X7VA 2OPSB 2XI2A 4JI6F 2WB1D 4ECXA 4ED1A 2JEFA 5J2PB 1EETA 3OPKA 4C8NA 4CDIA 5LM7E 2JOQA 3M9NB 1Y6VA 2A2DA 2CQIA 3N6NA 3PX4A 1HNZJ 3JSBA 3J7AN 1XQIA 5SZTA 3IFEA 1EQMA 1RBAA 5KFGA 3ILLA 3I31A 3QRRA 2FTRA 3DLEB 4CXKA 3VTIA 2V6AA 1XWLA 2OPPA 1NMEB 2YWGA 3OLBA 2CQ3A 5IT9U 5D3GA 3BM7A 2D3OR 2D69A 2R8HA 1FRLA 3GE9A 4JYAF 1JKHA 4QR2A 4WYWA 5A0YB 1FESA 1RHUB 2P9EA 3CT9A 3IP0A 1S76D 3LH2S 3M8PA 2BJEA 2BM0A 2GIFA 3VGUA 1ALHA 2JDJA 5FJ4A 1TL3A 3AQPA 1FVSA 3PEJA 2DNOA 2XYGB 1N0VC 3OFHA 1HNVB 4RLEA 3G82B 1XR6A 5LXRA 2HFZA 3QNWB 4ED5A 2DH8A 2CWXA 3IXQA 3BQ1A 3ILOA 4M8LA 4LIWA 4J9SA 2BMBA 1JB0C 3BB5A 3BH7B 3J81U 1G1XA 2F7VA 4N8OA 3W9HA 1UFKA 4QYRA 4E8UA 1XTZA 2HMIA 1P1LA 1KTQA 3V81A 4F3OA 3LP2B 4ZVGA 1UVLA 3CCQS 3UCGA 5JUMA 3QQCD 3DOMA 2F3JA 5GAHU 4PZVA 1HNXJ 1R6VA 4X2BA 2VA3A 5MAOA 1WKLA 4C11B 4C48A 3TANA 4DL3A 2QRRA 3ADAC 4C8KA 4Y2CA 4B3OB 3MM8B 2H1YA 3GFZA 3I4HX 5ETQA 1FRMA 2HMIB 2AT1B 4FDIA 3MMAB 2JH3A 2E5LJ 3NS5A 4C0OC 3PIOQ 1S0MA 4A46A 4F2SA 2WBMA 3CTRA 1TTHB 1NSAA 2XEXA 4NLUA 3QT8A 4ZLPA 4FS2A 2ADBA 3DFEA 5F41A 1QVGR 4MKAA 1OIAA 1F5AA 3R27A 4NA3A 4RW6A 3ZTSA 4K5SA 4ZCIA 2C28A 2V34A 2JEIA 2D41A 4OJHA 1UVKA 2CJXB 3KLHA 4UPKA 2ATCB 2KYZA 5KG4A 5K20B 5DDOC 3I56S 4LSZB 3H25A 5HBMA 4RNOA 3SSRA 3CCJS 4DN9A 3CJKB 1KHKA 2PD1A 1PYSB 2JEJA 1PKUA 2CQ2A 1JMTA 4Q7AA 2HWIA 3WX4A 1IR2A 1ZS6A 3MCOA 2AJQA 1SHQA 3F0NA 2PO4A 2XZWA 2OJ3A 4IR1A 1LWCA 3P96A 3W9JA 5EN1A 1EW2A 2YKAA 4DUYJ 1BMQB 3QMQA 2ZOFA 3QT5A 5HBMB 2J76E 3H5YA 1DZ5A 3OL9A 3BO3A 4ZA1A 1VK3A 3W60A 4IOAQ 1TKXA 4NEYA 3CPWR 4MKBA 2GFFA 4OL8A 2U1AA 3MZIA 3CMRA 4LFBF 1AJCA 3FFIA 5F8HA 1HBOB 5HP1A 3GB0A 3MEGA 4X66J 1CVJA 2L48A 1LW2A 4ZG9A 2H65B 4I4BA 2V67A 4Q5VA 3BQ2A 3CJSA 5B0GA 1VC5A 1W7WA 3ZTQA 1E2SP 1OY8A 3E8OA 3OBIA 1ANJA 5K9FA 4DSJA 1WOPA 2MQ8A 1H2VZ 3BGRA 2C2RA 3D6MB 4B3OA 4Q43A 3AOBA 5BJRA 1EW8A 1ZEDA 3NWRA 2H5EA 3M30B 2AEFA 1FEHA 1QSLA 4B56A 3OR1B 4GTWA 1HQAA 2FLLA 3BGOP 1U2RA 1S1TB 1RE1B 3CD6S 1CJKA 3KK1B 1RHMB 3I96A 2HAIA 2QA4G 1OSDA 1CEZA 5JVHQ 2XZTB 4J91A 3UN5A 1YKWA 5LSOA 1HNXF 1KHWA 4RW9A 3PO4A 2CJ9A 1F9FA 4K5RA 3P3DA 4DMZA 4WTYA 5L9XA 1TKDA 1XNQJ 1FRIA 3HD1A 1FXRA 4F4ZA 1XNRJ 2OO4A 4FNHA 5LOQA 1KQSR 1HBMA 2DH9A 4PABA 3HHLC 2DO0A 3SV3A 3QJJA 1EKSA 3DRSB 4K59A 2MGZA 3PKYA 3BJYA 4DR3F 4KC5A 2KYXA 2V4RA 3PXGa 1WC3A 2IPOB 4I6WA 1S49A 4P71A 3EJMA 2L9WA 3BR8A 5A8WA 2Y3YA 3V6JA 5G0RB 5T7LB 1U1RA 1T05A 1UWAA 3A4TA 3M8YA 3OTDA 5K8PA 2OPPB 2ILZA 4DCOB 5EWEA 3G8TA 3N6MA 2IC3A 4EYIB 3HT0A 4AL6A 2DKOB 3W64A
chains in the Genus database with same CATH topology
2XR9A 2D1GA 3WAVA 5DLVA 4ZGAA 1ZEFA 2IUCA 4LRAA 2X98A 4UPLA 2W5RA 4KAYA 3UN3A 1E33P 1ELYA 4KJGA 2GSOA 2ZKTA 3OT9A 1KH7A 3TWZA 1EW9A 5C66A 5GOVA 2GA3A 4NWJA 5L0EA 1ELXA 3UN2A 4LRFA 4LREA 4LQYA 4LR8A 3BDGB 5DLWA 4FDIA 3DYCA 3M7VA 5LQQA 5K4PA 1ALKA 4UOPA 5GRRA 4TN0A 5LIAA 1URAA 1ANIA 3A52A 1EQJA 3IGYB 4LRDA 3TX0A 4UPKA 4CYSA 4ZG7A 3ED4A 5DLTA 3BDFA 4UPIA 3NKOA 1AJBA 1KHKA 5LRNA 1SHQA 3WAWA 3NKNA 3UO0A 1EW2A 5IJSA 1B8JA 3SZYA 2VQRA 4ZG6A 4N7TA 3NKMA 4GTXA 1SHNA 4UORA 4LR9A 4KAVA 3SZZA 3NVLA 5KXAA 2W5WA 3KD8A 2W5VA 1KHLA 3CMRA 1AJCA 1AUKA 1KHNA 1N2KA 3IGZB 4LRBA 4LR7A 4KM4A 4ZG9A 3WAXA 2RH6A 3TG0A 2W5XA 2GLQA 5INHA 4GTYA 5HRTA 1KH5A 5LRMA 3BDGA 4GTZA 1E2SP 1KH9A 1ANJA 5TJ3A 5EGEA 3T01A 3M8WA 1N2LA 3T00A 1HJKA 4LRCA 1HDHA 3MK0A 5IJQA 4YR1A 1EW8A 2W5QA 3DPCA 1ZEDA 3E2DA 3UNYA 1AJAA 2W5TA 1ED9A 1ZEBA 1FSUA 4B56A 4GTWA 2W5SA 1HQAA 3NKRA 3MK2A 1ELZA 1Y6VA 4FDJA 4CXUA 4MIVA 1ALJA 3MK1A 2IFYA 4NWXA 2IUCB 3NKQA 1ED8A 2G9YA 1KHJA 3LXQA 3M8ZA 1P49A 4KJDA 3B5QA 4MHXA 4UPHA 3UN5A 2W8DA 5AJ9A 5L0KA 1Y7AA 4CXKA 2GSUA 3NKPA 1URBA 1E1ZP 4MY4A 4CYRA 3WBHA 2W8SA 1K7HA 1EJJA 2GSNA 3WAYA 4LR2A 1E3CP 1ALHA 1ALIA 3Q3QA 1EI6A 3T02A 2QZUA 1O99A 1O98A 3BDHA 5EGHA 4CXSA 2XRGA 3M8YA 2ANHA 4UOOA 5L0BA 1AJDA 3IDDA 4QAXA 1KH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XR9 A;  2D1G A;  3WAV A;  5DLV A;  4ZGA A;  1ZEF A;  2IUC A;  4LRA A;  2X98 A;  4UPL A;  2W5R A;  4KAY A;  3UN3 A;  1E33 P;  1ELY A;  4KJG A;  2GSO A;  2ZKT A;  3OT9 A;  1KH7 A;  3TWZ A;  1EW9 A;  5C66 A;  5GOV A;  2GA3 A;  4NWJ A;  5L0E A;  1ELX A;  3UN2 A;  4LRF A;  4LRE A;  4LQY A;  4LR8 A;  3BDG B;  5DLW A;  4FDI A;  3DYC A;  3M7V A;  5LQQ A;  5K4P A;  1ALK A;  4UOP A;  5GRR A;  4TN0 A;  5LIA A;  1URA A;  1ANI A;  3A52 A;  1EQJ A;  3IGY B;  4LRD A;  3TX0 A;  4UPK A;  4CYS A;  4ZG7 A;  3ED4 A;  5DLT A;  3BDF A;  4UPI A;  3NKO A;  1AJB A;  1KHK A;  5LRN A;  1SHQ A;  3WAW A;  3NKN A;  3UO0 A;  1EW2 A;  5IJS A;  1B8J A;  3SZY A;  2VQR A;  4ZG6 A;  4N7T A;  3NKM A;  4GTX A;  1SHN A;  4UOR A;  4LR9 A;  4KAV A;  3SZZ A;  3NVL A;  5KXA A;  2W5W A;  3KD8 A;  2W5V A;  1KHL A;  3CMR A;  1AJC A;  1AUK A;  1KHN A;  1N2K A;  3IGZ B;  4LRB A;  4LR7 A;  4KM4 A;  4ZG9 A;  3WAX A;  2RH6 A;  3TG0 A;  2W5X A;  2GLQ A;  5INH A;  4GTY A;  5HRT A;  1KH5 A;  5LRM A;  3BDG A;  4GTZ A;  1E2S P;  1KH9 A;  1ANJ A;  5TJ3 A;  5EGE A;  3T01 A;  3M8W A;  1N2L A;  3T00 A;  1HJK A;  4LRC A;  1HDH A;  3MK0 A;  5IJQ A;  4YR1 A;  1EW8 A;  2W5Q A;  3DPC A;  1ZED A;  3E2D A;  3UNY A;  1AJA A;  2W5T A;  1ED9 A;  1ZEB A;  1FSU A;  4B56 A;  4GTW A;  2W5S A;  1HQA A;  3NKR A;  3MK2 A;  1ELZ A;  1Y6V A;  4FDJ A;  4CXU A;  4MIV A;  1ALJ A;  3MK1 A;  2IFY A;  4NWX A;  2IUC B;  3NKQ A;  1ED8 A;  2G9Y A;  1KHJ A;  3LXQ A;  3M8Z A;  1P49 A;  4KJD A;  3B5Q A;  4MHX A;  4UPH A;  3UN5 A;  2W8D A;  5AJ9 A;  5L0K A;  1Y7A A;  4CXK A;  2GSU A;  3NKP A;  1URB A;  1E1Z P;  4MY4 A;  4CYR A;  3WBH A;  2W8S A;  1K7H A;  1EJJ A;  2GSN A;  3WAY A;  4LR2 A;  1E3C P;  1ALH A;  1ALI A;  3Q3Q A;  1EI6 A;  3T02 A;  2QZU A;  1O99 A;  1O98 A;  3BDH A;  5EGH A;  4CXS A;  2XRG A;  3M8Y A;  2ANH A;  4UOO A;  5L0B A;  1AJD A;  3IDD A;  4QAX A;  1KH4 A; 
#chains in the Genus database with same CATH topology
 2XR9 A;  4UQG A;  2R8J A;  2B43 A;  2KO1 A;  4XDC A;  4ZGA A;  1R8H A;  2DNN A;  3FSY A;  4TU8 A;  1RWU A;  2W8L A;  1H38 A;  4QR1 A;  1NDL A;  3MM6 A;  4ZDN A;  5KFH A;  5IC6 B;  4RBT A;  2UU9 J;  3MM9 A;  4TXS A;  1CSJ A;  1RT7 A;  2A6M A;  3DU5 A;  4YN3 B;  3DI6 A;  1NHU A;  3MMB A;  2AJ2 A;  3ENV A;  5DO2 A;  4PR6 A;  1V3Z A;  3J80 U;  3SI8 A;  5H9E K;  4DPW A;  2HHH F;  4K4Z A;  3TW0 A;  3VAG A;  4OLO A;  2XG8 A;  3W5Z A;  3OHA A;  2HYI B;  2R7U A;  2J0X A;  4KPC A;  3MED A;  2FJE B;  2GIQ A;  1IKX A;  1RWO B;  4YP3 A;  1S0V A;  1GTE A;  2HHW A;  1HQ2 A;  4NI2 A;  2LQ5 A;  3PIP Q;  1QUP A;  4FF3 A;  4K4U A;  3LAK A;  2E7X A;  3HHL D;  3A3P B;  4KSE B;  1RT1 A;  2DD8 S;  3NS7 B;  3PW4 A;  3BRE A;  4ED4 A;  5I42 A;  1SC6 A;  1URN A;  2VIC A;  1KTV A;  2GS8 A;  1RLD A;  3JSM A;  4ETX A;  3EYZ A;  1FEE A;  2I2Y A;  2ROP A;  1X4H A;  2XLK A;  1KVJ A;  3TX0 A;  3IGY B;  4C6A A;  1T3O A;  4ZP9 A;  3H2V E;  3OXG A;  4TY8 B;  3FEX B;  5A8K B;  3CO9 A;  1U1N A;  2IIH A;  1S97 A;  4MIW A;  4UOH A;  1ACM B;  4LSL A;  2UVW A;  1RP5 A;  1V9O A;  3GG1 A;  2MQQ A;  4IDK A;  1KON A;  4DQP A;  3UR0 A;  4X4T A;  1DFD A;  5HMZ A;  2L08 A;  3N9U C;  2C42 A;  4YOE A;  2NS1 B;  2CQD A;  3HHD A;  4FXV A;  1IWG A;  2HS0 A;  2VG7 B;  2HK2 A;  3LGN A;  3OTB A;  4PG8 A;  2IA6 A;  4ZIV A;  2UV8 G;  2BOP A;  5GVQ A;  1SHN A;  2DEI A;  2MQM A;  3H5X A;  1PO6 A;  2KM8 C;  1KOH A;  3VAL A;  4DF4 A;  3W5X A;  2DH7 A;  4R8U B;  4NLY A;  5IT9 Y;  5IM0 B;  2YKN B;  1KWM A;  3IR5 B;  3J80 Y;  4ZVS B;  2QLJ B;  4BS2 A;  4MH8 A;  4OI6 A;  4TYB A;  1T9T A;  1S4E A;  2HSE B;  3QIP A;  5K14 A;  3M9O B;  1VQS A;  4ICL A;  3SEO A;  3UD4 P;  1PC4 A;  1Y3J A;  1AW0 A;  4NZ6 A;  2GJ2 A;  4DSK A;  2RVJ A;  1REV B;  1WC6 A;  4LF8 J;  3BSC A;  1S1X A;  3EZU A;  1FJG J;  1ZH5 A;  1R43 A;  5KFT A;  5K8N A;  4PPZ A;  2ADC A;  1CJK B;  3NS6 A;  2F4V F;  5BYS A;  1NM2 A;  5D6G A;  5C42 B;  2ALZ A;  2UVR A;  2BKP A;  2VUG A;  4N56 A;  1HLW A;  4M5L A;  2XLI A;  1O0P A;  3T1Y J;  3BPS P;  4LF6 F;  1XNQ F;  2FUG 9;  3WX8 A;  1S1W B;  1SH0 A;  5G4D A;  1HHS A;  4CO5 A;  1N5Q A;  1IWA A;  4MKV A;  5AE1 A;  2HHS A;  4USJ C;  2HNZ A;  1JK9 B;  3M6V A;  3PDN A;  2GVZ A;  4MIV A;  4WFN Q;  2DCU B;  3BGR B;  3H8Y A;  2N7Y A;  4U7U K;  5C25 A;  4DL2 A;  2ZZM A;  3S8S A;  4JI4 F;  3UCU P;  3HD2 A;  3DRX A;  2Q3P A;  3H59 A;  1X4B A;  3L7U A;  4A8Y A;  2AGP A;  2O67 A;  2AX0 A;  2CFX A;  3NAI A;  4RNF A;  3AOC A;  4DS5 A;  3MAA A;  4IQM A;  3R2C J;  3ILJ A;  1TMJ A;  4ZVR B;  5BR8 F;  1G2E A;  3GCX P;  2YKO A;  4ZKA A;  2M0G B;  3HKW A;  4I7F A;  5THW A;  4LF8 F;  5IV4 A;  1EJJ A;  3KK2 A;  1VDH A;  2DTJ A;  4MYT A;  1FDB A;  3ZZY A;  4G6V B;  1NJY A;  1FNX H;  3JTO A;  1RTH B;  4ITS A;  1KLM A;  2YX1 A;  2DEJ A;  1JLC A;  3LUY A;  5KFO A;  2LEB A;  5ETN A;  1U2F A;  2ZJQ Q;  2VG7 A;  2XNR A;  1ZTW A;  3DM2 B;  4FYW B;  5LMU F;  3X1L B;  3BDH A;  2Y8W A;  2J5A A;  3ZTR A;  1V5V A;  2IJN A;  3CED A;  2CPI A;  4FZV A;  2FGO A;  1A0O B;  1PJ7 A;  4YDD B;  3OVB A;  4UOO A;  1C1C B;  1V3R A;  1AJD A;  4ECS A;  1S1V A;  4CO0 A;  3FRY A;  4I2P A;  4KE5 A;  2VJU A;  1XMQ F;  3UW1 A;  1D9F A;  1CQM A;  2DHA A;  2M2B A;  1NDP A;  3I0S A;  5A8W B;  5C7P A;  1TEL A;  1FCA A;  1RXO B;  4YB1 P;  1FNM A;  2B4O A;  4F4Y A;  4NA1 A;  1CJT B;  4LF2 A;  2MGZ B;  1RWP B;  2UXC J;  3THV A;  4R5P B;  2N3O A;  2KZZ A;  1VQL S;  1QAY A;  5IT0 A;  3VCD A;  5BR8 J;  1JWW A;  1J5O B;  4B9M A;  5K5M A;  4RW6 B;  2QMX A;  2YNH B;  3DLG B;  4ETZ A;  3PHE A;  4H4K C;  2GQQ A;  5A76 A;  1NBE B;  3HSZ A;  1B7F A;  2BQR A;  1IKX B;  4X4R A;  1GEH A;  2N4D A;  1YIT S;  4PCQ A;  5KG0 A;  1TUW A;  4A48 A;  1BWE A;  1IBL J;  5DLW A;  2Z2Y B;  3RJM B;  2BR0 A;  4UQT A;  2DXF A;  3G87 A;  3TP2 A;  1IQT A;  4O3N A;  3BSN A;  2H9Z A;  2IBO A;  2VKR A;  4X62 F;  3LWL A;  2XYP B;  4FN5 A;  5F9N A;  1OO0 B;  1TL7 B;  2XZD B;  2MSS A;  1ZET A;  3M4X A;  2EG1 A;  2FD2 A;  4JI3 J;  2W2N P;  3DOM B;  2ZUA A;  5CZX A;  2I9S A;  5KFE A;  3P5T L;  1Y10 A;  2MZS A;  4QWC A;  3G6E S;  4DS4 A;  1B7Y B;  2QE5 A;  2HHP A;  3BDF A;  3R1H A;  3NKO A;  2XO7 A;  1YIJ S;  4ZPT R;  1L3U A;  2F8E X;  2VFS A;  3L95 X;  1LKZ A;  3R9L A;  2MQO A;  4FF4 A;  2B4U A;  1LXJ A;  2WSE C;  4R25 A;  4C97 A;  1N52 B;  3UD3 P;  2ZHA A;  2YNI B;  2Y9H A;  2EFG A;  2LA4 A;  2HHH J;  4ZPA A;  4Y2I A;  3C6T A;  2ZDP A;  3I5B A;  2PMW A;  1HNV A;  1GT8 A;  4H4M A;  1GQE A;  3M2U B;  1CJU B;  4HAC A;  4LUB A;  4Y6I A;  5KFA A;  5CHC B;  3RB0 A;  3K7R A;  4NXN F;  1N33 F;  2GO8 A;  3M8P B;  3VR1 A;  2FQQ B;  5J1E A;  5H9F K;  2RT3 A;  3FMB A;  4HHH A;  4K4X A;  4DX5 A;  2YQ1 A;  1RA7 A;  4TU7 A;  3L9Z A;  4YME A;  1R8A A;  4R0E A;  2C2K B;  2XGQ A;  4J9P A;  1U1P A;  1N8R T;  3QRP A;  2K8G A;  4L74 A;  9RUB A;  1KKH A;  5KT3 A;  2I8E A;  4KGM A;  1PAU B;  1B64 A;  1KH5 A;  4E98 A;  3PJW A;  5BXI A;  2IDE A;  3RR8 A;  3K89 A;  2VQE F;  4DPU A;  3GWC A;  5KT4 A;  3M8W A;  3W2W A;  3BV8 A;  1JLG B;  1X31 C;  2YQ3 A;  1HHT P;  3TVK A;  3UVJ B;  2OPQ B;  3UNY A;  2R7X A;  3HP6 A;  2DYA A;  3OFG A;  5E3Q A;  4C3M A;  7FD1 A;  1XJW B;  5I3U B;  1EIY B;  3H40 A;  2D3Z A;  3T3F A;  4WFY A;  3EGN A;  5D8H B;  1SKS A;  1DAR A;  1HQU A;  2AJ0 A;  3T5H A;  5D0R A;  2JVR A;  5F9L A;  2IUC B;  1ED8 A;  2AV5 A;  3NBP B;  2YWK A;  3OLA A;  4OZJ A;  5HVG A;  4X64 F;  3BGL A;  1KQK A;  1ZM2 A;  4KHR A;  2W9A A;  1BQM A;  1XK8 A;  1X4C A;  3KDO A;  2HBQ B;  4XDD A;  1UVJ A;  4CYR A;  1DTT A;  1SH3 A;  3D6T B;  4ED8 A;  2BJ7 A;  1FTR A;  1H98 A;  5E3C A;  5DGA A;  2ZH7 A;  3VQS A;  4AT1 B;  1I5O B;  3W1Y C;  4U6P A;  3PW5 A;  3PFO A;  2MKC A;  2MMY A;  1YJV A;  1K73 T;  2LXU A;  3G2X A;  3DRY A;  1SJ4 P;  2AJ1 A;  4OI1 A;  1VOM A;  2V63 A;  1C1B A;  3HI9 A;  4FYY B;  4XPE A;  1VQ9 S;  2ROE A;  2VDH A;  4TVA B;  3SCI E;  2B56 A;  3T00 A;  1C0T A;  3QLH A;  5HAO A;  3DDI A;  2EVZ A;  1KQF B;  2KXF A;  5DLV A;  2XY5 A;  1E6V B;  1P9Y A;  4N76 A;  1AUS L;  3TVY A;  3CCU S;  1VRT A;  1ICE B;  2Q79 A;  2E9Z A;  1XNR F;  1W2I A;  2HHV A;  1PG5 B;  4RBU A;  2VQF J;  1U02 A;  4ANE A;  6AT1 B;  1T02 A;  2JHE A;  1YLX A;  2B5J B;  2DNY A;  3CJ0 A;  3MI7 X;  2K7K A;  3N5F A;  3W8P A;  4B9T A;  3UQS A;  1KFD A;  2JJ4 D;  3WBZ A;  2UZA A;  2FHO B;  3N6L A;  3SQG B;  5KT2 A;  2AIR B;  4JP8 A;  1KD1 T;  3ZZT A;  3EZ5 A;  4LMZ A;  2ZDO A;  2FYX A;  2ZNZ A;  3P49 B;  3FZB A;  3I9V 9;  4NRU A;  2O1P A;  5HN0 A;  1ZM3 A;  3MFH A;  3V6K A;  2HGN A;  3SQO P;  2G0I A;  1BQM B;  2IRX A;  4I2Q B;  4PPD A;  3OTO F;  3POT B;  4AL7 A;  5K4P A;  5M2U A;  3CC4 S;  1HNW J;  4X4U A;  1G7C B;  3BGU A;  2C3O A;  3H98 A;  3OFF A;  1FX4 A;  2AQ4 A;  2ZZN A;  2DIV A;  2PFD A;  1C4C A;  1QE1 B;  1HFE L;  2V94 A;  3EVW A;  3KG4 A;  3NGR A;  3C6U B;  4O3P A;  3HO1 A;  3EVO A;  2PMH A;  5JVG Q;  3QAT A;  3CB4 A;  2KH9 A;  1N5T A;  3SDE B;  3V81 B;  2BA9 A;  2BKO A;  4CTA B;  2B8P A;  2M9K A;  4NXN J;  3EGZ A;  4B3S F;  1JLA B;  4WU3 A;  4WU2 A;  1F5B A;  3DNC A;  3M6W A;  1N5V A;  4C0H A;  5LSL A;  4X4O A;  4A8M P;  3BEG B;  3UR3 C;  4EFA C;  1SB6 A;  1XC9 A;  1KS2 A;  2AYM A;  2DNL A;  2HFU A;  3GP9 A;  2EC2 A;  1SKW A;  3BBB A;  4Y0F A;  1MWY A;  1WC5 A;  2OGU A;  3GII A;  2E29 A;  2E9T A;  2QG9 B;  4WFA Q;  2JC0 A;  4ZG6 A;  1F1B B;  3AD7 C;  4QWE A;  3TJ9 A;  3C15 A;  1R7I A;  3DLK B;  1VQP S;  4F0M A;  5DQG A;  3CCZ A;  1WEY A;  2MB0 B;  5J1E B;  1S6P A;  2RHQ B;  2UVU A;  2J9D E;  2J0W A;  2OFG X;  3DLE A;  3MFI A;  5CH7 B;  1I94 F;  3R5D A;  3M2U A;  4LBH A;  2HZC A;  3CWJ A;  3GFH A;  4RUB A;  1RYR A;  2L9N A;  1Q7Y T;  3V2U C;  1DLO A;  2RQM A;  1H74 A;  2IHR 1;  3K8W A;  5IZH A;  1H2T Z;  3ET6 A;  2UUC J;  4FBU A;  3PKM A;  3HKZ D;  2E7W A;  2VZ9 A;  3M32 B;  2OUG A;  3DRP B;  4Y34 A;  4TNO A;  3FBC A;  1HQU B;  2V2V A;  3DKD A;  2MJN A;  3JS9 A;  3NXZ A;  3WIV A;  1Q95 G;  1SQE A;  2ZJR Q;  4JI0 F;  1YJU A;  3WDO A;  2AEM A;  2EBG A;  2HIY A;  4IG0 A;  5AE2 A;  5LJ5 Y;  1ED9 A;  4HDH A;  1FSU A;  2D7S A;  2JL9 A;  2W5S A;  3M2V B;  3W63 A;  4Q8E A;  3TUP A;  2OEK A;  4ERD A;  3RRK A;  5KFX A;  1ALJ A;  4TN2 A;  3OXF A;  2EFN A;  4OI0 A;  1GK8 A;  1UJ5 A;  3PRV A;  4LVO P;  2IJR A;  3TA0 A;  1F0X A;  2FJA B;  2NCK L;  2NXE A;  3AD9 C;  5HL7 Q;  2RB7 A;  3LXQ A;  2ZJP Q;  1HWU A;  5I4M A;  1W25 A;  4TLR A;  2HQ3 A;  4K4T A;  1U48 A;  4CNY A;  5KT5 A;  2RRB A;  4DPX A;  1BXN A;  4OZN A;  5EWG A;  1FXD A;  2M70 A;  1DRZ A;  2PI5 A;  2EK1 A;  3Q8R B;  5KFR A;  4M94 A;  2RDD A;  3TZW A;  2FJW A;  2UXC F;  4O0I A;  2GSN A;  4M5M A;  1H6K X;  2XWX A;  3LOU A;  4L72 B;  5FII A;  2YNH A;  2CIM A;  1IM6 A;  4FNI A;  3PCO B;  1VJQ A;  1IQZ A;  1LK7 A;  2YWE A;  4CLY A;  4ZLL A;  1EI6 A;  5LQQ A;  5F0U A;  5HRO B;  2XSF A;  2VON A;  2RS8 A;  3U1N A;  4HT5 A;  3ISZ A;  3M05 A;  3DHW C;  3HJV A;  1VRU B;  4KKO A;  4B3S J;  1K8A T;  1G4C A;  1C0T B;  2WHO A;  2Z4P A;  3Q0A A;  2AEJ A;  1GMV A;  3NGT A;  2KXN B;  2D1G A;  2CKW A;  2QLB B;  3H4D A;  1S9E A;  2K1R A;  4BWJ A;  4JV0 A;  4AXI A;  3KK3 A;  3CXC R;  4ID5 B;  3GYG A;  1NK7 A;  4DR5 F;  5J1N A;  2LYV A;  3ENW A;  2XS5 A;  2BQU A;  2B51 A;  5E0O A;  1WG1 A;  4ID8 A;  1TKZ B;  2BAN A;  2CPY A;  5DQI A;  5HSP A;  1HNZ F;  2P6S A;  1S6O A;  4CH1 A;  3C19 A;  4DFJ A;  4V19 J;  4KJG A;  4K8R A;  3GCW P;  3WIU A;  3OT9 A;  2RE1 A;  4LF6 J;  2WON A;  4KFB B;  1AZS A;  3NCQ A;  5KAK A;  2GA3 A;  2JLE A;  4DU8 A;  5L0E A;  1HI1 A;  3C14 B;  2NYH A;  3E01 B;  4OI4 A;  4EBC A;  1KHV A;  1EAR A;  2G9O A;  2QL9 B;  4IRD A;  2UXD F;  4LQY A;  5IFM A;  1N6Q B;  5E3P A;  3RBE A;  3D6H B;  1LQ9 A;  1HWL A;  2I38 A;  3US5 A;  3M7V A;  3NBP A;  3RGI A;  4Q45 A;  2C2E A;  2V4Q A;  4OHY A;  3D7S B;  2DGV A;  1Y3K A;  3LW5 C;  2KFZ A;  2RDI A;  3DLG A;  4CYU B;  5C25 B;  1WF2 A;  2GIR A;  1Q8L A;  1SV5 A;  1SKR A;  5LL6 d;  4P72 A;  3FC9 A;  2GGP B;  4CI0 B;  4NMX A;  2M8H A;  1Z2L A;  5AE3 A;  4YY3 F;  2OPQ A;  2UUC F;  9ATC B;  2HS4 A;  4GVB B;  2ZH8 A;  2RIL A;  3DCA A;  3Q23 A;  4X4V A;  1IXK A;  1U0H A;  4GMK A;  1BE4 A;  4OYW A;  2IJF A;  3CIZ A;  2Z0G A;  3AJ2 A;  3UPF A;  3PAC A;  5HAN A;  1WOR A;  5LRN A;  1CS4 A;  2QLF B;  5F8J A;  1EP4 B;  2ZH3 A;  2IM2 A;  1NLK L;  1TL4 A;  3C14 A;  3E01 A;  4CO1 A;  4DL7 A;  2WK4 A;  4J9Q A;  5F8N A;  1VBY A;  4OZ2 A;  1SQF A;  2OFH X;  2H5J B;  4NX9 A;  1CBK A;  1WF0 A;  2O5D A;  3UCZ P;  4F02 A;  2HGM A;  4IG3 B;  3JQJ A;  4ZLN A;  5KG2 A;  3J81 j;  4FS1 A;  2C3M A;  2XMT A;  3VZI A;  2M3D A;  2BW2 A;  4AUK A;  3RTV A;  2QEX S;  1M5H A;  3MCS A;  3ZNJ 1;  1KQG B;  1UL3 A;  3MHY A;  3C6T B;  1AA1 B;  1K47 A;  2WVD A;  2GVD B;  3FBB A;  3H2L A;  3Q8V A;  4LR7 A;  4ZK7 M;  1H3D A;  4OV1 A;  5HK4 A;  5CA5 A;  3TG0 A;  2W5X A;  2J7U A;  5HQ8 A;  5GAD U;  5INH A;  4M5I A;  5T41 A;  3BDG A;  5ETK A;  4J5O A;  2EKN A;  2OSR A;  2YTC A;  3HSD A;  1N2L A;  2OD6 A;  3TZY A;  1MWQ A;  5HRO A;  4AQY F;  3IRX B;  2JZ5 A;  3OW2 R;  2IA0 A;  2CUY A;  2WBR A;  5DDR C;  1RT6 B;  2FY8 A;  4YHH F;  3CF5 Q;  2J7W A;  4MKY A;  3QJP A;  1FK9 B;  3HX9 A;  1E6Y B;  2XHW A;  2A6O A;  1PIE A;  1H73 A;  3DMJ A;  3NGK A;  2UV8 A;  2HHT A;  4PWW A;  2VPY B;  5L38 A;  4C8O A;  1QLN A;  1YDL A;  4KYZ A;  5KOX A;  3JSM B;  4Z37 A;  1SL0 A;  2GMJ A;  2CAJ A;  2EK6 A;  2LQB A;  2JSX A;  4DPT A;  5DLG A;  1RHJ B;  3HF5 A;  5LMN F;  2X3D A;  2FY1 A;  2M7S A;  5AJ9 A;  4RL1 A;  2VV5 A;  2W4D A;  3VGV A;  1RDR A;  1YGY A;  3GSD A;  4ICL B;  5H9E J;  5C24 B;  3AD8 C;  3DOL A;  5CYM A;  2DY9 A;  4M5D A;  3M2V A;  3JAM U;  4XTT A;  1NK9 A;  2DGO A;  3R7N B;  3UI3 A;  3I6P A;  2MZJ A;  5ETP A;  4WZM A;  1YJT A;  4WK1 A;  2AJF E;  5DG8 A;  3PRD A;  1BHN A;  2GC8 A;  4S0M A;  5U47 A;  3NKY A;  3G86 A;  2ZH1 A;  3DRP A;  5HQM A;  1AXQ A;  4L6V 3;  3RG6 A;  3BN4 A;  3MD1 A;  1JIH A;  2KU7 A;  2L41 A;  5L0B A;  3IDD A;  4EO6 A;  3DGP A;  3HSJ A;  4KQZ A;  5I3P A;  3OUY B;  1YWX A;  1Q0N A;  4NLD A;  1DQ9 A;  4DG1 B;  5KG5 A;  5IWA F;  5J2M A;  1V6H A;  2ZNY A;  1RT4 A;  2E44 A;  4KH0 B;  3KJV B;  1FFG B;  1SC3 B;  3I4P A;  3EVM A;  2OPR B;  3GLJ A;  4NYP A;  4OV6 A;  3K57 A;  2JEG A;  2ROG A;  3IR6 B;  4FF1 A;  2CG8 A;  3BDP A;  2KRB A;  1WHX A;  4ZVO B;  2CNN B;  4ZP6 A;  2QX0 A;  3C15 B;  3PW0 A;  4BBY A;  2DNP A;  2MKJ A;  2UUT A;  5E5N A;  1Q1K A;  4R0J A;  4DSF A;  1S72 S;  4WJB A;  1AFI A;  1PC5 A;  2IY5 B;  1L3V A;  1ELX A;  4DHV A;  1WG4 A;  4NLP A;  1S59 A;  2WB4 A;  3T5K A;  3SCJ E;  4QQB A;  4WE1 B;  3PJX A;  2DNM A;  2OLW A;  3K5L A;  3KOA A;  1T94 A;  4WFZ A;  1E3C P;  4NEZ A;  2H3E B;  4PXB A;  5GRR A;  2GVZ B;  4OI2 A;  2MZT A;  3IGN A;  1K1S A;  1Q5V A;  2CQ1 A;  2HUR A;  2MKS A;  2V2K A;  4L3K A;  3EDR B;  3KK1 A;  1URR A;  5JJB A;  5M2R A;  1Q8I A;  2GZO A;  3MCM A;  4B9U A;  1MSW D;  2ZUG A;  3Q8Q B;  2XMU A;  1AT1 B;  1UJ6 A;  2KT2 A;  2WW8 A;  2C1E B;  2M8D B;  1OSC A;  1L5U A;  3M30 A;  4UPI A;  2DNR A;  2FHK A;  4WTO B;  1FVQ A;  3OR2 A;  2IFX A;  3NY0 A;  4UUX A;  4C8L A;  2ZVS A;  4UY8 T;  3HK2 A;  4CLW A;  2HWT A;  4KPY A;  4EZ9 A;  2VFR A;  4RUH A;  4FKY A;  3UO0 A;  1P27 B;  2F65 A;  2IVY A;  4H4O A;  5E41 A;  1OY9 A;  2P9G A;  3EMT A;  3FKB A;  3O6Q A;  3LA0 A;  4KR0 B;  4ZIW A;  2R3V A;  5HLF A;  4ELU A;  2UXB J;  1YBU A;  3V4I A;  3MEE B;  3TRG A;  4UOR A;  2M88 A;  4KAI A;  3D54 A;  3FFI B;  4HT7 A;  3THP A;  2B5J A;  1TAQ A;  3CC7 S;  2ZBR A;  3CMQ A;  4FXD A;  1P1T A;  1YZ6 A;  1Y5I B;  2Z2M A;  3TAQ A;  1AUD A;  2FVQ A;  2IDL A;  1KBR A;  1RBL A;  2HG4 A;  2YQ0 A;  3HVA A;  3KHL A;  1VRT B;  3SV4 A;  1SUQ A;  3D2W A;  2VA2 A;  3GJS B;  3WZ0 A;  4P74 A;  1NXI A;  3R5B A;  3GZ7 A;  3ISN C;  4IH7 A;  4OYX A;  4MTP A;  1HIY A;  1C0U B;  2G1D A;  3QLH B;  3FEY B;  2YPZ A;  2CJK A;  1RTJ B;  1UW4 A;  2DIT A;  2DR6 A;  3CNQ P;  4ALZ A;  5KTQ A;  2IMW P;  3R7B B;  1R8C A;  3W3S A;  1BC6 A;  2AJ4 A;  3OSP A;  4DV0 J;  5TJ3 A;  2ZH6 A;  3BO2 A;  4CLF A;  1CQN A;  2GML A;  1X8D A;  3GIR A;  4LRC A;  2E9R X;  3GJR B;  1HPZ B;  3TAR A;  1HA1 A;  2CAD A;  1FA0 A;  2COL A;  5JMN A;  1B99 A;  3RW7 A;  1TL1 B;  3CD5 A;  3SCL E;  1X5P A;  2HNY B;  4IFY A;  1NEE A;  1ZPW X;  2QLX A;  1CC8 A;  2PA3 A;  1ZOT A;  3AHP A;  4O44 B;  2KXH A;  5EUH A;  2NPF A;  5KFF A;  3NGD A;  4D3H A;  1FKA F;  3EIC A;  4W98 A;  3SXL A;  4ZHR A;  5KFJ A;  3VAJ A;  3ENQ A;  3CCT A;  1APS A;  3MMA A;  3NKP A;  4UOG A;  4MIB A;  1ZM4 A;  1MRO A;  4CTA A;  1U0S A;  1VHI A;  3CJR A;  1N88 A;  2Y1R I;  3IWN C;  3CCR S;  2R7V A;  4NLR A;  2GO9 A;  2GA7 A;  3MM8 A;  1QUV A;  3G6Y A;  1WI8 A;  2HND B;  1VQM S;  1M5V C;  2KG1 A;  1FTC A;  4KFB A;  2WON B;  4P2F A;  1QE1 A;  2L3M A;  5HJX A;  4O3S A;  2HVD A;  3VVU A;  4WK3 A;  4Y00 A;  1RQ0 A;  5FD1 A;  1S5Z A;  3HSG A;  1RAE B;  1FRX A;  2VQE J;  2BE7 D;  1VMB A;  2V8D A;  3HZG A;  5RUB A;  6FD1 A;  1A9N B;  4DCP B;  2KFY A;  1YBT A;  3DOK B;  1PBA A;  2XUL A;  1IN0 A;  1UET A;  1U1K A;  1PIL A;  2P6T A;  1I94 J;  2WVC A;  4QAX A;  3CD0 A;  3KMQ A;  3FDS A;  1RAI B;  3OSN A;  4DZD A;  4RX6 A;  2DR9 A;  4B3R F;  4YB7 A;  3MUR P;  4MAK A;  4AE5 A;  3OJS A;  4PWD A;  3JXO A;  1XMO F;  1OY6 A;  4FXW A;  3IG1 A;  5A8R B;  1N34 J;  1JLF B;  1HBM B;  3KLH B;  1E33 P;  4NA2 A;  1NDC A;  2XMA A;  2BOA A;  3QGH A;  2HAF A;  4UT4 A;  3N28 A;  1FKO A;  2VKZ G;  1IBM F;  2FHJ A;  3CCS S;  1LV5 A;  5A2Q Y;  3FQK A;  4KB7 A;  1RAA B;  4OZ5 A;  1S1U A;  4ES2 A;  4J9V A;  3V6H A;  4AYB D;  2SXL A;  2VC1 A;  1NKE A;  3DYC A;  4DOZ A;  4QIF A;  2NXJ A;  5HI7 A;  4KRW A;  3ONQ A;  4JI1 F;  3FBF A;  2NZ4 A;  3IC1 A;  4U67 Q;  4K7Q A;  1S1T A;  3R5G A;  4B02 A;  4LFC F;  1FDN A;  3QID A;  2LDI A;  2XWY A;  4OX9 J;  1ANI A;  2ZBQ A;  4O4R A;  4AND A;  4XIU A;  4DV0 F;  4M5N A;  2R8K A;  2ZFH A;  3SSS A;  1SC1 B;  1SJR A;  5ETM A;  1S6Q A;  4DN0 A;  3CME S;  3L7O A;  3F56 A;  4C0B A;  3HVR A;  4A8F A;  3BS9 A;  1NJI T;  1EX8 A;  1Q81 T;  2VQF F;  3M32 A;  2DGU A;  2J6S A;  1HYS A;  5ETV A;  3T6B A;  4CNZ A;  1IBM J;  4J9K A;  4C4W A;  3LP1 A;  1PGZ A;  1M5P C;  2HQI A;  4KHP J;  2KVQ E;  2FC8 A;  2D3U A;  4Y2M A;  1HBO A;  5KG3 A;  1RT2 A;  4HH0 A;  2BRK A;  5HP1 B;  1NB7 A;  1LWX A;  4FVC A;  4N7T A;  4EUV A;  3SCK E;  5KFC A;  2XLJ A;  3T5J A;  2RRN A;  4D3G A;  5A2Q U;  5I3U A;  3EXY A;  4FYV B;  3TQE A;  1GH8 A;  1SH2 A;  5LXY A;  1CJT A;  3D1O A;  5A0Y A;  2C2N A;  4EGL A;  4IFV B;  4KJI A;  2HRY A;  1S99 A;  2IM0 A;  4A8W A;  3BBF A;  4P75 A;  4DR6 J;  2PGC A;  2B9Y A;  2AKW B;  2J7K A;  4M5H A;  4C8Y A;  2J8A A;  5IC4 B;  1WC1 A;  5KFB A;  5HRT A;  1WHV A;  4M1K A;  5SUH A;  5BYR A;  2XMW A;  5EGE A;  3EGW B;  4I56 A;  4JI3 F;  4XK8 C;  5MLC V;  2CPJ A;  3KXD A;  1RBO B;  4DXL A;  3CJ3 A;  4JV1 A;  3CE8 A;  5GAH I;  5GAG U;  4LFC J;  3MK0 A;  5IJQ A;  4J37 A;  2W5T A;  3R3T A;  4CT9 A;  1ZEB A;  3N4W A;  2B9X A;  2QMU B;  2ASY A;  2Q1L A;  4B9V A;  1OPZ A;  1CJU A;  3KK2 B;  2DGW A;  4X4N A;  3KJN B;  3GSI A;  2I5J A;  4RNN A;  2C2Z B;  4Q2M A;  3HHE A;  4IH6 A;  1MRO B;  3RB6 A;  4GC6 A;  5E3R A;  4OQJ A;  1QDU B;  4IO9 Q;  1VQ5 S;  4QYZ J;  4MIA A;  4JI4 J;  3MR3 A;  4YR2 A;  2OTJ S;  3VAK A;  3B5Q A;  4USU A;  3J7Z T;  2W8D A;  2R7S A;  2XMV A;  5AXK A;  3A8K A;  5HAT A;  3GMG A;  2D9P A;  3HVT A;  3IWL A;  2FVC A;  1J2V A;  1SIZ A;  2PDA A;  4C11 A;  4O3R A;  2E5J A;  2AGQ A;  3VF0 B;  2NYI A;  4WBF A;  1JLQ A;  2LFV A;  4A47 A;  1RT5 B;  5KFW A;  4JV5 F;  4WII A;  1VQY A;  3KLE A;  1CJV A;  4AQY J;  1I3O B;  3QWU A;  5GME A;  1HW8 A;  3LP2 A;  1XMQ J;  1HPZ A;  1WC0 A;  3M8Q A;  4GO5 X;  4M95 A;  2FIU A;  2ACM A;  4CXS A;  3CW2 C;  1UAW A;  3IAM 9;  4G65 A;  4PXC A;  1RA6 A;  3VQT A;  1MNE A;  2FJV A;  1REV A;  3PX0 A;  5GMD A;  2YXL A;  5B0E A;  3S7R A;  3VHQ A;  3WAV A;  1X9S A;  1QTN B;  2OH2 A;  3CJ5 A;  2W4C A;  1R8B A;  1MG7 A;  2MKY A;  3M8R A;  1FDD A;  3KHR A;  4LFA F;  4LRA A;  1TKT A;  2VG5 B;  1U24 A;  3CUL A;  1NK4 A;  2W24 A;  2W5R A;  2XMM A;  4URG A;  2HNY A;  4DR7 J;  3JQM A;  1JLF A;  1YRT A;  2LEA A;  3W5Y A;  1GNK A;  4LF7 F;  1HMV A;  2ZH5 A;  1ELY A;  3IBC B;  3V4I B;  4PQU B;  1RAB B;  2LQJ A;  1NK6 A;  1Y7P A;  1Y5N B;  2KB2 A;  4W4M A;  3SFG A;  3AXK A;  4X64 J;  4JI5 F;  2GHW A;  2OPR A;  1DAX A;  4EK2 A;  4EU0 A;  1N5Y B;  2HVH A;  3QGG A;  5GOV A;  3BSO A;  3TAP A;  1FJ7 A;  2F40 A;  3E51 A;  1N36 J;  4IUF A;  5J2M B;  1KEK A;  2YNG A;  4OHZ A;  2J9D A;  2YKQ A;  1U49 A;  2RQ4 A;  2PSZ A;  3MM7 B;  4LSL B;  4U8V A;  1T11 A;  2Z2L A;  4QWD A;  3G6X A;  3T1H F;  3OD2 A;  1Q86 T;  2C2O B;  2QSF A;  2RS2 A;  1TR0 A;  4X65 F;  2VIH A;  2MEW A;  3HFZ B;  3GTY X;  4K2J A;  3V6D A;  2FVP A;  1UVI A;  5DZ7 A;  2V4J B;  3VAH A;  4CYS A;  3KHH A;  3MEE A;  1JX4 A;  3KTQ A;  3NL0 A;  1QAX A;  3U7J A;  5DLT A;  2DVI A;  3A8E A;  5CCM A;  4N5S A;  4ZJL A;  4ZVQ B;  5T14 A;  3C16 B;  3SSQ A;  1S4F A;  3D0G E;  2VFT A;  1N48 A;  1N34 F;  3J7Y I;  2BM1 A;  2NXC A;  4ES1 A;  3W2W B;  4LF5 J;  4PUO B;  4LFB J;  3K5O A;  2VBY A;  3CVK A;  2J6T A;  4K4S A;  4OX8 A;  3MEK A;  2VAS A;  1FDA A;  3MED B;  4URS A;  5E3A A;  3Q8P B;  3OL7 A;  4JI5 J;  5CYQ A;  4CWB A;  2HNZ B;  1RAH B;  4NLS A;  4U96 A;  4N47 A;  5A6P A;  1U1M A;  1RTD A;  1PAE X;  4JI8 J;  3QSI A;  3TI0 A;  1H0H B;  2VU5 A;  5KFI A;  2E1A A;  2E1R A;  2IAJ A;  3FQL A;  4DUZ J;  4A8S A;  1NSP A;  1MU2 A;  2ZD1 B;  5AT1 B;  3ZZR A;  2XYH B;  2XO6 A;  3DXS X;  1R0A A;  2B6A A;  2W25 A;  3KD8 A;  4RWW A;  5F8I A;  2G13 A;  1X9M A;  1VQK S;  3KLF A;  3MDF A;  2CZV C;  1HWI A;  2QV6 A;  1HBU B;  4HHJ A;  4CLZ A;  4JV5 J;  3UNG C;  2B8Q A;  4DV4 J;  3WAX A;  2FDN A;  4NE9 C;  1C0U A;  2GLQ A;  1JLE B;  2BRL A;  4EI2 A;  3D67 A;  2MPU A;  3MWB A;  3KJF B;  4GTZ A;  4NRT A;  4YY3 J;  2B9W A;  5L9N A;  3OTO J;  2D9O A;  4WKY A;  2V50 A;  3OL8 A;  3CMA S;  3WC2 A;  2VG6 A;  4GKK J;  2HVI A;  2HK3 A;  2R2U A;  4IOC Q;  5C2C A;  2W5Q A;  2CWK A;  4DLG A;  4USH A;  1L3K A;  5AXN A;  2ZH4 A;  1HD1 A;  2FPH X;  3MPD A;  4I6Y A;  3WHI A;  2R8I A;  2DIS A;  3W62 A;  3KUH A;  5F0W A;  3PYG A;  4FDJ A;  3SIP B;  2AYB A;  1VC6 A;  2QSW A;  2B4P A;  4JV2 A;  4P7V A;  1VBX A;  4OYO A;  4CRJ A;  4ZCM A;  3KJV A;  4LF4 F;  2V68 A;  1P49 A;  2HBZ B;  3OUY A;  1HQE B;  2K2P A;  2G1H A;  2E1C A;  3CJ4 A;  2R8G A;  1Y7A A;  2HZA A;  3D0H E;  4C3K A;  4ILL A;  1WNE A;  4PG4 A;  3S1T A;  1WKK A;  2ZEJ A;  5CCL A;  5I3Q A;  3PEH A;  3QYY A;  1U0H B;  5J2N A;  1F9H A;  2CJA A;  1TU0 B;  1KOO A;  1U2C A;  2UVV A;  4NLG A;  3ZFV A;  5D4O A;  4TQR A;  4L76 A;  1GXU A;  3HHK A;  3QBC A;  2BUN A;  3NEK A;  1RT6 A;  2HQD A;  4NZ0 A;  5KG1 A;  1CUL B;  4QPT A;  1RAC B;  3R5C A;  1HR0 J;  3HVW A;  5C24 A;  1VQ8 S;  2ANH A;  2P5V A;  2ZOM A;  4CLT A;  3MOZ A;  3BO4 A;  1YQH A;  4GO7 X;  3BYR A;  2FHM A;  3CDA A;  4I2P B;  1TL5 A;  4M63 A;  2W9B B;  4ED2 A;  2AZ1 A;  1RK8 A;  4DJB A;  4UZB A;  2XY6 A;  2YY3 A;  3QRQ A;  2ERR A;  4QCL A;  1FXL A;  2RKI A;  1RTZ A;  4UTG A;  3T41 A;  2IVM A;  1AZS B;  2QA2 A;  1GTH A;  5HVF A;  3F44 A;  1VGY A;  3LF0 A;  1WJ9 A;  3UN3 A;  3EM1 A;  4F04 B;  3DM2 A;  4DV3 J;  3RAQ A;  1QAJ A;  1TKX B;  4QOT A;  3FGV A;  1TV6 A;  4DR4 F;  4CZC A;  1D9D A;  4KHP F;  1UVM A;  2XBP A;  3MM7 A;  4IRC A;  1ITP A;  1ELO A;  1MML A;  1M0S A;  2QZ8 A;  3C3L A;  2ATL A;  4ID5 A;  3TOQ A;  1SBR A;  2YWF A;  2WSF C;  4DCJ B;  4DDF A;  4DBQ A;  2GV1 A;  2EI5 A;  2BZ2 A;  2LLZ A;  3H42 A;  5AXM A;  3CCL S;  1CS4 B;  2G2O A;  1IKV A;  2PEB A;  3RRG A;  1ULR A;  5KOW A;  1F2H A;  2ZBP A;  1NKC A;  5DLF A;  2R4F A;  1J5E F;  4F8R A;  4JI6 J;  2BKN A;  4HLB A;  3T1Y F;  2KDO A;  1EKR A;  1HMV B;  1K1Q A;  4OHV A;  1IJE B;  2EBE A;  4A8O A;  5D15 A;  1JQG A;  4Y28 C;  4KV8 B;  3R5J B;  3LP0 B;  4CLU A;  4B3T J;  4OX9 F;  4DFP A;  1EQJ A;  1PJ5 A;  4LRD A;  4ZG7 A;  2MXY A;  1TKT B;  2XTJ P;  3SBM A;  4AXJ A;  2NR0 A;  2KT3 A;  3TX8 A;  4DR1 F;  4NYZ A;  1R3N A;  3DOL B;  3ZZP A;  2X1G A;  4MK9 A;  3QO9 B;  4DUZ F;  3PZP A;  2HFV A;  2BAB A;  4LT6 A;  5J2N B;  1UEK A;  2PI4 A;  5L1L A;  1R27 B;  1Q5Y A;  3BPD A;  2IM3 A;  1VS3 A;  1X0P A;  3AB2 B;  5CD4 A;  3ZZ0 A;  1HW9 A;  2F1F A;  1HQE A;  3ELH A;  1JNZ B;  2JC1 A;  3JB9 k;  5IJS A;  1B8J A;  4C8M A;  1Q53 A;  1VQ4 S;  4MJK A;  1D0E A;  2AHO B;  3OR1 A;  2VQR A;  4Q2L A;  2P9C A;  1RT3 B;  3PYF A;  3Q8Y A;  4I67 A;  4GTX A;  3BSA A;  3MMC B;  4DF8 A;  3IO1 A;  1U4B A;  4L73 A;  4F0K A;  5LMU J;  5AJ3 F;  1U7L A;  3HJF A;  3OV7 A;  3KK3 B;  3NMA A;  1M5S A;  2EW9 A;  2AMC B;  4X65 J;  3NLC A;  1UA0 A;  1CG2 A;  2N3L A;  1YRX A;  2KHC A;  3UD5 A;  2AP6 A;  1WSR A;  3A3N B;  3S6E A;  3CJQ A;  1IKV B;  3DDK A;  4KT0 C;  2KN4 A;  4PAA A;  1NRK A;  1PSD A;  1VRU A;  2I0X A;  2PA8 D;  3LPY A;  1H72 C;  1HL6 A;  3GJT B;  4DR2 J;  3DLL Q;  4CO3 A;  4ECY A;  1FHT A;  4CO4 A;  5KFQ A;  1Q7L B;  5HO4 A;  2N7C A;  1X4A A;  1AJA A;  1KDN A;  2VDI A;  1MW7 A;  2GAH C;  1TV6 B;  1RKI A;  2V8G A;  4NOH A;  5H9F J;  2K3K A;  5A8K A;  3EX7 B;  1JJ2 R;  2LMI A;  2WVB A;  1TKZ A;  2BAN B;  3CGI A;  3W8G A;  4F36 A;  2KHD A;  3DLK A;  2IAJ B;  4QWB A;  3GR1 A;  2R7R A;  3PO5 A;  3MF5 A;  4NAS A;  3MXH P;  4Q0B B;  3MK1 A;  5B0B A;  2CJQ A;  1NZA A;  4OIX A;  3KLV A;  2NRE A;  5CYQ B;  3R6L B;  1UWB B;  2OI2 A;  4P9S A;  5L0K A;  2W7P A;  2Q6B A;  3HFK A;  2GJF A;  2HKE A;  4HI2 A;  4RW7 A;  3QPI A;  1Q78 A;  5KFL A;  1NCL A;  4NI2 B;  2HRT A;  2OHD A;  4FPI A;  1UA1 A;  1E1Z P;  3Q86 A;  3QSY B;  1HNW F;  2W8S A;  4FP9 A;  3WAY A;  4DR5 J;  3H5S A;  5CAB A;  1FJC A;  1T0T V;  3BDE A;  1YRU A;  2DGS A;  2LXI A;  2RF2 A;  4HHU A;  4CYU A;  3B54 A;  2OEL A;  4RW4 A;  2MKK A;  3L3C A;  1RT7 B;  3MTK A;  3GQC A;  3V6D B;  4OZL A;  3NGS A;  4HH1 A;  4JI8 F;  1Q82 T;  3NOG A;  4ECQ A;  1O51 A;  1KLN A;  2DXD A;  4DSL A;  1T9X A;  2IYG A;  3CD7 A;  1IVZ A;  3RAM A;  1N32 J;  3AA8 A;  5IS2 A;  3L7P A;  3CCE S;  2VJV A;  4O4G B;  1UMJ A;  4WP8 A;  4F50 A;  4QIV A;  2WOM A;  2IC3 B;  4NXM F;  3H20 A;  4WP9 A;  2ZH2 A;  5KFD A;  4UPL A;  4KAY A;  3G8Q A;  1CPZ A;  4PYA A;  4J9L A;  1FER A;  1SJ3 P;  1ZBT A;  1KVI A;  6FDR A;  5EGY A;  2RUG A;  3FEZ A;  3G9C A;  4BDP A;  3R5A A;  4HKQ A;  2MQL A;  3N79 A;  2ZIT A;  4HTJ A;  2ZKT A;  4B17 A;  3CIM A;  5LJ3 Y;  2ZM6 J;  5L8R C;  5DM7 Q;  3RU0 A;  1QTM A;  5C66 A;  3PTW A;  3JAM Y;  5KFY A;  3AFG A;  4JI0 J;  4LF5 F;  1SI9 A;  1CC7 A;  2B4V A;  2XCP A;  1E6V A;  2J0Q D;  2C22 A;  5CQG A;  5D78 A;  2L9D A;  2QIF A;  3B4D A;  5BYQ A;  4J9U E;  2RH6 A;  3LQV A;  4YQW A;  2Z30 B;  3W7B A;  2LQ8 A;  4CM2 A;  5CAA A;  5LIA A;  3BN7 A;  1Q16 B;  2M4M A;  2QYG A;  3I0R A;  1VQO S;  2VD3 A;  3K59 A;  3C6U A;  3ISN D;  4M5J A;  1RWW B;  2AYG A;  4QIE A;  3ZTO A;  4RU9 A;  3HLU A;  3KLE B;  3ICL A;  5DZ6 A;  4J90 A;  3K58 A;  2FLP A;  2ZBI A;  1FNO A;  1FKP A;  3EZO A;  3M2R B;  2PII A;  2V2Z A;  4U9R A;  5D4N A;  5ETR A;  2IVF B;  1HNI B;  4WFB Q;  3JYT A;  2AWZ A;  1U6F A;  4DV4 F;  1NHK L;  5L39 A;  2PFF B;  1AJB A;  4I2Q A;  2BJ1 A;  4OYZ A;  3J7Y U;  4OX6 A;  1SL2 A;  1ALI A;  1D8Z A;  1QM9 A;  3GV5 B;  1YJ7 A;  4CLP A;  3WQP A;  2AW0 A;  4JBC A;  5IQ6 A;  3B82 A;  2HFO A;  1NPR A;  3DYA B;  3MUV P;  4OJ1 A;  3C16 A;  4N8N A;  2VBZ A;  1G6B A;  3AB4 B;  4IOB A;  1LW2 B;  3VAI A;  1K9M T;  3SZY A;  4UST A;  1Y4Z B;  2EFV A;  4QZV B;  7AT1 B;  3P4U B;  4KO0 A;  3SDE A;  4F7V A;  4DUY F;  4UY8 5;  2HND A;  3NKM A;  4KAV A;  2QT7 A;  2GW8 A;  3FJ2 A;  2V4J A;  4DFK A;  1NH7 A;  1RCO B;  3D66 A;  4LVN P;  2Z58 B;  5KFK A;  3GV7 B;  2YKM B;  2J8S A;  3IM8 A;  2UUA F;  1VQ6 S;  3ED4 A;  2LCW A;  4B08 A;  1AUK A;  3GIK A;  1HHQ A;  4G1P A;  1ZAX A;  4LRB A;  3DYA A;  2JFD A;  4W90 B;  2J9C A;  3PNI A;  2DR7 A;  1GXT A;  1X60 A;  2XSJ A;  1UJ4 A;  2ILY A;  3D28 A;  4P6Q A;  4G1Q A;  3T01 A;  1T8E A;  3VAF A;  4MFB A;  4JUZ A;  4NWB A;  2H48 B;  3N0V A;  1NJZ A;  3A12 A;  4WYL A;  1HJK A;  3MTJ A;  3FBE A;  4OFZ A;  2Q66 A;  3TJ8 A;  5LMN J;  4IFV A;  4LQ3 A;  1U6B A;  1YJ9 S;  2IM1 A;  1NAQ A;  3SYZ A;  1EQ0 A;  5B08 A;  3K17 A;  2X1A A;  1WHY A;  1IKY B;  2E5L F;  4RZR A;  4KTQ A;  1OMS A;  3BKU A;  3HFV A;  5E2Q A;  4ZN1 A;  4RUA A;  1UP1 A;  1PBU A;  2DNH A;  2DHH A;  3SZ2 A;  2DR5 A;  2RHS B;  1MMN A;  2XSJ B;  4LSN A;  2CQP A;  1J27 A;  2DGQ A;  3R97 A;  3IM9 A;  3WC0 A;  3GPA A;  3LP1 B;  2DIU A;  4ZP8 A;  2DB1 A;  2CNO B;  4F4K A;  1RAO A;  1X5S A;  3KJQ B;  3NCP A;  1JLA A;  4NLO A;  2CVE A;  2GSU A;  2F63 A;  5IWA J;  4DQS A;  4EWT A;  1VBZ A;  2DRB A;  3RW6 A;  1XMB A;  2WCX A;  1R89 A;  4CP5 A;  2CPE A;  1B70 B;  3KG0 A;  3MPU B;  3CO0 P;  2HHX A;  2JFK A;  2QC3 A;  1S6Q B;  4YDX A;  4LFA J;  4KO0 B;  5L1J A;  3DLB A;  1P8G A;  4USI A;  3TUJ C;  2F9J A;  2YX7 A;  1TMM A;  2HW3 A;  1U8W A;  3OJU A;  4PKD B;  3GIJ A;  1RT3 A;  3RRH A;  1WTB A;  3CJT A;  2DR8 A;  3K5M A;  3MD3 A;  4WIQ A;  2MDA A;  5EGH A;  3D1H A;  3MMJ A;  2RSQ A;  1BGX T;  1H2U X;  4UOF A;  3CCW A;  3DXB A;  4X66 F;  3FUY A;  3AY0 A;  4ES3 A;  3M6X A;  1YBA A;  4KHM A;  3IA0 A;  4ECV A;  1FKP B;  3SQG A;  2HFN A;  2IUC A;  1JXE A;  2PEH A;  2XC9 A;  4JB8 B;  1RU2 A;  2E7V A;  2RF2 B;  1EZZ B;  3G82 A;  3I0R B;  3O44 A;  3RYL A;  1ZZF A;  4P2M A;  4ZVE A;  2YWH A;  5GAG I;  2MYF A;  2VF3 A;  5A6W A;  2YVS A;  1X5O A;  4ZVF A;  4BCA A;  3VAM A;  3KLG B;  4KV8 A;  3NGU A;  4A8K A;  3PVX A;  1SXL A;  2A3J A;  4NLX A;  3AJD A;  3THT A;  3TWZ A;  2FJB B;  1T03 B;  1PJ6 A;  1JJH A;  4PWD B;  3JTN A;  4RW7 B;  4UZC A;  2R2T A;  2XMJ A;  3I0S B;  3UDC A;  5KG6 A;  2JRS A;  5DQH A;  3U27 A;  2E66 A;  3E3X A;  3KFW X;  4LR8 A;  4I69 A;  3CDE A;  5B0D A;  5ITH A;  3QJL A;  2A10 A;  1RGV A;  1UZH A;  4OMF G;  5D0E A;  5DGB A;  2B7C B;  1DY3 A;  3D9B A;  1VBK A;  1NND A;  1M1K T;  2O66 A;  2GHP A;  1Z1Z A;  2ASJ A;  1YJW S;  2O01 C;  2HHQ A;  4Q8F A;  1U47 A;  2H54 B;  2R7W A;  1RCX B;  3A8I A;  1KLM B;  1Y0H A;  2NUU G;  4O3O A;  2WOM B;  1S7I A;  1JLB A;  4J9R A;  1XR7 A;  3CSK A;  2XS7 A;  2DHX A;  1F3F A;  1V5I B;  2IRU A;  2R42 A;  1REG X;  3S01 A;  4UW2 A;  2QGF B;  1T9W A;  1WOO A;  2GAG C;  4OI3 A;  5K8O A;  1H7W A;  3G71 S;  3RR7 A;  3NNH A;  2DNG A;  1NZ8 A;  2YX4 A;  1SVD A;  3GYX B;  2W9B A;  3MAQ A;  1XMO J;  1HYS B;  2A0F B;  1RU1 A;  2JNJ A;  3JQK A;  1D09 B;  3WAW A;  3GON A;  1S12 A;  5D4P A;  2H4W B;  3JSY A;  3T9N A;  3ULH A;  4RNM A;  1QSS A;  2UXB F;  1BWV A;  4IFY B;  1GMU A;  1TP7 A;  8AT1 B;  1LW0 B;  1QSY A;  4DWI A;  3NVL A;  2W7O A;  4DR1 J;  3RB3 A;  2W5W A;  2WW4 A;  2RQK A;  1TL7 A;  2BAC A;  4YB5 A;  4AD6 A;  4ZIT A;  5C5J A;  3NNC A;  4OYB A;  2FC9 A;  1WEZ A;  1KHL A;  3KDN A;  1IR0 A;  2CQC A;  3NP5 A;  4DV2 F;  2D1C A;  1N0U A;  2I1R A;  2HLU A;  3V4M A;  1VRQ C;  1OPI A;  1UW9 A;  3ZO7 A;  1C1C A;  4X62 J;  3F73 A;  1S1X B;  1NPP A;  2CJY B;  4Y3C A;  4KH1 B;  2EFP A;  3M9M B;  1S1U B;  3K5N A;  1IKW A;  4I6A A;  1NUE A;  5D4L A;  1Q8B A;  1NH8 A;  3IGV A;  4NLQ A;  1VQN S;  1R8P A;  2CDQ A;  4ZVT B;  1VC0 A;  3E2D A;  4F3Q A;  4K4V A;  1FK9 A;  2OD4 A;  2OMO A;  1RIS A;  4GRS A;  3BKT A;  4NCG B;  2W9C A;  3HHN B;  1NU4 A;  1JJC B;  3EE3 A;  2EPI A;  3OTE A;  1LK5 A;  1MLA A;  5A8R A;  3UDV A;  1KNZ A;  1ELZ A;  4V1A k;  5ADZ A;  3NKQ A;  2HRU A;  2YNI A;  5KFS A;  1T3N A;  4V19 X;  1KHJ A;  1CLF A;  3QFW A;  4HVZ A;  4ZPB A;  5HVH A;  3QZ7 A;  3M8Z A;  2BE9 B;  1OYD A;  3LAM A;  1VIO A;  2GVD A;  4LF9 F;  4OYM A;  3DOK A;  3NAH A;  1X0F A;  8ATC B;  4IDK B;  4IRK A;  3FSI A;  1LWE A;  2LQ9 A;  4DX7 A;  3OR2 B;  3C2P A;  1R6Y A;  1LXN A;  1LWF A;  2DHS A;  2X1F A;  2HVZ A;  1K7H A;  2DY1 A;  1L3T A;  1N5S A;  1SJQ A;  1PYT A;  1ZYQ A;  4WWS A;  4ECR A;  1R31 A;  1OWX A;  3OTC A;  1MN9 A;  1RTH A;  3U1L A;  4F25 A;  4YUD A;  2FJX A;  1PYO B;  1K0V A;  1YTY A;  3CUN A;  5C42 A;  4MMO A;  1T9V A;  3R6G B;  5F3T A;  4C2M A;  3I55 S;  3MEC A;  4X84 A;  4GKJ J;  2F8M A;  3HUL A;  3FK4 A;  3EWG A;  5GAE I;  1RTI B;  4PG6 A;  5H1S V;  4N41 A;  2KI2 A;  4DSI A;  1X4D A;  1MN7 A;  2O3D A;  1RT1 B;  2ZWP A;  1RHK B;  3MAA B;  3IRW P;  1VHF A;  5L1I A;  4ZHR B;  4JOU A;  2AX1 A;  3LPE A;  4DR3 J;  4CLK A;  1R0C B;  4M5K A;  1SL1 A;  5DDP C;  1VIX A;  3QIP B;  5K14 B;  2C3P A;  3D68 A;  1OYE A;  1RSC A;  3AOD A;  4QIW D;  3UWT A;  3H7H B;  2W2Q P;  4IR9 A;  3QFH A;  2MJU A;  3LP0 A;  4R5P A;  4IKA A;  3MEC B;  1T95 A;  1VLO A;  2DBB A;  3D5M A;  1OJ4 A;  3OFE A;  3W2V A;  3HT3 A;  2ZH9 A;  4HYK A;  2K7J A;  1AYE A;  1K0T A;  2GSO A;  3MM9 B;  1KFS A;  2WRM A;  3O1L A;  1UKU A;  4WXW A;  1FWP A;  1EW9 A;  2FLN A;  3MM6 B;  1F6T A;  2P2C B;  3BKF A;  3LWM A;  2R7O A;  3OHB A;  2UUW A;  4EBD A;  3J7A 1;  2IRY A;  3AA9 A;  1FX2 A;  4LRE A;  1LWE B;  4NLV A;  4U7U D;  2V9K A;  1F2G A;  4XPC A;  4U8Y A;  3FRZ A;  4OYP A;  4ED3 A;  1FJG F;  1RWX B;  2VB6 A;  4IYQ A;  2BE2 A;  2HEK A;  2RQC A;  1WAC A;  2ZE2 B;  1SUQ B;  1N5Y A;  2N4C A;  5HJY A;  2DRD A;  1IUJ A;  4U95 A;  4R8U A;  1B4S A;  1S48 A;  1GX5 A;  2QTW A;  1FFS B;  3DRS A;  2DJW A;  2VPX B;  1QJH A;  4I7F B;  5AXL A;  4J9O A;  4UUW A;  3VVT A;  3PG9 A;  3FMW A;  2J0S D;  2VG6 B;  1S0O A;  1LFP A;  2CPH A;  4H4O B;  2W4P A;  4LBP A;  4DI6 A;  3GIM A;  1T7P A;  2NUH A;  1FWL A;  3PJ9 A;  4KKO B;  4JI2 J;  1KC8 T;  4PWU A;  1RB0 A;  1CUL A;  1U25 A;  4KBI A;  4RW8 A;  1U1Q A;  2NSC A;  3ILI A;  4ATN A;  2CG4 A;  4G1I A;  1TK0 A;  2WVF A;  1NK8 A;  1N33 J;  2J9E A;  2K06 A;  5FDL B;  1OQ6 A;  1YZ7 A;  1NB2 A;  3KLF B;  2W7A A;  1S1W A;  4QR0 A;  1WHW A;  3KYL A;  4ZVU B;  2RNE A;  3DI6 B;  2ZD1 A;  1Z2Z A;  2W2P P;  3MMB B;  1O5J A;  2CQ0 A;  2JLF A;  3I5C A;  2BEF A;  2V8H A;  4NPO A;  3ZTP A;  5L46 A;  1XEZ A;  3DN9 A;  4CCH A;  1FFW B;  3V5R A;  1E6Y A;  1JLQ B;  2YWW A;  5M2P A;  1BUX A;  2DNZ A;  2AYE A;  2AZ3 A;  2EG2 A;  4ELT A;  1WKJ A;  3IRX A;  3R8Y A;  4ZLJ A;  4RW8 B;  2KZM A;  2QN6 B;  4FKX A;  4WE1 A;  5K8M A;  3T1H J;  3OXL A;  4B9S A;  4DV5 J;  1IBK J;  3VGT A;  4ZPC A;  1JJ4 A;  5F8G A;  1YK9 A;  4GKJ F;  2DNK A;  3Q8S B;  1TAU A;  1RAG B;  1IR1 A;  5D0H A;  5IM0 A;  2VC0 A;  4YR1 A;  2E5H A;  2W2M P;  3NMR A;  1HI8 A;  4PEO A;  4F4A A;  1VI7 A;  4OZ3 A;  4DU7 A;  2CQH A;  2G2Y A;  4NCG A;  2W9C B;  4FYX B;  1YHQ S;  1HBN B;  3P8B B;  1NHV A;  4CIO A;  3SFU A;  3MK2 A;  2VPW B;  3DDN A;  4DX8 H;  5KFN A;  2A18 A;  1N54 B;  1FRJ A;  2B7B B;  2BE2 B;  1KVK A;  2HQG A;  2MY8 A;  3P45 B;  5LT5 A;  5DET A;  2MHE A;  4ECU A;  3MR7 A;  4ZPV R;  3QAU A;  2GNK A;  4RW9 B;  1RT4 B;  1WI6 A;  1LWC B;  3DGV A;  2I6W A;  2AGO A;  2G9Y A;  1FWK A;  1S77 D;  1DQ8 A;  3GG0 A;  2RH3 A;  4A4J A;  1UVN A;  4GKK F;  4WF9 Q;  1HBU A;  1EP4 A;  1WDD A;  2EWH A;  3A3O B;  3AJ1 A;  2VOP A;  3IR7 B;  1SQG A;  4ED6 A;  1N32 F;  4HI1 A;  1S79 A;  2X7I A;  5B09 A;  4J9M A;  4FF2 A;  3HZE A;  4DV5 F;  1IBK F;  1P9Q C;  2ZM6 F;  4A8Q A;  4PQU A;  2ASL A;  1LNQ A;  2MKH A;  2HPU A;  4ED7 A;  4HDG A;  5KG7 A;  1WUU A;  4HTI A;  2PC6 A;  4DQR A;  1SV5 B;  2WVE A;  3ETM A;  3DLH A;  1RT2 B;  1TQL A;  2B9E A;  2EEY A;  3G4S S;  2GQC A;  1UFW A;  2ZHO A;  2NLW A;  1S6U A;  3H2U B;  2PMZ D;  4CH7 A;  2R2R A;  4F4W A;  1TUG B;  3RZA A;  4C9D A;  2CQ4 A;  1FI4 A;  1XBW A;  3KG1 A;  5DG9 A;  4Q44 A;  3HMJ G;  4K4W A;  2Y1J A;  2XS2 A;  3ITH B;  2M52 A;  1RLC L;  3KMS A;  4OHW A;  3NRB A;  2X98 A;  1VR6 A;  3M8Q B;  1SPB P;  2FGC A;  4EO8 A;  1LEO A;  2MLY A;  1N4L A;  1MWZ A;  4ELV A;  2CJB A;  3RBX A;  3HHL B;  3DMJ B;  3T9Z A;  3PR5 B;  4WKR A;  4BLG A;  1FJE B;  1VK8 A;  1D3W A;  1NKB A;  4WPA A;  3CDW A;  4GC7 A;  2VOO A;  2HGL A;  2KFN A;  3POT A;  4QWA A;  1KH7 A;  4RPF A;  2ASD A;  2UP1 A;  4IQX A;  3MPW A;  2KVI A;  4F4X A;  1F3V A;  2C2M B;  2K1R B;  1S9E B;  1WF1 A;  2ZWO A;  4LJM A;  1UFL A;  2EXU A;  4KIA A;  4ZPW R;  2Z57 B;  3BDG B;  2PN6 A;  4DV7 F;  1L3S A;  1A6L A;  2UUA J;  2POK A;  5T7L A;  5G0R A;  2HVE A;  1NK5 A;  2CZ4 A;  1U8S A;  1T05 B;  4K0K F;  5KFV A;  3NOC A;  4OYI A;  2BXJ A;  1U26 A;  1XN9 A;  1Y00 A;  2N82 B;  1ALK A;  3M6U A;  3D0I E;  3CDB A;  2KJW A;  5EX3 A;  1RHQ B;  3IBF B;  1FKO B;  4MT1 A;  4RBV A;  2MY7 A;  4RU2 A;  1K44 A;  4LBI A;  3CDU A;  3CCV S;  4X4Q A;  1TL3 B;  2VG5 A;  4TU9 A;  1IKY A;  5D77 A;  2HQF A;  2XQC A;  1RZM A;  3K5P A;  4AFF A;  2E5G A;  2H4Y B;  2Z56 B;  3R7S B;  4DPO A;  5HMW A;  3MR6 A;  4O23 A;  5D3G B;  3Q2S C;  4MFB B;  2XM3 A;  3FCW A;  4P2S A;  2RU3 A;  1Q8K A;  3TAM B;  1FRH A;  1RWM B;  3BGF A;  2XCA A;  3OQ2 A;  2JX2 A;  1AFJ A;  3CJK A;  2CRL A;  4ENO A;  3Q8U A;  4PXE A;  2W8K A;  3PX6 A;  2QA1 A;  4Z7C A;  2BBE A;  2KTQ A;  2R7T A;  2GCF A;  1M1H A;  2XY7 A;  2H5I B;  4F0H A;  2J6U A;  1BQN A;  1DTT B;  4TLQ A;  1FT8 A;  1TK8 A;  3O5T B;  5CYJ A;  4FBT A;  1T9U A;  4KGZ B;  1KHN A;  2HQC A;  2QA4 S;  1WEX A;  4I68 A;  4O3Q A;  3TUZ C;  4I1T A;  2ALY B;  5KT7 A;  4YR3 A;  3R1L A;  4UOC A;  1U45 A;  2LKZ A;  1FF2 A;  4N77 A;  3ZZO A;  4P73 A;  1Q79 A;  4FVM A;  5GAE U;  4JI7 F;  3NNA A;  3MGJ A;  1WOS A;  1RWN B;  4USK A;  3D6F B;  5C2G A;  1N6Q A;  2FVS A;  1DLO B;  4DL4 A;  3MUT P;  4ILM A;  1X9W A;  2NQP A;  3TZZ A;  3D1Q A;  3MAH A;  4LSN B;  3DU6 A;  2I5J B;  4TKT A;  3CJ2 A;  4XO0 A;  2HLT A;  3OVA A;  2VL1 A;  1IBC B;  5IOL A;  2QYC A;  2DGX A;  1QD1 A;  1WEL A;  1BQN B;  1SKU B;  3IBW A;  1RWK B;  1WTF A;  1M1G A;  4OJG A;  4OZ0 A;  4PG7 A;  4H4K A;  4CLS A;  2MQP A;  3M2R A;  1BY9 A;  3VGS A;  1TL1 A;  2RML A;  3UVJ A;  3DHX A;  1KSP A;  3HCX A;  1GMW A;  3EXC X;  4DZ6 A;  1IBL F;  2X1B A;  3M1V A;  4P7T A;  8RUC A;  2HBR B;  3Q22 A;  3A13 A;  5LSR A;  4NWX A;  4KGX B;  5JXS A;  3TAM A;  3NG8 A;  3U1M A;  4DV6 F;  1X4E A;  2BJD A;  5DM6 Q;  2HZV A;  2AF6 A;  2H51 B;  1HKA A;  4G1Q B;  2OSQ A;  4RUC A;  1BQX A;  4NL5 A;  4LF4 J;  4UPH A;  1PCA A;  3MM5 B;  1RTJ A;  4LF1 A;  2XB2 D;  1SCJ B;  2OP5 A;  5DS7 A;  5E7O B;  4FPR A;  1B0P A;  3A8J A;  1EAY C;  5F3Z A;  2VHG A;  4DV1 J;  1ZTT A;  4MY4 A;  2HBY B;  2Z2Z A;  2CPX A;  3WBH A;  2EKY A;  1ZA2 B;  3UE2 A;  3KLG A;  2P8I A;  2YKM A;  2VH7 A;  3GFY A;  4HEA 9;  2RJZ A;  4C98 A;  3PW2 A;  1HI0 P;  4B3R J;  4A8X A;  3IG1 B;  1EHW A;  3J81 Y;  1QAI A;  3PY8 A;  4ZJQ A;  5EDW A;  5HLF B;  1O98 A;  4LIR A;  5D0G A;  3A1Y G;  4JI7 J;  1GX6 A;  3BR9 A;  1UZD A;  2MZR A;  1SC4 B;  3I87 A;  3TUI C;  4YFU A;  2BQ3 A;  4F2R A;  3K2Y A;  2FZK B;  1JXV A;  1DQA A;  4TYA A;  3AOA A;  5EHH A;  4NCB A;  1KH4 A;  4O4G A;  4BC9 A;  2B0G A;  2OTL S;  1FO1 A;  2G4B A;  4K0K J;  5CZV A;  2MTL A;  1EJ7 L;  1ZEF A;  4WFX A;  1TK5 A;  3G8S A;  2Y0S D;  1TUV A;  2LU1 A;  2IYI A;  4EMD A;  2MZQ A;  3SMZ A;  5KFZ A;  1RUS A;  1Y5L B;  3OVS A;  4CT8 A;  1ZPV A;  2IMO A;  1EET B;  2Q6C A;  4M5G A;  2D74 B;  2MZ1 A;  1R0B G;  4ER8 A;  4ED0 A;  2LP4 A;  4NYO A;  1KN6 A;  5E33 A;  4DQQ A;  3ITH A;  2XHC A;  4ILR A;  2X3G A;  1GFW B;  3IN5 A;  3UFC X;  2VBW A;  3DLJ A;  1S57 A;  2DT9 A;  1NSQ A;  4JI2 F;  2LVW A;  7FDR A;  4NWJ A;  3UN2 A;  2OML A;  4LRF A;  5ETO A;  3DC2 A;  3E2E A;  4B9L A;  3TR5 A;  5CD4 H;  2E5I A;  1JNR B;  3G96 A;  2B3T B;  4GVL A;  1GXL A;  2DNQ A;  2ZC4 A;  3KLI B;  2RRA A;  3C8Y A;  3I9Z A;  3LO3 A;  1J5O A;  2XI3 A;  1YJN S;  1URA A;  1S6P B;  4B3T F;  3ZZU A;  3N01 A;  4K50 A;  3BBC A;  3Q89 A;  3T1A A;  3TZX A;  2E1P A;  3C46 A;  5F8M A;  4QPX A;  1UCN A;  4F26 A;  2V0N A;  4H54 A;  4ZVP B;  2ZE2 A;  1FD8 A;  2GMH A;  1T9Y A;  4Y2A A;  1S1V B;  1VJW A;  2CXE A;  4C3L A;  5KT6 A;  3FVY A;  1G3O A;  4W92 B;  2G0C A;  2JVO A;  3KUE A;  5DJB A;  2OKQ A;  3DGP B;  4QW8 A;  4ECT A;  2HWH A;  4CH0 S;  3NKN A;  2FHJ D;  4RKU C;  4USW A;  3MR2 A;  2AD9 A;  1RI7 A;  1JLC B;  4O0N A;  2BDP A;  1DTQ B;  5ETS A;  4DR7 F;  3LGH A;  2BV3 A;  2OPS A;  1S9F A;  4I0W A;  3TNV A;  2CVI A;  3W2V B;  3HDS A;  3O2I A;  2DXE A;  3EDQ B;  3RUB L;  3LAN A;  3BH6 B;  2UU9 F;  1YJR A;  1TVR B;  2WAQ D;  2Y1L B;  2VFU A;  3D3C J;  2FZG B;  3MMC A;  2Q43 A;  5HMX A;  5CYM B;  4KY3 A;  2BYC A;  2BJ8 A;  4J7C A;  2NXU A;  2XNQ A;  2V69 A;  3FCV A;  3H90 A;  1MMD A;  3L09 A;  5B0F A;  2GQ2 A;  3TYT A;  1U1L A;  4IO1 A;  5LRM A;  5ETT A;  1XR5 A;  4WP3 A;  4DEZ A;  4O44 A;  4P52 A;  1UPM B;  2OAU A;  3BQ0 A;  3O3L A;  2YH1 A;  1HNI A;  2OEJ A;  1I51 B;  1Z4U A;  1AB8 A;  1VLY A;  3DPC A;  4E2F B;  4I64 A;  4MYU A;  1M5K C;  5J2Q A;  2C3U A;  4CXU A;  4ZMM A;  1B0T A;  4USM A;  3C66 A;  4OYA A;  3KHG A;  4X4S A;  3DRR A;  4KGV B;  4CQ1 A;  3P6Y C;  2LEC A;  1RYS A;  3TJA A;  1ZAW A;  4WCE Q;  3QGP A;  4XAK A;  3PW7 A;  4KJD A;  2CQB A;  4YHH J;  2ZKU A;  3W9I A;  3MPY A;  3D4J A;  1GMW D;  1JXL A;  1B3T A;  2YKN A;  3FSX A;  3JSR A;  1D8Y A;  3JYT B;  3Q83 A;  4F67 A;  3PRB A;  4RR5 A;  3B6B A;  3H5U A;  4TY9 A;  3MCN A;  2LDY A;  3ZNU A;  4ZP7 A;  2R9L A;  1HR0 F;  4EZ6 A;  1QVF R;  2F9D A;  2F5G A;  2WZ1 A;  4PXD A;  4EEY A;  1TZ0 A;  2VFV A;  3GYN A;  5KFM A;  2KG0 A;  1SJF A;  2F4V J;  4L75 A;  3RB4 A;  2CNL B;  4URQ U;  1TFY A;  2PT0 A;  3HHL A;  2KM8 B;  2UUB F;  3IS9 B;  2DPJ A;  1YX2 A;  3AH6 A;  3EUN A;  2V8P A;  1O99 A;  1UEV A;  1RKJ A;  1H7X A;  3ENA A;  2NPI A;  3HM9 A;  2ZHB A;  1XIQ A;  2RUS A;  3HPO A;  1S9G B;  4AL5 A;  4DR6 F;  4U7C A;  2VPZ B;  4OLP A;  1ZZN A;  3FCH A;  5B0A A;  3KUG A;  4ZPD A;  2X51 A;  1W26 A;  2CA9 A;  2CPZ A;  2LXF A;  2ZZT A;  4OJ3 A;  2RAQ A;  5GAD I;  3QO9 A;  1ZAV A;  3NWG A;  3TVZ A;  3RAX A;  4RW4 B;  3IAS 9;  4DV6 J;  2OIH A;  1U09 A;  3PYE A;  1DHM A;  4GVB A;  3AQO A;  1NPK A;  1I6J A;  4JYA J;  2C2D A;  2ZOG A;  1RAJ A;  4MK7 A;  4BC7 A;  5I42 B;  5IQQ A;  3MR5 A;  3GIL A;  2V8V A;  1YG0 A;  2WTF A;  2YNF A;  1S0N A;  2LEP A;  1KP6 A;  1JLG A;  2MHN A;  3QT6 A;  4ZCK A;  2R2S A;  1P6T A;  3GFX A;  2DK2 A;  4P2X A;  4ZN3 A;  5IT4 A;  1NK0 A;  4B3M J;  2GX8 A;  4F3M A;  1RWV B;  3MUM P;  1UWB A;  3EGV A;  4HL9 A;  1DUR A;  2W1B A;  4CM0 A;  4DUT A;  3PR4 A;  2BW7 A;  2JLG A;  1U6Z A;  3J7Z 5;  1GAO A;  1WD6 A;  1S7H A;  1VFJ A;  2CQG A;  2CPF A;  4G3I A;  4Q0B A;  4NCA A;  4TN0 A;  2F8H A;  5EX0 A;  3PFE A;  3PV8 A;  2G2Z A;  1QY7 A;  3KWM A;  2YPY A;  1HBN A;  3PHT A;  1W2B R;  4BHQ A;  1DJ0 A;  1IM4 A;  1O8B A;  2APO A;  2QL7 B;  3AXM A;  3NCR A;  4QIG A;  1KR4 A;  3W61 A;  1A7G E;  4IH5 A;  3B8H A;  4HAC B;  5FLX U;  4DG1 A;  4H4M B;  1FRK A;  3GJQ B;  2FZC B;  1I1G A;  2F4F A;  4ZCL A;  4Z2X A;  4B3M F;  1OQ3 A;  2Z8Q A;  5FLX Y;  2GJI A;  2GHV C;  2QFI A;  1X4F A;  4PQA A;  3TA2 A;  1ZA1 B;  2FLO A;  4EYH B;  4ECZ A;  3O8W A;  3G6V A;  2YKP A;  1JLE A;  1UPP A;  1WG5 A;  1F9E B;  2ACY A;  4RWX A;  1T03 A;  2RU9 A;  3K0J A;  3P5B P;  1ARO P;  3QT7 A;  4DV3 F;  2XMK A;  2EFO A;  2K3I A;  5KFP A;  2CDR B;  1RAF B;  4LR9 A;  4DQI A;  1RHR B;  4IG3 A;  3T19 A;  4M5D B;  3TEH B;  5J2Q B;  4PG5 A;  3TQ1 A;  1WSV A;  1DBD A;  2B6A B;  2NZC A;  1R0A B;  4QU6 A;  3VWS A;  5KXA A;  4DSE A;  1RAD B;  4OHX A;  4DLE A;  3T5L A;  1OS5 A;  2CZ9 A;  3UDE A;  4FYD A;  5EWF A;  1X4G A;  2CNK B;  1NJW A;  3R2D J;  4RO0 A;  5FDL A;  3QAE A;  4YEA A;  4GTY A;  3I5A A;  5F8L A;  2WSC C;  1M5O C;  2DO4 A;  1C2P A;  2UUB J;  1V3S A;  4UF4 A;  1KRP A;  3ZC4 A;  1M90 T;  5HMY A;  1EB0 A;  1ROF A;  2JWN A;  3LTO A;  4DV7 J;  3IS9 A;  3W65 A;  2KRR A;  3GV8 B;  5B7W A;  4ANC A;  3VZH A;  1IJF B;  2QJ3 A;  1YSJ A;  1HD0 A;  2GGP A;  3BYP A;  2BJ9 A;  1LFW A;  3LGM A;  2QL5 B;  5DG7 A;  1J5E J;  2DPI A;  2FVR A;  3KNA A;  3NKR A;  2NXN A;  4ZOS A;  3B78 A;  5ETL A;  3VV2 B;  4LF7 J;  2ZC3 A;  1NJX A;  4LF9 J;  2IFY A;  3AAW B;  3GU0 A;  4QYZ K;  4P10 A;  1FD2 A;  2Y1I A;  3KNG A;  3IWX A;  2A2C A;  2BX6 A;  4MHX A;  1S9G A;  2RD5 C;  5KFU A;  1UEU A;  2YNG B;  1F60 B;  2KL8 A;  4QU7 A;  3TO8 A;  1NDK A;  1JLB B;  2QFJ A;  1URB A;  1B0V A;  1BLU A;  2QO3 A;  3ZXW A;  4K4Y A;  2V9W A;  2W2O P;  4BWM A;  4KGK A;  3W66 A;  2ZBC A;  4DX6 A;  4PRF A;  3N5B A;  4CO2 A;  2HHU A;  4YS2 A;  4LR2 A;  2HS3 A;  1YVF A;  3K8V A;  2YH0 A;  1MU2 B;  3Q3Q A;  4OX7 A;  5DDQ C;  3D3B J;  4DPY A;  3T02 A;  4CLL A;  3BF4 A;  1NO8 A;  2RKI B;  4YB6 A;  3T6J A;  3KKF A;  1UTA A;  5GMK a;  2MLZ A;  1RTD B;  2FJD B;  1C4A A;  2EFQ A;  2PE8 A;  2QZU A;  2KKH A;  2XRG A;  4EBE A;  1Q4R A;  3ETO A;  1O6X A;  2HIQ A;  2KT5 A;  2ZVI A;  3I82 A;  2A1B A;  4FDF A;  4PUO A;  5AJ3 J;  2YNF B;  3BZQ A;  3H0P A;  3LAL A;  2DGT A;  3PM9 A;  4HR2 A;  2MST A;  3DRR B;  3UDL A;  4TQS A;  2CPD A;  4MK8 A;  1BD6 A;  4USV A;  3RBZ A;  4B9N A;  5IXU A;  1RTI A;  3HXM A;  2DRA A;  1WC4 A;  4QW9 A;  2AU0 A;  5HQL A;  3QZ8 A;  4DV1 F;  4DL6 A;  1N56 A;  2E1M C;  1VYA A;  1Y9O A;  1DTQ A;  1FE0 A;  3AT1 B;  1RT5 A;  1TFW A;  1HWJ A;  2LU2 A;  2FB0 A;  1RJJ A;  2MQN A;  4X4P A;  1VCT A;  1LWF B;  4NZ7 A;  4RNH A;  1HAR A;  3M8S A;  2XGP A;  3EPG A;  2RDJ A;  4DFM A;  2ABY A;  3HVT B;  3EPI A;  2C3Y A;  4DR2 F;  2QLW A;  4DL0 C;  2CYY A;  3FZ2 A;  4DL5 A;  2IBK A;  4UOP A;  4NML A;  4ECW A;  1HWK A;  1WWH A;  4JI1 J;  3TEG A;  3ZZZ A;  1WDT A;  1D9A A;  4Z7Y A;  5B0C A;  4RJV A;  3F41 A;  4NLT A;  1N36 F;  4NLW A;  1TVR A;  4L3N A;  1XER A;  3CJ8 A;  2UXD J;  3A52 A;  2Y8Y A;  4IG0 B;  1U1O A;  3GR0 A;  4E0D A;  2V2Q A;  3CCM S;  1SJ1 A;  4WZQ A;  3U02 A;  2VOD A;  3KLI A;  2U2F A;  3PYD A;  4PYD A;  2EC0 A;  3ET6 B;  5CXT A;  4DV2 J;  2W01 A;  4OZ1 A;  3TA1 A;  1D1U A;  1IKW B;  1X5T A;  2G0J A;  1Y11 A;  1ZM9 A;  3B4M A;  3JTP A;  2NSB A;  3QGI A;  4WXO A;  4K2X A;  3MM5 A;  4QJV A;  4C7Q A;  4NXM J;  1C1B B;  2BJ3 A;  2YBV A;  3MOJ B;  2QMW A;  3H4B A;  1LOU A;  5L1K A;  3RBD A;  3OL6 A;  1VQ7 S;  2MLX A;  4TY8 A;  3M1V B;  2MKI A;  4J9N A;  3SZZ A;  3CC2 S;  1CJV B;  1VIS A;  1JKH B;  4C8Z A;  4QBU A;  3FNN A;  2HFS A;  2DHG A;  2W5V A;  2KJV A;  1YI2 S;  4DR4 J;  1LW0 A;  3Q2T C;  3L4B C;  1N2K A;  3IGZ B;  2LA6 A;  3X3U A;  4KM4 A;  2R7Q A;  4ZS6 A;  1F5C A;  1S10 A;  4Y65 A;  5DRK A;  3I32 A;  3MPV A;  2V5H G;  3IMQ J;  1SIW B;  2Y0B B;  1KH9 A;  4YR0 A;  4Y2K A;  2RIJ A;  2DCL A;  2VBX A;  4ZJO A;  1FE4 A;  2BVZ A;  2D3O 1;  4LQ9 A;  3MEG B;  1NSK L;  5J1P A;  3QWP A;  5J2P A;  2OEM A;  1HDH A;  4ZVH A;  5IV3 A;  2M5Y A;  3Q24 A;  1X7V A;  2OPS B;  2XI2 A;  4JI6 F;  2WB1 D;  4ECX A;  4ED1 A;  2JEF A;  5J2P B;  1EET A;  3OPK A;  4C8N A;  4CDI A;  5LM7 E;  2JOQ A;  3M9N B;  1Y6V A;  2A2D A;  2CQI A;  3N6N A;  3PX4 A;  1HNZ J;  3JSB A;  3J7A N;  1XQI A;  5SZT A;  3IFE A;  1EQM A;  1RBA A;  5KFG A;  3ILL A;  3I31 A;  3QRR A;  2FTR A;  3DLE B;  4CXK A;  3VTI A;  2V6A A;  1XWL A;  2OPP A;  1NME B;  2YWG A;  3OLB A;  2CQ3 A;  5IT9 U;  5D3G A;  3BM7 A;  2D3O R;  2D69 A;  2R8H A;  1FRL A;  3GE9 A;  4JYA F;  1JKH A;  4QR2 A;  4WYW A;  5A0Y B;  1FES A;  1RHU B;  2P9E A;  3CT9 A;  3IP0 A;  1S76 D;  3LH2 S;  3M8P A;  2BJE A;  2BM0 A;  2GIF A;  3VGU A;  1ALH A;  2JDJ A;  5FJ4 A;  1TL3 A;  3AQP A;  1FVS A;  3PEJ A;  2DNO A;  2XYG B;  1N0V C;  3OFH A;  1HNV B;  4RLE A;  3G82 B;  1XR6 A;  5LXR A;  2HFZ A;  3QNW B;  4ED5 A;  2DH8 A;  2CWX A;  3IXQ A;  3BQ1 A;  3ILO A;  4M8L A;  4LIW A;  4J9S A;  2BMB A;  1JB0 C;  3BB5 A;  3BH7 B;  3J81 U;  1G1X A;  2F7V A;  4N8O A;  3W9H A;  1UFK A;  4QYR A;  4E8U A;  1XTZ A;  2HMI A;  1P1L A;  1KTQ A;  3V81 A;  4F3O A;  3LP2 B;  4ZVG A;  1UVL A;  3CCQ S;  3UCG A;  5JUM A;  3QQC D;  3DOM A;  2F3J A;  5GAH U;  4PZV A;  1HNX J;  1R6V A;  4X2B A;  2VA3 A;  5MAO A;  1WKL A;  4C11 B;  4C48 A;  3TAN A;  4DL3 A;  2QRR A;  3ADA C;  4C8K A;  4Y2C A;  4B3O B;  3MM8 B;  2H1Y A;  3GFZ A;  3I4H X;  5ETQ A;  1FRM A;  2HMI B;  2AT1 B;  4FDI A;  3MMA B;  2JH3 A;  2E5L J;  3NS5 A;  4C0O C;  3PIO Q;  1S0M A;  4A46 A;  4F2S A;  2WBM A;  3CTR A;  1TTH B;  1NSA A;  2XEX A;  4NLU A;  3QT8 A;  4ZLP A;  4FS2 A;  2ADB A;  3DFE A;  5F41 A;  1QVG R;  4MKA A;  1OIA A;  1F5A A;  3R27 A;  4NA3 A;  4RW6 A;  3ZTS A;  4K5S A;  4ZCI A;  2C28 A;  2V34 A;  2JEI A;  2D41 A;  4OJH A;  1UVK A;  2CJX B;  3KLH A;  4UPK A;  2ATC B;  2KYZ A;  5KG4 A;  5K20 B;  5DDO C;  3I56 S;  4LSZ B;  3H25 A;  5HBM A;  4RNO A;  3SSR A;  3CCJ S;  4DN9 A;  3CJK B;  1KHK A;  2PD1 A;  1PYS B;  2JEJ A;  1PKU A;  2CQ2 A;  1JMT A;  4Q7A A;  2HWI A;  3WX4 A;  1IR2 A;  1ZS6 A;  3MCO A;  2AJQ A;  1SHQ A;  3F0N A;  2PO4 A;  2XZW A;  2OJ3 A;  4IR1 A;  1LWC A;  3P96 A;  3W9J A;  5EN1 A;  1EW2 A;  2YKA A;  4DUY J;  1BMQ B;  3QMQ A;  2ZOF A;  3QT5 A;  5HBM B;  2J76 E;  3H5Y A;  1DZ5 A;  3OL9 A;  3BO3 A;  4ZA1 A;  1VK3 A;  3W60 A;  4IOA Q;  1TKX A;  4NEY A;  3CPW R;  4MKB A;  2GFF A;  4OL8 A;  2U1A A;  3MZI A;  3CMR A;  4LFB F;  1AJC A;  3FFI A;  5F8H A;  1HBO B;  5HP1 A;  3GB0 A;  3MEG A;  4X66 J;  1CVJ A;  2L48 A;  1LW2 A;  4ZG9 A;  2H65 B;  4I4B A;  2V67 A;  4Q5V A;  3BQ2 A;  3CJS A;  5B0G A;  1VC5 A;  1W7W A;  3ZTQ A;  1E2S P;  1OY8 A;  3E8O A;  3OBI A;  1ANJ A;  5K9F A;  4DSJ A;  1WOP A;  2MQ8 A;  1H2V Z;  3BGR A;  2C2R A;  3D6M B;  4B3O A;  4Q43 A;  3AOB A;  5BJR A;  1EW8 A;  1ZED A;  3NWR A;  2H5E A;  3M30 B;  2AEF A;  1FEH A;  1QSL A;  4B56 A;  3OR1 B;  4GTW A;  1HQA A;  2FLL A;  3BGO P;  1U2R A;  1S1T B;  1RE1 B;  3CD6 S;  1CJK A;  3KK1 B;  1RHM B;  3I96 A;  2HAI A;  2QA4 G;  1OSD A;  1CEZ A;  5JVH Q;  2XZT B;  4J91 A;  3UN5 A;  1YKW A;  5LSO A;  1HNX F;  1KHW A;  4RW9 A;  3PO4 A;  2CJ9 A;  1F9F A;  4K5R A;  3P3D A;  4DMZ A;  4WTY A;  5L9X A;  1TKD A;  1XNQ J;  1FRI A;  3HD1 A;  1FXR A;  4F4Z A;  1XNR J;  2OO4 A;  4FNH A;  5LOQ A;  1KQS R;  1HBM A;  2DH9 A;  4PAB A;  3HHL C;  2DO0 A;  3SV3 A;  3QJJ A;  1EKS A;  3DRS B;  4K59 A;  2MGZ A;  3PKY A;  3BJY A;  4DR3 F;  4KC5 A;  2KYX A;  2V4R A;  3PXG a;  1WC3 A;  2IPO B;  4I6W A;  1S49 A;  4P71 A;  3EJM A;  2L9W A;  3BR8 A;  5A8W A;  2Y3Y A;  3V6J A;  5G0R B;  5T7L B;  1U1R A;  1T05 A;  1UWA A;  3A4T A;  3M8Y A;  3OTD A;  5K8P A;  2OPP B;  2ILZ A;  4DCO B;  5EWE A;  3G8T A;  3N6M A;  2IC3 A;  4EYI B;  3HT0 A;  4AL6 A;  2DKO B;  3W64 A; 
#chains in the Genus database with same CATH homology
 2XR9 A;  2D1G A;  3WAV A;  5DLV A;  4ZGA A;  1ZEF A;  2IUC A;  4LRA A;  2X98 A;  4UPL A;  2W5R A;  4KAY A;  3UN3 A;  1E33 P;  1ELY A;  4KJG A;  2GSO A;  2ZKT A;  3OT9 A;  1KH7 A;  3TWZ A;  1EW9 A;  5C66 A;  5GOV A;  2GA3 A;  4NWJ A;  5L0E A;  1ELX A;  3UN2 A;  4LRF A;  4LRE A;  4LQY A;  4LR8 A;  3BDG B;  5DLW A;  4FDI A;  3DYC A;  3M7V A;  5LQQ A;  5K4P A;  1ALK A;  4UOP A;  5GRR A;  4TN0 A;  5LIA A;  1URA A;  1ANI A;  3A52 A;  1EQJ A;  3IGY B;  4LRD A;  3TX0 A;  4UPK A;  4CYS A;  4ZG7 A;  3ED4 A;  5DLT A;  3BDF A;  4UPI A;  3NKO A;  1AJB A;  1KHK A;  5LRN A;  1SHQ A;  3WAW A;  3NKN A;  3UO0 A;  1EW2 A;  5IJS A;  1B8J A;  3SZY A;  2VQR A;  4ZG6 A;  4N7T A;  3NKM A;  4GTX A;  1SHN A;  4UOR A;  4LR9 A;  4KAV A;  3SZZ A;  3NVL A;  5KXA A;  2W5W A;  3KD8 A;  2W5V A;  1KHL A;  3CMR A;  1AJC A;  1AUK A;  1KHN A;  1N2K A;  3IGZ B;  4LRB A;  4LR7 A;  4KM4 A;  4ZG9 A;  3WAX A;  2RH6 A;  3TG0 A;  2W5X A;  2GLQ A;  5INH A;  4GTY A;  5HRT A;  1KH5 A;  5LRM A;  3BDG A;  4GTZ A;  1E2S P;  1KH9 A;  1ANJ A;  5TJ3 A;  5EGE A;  3T01 A;  3M8W A;  1N2L A;  3T00 A;  1HJK A;  4LRC A;  1HDH A;  3MK0 A;  5IJQ A;  4YR1 A;  1EW8 A;  2W5Q A;  3DPC A;  1ZED A;  3E2D A;  3UNY A;  1AJA A;  2W5T A;  1ED9 A;  1ZEB A;  1FSU A;  4B56 A;  4GTW A;  2W5S A;  1HQA A;  3NKR A;  3MK2 A;  1ELZ A;  1Y6V A;  4FDJ A;  4CXU A;  4MIV A;  1ALJ A;  3MK1 A;  2IFY A;  4NWX A;  2IUC B;  3NKQ A;  1ED8 A;  2G9Y A;  1KHJ A;  3LXQ A;  3M8Z A;  1P49 A;  4KJD A;  3B5Q A;  4MHX A;  4UPH A;  3UN5 A;  2W8D A;  5AJ9 A;  5L0K A;  1Y7A A;  4CXK A;  2GSU A;  3NKP A;  1URB A;  1E1Z P;  4MY4 A;  4CYR A;  3WBH A;  2W8S A;  1K7H A;  1EJJ A;  2GSN A;  3WAY A;  4LR2 A;  1E3C P;  1ALH A;  1ALI A;  3Q3Q A;  1EI6 A;  3T02 A;  2QZU A;  1O99 A;  1O98 A;  3BDH A;  5EGH A;  4CXS A;  2XRG A;  3M8Y A;  2ANH A;  4UOO A;  5L0B A;  1AJD A;  3IDD A;  4QAX A;  1KH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...