4LR8A

Phosphopentomutase s154a variant soaked with ribose 5-phosphate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
Knots found
sequence length
391
structure length
390
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTAADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 141
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lr8A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr8A01
1P49A 4KM4A 1B8JA 5GRRA 2G9YA 4UOOA 2RH6A 4LRBA 3DPCA 3WAXA 1ALIA 3UO0A 2W5QA 4GTZA 3BDFA 1SHNA 5AJ9A 3UN5A 3NKRA 4FDJA 1ALKA 3A52A 2W5SA 1EQJA 4LR2A 5IJQA 4GTXA 3NVLA 3WAVA 2XR9A 5LIAA 4CYSA 4LRCA 2GA3A 3NKMA 1EW9A 5LRNA 1E1ZP 5L0BA 4KJGA 4KAVA 1EI6A 1KHNA 2W8SA 1FSUA 1KHKA 1ANIA 2IFYA 1AJCA 4QAXA 1HDHA 4LR9A 1URAA 3MK2A 1EJJA 3BDGA 4LRDA 2IUCA 1EW2A 1ZEDA 4LREA 1URBA 2GSUA 1K7HA 1ZEBA 2ZKTA 4MIVA 5K4PA 5L0KA 1KH7A 4LR8A 5LRMA 4N7TA 3M8ZA 2W5VA 2GSOA 5INHA 1N2LA 3Q3QA 5L0EA 3BDHA 3NKOA 3KD8A 4GTYA 1O98A 1Y6VA 3BDGB 3TG0A 2IUCB 4UPLA 1ED9A 5EGEA 4YR1A 3WBHA 3WAYA 2VQRA 3MK0A 3LXQA 5EGHA 2W8DA 1KH9A 3SZZA 4LRFA 1AUKA 1E33P 5DLWA 1SHQA 1AJDA 3UN2A 3E2DA 4KJDA 3WAWA 1Y7AA 3NKQA 3SZYA 2GSNA 3T02A 2W5XA 3M7VA 1AJBA 1KHJA 2W5WA 3DYCA 5DLTA 5DLVA 1KHLA 3T00A 5C66A 1AJAA 1KH4A 4ZG6A 4FDIA 4CYRA 5GOVA 3M8WA 4GTWA 4CXKA 4B56A 4ZG9A 1ED8A 1E2SP 1N2KA 1HJKA 4LR7A 1ANJA 1ZEFA 2W5TA 4CXSA 1O99A 5IJSA 3IDDA 1E3CP 5KXAA 3TX0A 3IGZB 5HRTA 1EW8A 2X98A 4CXUA 4ZGAA 3NKNA 1ALHA 3IGYB 4MY4A 4UPHA 4KAYA 4UORA 4NWJA 1HQAA 3ED4A 4LQYA 1ALJA 5LQQA 4TN0A 4ZG7A 1ELZA 3B5QA 2D1GA 4MHXA 2XRGA 4NWXA 1ELXA 4UPKA 1ELYA 4UPIA 3CMRA 3M8YA 3TWZA 3OT9A 3T01A 3MK1A 2QZUA 2ANHA 3UNYA 4UOPA 4LRAA 3UN3A 1KH5A 3NKPA 2W5RA 5TJ3A 2GLQA
chains in the Genus database with same CATH superfamily
1SCJB 2J6UA 1JLBB 2HQ3A 2AJ1A 1S6PB 8AT1B 2MZQA 1WKKA 5F8MA 3HVWA 2CQDA 3T1YF 4GC7A 5F8NA 3C6UA 2UUCF 4ZS6A 3OQ2A 3LGHA 2HNZB 2J9EA 1SL2A 3S01A 3K59A 1OSCA 1S57A 1S1XA 2XYHB 3EMTA 2QC3A 4LIRA 2FQQB 3DXSX 4RW7B 1D9AA 3CDBA 1Y7PA 3CMQA 2ZWOA 3I5AA 2VKRA 1EJ7L 1U1LA 4NLUA 1FNMA 5ETKA 3MCMA 2GIQA 2QMUB 1QAXA 1BQXA 2XY7A 3IS9A 2OEJA 2RRAA 2HHVA 3POTA 3MCNA 3O8WA 3JSMB 4OYAA 3QIPA 5KFKA 3IC1A 4O3SA 4A8MP 2FVPA 1O0PA 2GW8A 3J81U 5IV3A 2LKZA 1Q7LB 4URGA 4X62J 3MZIA 3RYLA 5LRNA 4ILMA 4TVAB 1RA7A 1C1CB 3RRHA 4DPOA 1NCLA 3JQMA 4G65A 4PYDA 2VFRA 3D1HA 3R8YA 3OVSA 4XAKA 1MMNA 2Z8QA 2KZMA 1FTRA 2P2CB 5KG5A 2EI5A 2XB2D 3IBFB 2H51B 3B4MA 1VS3A 3MM7A 3NCQA 2G2YA 3DI6A 4I69A 1FO1A 5DGBA 2EFPA 3GQCA 4OYMA 4B3MF 2KO1A 1FKOB 4OJHA 4LF6F 1WG4A 4PCQA 1TL4A 2V63A 5L1IA 1QUVA 2DH8A 1KRPA 3KLGB 4LFAF 2HQIA 2RIJA 3SQOP 1YJNS 2GV1A 5FLXU 3MEEB 3CW2C 2XLIA 3TJ9A 2V8GA 1XMOF 5JUMA 3BGLA 1FFSB 4C8YA 5G4DA 4C97A 3CJ0A 3FZBA 2ZH6A 3HVTB 4PG8A 4F0KA 3KFWX 2GO8A 3VAIA 4N77A 5K4PA 4G3IA 3K8WA 3M8QA 4GTYA 2NXUA 4ZKAA 1XMQJ 3IAS9 4YB7A 1QVGR 2MMYA 1RAHB 5LSLA 2OPSB 3G8TA 1T02A 3I0RB 2HHPA 3DYAA 3KLIB 3CMES 3O5TB 3K5LA 3PNIA 4LVNP 1XNQJ 4PYAA 3DMJB 2DPIA 5DLVA 1ZS6A 2VC1A 4CO1A 2PE8A 1TUVA 2FUG9 4C11B 1DQAA 3DKDA 3HSGA 1T3NA 2CQHA 4G1QA 4ZPWR 3SSSA 4B3OB 2WCXA 3UDEA 1S6OA 2HMIA 5CAAA 4TKTA 2LYVA 2DO4A 2VF3A 2AHOB 5AXLA 5B0BA 4ZP6A 2V0NA 4MKBA 3QLHB 2FY8A 4Q44A 3NGSA 2OSRA 3GFYA 5LJ3Y 2YNGA 4K5SA 3ENWA 2AGPA 1RQ0A 3SCJE 4F36A 4DR4J 3CXCR 4OYBA 5A8RA 3MPWA 2J9DA 4KGVB 2WVDA 2OPRA 5DDRC 3DHXA 1HNVB 2BA9A 5HMYA 2DK2A 1UVJA 1YJUA 4PQUB 4ZPDA 1V3SA 5CCMA 2AGQA 4ZIVA 1P9QC 1TL3B 3N9UC 5I3QA 4MKAA 4N8NA 2GX8A 2PEBA 1KFSA 3DCAA 4D3HA 4JV0A 3H5YA 1A9NB 3W2VA 1RHUB 1YBTA 4WXOA 3LP1B 5E3QA 4ELVA 1S1TB 4ED4A 1UAWA 2EKYA 1GTHA 2KM8C 4ECSA 4AL5A 4I2QB 2QX0A 1NJXA 4LT6A 3BDPA 1V3ZA 2VQFJ 4N56A 2M5YA 1IQTA 4DPWA 4QU6A 1SUQB 4YEAA 4CH7A 2CG4A 5D78A 3DXBA 1GNKA 4CTAA 1Q53A 3SBMA 4FF1A 2U2FA 1S6UA 1IWGA 1FXLA 3NMAA 1LEOA 4GRSA 4ED5A 3PHEA 1R43A 3HJVA 4UY8T 3V81B 2AX0A 2CPHA 1SL0A 2K1RA 2J0WA 1YJTA 2GHPA 2BUNA 1YRTA 2MZRA 1U48A 1KD1T 4QBUA 5CQGA 2PI5A 4KFBB 3OPKA 3BQ0A 4ZHRB 3D6TB 5J1EB 3CULA 2HSEB 4DX7A 3I0SA 3M30B 3LPEA 2W4DA 1LWCA 2JWNA 4IG0A 3NNCA 4P7TA 2AEJA 4JP8A 2UVRA 2DISA 2W5WA 3EGWB 2CG8A 2IM0A 2EPIA 2C2OB 3M2UB 1FWLA 4RW8B 4UF4A 4UORA 2R42A 3I6PA 4MYUA 4KGXB 3V4IB 4BS2A 2OPQA 4ZP9A 1U1KA 1JXVA 3A8EA 2ZFHA 4NLQA 3G9CA 5GRRA 1DLOB 2HRUA 2MKSA 3DRPA 2W5SA 3S8SA 3MEDA 1FJEB 2XHCA 4DV3F 2QYCA 2HBQB 1WEYA 1ANIA 3BZQA 7AT1B 2V8VA 4DR5F 3UNGC 3CMAS 3HJFA 1UWAA 4LR8A 1JLCB 3OTBA 3N6NA 5ETVA 1KLMB 3VGUA 3OV7A 1NZAA 2VG6A 3DDNA 4OL8A 4FKYA 1CJKB 2CRLA 1Q81T 5A6WA 3RW7A 2AJ4A 3Q22A 2B43A 2IA6A 3PEJA 3KDOA 4OV6A 2DPJA 4WE1A 2ALZA 4DL0C 2HNDA 3CTRA 1QLNA 5J1NA 2OAUA 2X98A 2PT0A 2Z2ZA 3SIPB 1NUEA 1O5JA 1HNZF 1T03B 2O5DA 1NDLA 3FVYA 4U8YA 2IMOA 1ELXA 3SV3A 3MK1A 1U1NA 2JL9A 1QVFR 4UOOA 1YI2S 1M1KT 3JYTB 4HHUA 3MM8A 2V8DA 1S0OA 2YX4A 2XHWA 4ER8A 1NJYA 1IBKF 2DNOA 4I64A 2V4QA 3J7Z5 5HATA 5ETRA 1RT6A 3QFWA 3AXMA 2OMOA 2D7SA 3MR5A 3BV8A 2XMJA 1D9DA 1F9FA 5J2QA 2QSFA 5EWGA 2UUAJ 1E33P 5C25A 3H42A 3D6MB 3V5RA 1Y7AA 3P45B 3RB6A 4C3MA 3VF0B 1SKRA 4DR3F 2CDQA 1CS4B 4M5HA 3BKTA 3DLJA 4LSNA 2QFIA 1HW8A 1K0TA 3GYXB 1UPPA 3BBBA 2K8GA 1ZYQA 5IC4B 2DCLA 3F56A 2V94A 6FD1A 3A8IA 4ZVUB 2FHJA 5B0FA 4J9VA 4FDJA 3P8BB 4TN2A 1DTQB 1WDDA 3W3SA 2HNYA 3IWNC 1KVIA 2CPJA 1ZZNA 3PV8A 2APOA 2IFYA 2CNKB 1RWVB 3QBCA 1KHWA 3GV8B 2O01C 1URBA 4K4XA 4WZQA 4JI5J 1LW2A 4FPIA 1GMUA 2ZE2A 3EZ5A 2M3DA 1VISA 5K14A 3PJXA 1X7VA 1CJTB 3F0NA 1N0VC 4YHHJ 1FDDA 2XO6A 3FNNA 4DV6J 2RKIA 1TMJA 5HL7Q 5M2UA 2QA1A 4DR2F 5J2NB 2HHTA 2J6TA 4KR0B 2M8DB 2CAJA 4Y2MA 3NGDA 2WHOA 2J76E 4GVBB 4CH1A 5ETMA 3HSZA 2F5GA 1UL3A 4CLWA 1Y3KA 3B78A 3EVWA 2Y0BB 4AD6A 3PYEA 2BABA 2XGPA 4DSLA 2UU9F 1VI7A 1YJRA 3TUZC 1F0XA 4TLQA 3PIOQ 2LVWA 1WOPA 2GJFA 3DOLB 4CO0A 5J2MA 3R3TA 5MLCV 3KOAA 4DCOB 1D3WA 3M32B 2WAQD 2L9DA 4IUFA 2B4OA 4NOHA 1F3FA 5C2CA 4JBCA 3TOQA 6AT1B 3KUHA 1FCAA 2Y8YA 4OZ2A 2XG8A 2EW9A 1T94A 2E1CA 2C42A 3QO9B 1YJ7A 1NK7A 1KOHA 2OEKA 2R4FA 2E9TA 3VAJA 4JI4F 2JLGA 4CT8A 1R0CB 3TVZA 1NB2A 2FZKB 5K8PA 4J9LA 4A8QA 3UW1A 4OI2A 1BQMA 3GLJA 2HHSA 3QSYB 2UP1A 1IUJA 1U0HA 4JV5F 1URRA 3H4BA 3AJ1A 4C98A 3HM9A 1F6TA 3A12A 2YKNB 4N5SA 4JB8B 2QEXS 3GFZA 3H59A 1TFYA 3H0PA 2V69A 3HP6A 2CQ2A 4D3GA 4ZK7M 1J5OA 3GU0A 1F3VA 1VBXA 2FHJD 2M0GB 4MIAA 1EQ0A 2JC0A 4WIQA 3TEGA 1P9YA 1BUXA 4F0HA 1PIEA 1T9VA 3DLEB 2R8GA 2GO9A 1RYRA 1D9FA 2QRRA 4EU0A 1HWUA 1OQ3A 4ZCKA 3RR7A 3S1TA 2ROGA 1IVZA 3M8PA 2DGQA 4RZRA 1U6FA 4R5PA 3IWLA 4E8UA 4H4MA 5B0EA 1XC9A 1NSAA 5IC6B 3KK2A 1RABB 4DU7A 5HMZA 4HR2A 4P75A 5LJ5Y 3NNAA 1UJ5A 3D9BA 4KH0B 3CJ4A 2ZKUA 1QE1B 1R8PA 2HFUA 4LR2A 1LW0B 5T7LA 1GXUA 2K3KA 2DNPA 4JI2F 2YPYA 3MD3A 3SQGA 3S6EA 4CRJA 5KFJA 3U02A 1GX5A 1S4EA 3DLGB 2KL8A 3IP0A 1WKLA 1FJGF 1H2UX 1TK5A 1SJRA 3IA0A 1C4CA 3T1YJ 2KFYA 2HZAA 1LK7A 4MKYA 4PWWA 5AXMA 1KQKA 3L4BC 1W25A 4DUZF 1MLAA 1YRUA 1M5OC 2XNRA 2PFFB 3MECA 4L74A 3VVTA 3KDNA 1TVRB 4K50A 2Y1JA 1C0TB 1MN7A 4J7CA 3HHNB 1VRUB 4ZLNA 1FEEA 5LMNF 3W9JA 1N33F 3FBFA 4LF2A 3LANA 3CGIA 1Y11A 3W65A 3HF5A 5HP1A 2BW7A 3KMQA 3H8YA 1N6QB 4LMZA 4WP8A 4TY9A 3HT3A 1KQFB 5CD4H 3KNGA 2C2KB 1U47A 3GILA 2VJUA 2P9CA 2XCPA 4L6V3 2B4PA 2F1FA 4X64F 2F8HA 1HPZA 4E0DA 3FCVA 2M52A 4G1IA 5I3PA 4B9NA 2N3LA 2IM2A 3KJVA 4USJC 3MR2A 3LH2S 1NKEA 2O66A 1HI0P 3IFEA 5AE3A 4OLPA 1NLKL 4O44B 5HROA 3GV5B 3NAIA 5KG6A 4B9LA 1R8BA 3QAUA 3FEXB 2QMWA 1Q86T 3K5MA 4BHQA 1MU2A 4ENOA 3MWBA 1VLYA 1HNIA 4PPZA 3LP2B 3GZ7A 5A0YB 2Q66A 4UUXA 1SKSA 1JLBA 1HBMB 1IBMF 1S6PA 1OY9A 3HVAA 3P5BP 4QCLA 1Y9OA 3D67A 4I1TA 1KH5A 3NKPA 4PQAA 1LXNA 4B3MJ 3JSBA 3D6HB 2YBVA 3ZZUA 4LF6J 1LWFB 1YX2A 2C2DA 2B56A 4LFAJ 5D4LA 3NOCA 4QWBA 3G6VA 1WKJA 3M05A 5LMUJ 2A6MA 1VQ8S 5D0GA 4RW7A 2VONA 2DEIA 3VAHA 1ZZFA 2CQPA 3GV7B 1X31C 1S4FA 5ADZA 3Q0AA 3W8GA 1UVKA 5DLWA 3UCZP 2HYIB 4NLXA 4NA2A 5EWEA 4KJDA 2ILYA 3G71S 3E01B 4KGKA 4DV2F 2EBEA 2X3GA 1CSJA 2P6SA 1R0BG 4CXKA 3JSYA 4DCJB 1B0PA 1H7XA 4IOCQ 4V19X 1DAXA 1SPBP 4OI0A 3JSMA 2HK3A 3NBPB 4CQ1A 2DIUA 4EFAC 1NDKA 5KG0A 3IGYB 2FTRA 5L1KA 4LQYA 3H5UA 4BCAA 2V6AA 3OL6A 4QIEA 4URSA 1QAIA 2EFGA 2V4JB 5I3UB 2YQ0A 2B5JB 1HWLA 1DJ0A 1HBUB 4MT1A 1C1CA 1KTVA 3G6XA 3GFHA 1QTMA 1JX4A 3G8QA 4HI2A 1WEZA 3PYDA 1TKXB 4AFFA 3DNCA 3MK2A 5GMEA 1LV5A 2BV3A 2HHUA 4Y28C 2GSOA 1IKWB 4DG1B 2CPZA 2IVMA 4CLLA 5CYJA 2ABYA 4JYAJ 2YKPA 1RJJA 5KFQA 1Y5LB 4DF8A 4P72A 3KLEA 4K4WA 5HANA 4GO7X 2IJRA 4FP9A 5DQHA 3TEHB 1OWXA 2H5EA 1FKOA 1R27B 2EK1A 5JXSA 2DHGA 3PJ9A 2BKOA 4LFBF 2ZD1B 2DXDA 3MUTP 3KLGA 2FC9A 5IT4A 1UA1A 4FDFA 2CNNB 3GJTB 3MUVP 2HEKA 3MEEA 2RHSB 3CNQP 2KRBA 3EZOA 2OPPB 2R7VA 2YQ3A 1RTJB 2HK2A 1UP1A 4M5LA 3AHPA 4M8LA 2ZH4A 1SBRA 3WAXA 3UO0A 4GTZA 3MD1A 2KXHA 4OZ5A 1YITS 1B64A 4RX6A 4BLGA 2N4DA 4R25A 4RNOA 3NKMA 2VFTA 4FXDA 2G4BA 3KG1A 3G82B 1RTIB 3EUNA 2GAHC 3ZZZA 3BYRA 3GB0A 4DQRA 1FEHA 3VQTA 3M2VB 2OPSA 2E1RA 2VPWB 3I0RA 4RBTA 3QYYA 1SL1A 2AIRB 4O4RA 4NMLA 2RD5C 3JTOA 1PG5B 3DMJA 3GR0A 2AEFA 2JRSA 4C11A 2MKHA 2R8IA 3QATA 4WJBA 4B3OA 1ULRA 3ET6B 5E3PA 3TQ1A 5CYMB 3E3XA 2DXEA 3UI3A 2P8IA 3QLHA 1GMVA 2GMLA 4HTJA 4O4GB 1H2VZ 2MLXA 3MM5B 1U2CA 4OI4A 2AEMA 3FBCA 1S9EB 2R2SA 2NXEA 4NMXA 1TK0A 1U02A 2KYZA 2OTLS 1JNZB 4FYXB 1W7WA 3PW0A 5KOXA 2N7YA 1UFWA 2GHWA 1K9MT 3C6UB 2UUWA 1HNVA 3BM7A 4FF2A 1T9XA 2MJUA 5D4OA 1REGX 4RUCA 1NB7A 2DYAA 3CPWR 1FSUA 2G0CA 3EZUA 1DFDA 1TL5A 2PFDA 3K2YA 4JI7F 1RAOA 4M94A 2AGOA 4N7TA 4ZCLA 2MY8A 1XR5A 1BD6A 2BDPA 5IT9Y 3X3UA 2KB2A 3LP1A 4UZBA 1YZ6A 4AL6A 4CLSA 1S1TA 2DB1A 2QJ3A 3KG4A 3RAXA 4IYQA 3P6YC 2CQ3A 3CD0A 2XBPA 3M9NB 2HW3A 3OVBA 5A2QU 3GIMA 2JLFA 2FC8A 2DR7A 4DR5J 1IR0A 3DOKB 4X84A 4I2QA 2RQMA 3BREA 1PBAA 3LGNA 1QD1A 1VC0A 4FYVB 5B7WA 3LWLA 2AP6A 2ADCA 2W5TA 4GMKA 2HZCA 1VQMS 5K8OA 1SUQA 2LU2A 1NHKL 3NKNA 2UXBF 4DFPA 3TUJC 3TAPA 2HHWA 3RBZA 1HR0F 3CC4S 1WSRA 3DDIA 2HGLA 3NY0A 2HURA 3V81A 2OD6A 1RA6A 3HK2A 2B9EA 2B7CB 4JUZA 2QTWA 1W2BR 3ZZOA 4MK8A 1HNZJ 4IH6A 4KFBA 4ECWA 3VAFA 1HKAA 4DX5A 4ZHRA 3GIIA 5J1EA 3QIDA 2RDJA 1SJFA 4JOUA 3JB9k 4ZN3A 3AD8C 4CI0B 4F3OA 5D0RA 4NCAA 5IOLA 3CJ5A 3MM7B 3FSXA 3I5CA 3GJRB 1AUKA 2HLTA 1KC8T 3N79A 2IIHA 1PJ6A 2VDHA 1HI1A 4P73A 3HULA 2D74B 1IBCB 1IBKJ 3M2UA 2CNOB 1OYEA 1NNDA 3CD6S 2XGQA 4RW8A 1X4CA 3NWRA 3BSOA 1ED8A 3N01A 2VA3A 2P9EA 4ECZA 3V4IA 1KP6A 2CPIA 3HSJA 3HFVA 1XTZA 2V2ZA 1RKJA 1DLOA 1FRKA 4ZLJA 3PM9A 2RE1A 2VH7A 1WC6A 5HJXA 4YR0A 1M5PC 3A3OB 2GJ2A 4F0MA 2FLOA 1O6XA 2QL7B 2ZJRQ 5M2PA 4C8LA 2NXCA 1H3DA 2MEWA 3W5ZA 3BPDA 4OIXA 2G0IA 1JLCA 2BMBA 1KLMA 1EB0A 1ZM9A 5D6GA 5LRMA 1PYTA 5L8RC 4KV8B 1V5IB 3BDHA 3QRQA 3M6UA 1CJKA 5SUHA 3BGRA 4RW4B 4M95A 3VGSA 3JS9A 2FD2A 3QZ7A 4OMFG 4YB6A 2H5IB 4OI1A 1UETA 3T19A 4C8NA 2W5XA 2FJXA 2NPFA 2PC6A 4FDIA 5GAEI 2MSSA 1T03A 2YWGA 1Q5YA 5KXAA 1PC5A 1LXJA 1S97A 4DL4A 1WHYA 2Z56B 3PW2A 1N5YA 1BXNA 2NQPA 4CO4A 2R9LA 4P2FA 2IRYA 1UW4A 2XRGA 3JYTA 4ETZA 3TWZA 3TQEA 2CQBA 1IQZA 2RQCA 4FKXA 2DR6A 1X5SA 3T6BA 4OYZA 1M0SA 4Z7CA 4K4ZA 5E7OB 2ILZA 4LBIA 2AJFE 3K5NA 1BHNA 4ZCIA 2Y1RI 3PKYA 1WC4A 3AAWB 1XNRJ 4NLWA 4OI3A 1VDHA 1FK9B 4ZPAA 3Q8PB 1KH7A 1RBOB 2F40A 1SI9A 1T9TA 1U6ZA 3MR3A 4NEZA 3A13A 4C4WA 3CCTA 4F4WA 1IKVB 1CS4A 2MKKA 3OXGA 2NR0A 3ADAC 1Z2ZA 5DLTA 4B3TF 2C3MA 3GONA 2MKYA 2GC8A 4U8VA 1X4BA 2R7QA 1R89A 3R2CJ 4WKYA 1U8SA 2YWFA 1RXOB 4KO0B 1TQLA 2XM3A 2CZVC 4I6WA 5I4MA 2J9CA 3CCUS 2G0JA 1AROP 4PXDA 3TVKA 1KFDA 1DTQA 4K2JA 1XNQF 3CJ2A 2KG1A 3PW4A 3KK1B 2GZOA 1Y3JA 2W5QA 2R2TA 3LWMA 1VQ5S 5LOQA 3C6TB 4PUOA 3P3DA 3C66A 4B17A 1PCAA 1AJCA 1VJWA 2V5HG 4UY85 1HL6A 3PY8A 1R8HA 1LWXA 4OHVA 1UWBB 3I0SB 3T1AA 4J9NA 1MWZA 3GFXA 3B4DA 1CJTA 4S0MA 2JNJA 1X4DA 2DRAA 4DR1J 1N54B 2MB0B 1QDUB 4IFVB 1QJHA 4NCGB 5F41A 3DYCA 5J2NA 4USWA 3R7BB 4J5OA 3RJMB 4GVBA 3RBXA 1SV5B 1JLGB 3Q86A 4LF9J 2IVYA 4CO3A 4KAYA 1CULB 4LSZB 2UUTA 3FSIA 2HFVA 3JQKA 4NWBA 1TAQA 3VGVA 3BSNA 2C28A 2BJDA 2BXJA 1YHQS 3TAMA 3OXFA 3IR5B 3RR8A 2HQDA 3GWCA 4P71A 4IOAQ 3DOLA 2NS1B 3KKFA 2QIFA 3OTCA 2FYXA 3Q8UA 1D1UA 4UQGA 4XDCA 5F0UA 2VQFF 3M32A 1K7HA 4G6VB 4MFBB 1NM2A 2I0XA 4NZ0A 3I4PA 1DHMA 4EI2A 4CIOA 3OJSA 1NU4A 1RBLA 4ECYA 3TJAA 4CLYA 4IO9Q 3PG9A 3LAMA 4JI2J 5D0EA 2GSNA 3QO9A 3DLLQ 3UDVA 1X4HA 2EVZA 2H5JB 4F3MA 4F04B 1KLNA 1J27A 4CM0A 2EFNA 2OI2A 3VZHA 3JTNA 4FPRA 4K59A 1IR2A 1DQ8A 1TKTB 4DPTA 2AD9A 2N7CA 2GJIA 4AL7A 3CUNA 2RF2B 4NZ7A 5L1LA 1Q4RA 3R1LA 2H4WB 1TL7B 1TKZA 2BJ1A 4ANDA 2YKNA 3QAEA 1XJWB 1RTDB 1MWYA 4DUZJ 1RSCA 3JAMY 4QWAA 3A52A 3M6VA 4J9RA 3SSQA 3DGPB 1CBKA 4K4VA 5D77A 1HWJA 2ZH8A 1KHKA 3CCJS 1RT6B 3H2LA 1ROFA 1FVQA 2CVIA 3MEGB 5LMNJ 1YJ9S 1IBLJ 1WOOA 2V9KA 1TV6B 3PKMA 3Q23A 2XZTB 3O44A 4MMOA 4DUYF 4ED1A 3GR1A 3ZO7A 1SHQA 2DRDA 1AA1B 1EX8A 4OQJA 2HVZA 2B9YA 4RR5A 1HHSA 3K5PA 1NZ8A 1RWUA 2IYGA 4ZG6A 2IVFB 3PXGa 4NYZA 4Q45A 1ZEFA 5IQQA 4A4JA 1CJVA 2J9DE 1RWOB 4IH5A 4NPOA 2M8HA 4PG7A 4A8WA 3HKZD 4NWJA 2H4YB 5GAHU 2HHHF 1QE1A 3OD2A 2CWKA 3CD5A 5IZHA 1I94J 1LW0A 4RUBA 4USVA 2FVQA 4LSLB 3WX4A 5KFAA 4YDXA 4FBUA 1WELA 2WB1D 1ZM4A 4A48A 2GVZB 1U2RA 1SQEA 2HIQA 3DLGA 2E9ZA 4OHXA 4V19J 4PAAA 1TKDA 5BYRA 2ZE2B 3N5BA 1IBMJ 2R3VA 2G2OA 4F2RA 2DNLA 4PEOA 4RL1A 3D7SB 2W9AA 4M5IA 1SH0A 4IDKB 5IQ6A 4RWXA 3CDEA 2MJNA 2XMWA 3RW6A 2CFXA 1KHJA 1S0VA 2MZTA 2FHKA 3QNWB 2AKWB 1TVRA 1NK8A 2YX1A 3FCWA 1C0TA 1UZDA 2GQQA 1TZ0A 2MY7A 1VRUA 3P49B 2FLNA 2I5JB 2A18A 2LQBA 4ETXA 1B0TA 2UUAF 4QIVA 2XQCA 1PBUA 2M88A 4DV2J 1SQFA 1N6QA 2BRLA 2LA6A 2AJ0A 3AY0A 4DS4A 2KRRA 4OJGA 3UN5A 2JEIA 3DC2A 3WX8A 1RHRB 4HHJA 2NPIA 2ZBCA 2HHXA 5J2MB 2F3JA 3T1HF 3TR5A 2QLJB 2FJVA 2FLLA 5T41A 1EJJA 2OLWA 2AW0A 2XMTA 5CZVA 2ACMA 5IWAJ 3FMWA 3BKFA 4K4TA 1U09A 4TNOA 4IFYB 2BYCA 1SJ3P 1FVSA 1WC0A 1B7YB 3KNAA 2VQRA 5AXNA 4HHHA 3GIRA 3NKQA 4O44A 4CLKA 4C0HA 1RI7A 4H4KA 1UMJA 4RW6B 4U7UD 5B09A 4DV0J 4QWDA 3LP2A 5A0YA 2CPDA 1BQMB 5K8MA 2LXIA 4NYOA 2BOAA 5HRTA 2ASYA 1YSJA 5AXKA 4MH8A 4KPCA 3EWGA 3WDOA 3DRXA 3M6XA 4KTQA 1NRKA 2JSXA 1LWFA 4LFBJ 3VAKA 4OYOA 1FHTA 4YDDB 3CJRA 3ZZYA 4WTYA 4P52A 4O3PA 4WFYA 4CWBA 4B9UA 4Q2LA 3THTA 1RU2A 3BDEA 3RB4A 3RU0A 2MZ1A 1U45A 1WNEA 2EC2A 3V2UC 1TELA 2FJEB 1QSSA 2KN4A 2V68A 3RB0A 2HQGA 2DGUA 4ELTA 1HIYA 4G1PA 4HTIA 2LU1A 5H9FK 4YY3J 1SC1B 2MKCA 4ZOSA 1FTCA 4C6AA 1VRTB 3IWXA 1PKUA 3SZYA 1UCNA 4ED0A 4NLDA 2YVSA 2BJ7A 1PAUB 2ATCB 2LEBA 4K8RA 1HW9A 4U6PA 3AQPA 2KVIA 1MMLA 2V4JA 4NE9C 5I3UA 2CXEA 3THVA 4IRCA 2B5JA 2XLJA 1HBUA 3J7YI 1M1HA 5C24B 1WHWA 4P7VA 2B8QA 4KBIA 4M5DB 3QRRA 1IKYB 4USHA 3S7RA 1TKXA 1KEKA 2PIIA 1PILA 3T3FA 2HWTA 3MPUB 1V9OA 1XK8A 2GMJA 1IKWA 4DG1A 1HWIA 1VQPS 4RNNA 1N0UA 5F8IA 1D0EA 1O8BA 1GQEA 1N34F 1IR1A 3FGVA 3MOZA 4O0IA 2QLFB 3D0HE 5B0DA 1IXKA 3SEOA 2GCFA 5KTQA 4IOBA 2GA7A 4FNIA 1AJDA 1Q8LA 1ELOA 2B8PA 4ZP8A 2ZD1A 1UEKA 5CA5A 3THPA 3W5XA 3MECB 3AT1B 3HFKA 2D1CA 4WU3A 4JI7J 3V6KA 3PDNA 2OIHA 1UEVA 2HS4A 4HACA 5KT6A 4QIFA 2VUGA 2PO4A 1U7LA 2OPPA 4CZCA 4KIAA 1YWXA 1H38A 1RTJA 3RG6A 4Y65A 4F7VA 3NEKA 3DDKA 3QJJA 4A46A 2Q6BA 1KWMA 1S7IA 1M5KC 4R8UB 2QT7A 1UVIA 2IC3B 5KFGA 7FDRA 3CIZA 5B08A 3G82A 1RTIA 3A8JA 1T9UA 1UZHA 2HVDA 3UQSA 4CYSA 3ZTOA 5IS2A 4GKKJ 3TANA 2BE7D 1HR0J 3R97A 5GAHI 3LA0A 2RQKA 4BBYA 1HBOB 4KGMA 2BM1A 3ILIA 4DSJA 3GCWP 1U8WA 2J0SD 4OHZA 3C2PA 1RU1A 4PG5A 3OW2R 2GIFA 3K89A 5H9FJ 2FZCB 1BY9A 3ET6A 4H4OB 3BPSP 4N47A 1RWPB 2AMCB 5KFHA 5D8HB 1AXQA 2MQ8A 4DDFA 4O4GA 4P2MA 3NCPA 2X1BA 3AA9A 3MM5A 3I9ZA 3G87A 2MPUA 1S9EA 4XK8C 3FJ2A 4B3SF 3L7PA 4ILLA 5LXRA 5E2QA 1NEEA 4ECXA 3D54A 2Z2MA 3J7A1 1GH8A 1Y0HA 2IBKA 4MJKA 4HT5A 2XWYA 3HHLB 5DM7Q 2AV5A 2Z2LA 4GTXA 4DX8H 8ATCB 4YFUA 2D3UA 4MIWA 3NKYA 3Q8YA 3CDUA 1JJHA 1N88A 4NLPA 4ECTA 4WYWA 4RBVA 3HSDA 3NKOA 3KD8A 1LQ9A 1TL1B 2VPYB 1AUDA 2DR9A 4ZN1A 3DOKA 3DGVA 1ACMB 4WCEQ 3K8VA 1RT1B 4O3NA 2VKZG 4EZ6A 1WI6A 4Y00A 1XEZA 3R5DA 3UVJB 2I2YA 4CLPA 4DXLA 3C14B 3TI0A 1VR6A 1FRMA 2KT5A 4Y34A 3IGNA 1NH7A 2XI2A 2QGFB 3I82A 2E9RX 3H2UB 4DCPB 2RAQA 5E3AA 3U1NA 5AE1A 4TY8B 1SC4B 1G6BA 2DNMA 5D3GB 4TLRA 2EC0A 2I38A 2BJ3A 2R7RA 1FT8A 2IRUA 3UCUP 3GG1A 5D4PA 4JI1F 3KLEB 4ED6A 1NK6A 1CQNA 2W2PP 1GEHA 1WOSA 5MAOA 4ZVGA 2NXJA 3PIPQ 3WIUA 3W64A 4WBFA 3E2DA 4DQSA 4EBCA 3CCLS 3Q8VA 4NYPA 5IXUA 3T02A 3QJPA 4USMA 1XIQA 3I4HX 1S72S 1JLFB 3LQVA 1NPRA 2RMLA 2CZ9A 4AXIA 2AYGA 5LMUF 5M2RA 3MDFA 3BBFA 2YKMA 1RBAA 1L3VA 2B9XA 2FHMA 4NRTA 4QW9A 2HBZB 2LQ5A 3CMRA 1WJ9A 9RUBA 4B3TJ 1RHJB 2UXCF 3QZ8A 4LF5J 1ZAVA 3PW7A 2JFDA 2CPXA 2XY5A 1BMQB 4DEZA 5KT5A 2V2KA 1NH8A 4QAXA 2XLKA 4KV8A 1VRQC 3H20A 1ZEBA 1L3KA 3SXLA 4RW4A 2JEGA 1X5TA 3AOCA 2IHR1 1VQ4S 3R5BA 2FVCA 4WFBQ 1EQMA 4L3NA 4TU9A 5CH7B 5K8NA 4DSEA 2W7OA 3AD7C 1EETB 2ZC3A 2BBEA 2I8EA 1KHLA 1NSQA 2LECA 1WACA 4FYWB 4OYXA 2NREA 2POKA 5DDQC 4MAKA 2OSQA 2YKAA 4OZJA 4JYAF 4HL9A 2DNZA 5KG3A 1RB0A 4I67A 4ES3A 3KJFB 2X7IA 1ALHA 3EXYA 1LKZA 4KHPF 1M5VC 3K58A 3NWGA 2P6TA 2MLYA 3T01A 1XBWA 2QL9B 5F9LA 2DXFA 5KT7A 3EYZA 1S9FA 4J9KA 1HA1A 1F5AA 2VG7B 3Q8RB 2JVRA 3W63A 4XDDA 2RHQB 3HCXA 1U2FA 2MQLA 1FK9A 5JJBA 4KJGA 1A0OB 4JI0J 4WU2A 3T41A 3EPIA 3CO0P 2E5HA 3MFHA 2G1HA 2V9WA 1N2LA 2ZJQQ 4DF4A 3G86A 1DURA 3WAYA 1IKVA 5F8GA 3KLHB 2XO7A 1D8ZA 4DV5F 3DN9A 3CCRS 4CYUB 4NLOA 2V34A 4CDIA 3AOAA 3VHQA 3L3CA 1F1BB 1RE1B 5HI7A 4FXVA 2CYYA 3OSNA 4ZITA 1WD6A 4KO0A 2FJDB 5E0OA 3KJQB 1DBDA 1O51A 5HVHA 4Y3CA 3TX0A 1RP5A 2JX2A 2VHGA 3NG8A 3K57A 5HLFB 5EN1A 5DG9A 1MW7A 3KK1A 2QFJA 1H74A 3H90A 3NLCA 2DGXA 4CO2A 5HMWA 2FGCA 2ZZNA 4KM4A 3C6TA 3DRRB 3MUMP 1VJQA 2HBRB 3W7BA 1AW0A 1FERA 2MSTA 1PO6A 1E1ZP 1FKAF 1UWBA 4EO8A 1LNQA 4OV1A 4J91A 4R0JA 5FDLB 5CXTA 4YP3A 3NS7B 4QWEA 1FFGB 3C16B 2WBRA 5F9NA 1F60B 2W5VA 5K9FA 4O3RA 4X4PA 1EKRA 4IFVA 1WUUA 1S0MA 4NCGA 1FESA 2F4VJ 1NJIT 3VCDA 2IRXA 1G1XA 2NYIA 1AZSB 2IM1A 3M7VA 2EK6A 1SV5A 1JLGA 3OSPA 3IAM9 1PAEX 4F4XA 2PEHA 3FDSA 1K0VA 1CULA 3MMCB 3GTYX 2VBWA 3PRVA 1YG0A 3B82A 4KQZA 4DUYJ 4OYWA 2VDIA 4CXUA 2G9OA 4M5GA 2I6WA 2OFHX 3JQJA 1JWWA 1JB0C 5KT4A 2XSFA 2WVCA 4WZMA 2JDJA 4EUVA 1OY6A 3VTIA 1S48A 1NK0A 2DR5A 3PX4A 3EGVA 1FKPB 3H4DA 2ZBQA 3SDEB 4MFBA 2DGSA 5KT2A 1FWKA 3M2RB 1X4FA 2HHHJ 4Q8EA 1ZAXA 4TQRA 4Y6IA 2YWHA 3T6JA 1TUGB 3BGRB 1IN0A 3FCHA 2RILA 1T11A 1KVKA 1VHFA 4ZVQB 3T9NA 4DU8A 3K17A 2DIVA 1S49A 4OHWA 2MZJA 4J9UE 3JXOA 1Q8KA 2DGOA 2B6AB 1TKTA 2XZWA 3PZPA 1IKXA 2C2RA 4GTWA 2FVRA 1V5VA 2RF2A 2QA2A 1N5YB 3US5A 2KHDA 1O99A 1UJ6A 2AYBA 1TL7A 1VHIA 1P1TA 2MKJA 2YNHA 1B70B 1RTDA 3PX0A 2OHDA 4UPHA 1R6VA 4YB5A 4X4VA 3MCSA 3KG0A 4P74A 4ZJOA 1RWWB 2W5RA 4DUTA 3DGPA 4DPUA 2ZUGA 1NK4A 3NVLA 3L09A 3PX6A 3CCZA 4KJIA 3MEGA 1RT7A 4HLBA 5HMXA 1X8DA 1TV6A 2DGTA 2WSEC 3AB4B 4UUWA 4JI6J 4TYAA 3OL9A 5D4NA 2LCWA 4M63A 3M8SA 2RUSA 2BQUA 3NS5A 1O98A 3IRXB 4UPLA 1NJZA 2MKIA 1WORA 1VK8A 3D2WA 3UFCX 3OHAA 3MCOA 3T1HJ 2XZDB 3VALA 1CVJA 2KHCA 3PR5B 1R8CA 4WP3A 3CVKA 4FYDA 5KG1A 3BB5A 1AUSL 3TNVA 1HJKA 1X4EA 1FXRA 3H98A 1I3OB 1E6VB 1T05B 1G2EA 3BEGB 2ZEJA 4ANEA 4KYZA 1GX6A 1TP7A 2QYGA 3ONQA 2E5LJ 1SVDA 4LSLA 4Q2MA 1OIAA 4PUOB 4ED7A 2GVZA 2M7SA 2CJYB 1X9MA 2QZ8A 3DRSA 3WHIA 4X4RA 4J9SA 2NUHA 2KH9A 3AFGA 1MROB 2CQCA 2X1GA 2ASJA 2EWHA 4AXJA 5F8HA 2OGUA 3HXMA 3H5SA 4QR1A 1RAGB 2E44A 4IDKA 1LK5A 1ZAWA 1TU0B 4K4UA 4X4SA 4PXBA 4DV1J 4FVMA 5BYQA 3BR9A 4PWUA 4ED2A 1FI4A 1Z2LA 1Q79A 2VPZB 2DHAA 5L9NA 3LAKA 1XNRF 4LVOP 2I5JA 1JQGA 4YS2A 2D69A 2W9BB 4DPYA 1MNEA 1VBKA 1RCXB 2MXYA 2FJBB 3IBCB 4O23A 3M9OB 5DDOC 5KFZA 2I1RA 3TAMB 4MHXA 2HS3A 5KFYA 4YN3B 1S99A 3PFOA 4ED3A 3FSYA 1CC7A 2UUBJ 4C9DA 2B51A 4ICLB 4EYIB 1A7GE 3EVOA 1APSA 2CJKA 3M1VB 3WQPA 2OJ3A 2R7TA 2JEJA 1MSWD 4KT0C 4IFYA 4C8OA 1CC8A 4C3KA 2GAGC 3PRDA 4LUBA 5HQLA 3DHWC 4F8RA 3HZGA 5EGHA 2W8LA 1F9EB 4FS2A 1RT4B 4WK3A 5KFNA 4RW6A 2BKPA 2ZNYA 2R7WA 4F26A 4NI2B 2ATLA 4RPFA 2UZAA 5DZ7A 3GMGA 1N34J 2A6OA 4IR1A 2E5IA 3MR6A 3OFEA 1FE0A 1TKZB 2R8JA 5HK4A 1B4SA 5HVFA 5C42B 4DR1F 1HQAA 1M90T 5L46A 2O3DA 5KG2A 3HO1A 1SKWA 5IT9U 5EX0A 4Q8FA 3K0JA 1HNWF 2OFGX 1H2TZ 4EBDA 4RJVA 2O67A 4RNMA 2RH6A 1RADB 1BWEA 3LW5C 2COLA 2ZOMA 2DVIA 2KT2A 2ZHOA 2CQ4A 1F5BA 4LF9F 4DWIA 2X1FA 2IAJB 2RT3A 3BO4A 1S6QB 3MM9B 2EG1A 4FVCA 4NLSA 4RLEA 3KUGA 1VRTA 4NX9A 1C0UB 2KG0A 2Z4PA 2CPYA 1W26A 2MHEA 4CO5A 4DSFA 4TYBA 2PSZA 3WZ0A 3BBCA 2LXUA 3IRWP 3DLKB 1RLDA 4GKJF 4N8OA 4CLUA 1CJVB 2JFKA 3MM6B 3T00A 1X9WA 1IJEB 2DH7A 2KXNB 5BYSA 2KTQA 4PKDB 1ANJA 3VAGA 2A10A 3CDAA 2K7JA 2ZDOA 2GVDB 4LF4J 1RWKB 5C24A 2BJ9A 1SKUB 4M5DA 1IKYA 1S9GB 2RH3A 5EWFA 4NXNF 1QAYA 4UOPA 1N5TA 3BR8A 3L7OA 4NLVA 2Q1LA 3NGRA 1B0VA 4B02A 3AA8A 4USTA 4B9TA 1N36F 1HQUA 4B3SJ 4LRCA 5I42B 2J0XA 1S5ZA 4DR6J 1R0AB 5ETTA 1KHVA 1HD0A 4P10A 3W66A 1QSLA 1RGVA 3DRYA 2LXFA 2DBBA 2XULA 4KAIA 5F0WA 2VA2A 1V3RA 1LOUA 1SXLA 2FIUA 1KH9A 5HN0A 3ELHA 3ICLA 2J7UA 3EM1A 4IO1A 1JMTA 5HBMB 4L72B 1TK8A 3CCES 1S1WB 1FJCA 1IBLF 2CQ0A 2NSBA 2E7XA 1FE4A 1MMDA 1ZA1B 4QU7A 3EPGA 2IFXA 3ENQA 2ZC4A 2HVHA 1E6YB 4R8UA 4AQYJ 2WTFA 2IC3A 1Z1ZA 2CJAA 4CP5A 4X65J 2V2QA 4RW9B 1S7HA 3W61A 1Y00A 2ASLA 5LSRA 4LRAA 4WIIA 5KFXA 1FA0A 2ZOGA 2CADA 1U1RA 4LF1A 5AJ9A 2E7VA 3JSRA 1HYSB 3DU5A 2QLWA 3PACA 2LFVA 2IBOA 4WFZA 1T8EA 3MPDA 1PJ5A 3R27A 2U1AA 1U25A 1HBOA 3ZZTA 4MIVA 3VV2B 2BR0A 5F3TA 4J9PA 3R7SB 1NBEB 4WXWA 4L75A 1I94F 4CT9A 1VQ7S 2V50A 4B08A 2V2VA 4H4OA 5DG8A 2KM8B 2R7XA 1UFKA 1S0NA 4RUHA 2AJ2A 3LF0A 1OS5A 2WW4A 2D3ZA 3ZXWA 3FFIA 4JI1J 1SIZA 4UW2A 2W7PA 3PO4A 2Y1LB 3PYFA 2F7VA 3IG1B 2N4CA 3MAAB 3H5XA 1XR7A 5JVHQ 1VOMA 3G6ES 3FBBA 4EBEA 3LUYA 1GAOA 4RBUA 3M4XA 3FBEA 4NWXA 3HHLA 1ELYA 4M5MA 2ALYB 5LXYA 1K47A 3FKBA 2ANHA 4KY3A 3TX8A 2ZVIA 4NL5A 2GLQA 4EGLA 2OO4A 1FJ7A 3E8OA 4DSKA 3FQKA 2WSFC 2WB4A 2ROEA 2BM0A 4KGZB 1J5EJ 3IXQA 2IJFA 1VCTA 4CCHA 1HWKA 3GP9A 4ZPCA 3ZZ0A 1IWAA 3CC7S 1TL1A 2NYHA 5BR8F 1Y10A 3LTOA 1CJUB 1N5SA 2QG9B 3ENAA 2UXCJ 4NLTA 1RAAB 3MF5A 2ZNZA 3MMAB 4EK2A 1RT1A 1QM9A 2W7AA 2C2MB 2DY9A 2GGPB 2C2ZB 3UVJA 1JIHA 3BH6B 5IWAF 3C14A 1X0PA 2ZBRA 2W2NP 3PO5A 2J8SA 4IG3B 2OELA 1VQNS 2ACYA 4HDGA 4V1Ak 4Z7YA 4TY8A 2C2NA 4HEA9 3D66A 1S1UA 3N28A 2D9PA 5D3GA 3WBZA 2FJWA 2VL1A 2MQPA 3TW0A 2VC0A 2Z30B 3QWUA 4DV0F 4ANCA 3K5OA 1VMBA 1VFJA 1HBNB 2WSCC 3ENVA 1XMBA 4KHPJ 2DNQA 2BEFA 2XEXA 2ZM6F 1HDHA 3AODA 3HT0A 2JHEA 4DV7F 3X1LB 2Q6CA 2A2DA 2VBYA 5K20B 2EKNA 5INHA 3C19A 5KFUA 1WG1A 3D1OA 3BDGB 4DN0A 2FLPA 4MIBA 1JLFA 4DL2A 3CT9A 3Q24A 5KAKA 3U1LA 4HACB 4TQSA 3RRGA 4ZP7A 4DN9A 3WC2A 2CJ9A 4PPDA 3W9HA 1VQSA 3BGUA 3LO3A 4ZCMA 4HH1A 4ILRA 4OLOA 2HFOA 2GIRA 2QA4G 2MQOA 1URNA 4DV5J 4YY3F 2PMWA 1UEUA 4A47A 1OSDA 2HHQA 1XWLA 4H4KC 3EJMA 3O2IA 4ZVRB 1M1GA 2HVIA 4ZVHA 4C0OC 3T5LA 2E5JA 1RYSA 2Y8WA 5FD1A 2LDYA 3EDQB 1LFPA 5L38A 4MTPA 4Z37A 3J80Y 3HHLD 4F50A 2XMKA 3OFHA 2HZVA 3HFZB 3TRGA 2XSJA 2IUCB 1RT3A 2J5AA 4EZ9A 1BWVA 1EETA 3OL7A 3SZZA 2QE5A 3Q83A 3PCOB 4I2PB 3R1HA 3R5AA 4OYIA 5A8WB 1JLAB 2LDIA 4BC9A 3JAMU 1GXLA 2BE2B 3OR1B 3CJKB 1HFEL 3UDLA 4C2MA 4DR7F 2VODA 4USKA 1WTBA 3CWJA 3EXCX 5U47A 1LWEA 1NPKA 2JEFA 4Q0BB 4M5JA 3E51A 4HT7A 1T9WA 2VG7A 1EKSA 3IO1A 4JI3J 5H1SV 3HHKA 2OD4A 4KB7A 4X4NA 1L3SA 3BDFA 3OFFA 2XS7A 3TO8A 1S79A 4DZ6A 5IT0A 2JH3A 3HI9A 5LL6d 3IM9A 3R6GB 3FRZA 2DJWA 1FD2A 4NZ6A 1Y5NB 2A2CA 1S76D 2QMXA 3UDCA 1G4CA 2NCKL 2UXDJ 4OZLA 3RAQA 1N48A 2CNLB 3NS6A 1WEXA 3J81j 3VGTA 4J9OA 3MTJA 1NO8A 3KLHA 4LBHA 4OZNA 4CYUA 2WOMB 2OMLA 3LXQA 4P2SA 1NK5A 2G2ZA 3W8PA 2ZWPA 1I1GA 1P27B 2RNEA 4P2XA 4U96A 3UCGA 4GKKF 4XTTA 4B9MA 1X5OA 1SIWB 5GOVA 3QRPA 5KFLA 5HLFA 3CE8A 2AX1A 2HFNA 1RKIA 2LQJA 3T5JA 4PG6A 3SCLE 4QZVB 2UVWA 2BANB 3DU6A 3DRRA 3GIJA 3BO3A 5J2PB 1ELZA 2BQ3A 3EICA 4FN5A 2W8KA 2JZ5A 3B6BA 2ZH3A 2ZVSA 2PMHA 2YKQA 3TVYA 2VD3A 2HVEA 1NSKL 4ID8A 2FY1A 3T5HA 1P8GA 5FDLA 1U6BA 5LM7E 3CCQS 4QIWD 3C16A 5KFSA 4DSIA 4Y2AA 2JVOA 4UOFA 4XIUA 4CH0S 3OR2B 2ZKTA 3PR4A 3AD9C 4KC5A 1GT8A 2F8MA 2HGNA 4ECRA 5H9EK 1T3OA 3W60A 1AZSA 5ETQA 4HYKA 2ZH9A 2Z58B 2YY3A 1HQEB 2KKHA 3OVAA 5THWA 5DGAA 1U1QA 2XMVA 1EP4B 1JK9B 5L39A 2YKMB 2JJ4D 3DOMB 3KXDA 3MMCA 1S10A 1GXTA 4GC6A 2RU9A 2VJVA 3N6LA 4U67Q 2RU3A 2IA0A 1PYSB 1GFWB 3TYTA 4NA1A 1VQYA 3IMQJ 2NLWA 2VZ9A 3R5GA 2CJBA 5D0HA 3C15B 1EARA 3PHTA 5KFMA 4TN0A 4LF8J 2DKOB 4UPIA 3KJNB 1FWPA 1CPZA 4DOZA 2IPOB 4QOTA 1HMVB 1FKPA 4FZVA 3LP0B 3SDEA 5FJ4A 5KFCA 1GK8A 3M2RA 3SI8A 3GJQB 1RK8A 2QLBB 4ITSA 4F2SA 2C3PA 3GYGA 1EI6A 2XTJP 2MZSA 2DT9A 3D3BJ 2OUGA 3IBWA 4J9MA 2R7UA 1Q8BA 4MK9A 4GO5X 3QJLA 1KKHA 4UOGA 2UV8G 3AOBA 1ED9A 1GTEA 1JXLA 1N32J 3J81Y 1WI8A 2BACA 3PFEA 5EX3A 2B6AA 6FDRA 4B3RF 3I55S 2ZHAA 2AF6A 4F4YA 1YVFA 1YJWS 1PSDA 5ETOA 2C1EB 1F9HA 3SMZA 5GADU 4IRKA 3MGJA 5DRKA 1ZM2A 1G3OA 4UT4A 4BDPA 4DJBA 2EG2A 1RT5B 3W62A 1ITPA 2VBXA 2CPEA 3OLBA 4ZGAA 2PGCA 1ALJA 3QQCD 4A8SA 1YGYA 1X0FA 2VQEJ 3MXHP 1U49A 2EFOA 3QT7A 2HFSA 1RT2B 1K1SA 4X2BA 3W5YA 4RU2A 3OTDA 4PXCA 7FD1A 1FD8A 4JI8F 2L9WA 1X5PA 4PZVA 1FX4A 4UQTA 1U24A 3IRXA 3T5KA 4LREA 2BQRA 3SCIE 1OQ6A 3RB3A 2HRYA 2DGWA 2O1PA 5FLXY 2GFFA 2MHNA 2WW8A 4F67A 5H9EJ 4LF5F 2K06A 2DTJA 3KLFB 1HHQA 3HKWA 5ETLA 1FRXA 3KMSA 3F73A 4YMEA 2R8HA 3QT5A 1E6VA 1T05A 1ZM3A 2X1AA 1HNXF 1K44A 2F63A 2KVQE 3TZZA 4W4MA 1GMWA 1L3TA 3MMBB 2CPFA 2RS8A 2CJQA 1R8AA 1U1PA 2M4MA 4QQBA 1UW9A 2LLZA 2K2PA 1F2GA 3QGIA 3BQ2A 2EXUA 1MROA 3OLAA 3EVMA 3V6DB 3Q2SC 3EGNA 1JKHB 1J2VA 1K8AT 2VICA 3OL8A 3RAMA 3N5FA 1FX2A 4FF4A 5FIIA 4DMZA 5AT1B 1W2IA 2BW2A 1KOOA 2E1AA 1HNWJ 3M6WA 4AYBD 1NKCA 1JNRB 1AB8A 1DTTB 1U26A 2YTCA 2IJNA 4JV2A 2VOPA 3HPOA 4M5KA 3WBHA 4OFZA 1UKUA 3A8KA 3RZAA 2DH9A 1BE4A 3CJTA 5ETPA 4X4QA 3RBEA 3WAWA 4QR0A 1ZPWX 5A8KB 4W92B 5IM0B 2L3MA 4DLEA 2W9BA 2DCUB 2LP4A 4JI0F 5HO4A 5AE2A 1YBUA 3I9V9 5B0AA 1ZETA 2XCAA 2DGVA 2CVEA 4DL3A 3V4MA 2IY5B 1T95A 4ZVSB 5KOWA 1VLOA 1NJWA 1EW8A 5HQMA 3CCSS 3TUIC 4HDHA 4A8YA 4CLTA 4ICLA 3FUYA 4FBTA 2F65A 3B5QA 4GKJJ 2JOQA 3M1VA 2VBZA 3UD5A 4NRUA 5IJQA 3GSIA 4KAVA 4OHYA 3O6QA 3GSDA 4NXNJ 2J7KA 3T9ZA 2IYIA 1RT4A 3BSAA 4I6AA 4WP9A 2X3DA 2QO3A 1N36J 4NI2A 3CB4A 3BGOP 1N5QA 1IKXB 2H65B 4WFAQ 1A6LA 3OBIA 4R0EA 2KJWA 3IR7B 2R7SA 4K7QA 1WWHA 2H54B 4I0WA 2MQQA 3MPYA 4ZVFA 4QPXA 4CYRA 4QWCA 3OUYB 2YNHB 2XYGB 3LALA 1FRLA 4IQXA 4YUDA 1BQNB 5DJBA 3F44A 5C42A 2UUCJ 3W2WB 4ID5B 1V6HA 2Z57B 1VBYA 5KFRA 2ZBIA 2F4VF 3ED4A 2RDDA 1RTZA 3CC2S 3H2VE 4UPKA 2W4CA 1RT7B 1U1MA 1SH3A 4IRDA 1H0HB 2HAFA 2XY6A 1CG2A 1GMWD 3NGTA 4DBQA 2IAJA 2FHOB 3HD2A 2XR9A 4FXWA 1RLCL 3FK4A 1S6QA 4Q7AA 2N82B 4DLGA 3MM9A 2GQCA 5EDWA 3NCRA 4ED8A 1URAA 4RWWA 5KFWA 1C0UA 4NLYA 4ZIWA 1N56A 5F8LA 2VG5B 1REVB 2WONA 2ZH1A 3N4WA 3ISND 1N52B 2J6SA 2DNYA 5GMKa 3BSCA 3ULHA 4FF3A 4PABA 3DLKA 5KFPA 2ZHBA 1UVNA 5G0RB 2AYEA 4K4YA 3MM6A 2DRBA 1YBAA 4ECQA 4F02A 1UFLA 3QPIA 1H72C 1S1VB 3LPYA 2HAIA 4C8MA 3PVXA 2EFQA 3VQSA 1ZTTA 2WVBA 4LF7F 1WTFA 2GVDA 2IDLA 2Y9HA 2MGZB 1RDRA 4Y2IA 1FNXH 1E3CP 3D5MA 1S9GA 1Y5IB 2ADBA 1ZTWA 2VU5A 5C2GA 2HWIA 2ZUAA 5LQQA 1FXDA 4ZG7A 3ITHB 4I7FB 3DRSB 1BGXT 4DZDA 2PMZD 5I42A 4ZVTB 1JLQB 5E5NA 5GADI 3BGFA 1UJ4A 1R0AA 5CYQB 1JXEA 4I56A 2GA3A 5B0GA 2LQ8A 2R8KA 3AXKA 4AT1B 2YNFB 3TZXA 3CIMA 5E41A 1KQSR 2AU0A 1JLEB 4KRWA 3A1YG 2Q3PA 4PRFA 2CQIA 4QYRA 5L0EA 2NXNA 2HNZA 2F9JA 4OX9F 3DM2B 4EO6A 4DQPA 2GQ2A 3PTWA 3OHBA 5HBMA 4OX6A 3RBDA 1RHKB 4X66F 1S1WA 2UVVA 2N3OA 3KHLA 5BR8J 5E3RA 3MTKA 1OO0B 3MHYA 4JI6F 1XMOJ 3A4TA 2HG4A 1D09B 5AJ3F 4KE5A 4LFCF 1E6YA 2CQ1A 4QJVA 2DITA 2J0QD 2KXFA 5HVGA 4RW9A 2DD8S 2V8PA 5CCLA 3D68A 3VVUA 1HD1A 2ZH7A 2A3JA 1HYSA 1T7PA 4QW8A 2NZ4A 1BLUA 3ILOA 5B0CA 1PYOB 2DEJA 2DNHA 3TJ8A 3EGZA 5DO2A 3ZNJ1 4Q5VA 1VQOS 4Y2CA 3PYGA 3NMRA 3CF5Q 3MURP 2KU7A 4ECVA 2CZ4A 4URQU 2FPHX 2E5LF 2B9WA 3HX9A 3UR3C 5F3ZA 2RQ4A 3D6FB 3ZNUA 1IM4A 2YWWA 4U7CA 1JJCB 3H25A 3KWMA 4YR1A 1KN6A 4TU8A 1L3UA 1I6JA 4USIA 2JLEA 2X51A 3WC0A 4ES2A 2ZM6J 3SYZA 4F4ZA 5GAEU 3UPFA 4DV7J 4L76A 3IG1A 2HS0A 1YLXA 5LT5A 2XNQA 3MAAA 4DL6A 4A8FA 1YDLA 1WF1A 2MDAA 4K2XA 1RHQB 3VR1A 2YNIB 2C3UA 3D0IE 2D3O1 1F2HA 2R7OA 3R5JB 4ZVEA 4DV1F 1WC5A 4C7QA 5KT3A 4RNHA 3HDSA 4KPYA 4PWDB 1YIJS 1KSPA 4N76A 3QMQA 1RAIB 1YRXA 2QL5B 3Q89A 5KFEA 1RTHB 1DQ9A 1CJUA 4DX6A 5F8JA 1FDAA 1EW2A 4RO0A 5L0KA 3MMAA 3KK3B 1SC6A 3HVTA 3GG0A 4USUA 2QN6B 1TAUA 2UUBF 3ZTPA 4TU7A 2W9CB 1WC3A 2RSQA 3OTOF 2GGPA 1C1BB 4LQ9A 3PRBA 2PDAA 2HFZA 1NXIA 3QWPA 3D1QA 3ETMA 2E1MC 1EAYC 2F9DA 4PG4A 3KLIA 3UWTA 4IG3A 1L5UA 4M1KA 2LEPA 4DFKA 4WFNQ 5IJSA 1Q16B 1FF2A 4K0KF 2E5GA 2RS2A 2NZCA 3VWSA 2B4UA 4KKOB 2H3EB 2HGMA 2KDOA 2AT1B 3ISZA 1X60A 5KG4A 4I4BA 3R9LA 4KSEB 2ERRA 1HQUB 3C3LA 4IH7A 4NXMF 1VYAA 4WTOB 1HBNA 4DR7J 2VASA 4DI6A 1NPPA 1HLWA 2W4PA 3AJDA 4NEYA 2IMWP 4F4AA 1RAJA 1Q8IA 3BDGA 4O3OA 2KFNA 2MQNA 2DR8A 4DV4F 3NP5A 3M8ZA 4ZPBA 2XMAA 4PQUA 1IJFB 1RWXB 1DARA 1Y6VA 3V6JA 1U4BA 3R7NB 4IQMA 1TL3A 1S1XB 1HQ2A 3MEKA 1R31A 1CQMA 5LSOA 2V67A 4DL7A 3KHRA 4J90A 3BQ1A 3CO9A 1S59A 3RGIA 2QV6A 4DV3J 3ILJA 2AYMA 5C7PA 4CNYA 5DG7A 2ZH2A 2BJEA 1RZMA 3IS9B 4H54A 3POTB 4ES1A 1SHNA 3QIPB 3DLBA 1ALKA 2VV5A 3I96A 2LQ9A 1AYEA 3AQOA 5A6PA 5DS7A 1KQGB 1VC5A 2EEYA 5L0BA 3G96A 2W8SA 3WIVA 1EZZB 1I5OB 1VK3A 3NXZA 5JMNA 4LR9A 3AH6A 4LF4F 3KYLA 2IUCA 4OX8A 2Y1IA 3HLUA 2D3OR 2R2UA 4DHVA 4I2PA 4HI1A 3AB2B 2A1BA 3U27A 5RUBA 3CCVS 2SXLA 5A8WA 1JLAA 1WC1A 3JTPA 3BH7B 2BE2A 3TA0A 4CNZA 3OR1A 3CJKA 4ZVPB 3FFIB 2VB6A 2B7BB 1P6TA 1H98A 3BYPA 3M30A 1R3NA 4DR6F 4ALZA 2MYFA 3CJ3A 3J7AN 3ZZRA 2Q43A 3DI6B 3I31A 3R6LB 4QIGA 4Q0BA 3CD7A 4OX7A 3SSRA 2K3IA 4MY4A 2OEMA 2DO0A 2XC9A 3EX7B 2IM3A 2CJXB 5CABA 3D4JA 1RHMB 3NOGA 4ECUA 4PR6A 3CSKA 1AT1B 1OPZA 2EFVA 2DNKA 1VBZA 1RISA 3R2DJ 3TP2A 2V8HA 4OZ0A 4DR3J 2WOMA 4AQYF 4RNFA 2HQFA 4X65F 4B9SA 4MKVA 1SH2A 4ELUA 5DQIA 4RU9A 1WSVA 4ZVOB 1HHTP 3M8QB 3GPAA 8RUCA 1D8YA 1YK9A 2D41A 2ZBPA 3HHEA 4BWMA 1X9SA 5D15A 4ZA1A 1C2PA 1YTYA 3BO2A 4CM2A 2R2RA 4N41A 1FRIA 2HQCA 3DYAB 4DPXA 2OH2A 1XQIA 2RJZA 4X62F 4J37A 3KUEA 1QTNB 2BANA 5JVGQ 5J2PA 1S1UB 2HPUA 4B3RJ 4OZ3A 4Y0FA 1WHXA 4G1QB 4K5RA 2KT3A 2DY1A 2WVFA 3GYNA 5HJYA 2HMIB 2D1GA 3I5BA 2G1DA 4OI6A 3TAQA 2H9ZA 3UNYA 2HKEA 1P49A 3MMJA 4LRBA 4WK1A 2YX7A 1FDBA 1ZA2B 2BKNA 2YNGB 1XN9A 4A8XA 1QSYA 3BF4A 2EBGA 3OR2A 1FRJA 3C8YA 2WVEA 1CEZA 2XMUA 1YZ7A 5A8RB 4EEYA 3J7ZT 1MG7A 2OPRB 1B99A 4DR2J 2PA3A 1M5HA 4XO0A 3G8SA 1PJ7A 3Q3QA 4UZCA 2AZ3A 3KLVA 1HQEA 2CDRB 3E2EA 2KZZA 4ZLLA 4JI8J 1EP4A 4LRFA 2P5VA 2FZGB 4KH1B 4CLZA 3DOMA 5CD4A 2HWHA 4XPCA 3P5TL 1ZOTA 1J5EF 2AJQA 3EDRB 3KHHA 1LFWA 4WKRA 2RDIA 2WRMA 3KHGA 1FRHA 3W2VB 2UU9J 2PN6A 3SCKE 3LOUA 4B56A 5DLFA 1Q1KA 1RWMB 3C15A 1G7CB 2MTLA 1VQKS 4X4UA 4OYPA 1K73T 1HMVA 1Q82T 3LP0A 1NHUA 3QGHA 3F41A 2GNKA 3P4UB 3D28A 1HNXJ 1ALIA 4RKUC 1NDCA 1XMQF 4FS1A 4CTAB 3NGUA 2LMIA 3G2XA 4XPEA 2XSJB 3NGKA 1RT3B 2GHVC 3VZIA 5KFFA 2Q79A 2VFUA 3DFEA 4B9VA 3HHLC 2E7WA 2DHSA 5EUHA 4WPAA 2K1RB 3ILLA 4E2FB 2KJVA 3G6YA 4JI4J 3MK0A 2W8DA 2C3OA 1VQLS 3CDWA 3UN2A 2PD1A 4JV5J 5DZ6A 1AJBA 3U7JA 1WG5A 1LWCB 1LWEB 1RT5A 5C66A 4IG0B 2ZJPQ 3QFHA 2KFZA 1K1QA 4L73A 3N6MA 4DR4F 4EMDA 1XR6A 3TA2A 3TUPA 1NMEB 3IDDA 3NNHA 5KFDA 5ITHA 1BC6A 1RT2A 1DZ5A 2E29A 2M9KA 3CCWA 4Q43A 3CJQA 4DQQA 2VPXB 5KFIA 3ZTRA 2HRTA 2ZZMA 1B8JA 3EE3A 2OPQB 1TFWA 1VC6A 3MAQA 3D0GE 2L08A 4OZ1A 4NA3A 3FC9A 2ROPA 3DRPB 3ZC4A 3MEDB 1ICEB 3KTQA 5K5MA 3B8HA 1AFIA 2RRBA 3QGPA 3IM8A 1KDNA 4I6YA 3KLFA 4NCBA 1B3TA 2QSWA 4O3QA 5A76A 1RCOB 1YKWA 2OKQA 2YPZA 5DM6Q 5KFOA 3ZTSA 1YJVA 3BS9A 3H40A 3CJSA 2VG6B 2CA9A 1N4LA 3MMBA 2CKWA 2ZZTA 2VOOA 1E2SP 2C3YA 1RACB 1Q0NA 5J1PA 4LJMA 5E33A 1RAFB 4ERDA 3J7YU 3HHDA 2DHXA 3OTEA 2MQMA 4WE1B 1VQ9S 2HIYA 1KTQA 2HNDB 4MK7A 4M5NA 5BJRA 4DS5A 2H48B 4IKAA 3OFGA 1CLFA 3M8YA 2B4VA 3UD3P 3V6DA 1JKHA 2G13A 4MYTA 1FJGJ 2B3TB 4PXEA 2W25A 4F3QA 4DFJA 2C22A 1FFWB 3WAVA 1OYDA 2GMHA 4AUKA 1SJQA 4O0NA 3CCMS 3LGMA 2AQ4A 1OMSA 4RUAA 3I87A 3C46A 5IV4A 3OJUA 3MM8B 1DTTA 3OXLA 4LRDA 2GSUA 2L48A 3SV4A 1OPIA 2RRNA 3R5CA 5GAGU 3GJSB 2WBMA 3BKUA 4JI3F 3RUBL 4C3LA 5A8KA 5IM0A 3A3NB 4C48A 1QY7A 1Z4UA 2VFVA 4BWJA 2YWKA 1I51B 1N33J 4F25A 5J2QB 2F8EX 2J8AA 5C25B 1HI8A 2HLUA 2WZ1A 4TXSA 2UXDF 3DLEA 3M8WA 3FMBA 2LEAA 2YXLA 4OJ1A 4WF9Q 3ZTQA 4UTGA 4C8KA 5BXIA 2C2EA 2W2MP 4QPTA 3B54A 4WWSA 4LSNB 2BX6A 4X64J 4P6QA 3N0VA 2Y0SD 4ZPTR 5HQ8A 3SFGA 4EYHB 2UV8A 5A2QY 4LF7J 3GIKA 2FVSA 1NKBA 2ZDPA 3IR6B 3TA1A 1VIXA 2CUYA 3FQLA 4A8OA 2DNRA 4QR2A 3HVRA 2XWXA 4F4KA 5KFTA 2HNYB 4WYLA 1SC3B 4L3KA 2YWEA 2Z2YB 1PC4A 4P9SA 5EGEA 1H6KX 3QT6A 2M2BA 1U0SA 1LW2B 2V4RA 5K14B 3OUYA 3ETOA 3O3LA 1OY8A 4HVZA 1BQNA 1UPMB 3FZ2A 2FDNA 3W2WA 4ID5A 2KI2A 4ZMMA 4YR3A 4OX9J 3PW5A 2W2QP 5IFMA 2RKIB 4UOHA 2ZH5A 2MLZA 3QSIA 1WDTA 9ATCB 4YOEA 4X66J 1VQ6S 3Q8QB 2W2OP 2JC1A 2QZUA 2M70A 2G9YA 4ZLPA 2BZ2A 3QGGA 3G4SS 1X4GA 5AJ3J 2OTJS 4LFCJ 3SZ2A 2CQGA 1N5VA 2YH1A 5LIAA 1H73A 2I9SA 2VG5A 1KHNA 1REVA 3RRKA 1T9YA 3MFIA 5HSPA 5CZXA 3CJ8A 4BC7A 1ZEDA 5EHHA 4LF8F 3U1MA 1QUPA 5G0RA 4HKQA 5KG7A 4GVLA 3TG0A 1T0TV 3QT8A 5KFVA 1MN9A 2QLXA 2J7WA 1RUSA 1S1VA 1TTHB 1WF0A 2RB7A 3PJWA 1KR4A 2AZ1A 4KHMA 1H7WA 2Y3YA 2RUGA 4AE5A 5L9XA 1PGZA 3A3PB 2DNNA 5GVQA 5T14A 1F5CA 2Z0GA 5DETA 1KH4A 2MGZA 1NK9A 2BOPA 2W01A 2L41A 2WK4A 4LR7A 4NLGA 4FNHA 1SQGA 1SJ4P 3ITHA 1N32F 1Q5VA 4I7FA 1S77D 1HARA 1JLQA 2H1YA 1FNOA 3RTVA 4C8ZA 1R7IA 2W24A 5CYQA 2YKOA 4JI5F 1HBMA 3NKRA 2BJ8A 4YR2A 1U0HB 2YNFA 2W1BA 1SB6A 1B7FA 3TZYA 2K7KA 1Y4ZB 1NSPA 1JLEA 4YQWA 4YHHF 1FDNA 3PEHA 1VGYA 2KYXA 5GMDA 1ZBTA 3FRYA 4DV6F 1U1OA 3DM2A 1KVJA 2BRKA 1QAJA 2QA4S 2VQEF 1UTAA 2NUUG 3W9IA 1J5OB 2DHHA 4ZJQA 3O1LA 3MI7X 1C4AA 1NHVA 1KS2A 2CWXA 2RVJA 5HAOA 1KNZA 3NL0A 4LQ3A 1M5SA 5SZTA 1ZH5A 4U95A 3DLHA 4ZJLA 3BJYA 3MR7A 2NSCA 1N8RT 3Q2TC 1UVLA 4CLFA 4ZG9A 4DQIA 3E01A 3BN4A 5DDPC 3W1YC 3UR0A 4QYZK 4C0BA 4K4SA 3ZFVA 2FJAB 3IN5A 3J80U 3OTOJ 3IGZB 3M8PB 4EWTA 3NRBA 2DNGA 4R5PB 1UVMA 4H4MB 4DFMA 3HMJG 3MAHA 3NBPA 3OT9A 4NASA 3KK2B 5TJ3A 3DPCA 4HH0A 2OP5A 4E98A 4K0KJ 5L1JA 2L9NA 1S12A 3NAHA 2FB0A 3HD1A 4W98A 1IM6A 4UOCA 1NDPA 2HBYB 1RAEB 1JJ2R 1SJ1A 3D3CJ 5T7LB 2E66A 2UVUA 2XS5A 3MOJB 3CEDA 3SQGB 4NXMJ 5DLGA 5ETSA 2ASDA 4OJ3A 5C5JA 1Q7YT 2A0FB 2IDEA 1ZPVA 2XYPB 3K7RA 2ZITA 4LIWA 4X4OA 1X4AA 2VFSA 4DV4J 2AWZA 1AJAA 4ZPVR 1RWNB 2YNIA 4U7UK 4ATNA 4NLRA 1N2KA 2LA4A 3L9ZA 4U9RA 5GAGI 4LBPA 1P1LA 2PI4A 5CHCB 3UD4P 2BVZA 4PWDA 3BN7A 1AFJA 2XS2A 2CIMA 4IR9A 1EHWA 3SFUA 1R6YA 1RTHA 2VIHA 1WF2A 1KONA 3V6HA 3ZZPA 1EQJA 1TR0A 5KFBA 2BE9B 3Q8SB 4Z2XA 3FEZA 1YQHA 1EW9A 2YQ1A 4DL5A 5HP1B 3KK3A 2WONB 1NAQA 3GCXP 2XI3A 4KHRA 3L7UA 3VAMA 4JV1A 1DY3A 1MWQA 4A8KA 3M9MB 2E1PA 1WHVA 4J9QA 4FYYB 2W9CA 1UA0A 3L95X 3MPVA 2D9OA 3UE2A 3H7HB 3ISNC 1KBRA 2PA8D 3GE9A 3I56S 5ETNA 2UXBJ 1C1BA 2GS8A 1HPZB 3IGVA 3M2VA 4WFXA 3P96A 3TARA 3HZEA 3KJVB 1Q78A 1Q95G 3M8RA 3I32A 1DRZA 2ZOFA 4W90B 4X4TA 3FEYB 3AJ2A 1XERA 4KKOA 4ZDNA 2YH0A 1OJ4A 5DQGA 2FGOA 4CXSA 1VIOA 5EGYA 2B0GA 4Y2KA 1TMMA 4YB1P 5HROB 5CYMA 1JJ4A 4QYZJ 2XMMA 1TUWA 5E3CA 3TZWA 2P9GA 2F4FA 4I68A 1MU2B 1HNIB 3UN3A 1EIYB
chains in the Genus database with same CATH topology
1P49A 4KM4A 1B8JA 5GRRA 2G9YA 4UOOA 2RH6A 4LRBA 3DPCA 3WAXA 1ALIA 3UO0A 2W5QA 4GTZA 3BDFA 1SHNA 5AJ9A 3UN5A 3NKRA 4FDJA 1ALKA 3A52A 2W5SA 1EQJA 4LR2A 5IJQA 4GTXA 3NVLA 3WAVA 2XR9A 5LIAA 4CYSA 4LRCA 2GA3A 3NKMA 1EW9A 5LRNA 1E1ZP 5L0BA 4KJGA 4KAVA 1EI6A 1KHNA 2W8SA 1FSUA 1KHKA 1ANIA 2IFYA 1AJCA 4QAXA 1HDHA 4LR9A 1URAA 3MK2A 1EJJA 3BDGA 4LRDA 2IUCA 1EW2A 1ZEDA 4LREA 1URBA 2GSUA 1K7HA 1ZEBA 2ZKTA 4MIVA 5K4PA 5L0KA 1KH7A 4LR8A 5LRMA 4N7TA 3M8ZA 2W5VA 2GSOA 5INHA 1N2LA 3Q3QA 5L0EA 3BDHA 3NKOA 3KD8A 4GTYA 1O98A 1Y6VA 3BDGB 3TG0A 2IUCB 4UPLA 1ED9A 5EGEA 4YR1A 3WBHA 3WAYA 2VQRA 3MK0A 3LXQA 5EGHA 2W8DA 1KH9A 3SZZA 4LRFA 1AUKA 1E33P 5DLWA 1SHQA 1AJDA 3UN2A 3E2DA 4KJDA 3WAWA 1Y7AA 3NKQA 3SZYA 2GSNA 3T02A 2W5XA 3M7VA 1AJBA 1KHJA 2W5WA 3DYCA 5DLTA 5DLVA 1KHLA 3T00A 5C66A 1AJAA 1KH4A 4ZG6A 4FDIA 4CYRA 5GOVA 3M8WA 4GTWA 4CXKA 4B56A 4ZG9A 1ED8A 1E2SP 1N2KA 1HJKA 4LR7A 1ANJA 1ZEFA 2W5TA 4CXSA 1O99A 5IJSA 3IDDA 1E3CP 5KXAA 3TX0A 3IGZB 5HRTA 1EW8A 2X98A 4CXUA 4ZGAA 3NKNA 1ALHA 3IGYB 4MY4A 4UPHA 4KAYA 4UORA 4NWJA 1HQAA 3ED4A 4LQYA 1ALJA 5LQQA 4TN0A 4ZG7A 1ELZA 3B5QA 2D1GA 4MHXA 2XRGA 4NWXA 1ELXA 4UPKA 1ELYA 4UPIA 3CMRA 3M8YA 3TWZA 3OT9A 3T01A 3MK1A 2QZUA 2ANHA 3UNYA 4UOPA 4LRAA 3UN3A 1KH5A 3NKPA 2W5RA 5TJ3A 2GLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P49 A;  4KM4 A;  1B8J A;  5GRR A;  2G9Y A;  4UOO A;  2RH6 A;  4LRB A;  3DPC A;  3WAX A;  1ALI A;  3UO0 A;  2W5Q A;  4GTZ A;  3BDF A;  1SHN A;  5AJ9 A;  3UN5 A;  3NKR A;  4FDJ A;  1ALK A;  3A52 A;  2W5S A;  1EQJ A;  4LR2 A;  5IJQ A;  4GTX A;  3NVL A;  3WAV A;  2XR9 A;  5LIA A;  4CYS A;  4LRC A;  2GA3 A;  3NKM A;  1EW9 A;  5LRN A;  1E1Z P;  5L0B A;  4KJG A;  4KAV A;  1EI6 A;  1KHN A;  2W8S A;  1FSU A;  1KHK A;  1ANI A;  2IFY A;  1AJC A;  4QAX A;  1HDH A;  4LR9 A;  1URA A;  3MK2 A;  1EJJ A;  3BDG A;  4LRD A;  2IUC A;  1EW2 A;  1ZED A;  4LRE A;  1URB A;  2GSU A;  1K7H A;  1ZEB A;  2ZKT A;  4MIV A;  5K4P A;  5L0K A;  1KH7 A;  4LR8 A;  5LRM A;  4N7T A;  3M8Z A;  2W5V A;  2GSO A;  5INH A;  1N2L A;  3Q3Q A;  5L0E A;  3BDH A;  3NKO A;  3KD8 A;  4GTY A;  1O98 A;  1Y6V A;  3BDG B;  3TG0 A;  2IUC B;  4UPL A;  1ED9 A;  5EGE A;  4YR1 A;  3WBH A;  3WAY A;  2VQR A;  3MK0 A;  3LXQ A;  5EGH A;  2W8D A;  1KH9 A;  3SZZ A;  4LRF A;  1AUK A;  1E33 P;  5DLW A;  1SHQ A;  1AJD A;  3UN2 A;  3E2D A;  4KJD A;  3WAW A;  1Y7A A;  3NKQ A;  3SZY A;  2GSN A;  3T02 A;  2W5X A;  3M7V A;  1AJB A;  1KHJ A;  2W5W A;  3DYC A;  5DLT A;  5DLV A;  1KHL A;  3T00 A;  5C66 A;  1AJA A;  1KH4 A;  4ZG6 A;  4FDI A;  4CYR A;  5GOV A;  3M8W A;  4GTW A;  4CXK A;  4B56 A;  4ZG9 A;  1ED8 A;  1E2S P;  1N2K A;  1HJK A;  4LR7 A;  1ANJ A;  1ZEF A;  2W5T A;  4CXS A;  1O99 A;  5IJS A;  3IDD A;  1E3C P;  5KXA A;  3TX0 A;  3IGZ B;  5HRT A;  1EW8 A;  2X98 A;  4CXU A;  4ZGA A;  3NKN A;  1ALH A;  3IGY B;  4MY4 A;  4UPH A;  4KAY A;  4UOR A;  4NWJ A;  1HQA A;  3ED4 A;  4LQY A;  1ALJ A;  5LQQ A;  4TN0 A;  4ZG7 A;  1ELZ A;  3B5Q A;  2D1G A;  4MHX A;  2XRG A;  4NWX A;  1ELX A;  4UPK A;  1ELY A;  4UPI A;  3CMR A;  3M8Y A;  3TWZ A;  3OT9 A;  3T01 A;  3MK1 A;  2QZU A;  2ANH A;  3UNY A;  4UOP A;  4LRA A;  3UN3 A;  1KH5 A;  3NKP A;  2W5R A;  5TJ3 A;  2GLQ A; 
#chains in the Genus database with same CATH topology
 1SCJ B;  2J6U A;  1JLB B;  2HQ3 A;  2AJ1 A;  1S6P B;  8AT1 B;  2MZQ A;  1WKK A;  5F8M A;  3HVW A;  2CQD A;  3T1Y F;  4GC7 A;  5F8N A;  3C6U A;  2UUC F;  4ZS6 A;  3OQ2 A;  3LGH A;  2HNZ B;  2J9E A;  1SL2 A;  3S01 A;  3K59 A;  1OSC A;  1S57 A;  1S1X A;  2XYH B;  3EMT A;  2QC3 A;  4LIR A;  2FQQ B;  3DXS X;  4RW7 B;  1D9A A;  3CDB A;  1Y7P A;  3CMQ A;  2ZWO A;  3I5A A;  2VKR A;  1EJ7 L;  1U1L A;  4NLU A;  1FNM A;  5ETK A;  3MCM A;  2GIQ A;  2QMU B;  1QAX A;  1BQX A;  2XY7 A;  3IS9 A;  2OEJ A;  2RRA A;  2HHV A;  3POT A;  3MCN A;  3O8W A;  3JSM B;  4OYA A;  3QIP A;  5KFK A;  3IC1 A;  4O3S A;  4A8M P;  2FVP A;  1O0P A;  2GW8 A;  3J81 U;  5IV3 A;  2LKZ A;  1Q7L B;  4URG A;  4X62 J;  3MZI A;  3RYL A;  5LRN A;  4ILM A;  4TVA B;  1RA7 A;  1C1C B;  3RRH A;  4DPO A;  1NCL A;  3JQM A;  4G65 A;  4PYD A;  2VFR A;  3D1H A;  3R8Y A;  3OVS A;  4XAK A;  1MMN A;  2Z8Q A;  2KZM A;  1FTR A;  2P2C B;  5KG5 A;  2EI5 A;  2XB2 D;  3IBF B;  2H51 B;  3B4M A;  1VS3 A;  3MM7 A;  3NCQ A;  2G2Y A;  3DI6 A;  4I69 A;  1FO1 A;  5DGB A;  2EFP A;  3GQC A;  4OYM A;  4B3M F;  2KO1 A;  1FKO B;  4OJH A;  4LF6 F;  1WG4 A;  4PCQ A;  1TL4 A;  2V63 A;  5L1I A;  1QUV A;  2DH8 A;  1KRP A;  3KLG B;  4LFA F;  2HQI A;  2RIJ A;  3SQO P;  1YJN S;  2GV1 A;  5FLX U;  3MEE B;  3CW2 C;  2XLI A;  3TJ9 A;  2V8G A;  1XMO F;  5JUM A;  3BGL A;  1FFS B;  4C8Y A;  5G4D A;  4C97 A;  3CJ0 A;  3FZB A;  2ZH6 A;  3HVT B;  4PG8 A;  4F0K A;  3KFW X;  2GO8 A;  3VAI A;  4N77 A;  5K4P A;  4G3I A;  3K8W A;  3M8Q A;  4GTY A;  2NXU A;  4ZKA A;  1XMQ J;  3IAS 9;  4YB7 A;  1QVG R;  2MMY A;  1RAH B;  5LSL A;  2OPS B;  3G8T A;  1T02 A;  3I0R B;  2HHP A;  3DYA A;  3KLI B;  3CME S;  3O5T B;  3K5L A;  3PNI A;  4LVN P;  1XNQ J;  4PYA A;  3DMJ B;  2DPI A;  5DLV A;  1ZS6 A;  2VC1 A;  4CO1 A;  2PE8 A;  1TUV A;  2FUG 9;  4C11 B;  1DQA A;  3DKD A;  3HSG A;  1T3N A;  2CQH A;  4G1Q A;  4ZPW R;  3SSS A;  4B3O B;  2WCX A;  3UDE A;  1S6O A;  2HMI A;  5CAA A;  4TKT A;  2LYV A;  2DO4 A;  2VF3 A;  2AHO B;  5AXL A;  5B0B A;  4ZP6 A;  2V0N A;  4MKB A;  3QLH B;  2FY8 A;  4Q44 A;  3NGS A;  2OSR A;  3GFY A;  5LJ3 Y;  2YNG A;  4K5S A;  3ENW A;  2AGP A;  1RQ0 A;  3SCJ E;  4F36 A;  4DR4 J;  3CXC R;  4OYB A;  5A8R A;  3MPW A;  2J9D A;  4KGV B;  2WVD A;  2OPR A;  5DDR C;  3DHX A;  1HNV B;  2BA9 A;  5HMY A;  2DK2 A;  1UVJ A;  1YJU A;  4PQU B;  4ZPD A;  1V3S A;  5CCM A;  2AGQ A;  4ZIV A;  1P9Q C;  1TL3 B;  3N9U C;  5I3Q A;  4MKA A;  4N8N A;  2GX8 A;  2PEB A;  1KFS A;  3DCA A;  4D3H A;  4JV0 A;  3H5Y A;  1A9N B;  3W2V A;  1RHU B;  1YBT A;  4WXO A;  3LP1 B;  5E3Q A;  4ELV A;  1S1T B;  4ED4 A;  1UAW A;  2EKY A;  1GTH A;  2KM8 C;  4ECS A;  4AL5 A;  4I2Q B;  2QX0 A;  1NJX A;  4LT6 A;  3BDP A;  1V3Z A;  2VQF J;  4N56 A;  2M5Y A;  1IQT A;  4DPW A;  4QU6 A;  1SUQ B;  4YEA A;  4CH7 A;  2CG4 A;  5D78 A;  3DXB A;  1GNK A;  4CTA A;  1Q53 A;  3SBM A;  4FF1 A;  2U2F A;  1S6U A;  1IWG A;  1FXL A;  3NMA A;  1LEO A;  4GRS A;  4ED5 A;  3PHE A;  1R43 A;  3HJV A;  4UY8 T;  3V81 B;  2AX0 A;  2CPH A;  1SL0 A;  2K1R A;  2J0W A;  1YJT A;  2GHP A;  2BUN A;  1YRT A;  2MZR A;  1U48 A;  1KD1 T;  4QBU A;  5CQG A;  2PI5 A;  4KFB B;  3OPK A;  3BQ0 A;  4ZHR B;  3D6T B;  5J1E B;  3CUL A;  2HSE B;  4DX7 A;  3I0S A;  3M30 B;  3LPE A;  2W4D A;  1LWC A;  2JWN A;  4IG0 A;  3NNC A;  4P7T A;  2AEJ A;  4JP8 A;  2UVR A;  2DIS A;  2W5W A;  3EGW B;  2CG8 A;  2IM0 A;  2EPI A;  2C2O B;  3M2U B;  1FWL A;  4RW8 B;  4UF4 A;  4UOR A;  2R42 A;  3I6P A;  4MYU A;  4KGX B;  3V4I B;  4BS2 A;  2OPQ A;  4ZP9 A;  1U1K A;  1JXV A;  3A8E A;  2ZFH A;  4NLQ A;  3G9C A;  5GRR A;  1DLO B;  2HRU A;  2MKS A;  3DRP A;  2W5S A;  3S8S A;  3MED A;  1FJE B;  2XHC A;  4DV3 F;  2QYC A;  2HBQ B;  1WEY A;  1ANI A;  3BZQ A;  7AT1 B;  2V8V A;  4DR5 F;  3UNG C;  3CMA S;  3HJF A;  1UWA A;  4LR8 A;  1JLC B;  3OTB A;  3N6N A;  5ETV A;  1KLM B;  3VGU A;  3OV7 A;  1NZA A;  2VG6 A;  3DDN A;  4OL8 A;  4FKY A;  1CJK B;  2CRL A;  1Q81 T;  5A6W A;  3RW7 A;  2AJ4 A;  3Q22 A;  2B43 A;  2IA6 A;  3PEJ A;  3KDO A;  4OV6 A;  2DPJ A;  4WE1 A;  2ALZ A;  4DL0 C;  2HND A;  3CTR A;  1QLN A;  5J1N A;  2OAU A;  2X98 A;  2PT0 A;  2Z2Z A;  3SIP B;  1NUE A;  1O5J A;  1HNZ F;  1T03 B;  2O5D A;  1NDL A;  3FVY A;  4U8Y A;  2IMO A;  1ELX A;  3SV3 A;  3MK1 A;  1U1N A;  2JL9 A;  1QVF R;  4UOO A;  1YI2 S;  1M1K T;  3JYT B;  4HHU A;  3MM8 A;  2V8D A;  1S0O A;  2YX4 A;  2XHW A;  4ER8 A;  1NJY A;  1IBK F;  2DNO A;  4I64 A;  2V4Q A;  3J7Z 5;  5HAT A;  5ETR A;  1RT6 A;  3QFW A;  3AXM A;  2OMO A;  2D7S A;  3MR5 A;  3BV8 A;  2XMJ A;  1D9D A;  1F9F A;  5J2Q A;  2QSF A;  5EWG A;  2UUA J;  1E33 P;  5C25 A;  3H42 A;  3D6M B;  3V5R A;  1Y7A A;  3P45 B;  3RB6 A;  4C3M A;  3VF0 B;  1SKR A;  4DR3 F;  2CDQ A;  1CS4 B;  4M5H A;  3BKT A;  3DLJ A;  4LSN A;  2QFI A;  1HW8 A;  1K0T A;  3GYX B;  1UPP A;  3BBB A;  2K8G A;  1ZYQ A;  5IC4 B;  2DCL A;  3F56 A;  2V94 A;  6FD1 A;  3A8I A;  4ZVU B;  2FHJ A;  5B0F A;  4J9V A;  4FDJ A;  3P8B B;  4TN2 A;  1DTQ B;  1WDD A;  3W3S A;  2HNY A;  3IWN C;  1KVI A;  2CPJ A;  1ZZN A;  3PV8 A;  2APO A;  2IFY A;  2CNK B;  1RWV B;  3QBC A;  1KHW A;  3GV8 B;  2O01 C;  1URB A;  4K4X A;  4WZQ A;  4JI5 J;  1LW2 A;  4FPI A;  1GMU A;  2ZE2 A;  3EZ5 A;  2M3D A;  1VIS A;  5K14 A;  3PJX A;  1X7V A;  1CJT B;  3F0N A;  1N0V C;  4YHH J;  1FDD A;  2XO6 A;  3FNN A;  4DV6 J;  2RKI A;  1TMJ A;  5HL7 Q;  5M2U A;  2QA1 A;  4DR2 F;  5J2N B;  2HHT A;  2J6T A;  4KR0 B;  2M8D B;  2CAJ A;  4Y2M A;  3NGD A;  2WHO A;  2J76 E;  4GVB B;  4CH1 A;  5ETM A;  3HSZ A;  2F5G A;  1UL3 A;  4CLW A;  1Y3K A;  3B78 A;  3EVW A;  2Y0B B;  4AD6 A;  3PYE A;  2BAB A;  2XGP A;  4DSL A;  2UU9 F;  1VI7 A;  1YJR A;  3TUZ C;  1F0X A;  4TLQ A;  3PIO Q;  2LVW A;  1WOP A;  2GJF A;  3DOL B;  4CO0 A;  5J2M A;  3R3T A;  5MLC V;  3KOA A;  4DCO B;  1D3W A;  3M32 B;  2WAQ D;  2L9D A;  4IUF A;  2B4O A;  4NOH A;  1F3F A;  5C2C A;  4JBC A;  3TOQ A;  6AT1 B;  3KUH A;  1FCA A;  2Y8Y A;  4OZ2 A;  2XG8 A;  2EW9 A;  1T94 A;  2E1C A;  2C42 A;  3QO9 B;  1YJ7 A;  1NK7 A;  1KOH A;  2OEK A;  2R4F A;  2E9T A;  3VAJ A;  4JI4 F;  2JLG A;  4CT8 A;  1R0C B;  3TVZ A;  1NB2 A;  2FZK B;  5K8P A;  4J9L A;  4A8Q A;  3UW1 A;  4OI2 A;  1BQM A;  3GLJ A;  2HHS A;  3QSY B;  2UP1 A;  1IUJ A;  1U0H A;  4JV5 F;  1URR A;  3H4B A;  3AJ1 A;  4C98 A;  3HM9 A;  1F6T A;  3A12 A;  2YKN B;  4N5S A;  4JB8 B;  2QEX S;  3GFZ A;  3H59 A;  1TFY A;  3H0P A;  2V69 A;  3HP6 A;  2CQ2 A;  4D3G A;  4ZK7 M;  1J5O A;  3GU0 A;  1F3V A;  1VBX A;  2FHJ D;  2M0G B;  4MIA A;  1EQ0 A;  2JC0 A;  4WIQ A;  3TEG A;  1P9Y A;  1BUX A;  4F0H A;  1PIE A;  1T9V A;  3DLE B;  2R8G A;  2GO9 A;  1RYR A;  1D9F A;  2QRR A;  4EU0 A;  1HWU A;  1OQ3 A;  4ZCK A;  3RR7 A;  3S1T A;  2ROG A;  1IVZ A;  3M8P A;  2DGQ A;  4RZR A;  1U6F A;  4R5P A;  3IWL A;  4E8U A;  4H4M A;  5B0E A;  1XC9 A;  1NSA A;  5IC6 B;  3KK2 A;  1RAB B;  4DU7 A;  5HMZ A;  4HR2 A;  4P75 A;  5LJ5 Y;  3NNA A;  1UJ5 A;  3D9B A;  4KH0 B;  3CJ4 A;  2ZKU A;  1QE1 B;  1R8P A;  2HFU A;  4LR2 A;  1LW0 B;  5T7L A;  1GXU A;  2K3K A;  2DNP A;  4JI2 F;  2YPY A;  3MD3 A;  3SQG A;  3S6E A;  4CRJ A;  5KFJ A;  3U02 A;  1GX5 A;  1S4E A;  3DLG B;  2KL8 A;  3IP0 A;  1WKL A;  1FJG F;  1H2U X;  1TK5 A;  1SJR A;  3IA0 A;  1C4C A;  3T1Y J;  2KFY A;  2HZA A;  1LK7 A;  4MKY A;  4PWW A;  5AXM A;  1KQK A;  3L4B C;  1W25 A;  4DUZ F;  1MLA A;  1YRU A;  1M5O C;  2XNR A;  2PFF B;  3MEC A;  4L74 A;  3VVT A;  3KDN A;  1TVR B;  4K50 A;  2Y1J A;  1C0T B;  1MN7 A;  4J7C A;  3HHN B;  1VRU B;  4ZLN A;  1FEE A;  5LMN F;  3W9J A;  1N33 F;  3FBF A;  4LF2 A;  3LAN A;  3CGI A;  1Y11 A;  3W65 A;  3HF5 A;  5HP1 A;  2BW7 A;  3KMQ A;  3H8Y A;  1N6Q B;  4LMZ A;  4WP8 A;  4TY9 A;  3HT3 A;  1KQF B;  5CD4 H;  3KNG A;  2C2K B;  1U47 A;  3GIL A;  2VJU A;  2P9C A;  2XCP A;  4L6V 3;  2B4P A;  2F1F A;  4X64 F;  2F8H A;  1HPZ A;  4E0D A;  3FCV A;  2M52 A;  4G1I A;  5I3P A;  4B9N A;  2N3L A;  2IM2 A;  3KJV A;  4USJ C;  3MR2 A;  3LH2 S;  1NKE A;  2O66 A;  1HI0 P;  3IFE A;  5AE3 A;  4OLP A;  1NLK L;  4O44 B;  5HRO A;  3GV5 B;  3NAI A;  5KG6 A;  4B9L A;  1R8B A;  3QAU A;  3FEX B;  2QMW A;  1Q86 T;  3K5M A;  4BHQ A;  1MU2 A;  4ENO A;  3MWB A;  1VLY A;  1HNI A;  4PPZ A;  3LP2 B;  3GZ7 A;  5A0Y B;  2Q66 A;  4UUX A;  1SKS A;  1JLB A;  1HBM B;  1IBM F;  1S6P A;  1OY9 A;  3HVA A;  3P5B P;  4QCL A;  1Y9O A;  3D67 A;  4I1T A;  1KH5 A;  3NKP A;  4PQA A;  1LXN A;  4B3M J;  3JSB A;  3D6H B;  2YBV A;  3ZZU A;  4LF6 J;  1LWF B;  1YX2 A;  2C2D A;  2B56 A;  4LFA J;  5D4L A;  3NOC A;  4QWB A;  3G6V A;  1WKJ A;  3M05 A;  5LMU J;  2A6M A;  1VQ8 S;  5D0G A;  4RW7 A;  2VON A;  2DEI A;  3VAH A;  1ZZF A;  2CQP A;  3GV7 B;  1X31 C;  1S4F A;  5ADZ A;  3Q0A A;  3W8G A;  1UVK A;  5DLW A;  3UCZ P;  2HYI B;  4NLX A;  4NA2 A;  5EWE A;  4KJD A;  2ILY A;  3G71 S;  3E01 B;  4KGK A;  4DV2 F;  2EBE A;  2X3G A;  1CSJ A;  2P6S A;  1R0B G;  4CXK A;  3JSY A;  4DCJ B;  1B0P A;  1H7X A;  4IOC Q;  4V19 X;  1DAX A;  1SPB P;  4OI0 A;  3JSM A;  2HK3 A;  3NBP B;  4CQ1 A;  2DIU A;  4EFA C;  1NDK A;  5KG0 A;  3IGY B;  2FTR A;  5L1K A;  4LQY A;  3H5U A;  4BCA A;  2V6A A;  3OL6 A;  4QIE A;  4URS A;  1QAI A;  2EFG A;  2V4J B;  5I3U B;  2YQ0 A;  2B5J B;  1HWL A;  1DJ0 A;  1HBU B;  4MT1 A;  1C1C A;  1KTV A;  3G6X A;  3GFH A;  1QTM A;  1JX4 A;  3G8Q A;  4HI2 A;  1WEZ A;  3PYD A;  1TKX B;  4AFF A;  3DNC A;  3MK2 A;  5GME A;  1LV5 A;  2BV3 A;  2HHU A;  4Y28 C;  2GSO A;  1IKW B;  4DG1 B;  2CPZ A;  2IVM A;  4CLL A;  5CYJ A;  2ABY A;  4JYA J;  2YKP A;  1RJJ A;  5KFQ A;  1Y5L B;  4DF8 A;  4P72 A;  3KLE A;  4K4W A;  5HAN A;  4GO7 X;  2IJR A;  4FP9 A;  5DQH A;  3TEH B;  1OWX A;  2H5E A;  1FKO A;  1R27 B;  2EK1 A;  5JXS A;  2DHG A;  3PJ9 A;  2BKO A;  4LFB F;  2ZD1 B;  2DXD A;  3MUT P;  3KLG A;  2FC9 A;  5IT4 A;  1UA1 A;  4FDF A;  2CNN B;  3GJT B;  3MUV P;  2HEK A;  3MEE A;  2RHS B;  3CNQ P;  2KRB A;  3EZO A;  2OPP B;  2R7V A;  2YQ3 A;  1RTJ B;  2HK2 A;  1UP1 A;  4M5L A;  3AHP A;  4M8L A;  2ZH4 A;  1SBR A;  3WAX A;  3UO0 A;  4GTZ A;  3MD1 A;  2KXH A;  4OZ5 A;  1YIT S;  1B64 A;  4RX6 A;  4BLG A;  2N4D A;  4R25 A;  4RNO A;  3NKM A;  2VFT A;  4FXD A;  2G4B A;  3KG1 A;  3G82 B;  1RTI B;  3EUN A;  2GAH C;  3ZZZ A;  3BYR A;  3GB0 A;  4DQR A;  1FEH A;  3VQT A;  3M2V B;  2OPS A;  2E1R A;  2VPW B;  3I0R A;  4RBT A;  3QYY A;  1SL1 A;  2AIR B;  4O4R A;  4NML A;  2RD5 C;  3JTO A;  1PG5 B;  3DMJ A;  3GR0 A;  2AEF A;  2JRS A;  4C11 A;  2MKH A;  2R8I A;  3QAT A;  4WJB A;  4B3O A;  1ULR A;  3ET6 B;  5E3P A;  3TQ1 A;  5CYM B;  3E3X A;  2DXE A;  3UI3 A;  2P8I A;  3QLH A;  1GMV A;  2GML A;  4HTJ A;  4O4G B;  1H2V Z;  2MLX A;  3MM5 B;  1U2C A;  4OI4 A;  2AEM A;  3FBC A;  1S9E B;  2R2S A;  2NXE A;  4NMX A;  1TK0 A;  1U02 A;  2KYZ A;  2OTL S;  1JNZ B;  4FYX B;  1W7W A;  3PW0 A;  5KOX A;  2N7Y A;  1UFW A;  2GHW A;  1K9M T;  3C6U B;  2UUW A;  1HNV A;  3BM7 A;  4FF2 A;  1T9X A;  2MJU A;  5D4O A;  1REG X;  4RUC A;  1NB7 A;  2DYA A;  3CPW R;  1FSU A;  2G0C A;  3EZU A;  1DFD A;  1TL5 A;  2PFD A;  3K2Y A;  4JI7 F;  1RAO A;  4M94 A;  2AGO A;  4N7T A;  4ZCL A;  2MY8 A;  1XR5 A;  1BD6 A;  2BDP A;  5IT9 Y;  3X3U A;  2KB2 A;  3LP1 A;  4UZB A;  1YZ6 A;  4AL6 A;  4CLS A;  1S1T A;  2DB1 A;  2QJ3 A;  3KG4 A;  3RAX A;  4IYQ A;  3P6Y C;  2CQ3 A;  3CD0 A;  2XBP A;  3M9N B;  2HW3 A;  3OVB A;  5A2Q U;  3GIM A;  2JLF A;  2FC8 A;  2DR7 A;  4DR5 J;  1IR0 A;  3DOK B;  4X84 A;  4I2Q A;  2RQM A;  3BRE A;  1PBA A;  3LGN A;  1QD1 A;  1VC0 A;  4FYV B;  5B7W A;  3LWL A;  2AP6 A;  2ADC A;  2W5T A;  4GMK A;  2HZC A;  1VQM S;  5K8O A;  1SUQ A;  2LU2 A;  1NHK L;  3NKN A;  2UXB F;  4DFP A;  3TUJ C;  3TAP A;  2HHW A;  3RBZ A;  1HR0 F;  3CC4 S;  1WSR A;  3DDI A;  2HGL A;  3NY0 A;  2HUR A;  3V81 A;  2OD6 A;  1RA6 A;  3HK2 A;  2B9E A;  2B7C B;  4JUZ A;  2QTW A;  1W2B R;  3ZZO A;  4MK8 A;  1HNZ J;  4IH6 A;  4KFB A;  4ECW A;  3VAF A;  1HKA A;  4DX5 A;  4ZHR A;  3GII A;  5J1E A;  3QID A;  2RDJ A;  1SJF A;  4JOU A;  3JB9 k;  4ZN3 A;  3AD8 C;  4CI0 B;  4F3O A;  5D0R A;  4NCA A;  5IOL A;  3CJ5 A;  3MM7 B;  3FSX A;  3I5C A;  3GJR B;  1AUK A;  2HLT A;  1KC8 T;  3N79 A;  2IIH A;  1PJ6 A;  2VDH A;  1HI1 A;  4P73 A;  3HUL A;  2D74 B;  1IBC B;  1IBK J;  3M2U A;  2CNO B;  1OYE A;  1NND A;  3CD6 S;  2XGQ A;  4RW8 A;  1X4C A;  3NWR A;  3BSO A;  1ED8 A;  3N01 A;  2VA3 A;  2P9E A;  4ECZ A;  3V4I A;  1KP6 A;  2CPI A;  3HSJ A;  3HFV A;  1XTZ A;  2V2Z A;  1RKJ A;  1DLO A;  1FRK A;  4ZLJ A;  3PM9 A;  2RE1 A;  2VH7 A;  1WC6 A;  5HJX A;  4YR0 A;  1M5P C;  3A3O B;  2GJ2 A;  4F0M A;  2FLO A;  1O6X A;  2QL7 B;  2ZJR Q;  5M2P A;  4C8L A;  2NXC A;  1H3D A;  2MEW A;  3W5Z A;  3BPD A;  4OIX A;  2G0I A;  1JLC A;  2BMB A;  1KLM A;  1EB0 A;  1ZM9 A;  5D6G A;  5LRM A;  1PYT A;  5L8R C;  4KV8 B;  1V5I B;  3BDH A;  3QRQ A;  3M6U A;  1CJK A;  5SUH A;  3BGR A;  4RW4 B;  4M95 A;  3VGS A;  3JS9 A;  2FD2 A;  3QZ7 A;  4OMF G;  4YB6 A;  2H5I B;  4OI1 A;  1UET A;  3T19 A;  4C8N A;  2W5X A;  2FJX A;  2NPF A;  2PC6 A;  4FDI A;  5GAE I;  2MSS A;  1T03 A;  2YWG A;  1Q5Y A;  5KXA A;  1PC5 A;  1LXJ A;  1S97 A;  4DL4 A;  1WHY A;  2Z56 B;  3PW2 A;  1N5Y A;  1BXN A;  2NQP A;  4CO4 A;  2R9L A;  4P2F A;  2IRY A;  1UW4 A;  2XRG A;  3JYT A;  4ETZ A;  3TWZ A;  3TQE A;  2CQB A;  1IQZ A;  2RQC A;  4FKX A;  2DR6 A;  1X5S A;  3T6B A;  4OYZ A;  1M0S A;  4Z7C A;  4K4Z A;  5E7O B;  2ILZ A;  4LBI A;  2AJF E;  3K5N A;  1BHN A;  4ZCI A;  2Y1R I;  3PKY A;  1WC4 A;  3AAW B;  1XNR J;  4NLW A;  4OI3 A;  1VDH A;  1FK9 B;  4ZPA A;  3Q8P B;  1KH7 A;  1RBO B;  2F40 A;  1SI9 A;  1T9T A;  1U6Z A;  3MR3 A;  4NEZ A;  3A13 A;  4C4W A;  3CCT A;  4F4W A;  1IKV B;  1CS4 A;  2MKK A;  3OXG A;  2NR0 A;  3ADA C;  1Z2Z A;  5DLT A;  4B3T F;  2C3M A;  3GON A;  2MKY A;  2GC8 A;  4U8V A;  1X4B A;  2R7Q A;  1R89 A;  3R2C J;  4WKY A;  1U8S A;  2YWF A;  1RXO B;  4KO0 B;  1TQL A;  2XM3 A;  2CZV C;  4I6W A;  5I4M A;  2J9C A;  3CCU S;  2G0J A;  1ARO P;  4PXD A;  3TVK A;  1KFD A;  1DTQ A;  4K2J A;  1XNQ F;  3CJ2 A;  2KG1 A;  3PW4 A;  3KK1 B;  2GZO A;  1Y3J A;  2W5Q A;  2R2T A;  3LWM A;  1VQ5 S;  5LOQ A;  3C6T B;  4PUO A;  3P3D A;  3C66 A;  4B17 A;  1PCA A;  1AJC A;  1VJW A;  2V5H G;  4UY8 5;  1HL6 A;  3PY8 A;  1R8H A;  1LWX A;  4OHV A;  1UWB B;  3I0S B;  3T1A A;  4J9N A;  1MWZ A;  3GFX A;  3B4D A;  1CJT A;  4S0M A;  2JNJ A;  1X4D A;  2DRA A;  4DR1 J;  1N54 B;  2MB0 B;  1QDU B;  4IFV B;  1QJH A;  4NCG B;  5F41 A;  3DYC A;  5J2N A;  4USW A;  3R7B B;  4J5O A;  3RJM B;  4GVB A;  3RBX A;  1SV5 B;  1JLG B;  3Q86 A;  4LF9 J;  2IVY A;  4CO3 A;  4KAY A;  1CUL B;  4LSZ B;  2UUT A;  3FSI A;  2HFV A;  3JQK A;  4NWB A;  1TAQ A;  3VGV A;  3BSN A;  2C28 A;  2BJD A;  2BXJ A;  1YHQ S;  3TAM A;  3OXF A;  3IR5 B;  3RR8 A;  2HQD A;  3GWC A;  4P71 A;  4IOA Q;  3DOL A;  2NS1 B;  3KKF A;  2QIF A;  3OTC A;  2FYX A;  3Q8U A;  1D1U A;  4UQG A;  4XDC A;  5F0U A;  2VQF F;  3M32 A;  1K7H A;  4G6V B;  4MFB B;  1NM2 A;  2I0X A;  4NZ0 A;  3I4P A;  1DHM A;  4EI2 A;  4CIO A;  3OJS A;  1NU4 A;  1RBL A;  4ECY A;  3TJA A;  4CLY A;  4IO9 Q;  3PG9 A;  3LAM A;  4JI2 J;  5D0E A;  2GSN A;  3QO9 A;  3DLL Q;  3UDV A;  1X4H A;  2EVZ A;  2H5J B;  4F3M A;  4F04 B;  1KLN A;  1J27 A;  4CM0 A;  2EFN A;  2OI2 A;  3VZH A;  3JTN A;  4FPR A;  4K59 A;  1IR2 A;  1DQ8 A;  1TKT B;  4DPT A;  2AD9 A;  2N7C A;  2GJI A;  4AL7 A;  3CUN A;  2RF2 B;  4NZ7 A;  5L1L A;  1Q4R A;  3R1L A;  2H4W B;  1TL7 B;  1TKZ A;  2BJ1 A;  4AND A;  2YKN A;  3QAE A;  1XJW B;  1RTD B;  1MWY A;  4DUZ J;  1RSC A;  3JAM Y;  4QWA A;  3A52 A;  3M6V A;  4J9R A;  3SSQ A;  3DGP B;  1CBK A;  4K4V A;  5D77 A;  1HWJ A;  2ZH8 A;  1KHK A;  3CCJ S;  1RT6 B;  3H2L A;  1ROF A;  1FVQ A;  2CVI A;  3MEG B;  5LMN J;  1YJ9 S;  1IBL J;  1WOO A;  2V9K A;  1TV6 B;  3PKM A;  3Q23 A;  2XZT B;  3O44 A;  4MMO A;  4DUY F;  4ED1 A;  3GR1 A;  3ZO7 A;  1SHQ A;  2DRD A;  1AA1 B;  1EX8 A;  4OQJ A;  2HVZ A;  2B9Y A;  4RR5 A;  1HHS A;  3K5P A;  1NZ8 A;  1RWU A;  2IYG A;  4ZG6 A;  2IVF B;  3PXG a;  4NYZ A;  4Q45 A;  1ZEF A;  5IQQ A;  4A4J A;  1CJV A;  2J9D E;  1RWO B;  4IH5 A;  4NPO A;  2M8H A;  4PG7 A;  4A8W A;  3HKZ D;  4NWJ A;  2H4Y B;  5GAH U;  2HHH F;  1QE1 A;  3OD2 A;  2CWK A;  3CD5 A;  5IZH A;  1I94 J;  1LW0 A;  4RUB A;  4USV A;  2FVQ A;  4LSL B;  3WX4 A;  5KFA A;  4YDX A;  4FBU A;  1WEL A;  2WB1 D;  1ZM4 A;  4A48 A;  2GVZ B;  1U2R A;  1SQE A;  2HIQ A;  3DLG A;  2E9Z A;  4OHX A;  4V19 J;  4PAA A;  1TKD A;  5BYR A;  2ZE2 B;  3N5B A;  1IBM J;  2R3V A;  2G2O A;  4F2R A;  2DNL A;  4PEO A;  4RL1 A;  3D7S B;  2W9A A;  4M5I A;  1SH0 A;  4IDK B;  5IQ6 A;  4RWX A;  3CDE A;  2MJN A;  2XMW A;  3RW6 A;  2CFX A;  1KHJ A;  1S0V A;  2MZT A;  2FHK A;  3QNW B;  2AKW B;  1TVR A;  1NK8 A;  2YX1 A;  3FCW A;  1C0T A;  1UZD A;  2GQQ A;  1TZ0 A;  2MY7 A;  1VRU A;  3P49 B;  2FLN A;  2I5J B;  2A18 A;  2LQB A;  4ETX A;  1B0T A;  2UUA F;  4QIV A;  2XQC A;  1PBU A;  2M88 A;  4DV2 J;  1SQF A;  1N6Q A;  2BRL A;  2LA6 A;  2AJ0 A;  3AY0 A;  4DS4 A;  2KRR A;  4OJG A;  3UN5 A;  2JEI A;  3DC2 A;  3WX8 A;  1RHR B;  4HHJ A;  2NPI A;  2ZBC A;  2HHX A;  5J2M B;  2F3J A;  3T1H F;  3TR5 A;  2QLJ B;  2FJV A;  2FLL A;  5T41 A;  1EJJ A;  2OLW A;  2AW0 A;  2XMT A;  5CZV A;  2ACM A;  5IWA J;  3FMW A;  3BKF A;  4K4T A;  1U09 A;  4TNO A;  4IFY B;  2BYC A;  1SJ3 P;  1FVS A;  1WC0 A;  1B7Y B;  3KNA A;  2VQR A;  5AXN A;  4HHH A;  3GIR A;  3NKQ A;  4O44 A;  4CLK A;  4C0H A;  1RI7 A;  4H4K A;  1UMJ A;  4RW6 B;  4U7U D;  5B09 A;  4DV0 J;  4QWD A;  3LP2 A;  5A0Y A;  2CPD A;  1BQM B;  5K8M A;  2LXI A;  4NYO A;  2BOA A;  5HRT A;  2ASY A;  1YSJ A;  5AXK A;  4MH8 A;  4KPC A;  3EWG A;  3WDO A;  3DRX A;  3M6X A;  4KTQ A;  1NRK A;  2JSX A;  1LWF A;  4LFB J;  3VAK A;  4OYO A;  1FHT A;  4YDD B;  3CJR A;  3ZZY A;  4WTY A;  4P52 A;  4O3P A;  4WFY A;  4CWB A;  4B9U A;  4Q2L A;  3THT A;  1RU2 A;  3BDE A;  3RB4 A;  3RU0 A;  2MZ1 A;  1U45 A;  1WNE A;  2EC2 A;  3V2U C;  1TEL A;  2FJE B;  1QSS A;  2KN4 A;  2V68 A;  3RB0 A;  2HQG A;  2DGU A;  4ELT A;  1HIY A;  4G1P A;  4HTI A;  2LU1 A;  5H9F K;  4YY3 J;  1SC1 B;  2MKC A;  4ZOS A;  1FTC A;  4C6A A;  1VRT B;  3IWX A;  1PKU A;  3SZY A;  1UCN A;  4ED0 A;  4NLD A;  2YVS A;  2BJ7 A;  1PAU B;  2ATC B;  2LEB A;  4K8R A;  1HW9 A;  4U6P A;  3AQP A;  2KVI A;  1MML A;  2V4J A;  4NE9 C;  5I3U A;  2CXE A;  3THV A;  4IRC A;  2B5J A;  2XLJ A;  1HBU A;  3J7Y I;  1M1H A;  5C24 B;  1WHW A;  4P7V A;  2B8Q A;  4KBI A;  4M5D B;  3QRR A;  1IKY B;  4USH A;  3S7R A;  1TKX A;  1KEK A;  2PII A;  1PIL A;  3T3F A;  2HWT A;  3MPU B;  1V9O A;  1XK8 A;  2GMJ A;  1IKW A;  4DG1 A;  1HWI A;  1VQP S;  4RNN A;  1N0U A;  5F8I A;  1D0E A;  1O8B A;  1GQE A;  1N34 F;  1IR1 A;  3FGV A;  3MOZ A;  4O0I A;  2QLF B;  3D0H E;  5B0D A;  1IXK A;  3SEO A;  2GCF A;  5KTQ A;  4IOB A;  2GA7 A;  4FNI A;  1AJD A;  1Q8L A;  1ELO A;  2B8P A;  4ZP8 A;  2ZD1 A;  1UEK A;  5CA5 A;  3THP A;  3W5X A;  3MEC B;  3AT1 B;  3HFK A;  2D1C A;  4WU3 A;  4JI7 J;  3V6K A;  3PDN A;  2OIH A;  1UEV A;  2HS4 A;  4HAC A;  5KT6 A;  4QIF A;  2VUG A;  2PO4 A;  1U7L A;  2OPP A;  4CZC A;  4KIA A;  1YWX A;  1H38 A;  1RTJ A;  3RG6 A;  4Y65 A;  4F7V A;  3NEK A;  3DDK A;  3QJJ A;  4A46 A;  2Q6B A;  1KWM A;  1S7I A;  1M5K C;  4R8U B;  2QT7 A;  1UVI A;  2IC3 B;  5KFG A;  7FDR A;  3CIZ A;  5B08 A;  3G82 A;  1RTI A;  3A8J A;  1T9U A;  1UZH A;  2HVD A;  3UQS A;  4CYS A;  3ZTO A;  5IS2 A;  4GKK J;  3TAN A;  2BE7 D;  1HR0 J;  3R97 A;  5GAH I;  3LA0 A;  2RQK A;  4BBY A;  1HBO B;  4KGM A;  2BM1 A;  3ILI A;  4DSJ A;  3GCW P;  1U8W A;  2J0S D;  4OHZ A;  3C2P A;  1RU1 A;  4PG5 A;  3OW2 R;  2GIF A;  3K89 A;  5H9F J;  2FZC B;  1BY9 A;  3ET6 A;  4H4O B;  3BPS P;  4N47 A;  1RWP B;  2AMC B;  5KFH A;  5D8H B;  1AXQ A;  2MQ8 A;  4DDF A;  4O4G A;  4P2M A;  3NCP A;  2X1B A;  3AA9 A;  3MM5 A;  3I9Z A;  3G87 A;  2MPU A;  1S9E A;  4XK8 C;  3FJ2 A;  4B3S F;  3L7P A;  4ILL A;  5LXR A;  5E2Q A;  1NEE A;  4ECX A;  3D54 A;  2Z2M A;  3J7A 1;  1GH8 A;  1Y0H A;  2IBK A;  4MJK A;  4HT5 A;  2XWY A;  3HHL B;  5DM7 Q;  2AV5 A;  2Z2L A;  4GTX A;  4DX8 H;  8ATC B;  4YFU A;  2D3U A;  4MIW A;  3NKY A;  3Q8Y A;  3CDU A;  1JJH A;  1N88 A;  4NLP A;  4ECT A;  4WYW A;  4RBV A;  3HSD A;  3NKO A;  3KD8 A;  1LQ9 A;  1TL1 B;  2VPY B;  1AUD A;  2DR9 A;  4ZN1 A;  3DOK A;  3DGV A;  1ACM B;  4WCE Q;  3K8V A;  1RT1 B;  4O3N A;  2VKZ G;  4EZ6 A;  1WI6 A;  4Y00 A;  1XEZ A;  3R5D A;  3UVJ B;  2I2Y A;  4CLP A;  4DXL A;  3C14 B;  3TI0 A;  1VR6 A;  1FRM A;  2KT5 A;  4Y34 A;  3IGN A;  1NH7 A;  2XI2 A;  2QGF B;  3I82 A;  2E9R X;  3H2U B;  4DCP B;  2RAQ A;  5E3A A;  3U1N A;  5AE1 A;  4TY8 B;  1SC4 B;  1G6B A;  2DNM A;  5D3G B;  4TLR A;  2EC0 A;  2I38 A;  2BJ3 A;  2R7R A;  1FT8 A;  2IRU A;  3UCU P;  3GG1 A;  5D4P A;  4JI1 F;  3KLE B;  4ED6 A;  1NK6 A;  1CQN A;  2W2P P;  1GEH A;  1WOS A;  5MAO A;  4ZVG A;  2NXJ A;  3PIP Q;  3WIU A;  3W64 A;  4WBF A;  3E2D A;  4DQS A;  4EBC A;  3CCL S;  3Q8V A;  4NYP A;  5IXU A;  3T02 A;  3QJP A;  4USM A;  1XIQ A;  3I4H X;  1S72 S;  1JLF B;  3LQV A;  1NPR A;  2RML A;  2CZ9 A;  4AXI A;  2AYG A;  5LMU F;  5M2R A;  3MDF A;  3BBF A;  2YKM A;  1RBA A;  1L3V A;  2B9X A;  2FHM A;  4NRT A;  4QW9 A;  2HBZ B;  2LQ5 A;  3CMR A;  1WJ9 A;  9RUB A;  4B3T J;  1RHJ B;  2UXC F;  3QZ8 A;  4LF5 J;  1ZAV A;  3PW7 A;  2JFD A;  2CPX A;  2XY5 A;  1BMQ B;  4DEZ A;  5KT5 A;  2V2K A;  1NH8 A;  4QAX A;  2XLK A;  4KV8 A;  1VRQ C;  3H20 A;  1ZEB A;  1L3K A;  3SXL A;  4RW4 A;  2JEG A;  1X5T A;  3AOC A;  2IHR 1;  1VQ4 S;  3R5B A;  2FVC A;  4WFB Q;  1EQM A;  4L3N A;  4TU9 A;  5CH7 B;  5K8N A;  4DSE A;  2W7O A;  3AD7 C;  1EET B;  2ZC3 A;  2BBE A;  2I8E A;  1KHL A;  1NSQ A;  2LEC A;  1WAC A;  4FYW B;  4OYX A;  2NRE A;  2POK A;  5DDQ C;  4MAK A;  2OSQ A;  2YKA A;  4OZJ A;  4JYA F;  4HL9 A;  2DNZ A;  5KG3 A;  1RB0 A;  4I67 A;  4ES3 A;  3KJF B;  2X7I A;  1ALH A;  3EXY A;  1LKZ A;  4KHP F;  1M5V C;  3K58 A;  3NWG A;  2P6T A;  2MLY A;  3T01 A;  1XBW A;  2QL9 B;  5F9L A;  2DXF A;  5KT7 A;  3EYZ A;  1S9F A;  4J9K A;  1HA1 A;  1F5A A;  2VG7 B;  3Q8R B;  2JVR A;  3W63 A;  4XDD A;  2RHQ B;  3HCX A;  1U2F A;  2MQL A;  1FK9 A;  5JJB A;  4KJG A;  1A0O B;  4JI0 J;  4WU2 A;  3T41 A;  3EPI A;  3CO0 P;  2E5H A;  3MFH A;  2G1H A;  2V9W A;  1N2L A;  2ZJQ Q;  4DF4 A;  3G86 A;  1DUR A;  3WAY A;  1IKV A;  5F8G A;  3KLH B;  2XO7 A;  1D8Z A;  4DV5 F;  3DN9 A;  3CCR S;  4CYU B;  4NLO A;  2V34 A;  4CDI A;  3AOA A;  3VHQ A;  3L3C A;  1F1B B;  1RE1 B;  5HI7 A;  4FXV A;  2CYY A;  3OSN A;  4ZIT A;  1WD6 A;  4KO0 A;  2FJD B;  5E0O A;  3KJQ B;  1DBD A;  1O51 A;  5HVH A;  4Y3C A;  3TX0 A;  1RP5 A;  2JX2 A;  2VHG A;  3NG8 A;  3K57 A;  5HLF B;  5EN1 A;  5DG9 A;  1MW7 A;  3KK1 A;  2QFJ A;  1H74 A;  3H90 A;  3NLC A;  2DGX A;  4CO2 A;  5HMW A;  2FGC A;  2ZZN A;  4KM4 A;  3C6T A;  3DRR B;  3MUM P;  1VJQ A;  2HBR B;  3W7B A;  1AW0 A;  1FER A;  2MST A;  1PO6 A;  1E1Z P;  1FKA F;  1UWB A;  4EO8 A;  1LNQ A;  4OV1 A;  4J91 A;  4R0J A;  5FDL B;  5CXT A;  4YP3 A;  3NS7 B;  4QWE A;  1FFG B;  3C16 B;  2WBR A;  5F9N A;  1F60 B;  2W5V A;  5K9F A;  4O3R A;  4X4P A;  1EKR A;  4IFV A;  1WUU A;  1S0M A;  4NCG A;  1FES A;  2F4V J;  1NJI T;  3VCD A;  2IRX A;  1G1X A;  2NYI A;  1AZS B;  2IM1 A;  3M7V A;  2EK6 A;  1SV5 A;  1JLG A;  3OSP A;  3IAM 9;  1PAE X;  4F4X A;  2PEH A;  3FDS A;  1K0V A;  1CUL A;  3MMC B;  3GTY X;  2VBW A;  3PRV A;  1YG0 A;  3B82 A;  4KQZ A;  4DUY J;  4OYW A;  2VDI A;  4CXU A;  2G9O A;  4M5G A;  2I6W A;  2OFH X;  3JQJ A;  1JWW A;  1JB0 C;  5KT4 A;  2XSF A;  2WVC A;  4WZM A;  2JDJ A;  4EUV A;  1OY6 A;  3VTI A;  1S48 A;  1NK0 A;  2DR5 A;  3PX4 A;  3EGV A;  1FKP B;  3H4D A;  2ZBQ A;  3SDE B;  4MFB A;  2DGS A;  5KT2 A;  1FWK A;  3M2R B;  1X4F A;  2HHH J;  4Q8E A;  1ZAX A;  4TQR A;  4Y6I A;  2YWH A;  3T6J A;  1TUG B;  3BGR B;  1IN0 A;  3FCH A;  2RIL A;  1T11 A;  1KVK A;  1VHF A;  4ZVQ B;  3T9N A;  4DU8 A;  3K17 A;  2DIV A;  1S49 A;  4OHW A;  2MZJ A;  4J9U E;  3JXO A;  1Q8K A;  2DGO A;  2B6A B;  1TKT A;  2XZW A;  3PZP A;  1IKX A;  2C2R A;  4GTW A;  2FVR A;  1V5V A;  2RF2 A;  2QA2 A;  1N5Y B;  3US5 A;  2KHD A;  1O99 A;  1UJ6 A;  2AYB A;  1TL7 A;  1VHI A;  1P1T A;  2MKJ A;  2YNH A;  1B70 B;  1RTD A;  3PX0 A;  2OHD A;  4UPH A;  1R6V A;  4YB5 A;  4X4V A;  3MCS A;  3KG0 A;  4P74 A;  4ZJO A;  1RWW B;  2W5R A;  4DUT A;  3DGP A;  4DPU A;  2ZUG A;  1NK4 A;  3NVL A;  3L09 A;  3PX6 A;  3CCZ A;  4KJI A;  3MEG A;  1RT7 A;  4HLB A;  5HMX A;  1X8D A;  1TV6 A;  2DGT A;  2WSE C;  3AB4 B;  4UUW A;  4JI6 J;  4TYA A;  3OL9 A;  5D4N A;  2LCW A;  4M63 A;  3M8S A;  2RUS A;  2BQU A;  3NS5 A;  1O98 A;  3IRX B;  4UPL A;  1NJZ A;  2MKI A;  1WOR A;  1VK8 A;  3D2W A;  3UFC X;  3OHA A;  3MCO A;  3T1H J;  2XZD B;  3VAL A;  1CVJ A;  2KHC A;  3PR5 B;  1R8C A;  4WP3 A;  3CVK A;  4FYD A;  5KG1 A;  3BB5 A;  1AUS L;  3TNV A;  1HJK A;  1X4E A;  1FXR A;  3H98 A;  1I3O B;  1E6V B;  1T05 B;  1G2E A;  3BEG B;  2ZEJ A;  4ANE A;  4KYZ A;  1GX6 A;  1TP7 A;  2QYG A;  3ONQ A;  2E5L J;  1SVD A;  4LSL A;  4Q2M A;  1OIA A;  4PUO B;  4ED7 A;  2GVZ A;  2M7S A;  2CJY B;  1X9M A;  2QZ8 A;  3DRS A;  3WHI A;  4X4R A;  4J9S A;  2NUH A;  2KH9 A;  3AFG A;  1MRO B;  2CQC A;  2X1G A;  2ASJ A;  2EWH A;  4AXJ A;  5F8H A;  2OGU A;  3HXM A;  3H5S A;  4QR1 A;  1RAG B;  2E44 A;  4IDK A;  1LK5 A;  1ZAW A;  1TU0 B;  4K4U A;  4X4S A;  4PXB A;  4DV1 J;  4FVM A;  5BYQ A;  3BR9 A;  4PWU A;  4ED2 A;  1FI4 A;  1Z2L A;  1Q79 A;  2VPZ B;  2DHA A;  5L9N A;  3LAK A;  1XNR F;  4LVO P;  2I5J A;  1JQG A;  4YS2 A;  2D69 A;  2W9B B;  4DPY A;  1MNE A;  1VBK A;  1RCX B;  2MXY A;  2FJB B;  3IBC B;  4O23 A;  3M9O B;  5DDO C;  5KFZ A;  2I1R A;  3TAM B;  4MHX A;  2HS3 A;  5KFY A;  4YN3 B;  1S99 A;  3PFO A;  4ED3 A;  3FSY A;  1CC7 A;  2UUB J;  4C9D A;  2B51 A;  4ICL B;  4EYI B;  1A7G E;  3EVO A;  1APS A;  2CJK A;  3M1V B;  3WQP A;  2OJ3 A;  2R7T A;  2JEJ A;  1MSW D;  4KT0 C;  4IFY A;  4C8O A;  1CC8 A;  4C3K A;  2GAG C;  3PRD A;  4LUB A;  5HQL A;  3DHW C;  4F8R A;  3HZG A;  5EGH A;  2W8L A;  1F9E B;  4FS2 A;  1RT4 B;  4WK3 A;  5KFN A;  4RW6 A;  2BKP A;  2ZNY A;  2R7W A;  4F26 A;  4NI2 B;  2ATL A;  4RPF A;  2UZA A;  5DZ7 A;  3GMG A;  1N34 J;  2A6O A;  4IR1 A;  2E5I A;  3MR6 A;  3OFE A;  1FE0 A;  1TKZ B;  2R8J A;  5HK4 A;  1B4S A;  5HVF A;  5C42 B;  4DR1 F;  1HQA A;  1M90 T;  5L46 A;  2O3D A;  5KG2 A;  3HO1 A;  1SKW A;  5IT9 U;  5EX0 A;  4Q8F A;  3K0J A;  1HNW F;  2OFG X;  1H2T Z;  4EBD A;  4RJV A;  2O67 A;  4RNM A;  2RH6 A;  1RAD B;  1BWE A;  3LW5 C;  2COL A;  2ZOM A;  2DVI A;  2KT2 A;  2ZHO A;  2CQ4 A;  1F5B A;  4LF9 F;  4DWI A;  2X1F A;  2IAJ B;  2RT3 A;  3BO4 A;  1S6Q B;  3MM9 B;  2EG1 A;  4FVC A;  4NLS A;  4RLE A;  3KUG A;  1VRT A;  4NX9 A;  1C0U B;  2KG0 A;  2Z4P A;  2CPY A;  1W26 A;  2MHE A;  4CO5 A;  4DSF A;  4TYB A;  2PSZ A;  3WZ0 A;  3BBC A;  2LXU A;  3IRW P;  3DLK B;  1RLD A;  4GKJ F;  4N8O A;  4CLU A;  1CJV B;  2JFK A;  3MM6 B;  3T00 A;  1X9W A;  1IJE B;  2DH7 A;  2KXN B;  5BYS A;  2KTQ A;  4PKD B;  1ANJ A;  3VAG A;  2A10 A;  3CDA A;  2K7J A;  2ZDO A;  2GVD B;  4LF4 J;  1RWK B;  5C24 A;  2BJ9 A;  1SKU B;  4M5D A;  1IKY A;  1S9G B;  2RH3 A;  5EWF A;  4NXN F;  1QAY A;  4UOP A;  1N5T A;  3BR8 A;  3L7O A;  4NLV A;  2Q1L A;  3NGR A;  1B0V A;  4B02 A;  3AA8 A;  4UST A;  4B9T A;  1N36 F;  1HQU A;  4B3S J;  4LRC A;  5I42 B;  2J0X A;  1S5Z A;  4DR6 J;  1R0A B;  5ETT A;  1KHV A;  1HD0 A;  4P10 A;  3W66 A;  1QSL A;  1RGV A;  3DRY A;  2LXF A;  2DBB A;  2XUL A;  4KAI A;  5F0W A;  2VA2 A;  1V3R A;  1LOU A;  1SXL A;  2FIU A;  1KH9 A;  5HN0 A;  3ELH A;  3ICL A;  2J7U A;  3EM1 A;  4IO1 A;  1JMT A;  5HBM B;  4L72 B;  1TK8 A;  3CCE S;  1S1W B;  1FJC A;  1IBL F;  2CQ0 A;  2NSB A;  2E7X A;  1FE4 A;  1MMD A;  1ZA1 B;  4QU7 A;  3EPG A;  2IFX A;  3ENQ A;  2ZC4 A;  2HVH A;  1E6Y B;  4R8U A;  4AQY J;  2WTF A;  2IC3 A;  1Z1Z A;  2CJA A;  4CP5 A;  4X65 J;  2V2Q A;  4RW9 B;  1S7H A;  3W61 A;  1Y00 A;  2ASL A;  5LSR A;  4LRA A;  4WII A;  5KFX A;  1FA0 A;  2ZOG A;  2CAD A;  1U1R A;  4LF1 A;  5AJ9 A;  2E7V A;  3JSR A;  1HYS B;  3DU5 A;  2QLW A;  3PAC A;  2LFV A;  2IBO A;  4WFZ A;  1T8E A;  3MPD A;  1PJ5 A;  3R27 A;  2U1A A;  1U25 A;  1HBO A;  3ZZT A;  4MIV A;  3VV2 B;  2BR0 A;  5F3T A;  4J9P A;  3R7S B;  1NBE B;  4WXW A;  4L75 A;  1I94 F;  4CT9 A;  1VQ7 S;  2V50 A;  4B08 A;  2V2V A;  4H4O A;  5DG8 A;  2KM8 B;  2R7X A;  1UFK A;  1S0N A;  4RUH A;  2AJ2 A;  3LF0 A;  1OS5 A;  2WW4 A;  2D3Z A;  3ZXW A;  3FFI A;  4JI1 J;  1SIZ A;  4UW2 A;  2W7P A;  3PO4 A;  2Y1L B;  3PYF A;  2F7V A;  3IG1 B;  2N4C A;  3MAA B;  3H5X A;  1XR7 A;  5JVH Q;  1VOM A;  3G6E S;  3FBB A;  4EBE A;  3LUY A;  1GAO A;  4RBU A;  3M4X A;  3FBE A;  4NWX A;  3HHL A;  1ELY A;  4M5M A;  2ALY B;  5LXY A;  1K47 A;  3FKB A;  2ANH A;  4KY3 A;  3TX8 A;  2ZVI A;  4NL5 A;  2GLQ A;  4EGL A;  2OO4 A;  1FJ7 A;  3E8O A;  4DSK A;  3FQK A;  2WSF C;  2WB4 A;  2ROE A;  2BM0 A;  4KGZ B;  1J5E J;  3IXQ A;  2IJF A;  1VCT A;  4CCH A;  1HWK A;  3GP9 A;  4ZPC A;  3ZZ0 A;  1IWA A;  3CC7 S;  1TL1 A;  2NYH A;  5BR8 F;  1Y10 A;  3LTO A;  1CJU B;  1N5S A;  2QG9 B;  3ENA A;  2UXC J;  4NLT A;  1RAA B;  3MF5 A;  2ZNZ A;  3MMA B;  4EK2 A;  1RT1 A;  1QM9 A;  2W7A A;  2C2M B;  2DY9 A;  2GGP B;  2C2Z B;  3UVJ A;  1JIH A;  3BH6 B;  5IWA F;  3C14 A;  1X0P A;  2ZBR A;  2W2N P;  3PO5 A;  2J8S A;  4IG3 B;  2OEL A;  1VQN S;  2ACY A;  4HDG A;  4V1A k;  4Z7Y A;  4TY8 A;  2C2N A;  4HEA 9;  3D66 A;  1S1U A;  3N28 A;  2D9P A;  5D3G A;  3WBZ A;  2FJW A;  2VL1 A;  2MQP A;  3TW0 A;  2VC0 A;  2Z30 B;  3QWU A;  4DV0 F;  4ANC A;  3K5O A;  1VMB A;  1VFJ A;  1HBN B;  2WSC C;  3ENV A;  1XMB A;  4KHP J;  2DNQ A;  2BEF A;  2XEX A;  2ZM6 F;  1HDH A;  3AOD A;  3HT0 A;  2JHE A;  4DV7 F;  3X1L B;  2Q6C A;  2A2D A;  2VBY A;  5K20 B;  2EKN A;  5INH A;  3C19 A;  5KFU A;  1WG1 A;  3D1O A;  3BDG B;  4DN0 A;  2FLP A;  4MIB A;  1JLF A;  4DL2 A;  3CT9 A;  3Q24 A;  5KAK A;  3U1L A;  4HAC B;  4TQS A;  3RRG A;  4ZP7 A;  4DN9 A;  3WC2 A;  2CJ9 A;  4PPD A;  3W9H A;  1VQS A;  3BGU A;  3LO3 A;  4ZCM A;  4HH1 A;  4ILR A;  4OLO A;  2HFO A;  2GIR A;  2QA4 G;  2MQO A;  1URN A;  4DV5 J;  4YY3 F;  2PMW A;  1UEU A;  4A47 A;  1OSD A;  2HHQ A;  1XWL A;  4H4K C;  3EJM A;  3O2I A;  4ZVR B;  1M1G A;  2HVI A;  4ZVH A;  4C0O C;  3T5L A;  2E5J A;  1RYS A;  2Y8W A;  5FD1 A;  2LDY A;  3EDQ B;  1LFP A;  5L38 A;  4MTP A;  4Z37 A;  3J80 Y;  3HHL D;  4F50 A;  2XMK A;  3OFH A;  2HZV A;  3HFZ B;  3TRG A;  2XSJ A;  2IUC B;  1RT3 A;  2J5A A;  4EZ9 A;  1BWV A;  1EET A;  3OL7 A;  3SZZ A;  2QE5 A;  3Q83 A;  3PCO B;  4I2P B;  3R1H A;  3R5A A;  4OYI A;  5A8W B;  1JLA B;  2LDI A;  4BC9 A;  3JAM U;  1GXL A;  2BE2 B;  3OR1 B;  3CJK B;  1HFE L;  3UDL A;  4C2M A;  4DR7 F;  2VOD A;  4USK A;  1WTB A;  3CWJ A;  3EXC X;  5U47 A;  1LWE A;  1NPK A;  2JEF A;  4Q0B B;  4M5J A;  3E51 A;  4HT7 A;  1T9W A;  2VG7 A;  1EKS A;  3IO1 A;  4JI3 J;  5H1S V;  3HHK A;  2OD4 A;  4KB7 A;  4X4N A;  1L3S A;  3BDF A;  3OFF A;  2XS7 A;  3TO8 A;  1S79 A;  4DZ6 A;  5IT0 A;  2JH3 A;  3HI9 A;  5LL6 d;  3IM9 A;  3R6G B;  3FRZ A;  2DJW A;  1FD2 A;  4NZ6 A;  1Y5N B;  2A2C A;  1S76 D;  2QMX A;  3UDC A;  1G4C A;  2NCK L;  2UXD J;  4OZL A;  3RAQ A;  1N48 A;  2CNL B;  3NS6 A;  1WEX A;  3J81 j;  3VGT A;  4J9O A;  3MTJ A;  1NO8 A;  3KLH A;  4LBH A;  4OZN A;  4CYU A;  2WOM B;  2OML A;  3LXQ A;  4P2S A;  1NK5 A;  2G2Z A;  3W8P A;  2ZWP A;  1I1G A;  1P27 B;  2RNE A;  4P2X A;  4U96 A;  3UCG A;  4GKK F;  4XTT A;  4B9M A;  1X5O A;  1SIW B;  5GOV A;  3QRP A;  5KFL A;  5HLF A;  3CE8 A;  2AX1 A;  2HFN A;  1RKI A;  2LQJ A;  3T5J A;  4PG6 A;  3SCL E;  4QZV B;  2UVW A;  2BAN B;  3DU6 A;  3DRR A;  3GIJ A;  3BO3 A;  5J2P B;  1ELZ A;  2BQ3 A;  3EIC A;  4FN5 A;  2W8K A;  2JZ5 A;  3B6B A;  2ZH3 A;  2ZVS A;  2PMH A;  2YKQ A;  3TVY A;  2VD3 A;  2HVE A;  1NSK L;  4ID8 A;  2FY1 A;  3T5H A;  1P8G A;  5FDL A;  1U6B A;  5LM7 E;  3CCQ S;  4QIW D;  3C16 A;  5KFS A;  4DSI A;  4Y2A A;  2JVO A;  4UOF A;  4XIU A;  4CH0 S;  3OR2 B;  2ZKT A;  3PR4 A;  3AD9 C;  4KC5 A;  1GT8 A;  2F8M A;  2HGN A;  4ECR A;  5H9E K;  1T3O A;  3W60 A;  1AZS A;  5ETQ A;  4HYK A;  2ZH9 A;  2Z58 B;  2YY3 A;  1HQE B;  2KKH A;  3OVA A;  5THW A;  5DGA A;  1U1Q A;  2XMV A;  1EP4 B;  1JK9 B;  5L39 A;  2YKM B;  2JJ4 D;  3DOM B;  3KXD A;  3MMC A;  1S10 A;  1GXT A;  4GC6 A;  2RU9 A;  2VJV A;  3N6L A;  4U67 Q;  2RU3 A;  2IA0 A;  1PYS B;  1GFW B;  3TYT A;  4NA1 A;  1VQY A;  3IMQ J;  2NLW A;  2VZ9 A;  3R5G A;  2CJB A;  5D0H A;  3C15 B;  1EAR A;  3PHT A;  5KFM A;  4TN0 A;  4LF8 J;  2DKO B;  4UPI A;  3KJN B;  1FWP A;  1CPZ A;  4DOZ A;  2IPO B;  4QOT A;  1HMV B;  1FKP A;  4FZV A;  3LP0 B;  3SDE A;  5FJ4 A;  5KFC A;  1GK8 A;  3M2R A;  3SI8 A;  3GJQ B;  1RK8 A;  2QLB B;  4ITS A;  4F2S A;  2C3P A;  3GYG A;  1EI6 A;  2XTJ P;  2MZS A;  2DT9 A;  3D3B J;  2OUG A;  3IBW A;  4J9M A;  2R7U A;  1Q8B A;  4MK9 A;  4GO5 X;  3QJL A;  1KKH A;  4UOG A;  2UV8 G;  3AOB A;  1ED9 A;  1GTE A;  1JXL A;  1N32 J;  3J81 Y;  1WI8 A;  2BAC A;  3PFE A;  5EX3 A;  2B6A A;  6FDR A;  4B3R F;  3I55 S;  2ZHA A;  2AF6 A;  4F4Y A;  1YVF A;  1YJW S;  1PSD A;  5ETO A;  2C1E B;  1F9H A;  3SMZ A;  5GAD U;  4IRK A;  3MGJ A;  5DRK A;  1ZM2 A;  1G3O A;  4UT4 A;  4BDP A;  4DJB A;  2EG2 A;  1RT5 B;  3W62 A;  1ITP A;  2VBX A;  2CPE A;  3OLB A;  4ZGA A;  2PGC A;  1ALJ A;  3QQC D;  4A8S A;  1YGY A;  1X0F A;  2VQE J;  3MXH P;  1U49 A;  2EFO A;  3QT7 A;  2HFS A;  1RT2 B;  1K1S A;  4X2B A;  3W5Y A;  4RU2 A;  3OTD A;  4PXC A;  7FD1 A;  1FD8 A;  4JI8 F;  2L9W A;  1X5P A;  4PZV A;  1FX4 A;  4UQT A;  1U24 A;  3IRX A;  3T5K A;  4LRE A;  2BQR A;  3SCI E;  1OQ6 A;  3RB3 A;  2HRY A;  2DGW A;  2O1P A;  5FLX Y;  2GFF A;  2MHN A;  2WW8 A;  4F67 A;  5H9E J;  4LF5 F;  2K06 A;  2DTJ A;  3KLF B;  1HHQ A;  3HKW A;  5ETL A;  1FRX A;  3KMS A;  3F73 A;  4YME A;  2R8H A;  3QT5 A;  1E6V A;  1T05 A;  1ZM3 A;  2X1A A;  1HNX F;  1K44 A;  2F63 A;  2KVQ E;  3TZZ A;  4W4M A;  1GMW A;  1L3T A;  3MMB B;  2CPF A;  2RS8 A;  2CJQ A;  1R8A A;  1U1P A;  2M4M A;  4QQB A;  1UW9 A;  2LLZ A;  2K2P A;  1F2G A;  3QGI A;  3BQ2 A;  2EXU A;  1MRO A;  3OLA A;  3EVM A;  3V6D B;  3Q2S C;  3EGN A;  1JKH B;  1J2V A;  1K8A T;  2VIC A;  3OL8 A;  3RAM A;  3N5F A;  1FX2 A;  4FF4 A;  5FII A;  4DMZ A;  5AT1 B;  1W2I A;  2BW2 A;  1KOO A;  2E1A A;  1HNW J;  3M6W A;  4AYB D;  1NKC A;  1JNR B;  1AB8 A;  1DTT B;  1U26 A;  2YTC A;  2IJN A;  4JV2 A;  2VOP A;  3HPO A;  4M5K A;  3WBH A;  4OFZ A;  1UKU A;  3A8K A;  3RZA A;  2DH9 A;  1BE4 A;  3CJT A;  5ETP A;  4X4Q A;  3RBE A;  3WAW A;  4QR0 A;  1ZPW X;  5A8K B;  4W92 B;  5IM0 B;  2L3M A;  4DLE A;  2W9B A;  2DCU B;  2LP4 A;  4JI0 F;  5HO4 A;  5AE2 A;  1YBU A;  3I9V 9;  5B0A A;  1ZET A;  2XCA A;  2DGV A;  2CVE A;  4DL3 A;  3V4M A;  2IY5 B;  1T95 A;  4ZVS B;  5KOW A;  1VLO A;  1NJW A;  1EW8 A;  5HQM A;  3CCS S;  3TUI C;  4HDH A;  4A8Y A;  4CLT A;  4ICL A;  3FUY A;  4FBT A;  2F65 A;  3B5Q A;  4GKJ J;  2JOQ A;  3M1V A;  2VBZ A;  3UD5 A;  4NRU A;  5IJQ A;  3GSI A;  4KAV A;  4OHY A;  3O6Q A;  3GSD A;  4NXN J;  2J7K A;  3T9Z A;  2IYI A;  1RT4 A;  3BSA A;  4I6A A;  4WP9 A;  2X3D A;  2QO3 A;  1N36 J;  4NI2 A;  3CB4 A;  3BGO P;  1N5Q A;  1IKX B;  2H65 B;  4WFA Q;  1A6L A;  3OBI A;  4R0E A;  2KJW A;  3IR7 B;  2R7S A;  4K7Q A;  1WWH A;  2H54 B;  4I0W A;  2MQQ A;  3MPY A;  4ZVF A;  4QPX A;  4CYR A;  4QWC A;  3OUY B;  2YNH B;  2XYG B;  3LAL A;  1FRL A;  4IQX A;  4YUD A;  1BQN B;  5DJB A;  3F44 A;  5C42 A;  2UUC J;  3W2W B;  4ID5 B;  1V6H A;  2Z57 B;  1VBY A;  5KFR A;  2ZBI A;  2F4V F;  3ED4 A;  2RDD A;  1RTZ A;  3CC2 S;  3H2V E;  4UPK A;  2W4C A;  1RT7 B;  1U1M A;  1SH3 A;  4IRD A;  1H0H B;  2HAF A;  2XY6 A;  1CG2 A;  1GMW D;  3NGT A;  4DBQ A;  2IAJ A;  2FHO B;  3HD2 A;  2XR9 A;  4FXW A;  1RLC L;  3FK4 A;  1S6Q A;  4Q7A A;  2N82 B;  4DLG A;  3MM9 A;  2GQC A;  5EDW A;  3NCR A;  4ED8 A;  1URA A;  4RWW A;  5KFW A;  1C0U A;  4NLY A;  4ZIW A;  1N56 A;  5F8L A;  2VG5 B;  1REV B;  2WON A;  2ZH1 A;  3N4W A;  3ISN D;  1N52 B;  2J6S A;  2DNY A;  5GMK a;  3BSC A;  3ULH A;  4FF3 A;  4PAB A;  3DLK A;  5KFP A;  2ZHB A;  1UVN A;  5G0R B;  2AYE A;  4K4Y A;  3MM6 A;  2DRB A;  1YBA A;  4ECQ A;  4F02 A;  1UFL A;  3QPI A;  1H72 C;  1S1V B;  3LPY A;  2HAI A;  4C8M A;  3PVX A;  2EFQ A;  3VQS A;  1ZTT A;  2WVB A;  4LF7 F;  1WTF A;  2GVD A;  2IDL A;  2Y9H A;  2MGZ B;  1RDR A;  4Y2I A;  1FNX H;  1E3C P;  3D5M A;  1S9G A;  1Y5I B;  2ADB A;  1ZTW A;  2VU5 A;  5C2G A;  2HWI A;  2ZUA A;  5LQQ A;  1FXD A;  4ZG7 A;  3ITH B;  4I7F B;  3DRS B;  1BGX T;  4DZD A;  2PMZ D;  5I42 A;  4ZVT B;  1JLQ B;  5E5N A;  5GAD I;  3BGF A;  1UJ4 A;  1R0A A;  5CYQ B;  1JXE A;  4I56 A;  2GA3 A;  5B0G A;  2LQ8 A;  2R8K A;  3AXK A;  4AT1 B;  2YNF B;  3TZX A;  3CIM A;  5E41 A;  1KQS R;  2AU0 A;  1JLE B;  4KRW A;  3A1Y G;  2Q3P A;  4PRF A;  2CQI A;  4QYR A;  5L0E A;  2NXN A;  2HNZ A;  2F9J A;  4OX9 F;  3DM2 B;  4EO6 A;  4DQP A;  2GQ2 A;  3PTW A;  3OHB A;  5HBM A;  4OX6 A;  3RBD A;  1RHK B;  4X66 F;  1S1W A;  2UVV A;  2N3O A;  3KHL A;  5BR8 J;  5E3R A;  3MTK A;  1OO0 B;  3MHY A;  4JI6 F;  1XMO J;  3A4T A;  2HG4 A;  1D09 B;  5AJ3 F;  4KE5 A;  4LFC F;  1E6Y A;  2CQ1 A;  4QJV A;  2DIT A;  2J0Q D;  2KXF A;  5HVG A;  4RW9 A;  2DD8 S;  2V8P A;  5CCL A;  3D68 A;  3VVU A;  1HD1 A;  2ZH7 A;  2A3J A;  1HYS A;  1T7P A;  4QW8 A;  2NZ4 A;  1BLU A;  3ILO A;  5B0C A;  1PYO B;  2DEJ A;  2DNH A;  3TJ8 A;  3EGZ A;  5DO2 A;  3ZNJ 1;  4Q5V A;  1VQO S;  4Y2C A;  3PYG A;  3NMR A;  3CF5 Q;  3MUR P;  2KU7 A;  4ECV A;  2CZ4 A;  4URQ U;  2FPH X;  2E5L F;  2B9W A;  3HX9 A;  3UR3 C;  5F3Z A;  2RQ4 A;  3D6F B;  3ZNU A;  1IM4 A;  2YWW A;  4U7C A;  1JJC B;  3H25 A;  3KWM A;  4YR1 A;  1KN6 A;  4TU8 A;  1L3U A;  1I6J A;  4USI A;  2JLE A;  2X51 A;  3WC0 A;  4ES2 A;  2ZM6 J;  3SYZ A;  4F4Z A;  5GAE U;  3UPF A;  4DV7 J;  4L76 A;  3IG1 A;  2HS0 A;  1YLX A;  5LT5 A;  2XNQ A;  3MAA A;  4DL6 A;  4A8F A;  1YDL A;  1WF1 A;  2MDA A;  4K2X A;  1RHQ B;  3VR1 A;  2YNI B;  2C3U A;  3D0I E;  2D3O 1;  1F2H A;  2R7O A;  3R5J B;  4ZVE A;  4DV1 F;  1WC5 A;  4C7Q A;  5KT3 A;  4RNH A;  3HDS A;  4KPY A;  4PWD B;  1YIJ S;  1KSP A;  4N76 A;  3QMQ A;  1RAI B;  1YRX A;  2QL5 B;  3Q89 A;  5KFE A;  1RTH B;  1DQ9 A;  1CJU A;  4DX6 A;  5F8J A;  1FDA A;  1EW2 A;  4RO0 A;  5L0K A;  3MMA A;  3KK3 B;  1SC6 A;  3HVT A;  3GG0 A;  4USU A;  2QN6 B;  1TAU A;  2UUB F;  3ZTP A;  4TU7 A;  2W9C B;  1WC3 A;  2RSQ A;  3OTO F;  2GGP A;  1C1B B;  4LQ9 A;  3PRB A;  2PDA A;  2HFZ A;  1NXI A;  3QWP A;  3D1Q A;  3ETM A;  2E1M C;  1EAY C;  2F9D A;  4PG4 A;  3KLI A;  3UWT A;  4IG3 A;  1L5U A;  4M1K A;  2LEP A;  4DFK A;  4WFN Q;  5IJS A;  1Q16 B;  1FF2 A;  4K0K F;  2E5G A;  2RS2 A;  2NZC A;  3VWS A;  2B4U A;  4KKO B;  2H3E B;  2HGM A;  2KDO A;  2AT1 B;  3ISZ A;  1X60 A;  5KG4 A;  4I4B A;  3R9L A;  4KSE B;  2ERR A;  1HQU B;  3C3L A;  4IH7 A;  4NXM F;  1VYA A;  4WTO B;  1HBN A;  4DR7 J;  2VAS A;  4DI6 A;  1NPP A;  1HLW A;  2W4P A;  3AJD A;  4NEY A;  2IMW P;  4F4A A;  1RAJ A;  1Q8I A;  3BDG A;  4O3O A;  2KFN A;  2MQN A;  2DR8 A;  4DV4 F;  3NP5 A;  3M8Z A;  4ZPB A;  2XMA A;  4PQU A;  1IJF B;  1RWX B;  1DAR A;  1Y6V A;  3V6J A;  1U4B A;  3R7N B;  4IQM A;  1TL3 A;  1S1X B;  1HQ2 A;  3MEK A;  1R31 A;  1CQM A;  5LSO A;  2V67 A;  4DL7 A;  3KHR A;  4J90 A;  3BQ1 A;  3CO9 A;  1S59 A;  3RGI A;  2QV6 A;  4DV3 J;  3ILJ A;  2AYM A;  5C7P A;  4CNY A;  5DG7 A;  2ZH2 A;  2BJE A;  1RZM A;  3IS9 B;  4H54 A;  3POT B;  4ES1 A;  1SHN A;  3QIP B;  3DLB A;  1ALK A;  2VV5 A;  3I96 A;  2LQ9 A;  1AYE A;  3AQO A;  5A6P A;  5DS7 A;  1KQG B;  1VC5 A;  2EEY A;  5L0B A;  3G96 A;  2W8S A;  3WIV A;  1EZZ B;  1I5O B;  1VK3 A;  3NXZ A;  5JMN A;  4LR9 A;  3AH6 A;  4LF4 F;  3KYL A;  2IUC A;  4OX8 A;  2Y1I A;  3HLU A;  2D3O R;  2R2U A;  4DHV A;  4I2P A;  4HI1 A;  3AB2 B;  2A1B A;  3U27 A;  5RUB A;  3CCV S;  2SXL A;  5A8W A;  1JLA A;  1WC1 A;  3JTP A;  3BH7 B;  2BE2 A;  3TA0 A;  4CNZ A;  3OR1 A;  3CJK A;  4ZVP B;  3FFI B;  2VB6 A;  2B7B B;  1P6T A;  1H98 A;  3BYP A;  3M30 A;  1R3N A;  4DR6 F;  4ALZ A;  2MYF A;  3CJ3 A;  3J7A N;  3ZZR A;  2Q43 A;  3DI6 B;  3I31 A;  3R6L B;  4QIG A;  4Q0B A;  3CD7 A;  4OX7 A;  3SSR A;  2K3I A;  4MY4 A;  2OEM A;  2DO0 A;  2XC9 A;  3EX7 B;  2IM3 A;  2CJX B;  5CAB A;  3D4J A;  1RHM B;  3NOG A;  4ECU A;  4PR6 A;  3CSK A;  1AT1 B;  1OPZ A;  2EFV A;  2DNK A;  1VBZ A;  1RIS A;  3R2D J;  3TP2 A;  2V8H A;  4OZ0 A;  4DR3 J;  2WOM A;  4AQY F;  4RNF A;  2HQF A;  4X65 F;  4B9S A;  4MKV A;  1SH2 A;  4ELU A;  5DQI A;  4RU9 A;  1WSV A;  4ZVO B;  1HHT P;  3M8Q B;  3GPA A;  8RUC A;  1D8Y A;  1YK9 A;  2D41 A;  2ZBP A;  3HHE A;  4BWM A;  1X9S A;  5D15 A;  4ZA1 A;  1C2P A;  1YTY A;  3BO2 A;  4CM2 A;  2R2R A;  4N41 A;  1FRI A;  2HQC A;  3DYA B;  4DPX A;  2OH2 A;  1XQI A;  2RJZ A;  4X62 F;  4J37 A;  3KUE A;  1QTN B;  2BAN A;  5JVG Q;  5J2P A;  1S1U B;  2HPU A;  4B3R J;  4OZ3 A;  4Y0F A;  1WHX A;  4G1Q B;  4K5R A;  2KT3 A;  2DY1 A;  2WVF A;  3GYN A;  5HJY A;  2HMI B;  2D1G A;  3I5B A;  2G1D A;  4OI6 A;  3TAQ A;  2H9Z A;  3UNY A;  2HKE A;  1P49 A;  3MMJ A;  4LRB A;  4WK1 A;  2YX7 A;  1FDB A;  1ZA2 B;  2BKN A;  2YNG B;  1XN9 A;  4A8X A;  1QSY A;  3BF4 A;  2EBG A;  3OR2 A;  1FRJ A;  3C8Y A;  2WVE A;  1CEZ A;  2XMU A;  1YZ7 A;  5A8R B;  4EEY A;  3J7Z T;  1MG7 A;  2OPR B;  1B99 A;  4DR2 J;  2PA3 A;  1M5H A;  4XO0 A;  3G8S A;  1PJ7 A;  3Q3Q A;  4UZC A;  2AZ3 A;  3KLV A;  1HQE A;  2CDR B;  3E2E A;  2KZZ A;  4ZLL A;  4JI8 J;  1EP4 A;  4LRF A;  2P5V A;  2FZG B;  4KH1 B;  4CLZ A;  3DOM A;  5CD4 A;  2HWH A;  4XPC A;  3P5T L;  1ZOT A;  1J5E F;  2AJQ A;  3EDR B;  3KHH A;  1LFW A;  4WKR A;  2RDI A;  2WRM A;  3KHG A;  1FRH A;  3W2V B;  2UU9 J;  2PN6 A;  3SCK E;  3LOU A;  4B56 A;  5DLF A;  1Q1K A;  1RWM B;  3C15 A;  1G7C B;  2MTL A;  1VQK S;  4X4U A;  4OYP A;  1K73 T;  1HMV A;  1Q82 T;  3LP0 A;  1NHU A;  3QGH A;  3F41 A;  2GNK A;  3P4U B;  3D28 A;  1HNX J;  1ALI A;  4RKU C;  1NDC A;  1XMQ F;  4FS1 A;  4CTA B;  3NGU A;  2LMI A;  3G2X A;  4XPE A;  2XSJ B;  3NGK A;  1RT3 B;  2GHV C;  3VZI A;  5KFF A;  2Q79 A;  2VFU A;  3DFE A;  4B9V A;  3HHL C;  2E7W A;  2DHS A;  5EUH A;  4WPA A;  2K1R B;  3ILL A;  4E2F B;  2KJV A;  3G6Y A;  4JI4 J;  3MK0 A;  2W8D A;  2C3O A;  1VQL S;  3CDW A;  3UN2 A;  2PD1 A;  4JV5 J;  5DZ6 A;  1AJB A;  3U7J A;  1WG5 A;  1LWC B;  1LWE B;  1RT5 A;  5C66 A;  4IG0 B;  2ZJP Q;  3QFH A;  2KFZ A;  1K1Q A;  4L73 A;  3N6M A;  4DR4 F;  4EMD A;  1XR6 A;  3TA2 A;  3TUP A;  1NME B;  3IDD A;  3NNH A;  5KFD A;  5ITH A;  1BC6 A;  1RT2 A;  1DZ5 A;  2E29 A;  2M9K A;  3CCW A;  4Q43 A;  3CJQ A;  4DQQ A;  2VPX B;  5KFI A;  3ZTR A;  2HRT A;  2ZZM A;  1B8J A;  3EE3 A;  2OPQ B;  1TFW A;  1VC6 A;  3MAQ A;  3D0G E;  2L08 A;  4OZ1 A;  4NA3 A;  3FC9 A;  2ROP A;  3DRP B;  3ZC4 A;  3MED B;  1ICE B;  3KTQ A;  5K5M A;  3B8H A;  1AFI A;  2RRB A;  3QGP A;  3IM8 A;  1KDN A;  4I6Y A;  3KLF A;  4NCB A;  1B3T A;  2QSW A;  4O3Q A;  5A76 A;  1RCO B;  1YKW A;  2OKQ A;  2YPZ A;  5DM6 Q;  5KFO A;  3ZTS A;  1YJV A;  3BS9 A;  3H40 A;  3CJS A;  2VG6 B;  2CA9 A;  1N4L A;  3MMB A;  2CKW A;  2ZZT A;  2VOO A;  1E2S P;  2C3Y A;  1RAC B;  1Q0N A;  5J1P A;  4LJM A;  5E33 A;  1RAF B;  4ERD A;  3J7Y U;  3HHD A;  2DHX A;  3OTE A;  2MQM A;  4WE1 B;  1VQ9 S;  2HIY A;  1KTQ A;  2HND B;  4MK7 A;  4M5N A;  5BJR A;  4DS5 A;  2H48 B;  4IKA A;  3OFG A;  1CLF A;  3M8Y A;  2B4V A;  3UD3 P;  3V6D A;  1JKH A;  2G13 A;  4MYT A;  1FJG J;  2B3T B;  4PXE A;  2W25 A;  4F3Q A;  4DFJ A;  2C22 A;  1FFW B;  3WAV A;  1OYD A;  2GMH A;  4AUK A;  1SJQ A;  4O0N A;  3CCM S;  3LGM A;  2AQ4 A;  1OMS A;  4RUA A;  3I87 A;  3C46 A;  5IV4 A;  3OJU A;  3MM8 B;  1DTT A;  3OXL A;  4LRD A;  2GSU A;  2L48 A;  3SV4 A;  1OPI A;  2RRN A;  3R5C A;  5GAG U;  3GJS B;  2WBM A;  3BKU A;  4JI3 F;  3RUB L;  4C3L A;  5A8K A;  5IM0 A;  3A3N B;  4C48 A;  1QY7 A;  1Z4U A;  2VFV A;  4BWJ A;  2YWK A;  1I51 B;  1N33 J;  4F25 A;  5J2Q B;  2F8E X;  2J8A A;  5C25 B;  1HI8 A;  2HLU A;  2WZ1 A;  4TXS A;  2UXD F;  3DLE A;  3M8W A;  3FMB A;  2LEA A;  2YXL A;  4OJ1 A;  4WF9 Q;  3ZTQ A;  4UTG A;  4C8K A;  5BXI A;  2C2E A;  2W2M P;  4QPT A;  3B54 A;  4WWS A;  4LSN B;  2BX6 A;  4X64 J;  4P6Q A;  3N0V A;  2Y0S D;  4ZPT R;  5HQ8 A;  3SFG A;  4EYH B;  2UV8 A;  5A2Q Y;  4LF7 J;  3GIK A;  2FVS A;  1NKB A;  2ZDP A;  3IR6 B;  3TA1 A;  1VIX A;  2CUY A;  3FQL A;  4A8O A;  2DNR A;  4QR2 A;  3HVR A;  2XWX A;  4F4K A;  5KFT A;  2HNY B;  4WYL A;  1SC3 B;  4L3K A;  2YWE A;  2Z2Y B;  1PC4 A;  4P9S A;  5EGE A;  1H6K X;  3QT6 A;  2M2B A;  1U0S A;  1LW2 B;  2V4R A;  5K14 B;  3OUY A;  3ETO A;  3O3L A;  1OY8 A;  4HVZ A;  1BQN A;  1UPM B;  3FZ2 A;  2FDN A;  3W2W A;  4ID5 A;  2KI2 A;  4ZMM A;  4YR3 A;  4OX9 J;  3PW5 A;  2W2Q P;  5IFM A;  2RKI B;  4UOH A;  2ZH5 A;  2MLZ A;  3QSI A;  1WDT A;  9ATC B;  4YOE A;  4X66 J;  1VQ6 S;  3Q8Q B;  2W2O P;  2JC1 A;  2QZU A;  2M70 A;  2G9Y A;  4ZLP A;  2BZ2 A;  3QGG A;  3G4S S;  1X4G A;  5AJ3 J;  2OTJ S;  4LFC J;  3SZ2 A;  2CQG A;  1N5V A;  2YH1 A;  5LIA A;  1H73 A;  2I9S A;  2VG5 A;  1KHN A;  1REV A;  3RRK A;  1T9Y A;  3MFI A;  5HSP A;  5CZX A;  3CJ8 A;  4BC7 A;  1ZED A;  5EHH A;  4LF8 F;  3U1M A;  1QUP A;  5G0R A;  4HKQ A;  5KG7 A;  4GVL A;  3TG0 A;  1T0T V;  3QT8 A;  5KFV A;  1MN9 A;  2QLX A;  2J7W A;  1RUS A;  1S1V A;  1TTH B;  1WF0 A;  2RB7 A;  3PJW A;  1KR4 A;  2AZ1 A;  4KHM A;  1H7W A;  2Y3Y A;  2RUG A;  4AE5 A;  5L9X A;  1PGZ A;  3A3P B;  2DNN A;  5GVQ A;  5T14 A;  1F5C A;  2Z0G A;  5DET A;  1KH4 A;  2MGZ A;  1NK9 A;  2BOP A;  2W01 A;  2L41 A;  2WK4 A;  4LR7 A;  4NLG A;  4FNH A;  1SQG A;  1SJ4 P;  3ITH A;  1N32 F;  1Q5V A;  4I7F A;  1S77 D;  1HAR A;  1JLQ A;  2H1Y A;  1FNO A;  3RTV A;  4C8Z A;  1R7I A;  2W24 A;  5CYQ A;  2YKO A;  4JI5 F;  1HBM A;  3NKR A;  2BJ8 A;  4YR2 A;  1U0H B;  2YNF A;  2W1B A;  1SB6 A;  1B7F A;  3TZY A;  2K7K A;  1Y4Z B;  1NSP A;  1JLE A;  4YQW A;  4YHH F;  1FDN A;  3PEH A;  1VGY A;  2KYX A;  5GMD A;  1ZBT A;  3FRY A;  4DV6 F;  1U1O A;  3DM2 A;  1KVJ A;  2BRK A;  1QAJ A;  2QA4 S;  2VQE F;  1UTA A;  2NUU G;  3W9I A;  1J5O B;  2DHH A;  4ZJQ A;  3O1L A;  3MI7 X;  1C4A A;  1NHV A;  1KS2 A;  2CWX A;  2RVJ A;  5HAO A;  1KNZ A;  3NL0 A;  4LQ3 A;  1M5S A;  5SZT A;  1ZH5 A;  4U95 A;  3DLH A;  4ZJL A;  3BJY A;  3MR7 A;  2NSC A;  1N8R T;  3Q2T C;  1UVL A;  4CLF A;  4ZG9 A;  4DQI A;  3E01 A;  3BN4 A;  5DDP C;  3W1Y C;  3UR0 A;  4QYZ K;  4C0B A;  4K4S A;  3ZFV A;  2FJA B;  3IN5 A;  3J80 U;  3OTO J;  3IGZ B;  3M8P B;  4EWT A;  3NRB A;  2DNG A;  4R5P B;  1UVM A;  4H4M B;  4DFM A;  3HMJ G;  3MAH A;  3NBP A;  3OT9 A;  4NAS A;  3KK2 B;  5TJ3 A;  3DPC A;  4HH0 A;  2OP5 A;  4E98 A;  4K0K J;  5L1J A;  2L9N A;  1S12 A;  3NAH A;  2FB0 A;  3HD1 A;  4W98 A;  1IM6 A;  4UOC A;  1NDP A;  2HBY B;  1RAE B;  1JJ2 R;  1SJ1 A;  3D3C J;  5T7L B;  2E66 A;  2UVU A;  2XS5 A;  3MOJ B;  3CED A;  3SQG B;  4NXM J;  5DLG A;  5ETS A;  2ASD A;  4OJ3 A;  5C5J A;  1Q7Y T;  2A0F B;  2IDE A;  1ZPV A;  2XYP B;  3K7R A;  2ZIT A;  4LIW A;  4X4O A;  1X4A A;  2VFS A;  4DV4 J;  2AWZ A;  1AJA A;  4ZPV R;  1RWN B;  2YNI A;  4U7U K;  4ATN A;  4NLR A;  1N2K A;  2LA4 A;  3L9Z A;  4U9R A;  5GAG I;  4LBP A;  1P1L A;  2PI4 A;  5CHC B;  3UD4 P;  2BVZ A;  4PWD A;  3BN7 A;  1AFJ A;  2XS2 A;  2CIM A;  4IR9 A;  1EHW A;  3SFU A;  1R6Y A;  1RTH A;  2VIH A;  1WF2 A;  1KON A;  3V6H A;  3ZZP A;  1EQJ A;  1TR0 A;  5KFB A;  2BE9 B;  3Q8S B;  4Z2X A;  3FEZ A;  1YQH A;  1EW9 A;  2YQ1 A;  4DL5 A;  5HP1 B;  3KK3 A;  2WON B;  1NAQ A;  3GCX P;  2XI3 A;  4KHR A;  3L7U A;  3VAM A;  4JV1 A;  1DY3 A;  1MWQ A;  4A8K A;  3M9M B;  2E1P A;  1WHV A;  4J9Q A;  4FYY B;  2W9C A;  1UA0 A;  3L95 X;  3MPV A;  2D9O A;  3UE2 A;  3H7H B;  3ISN C;  1KBR A;  2PA8 D;  3GE9 A;  3I56 S;  5ETN A;  2UXB J;  1C1B A;  2GS8 A;  1HPZ B;  3IGV A;  3M2V A;  4WFX A;  3P96 A;  3TAR A;  3HZE A;  3KJV B;  1Q78 A;  1Q95 G;  3M8R A;  3I32 A;  1DRZ A;  2ZOF A;  4W90 B;  4X4T A;  3FEY B;  3AJ2 A;  1XER A;  4KKO A;  4ZDN A;  2YH0 A;  1OJ4 A;  5DQG A;  2FGO A;  4CXS A;  1VIO A;  5EGY A;  2B0G A;  4Y2K A;  1TMM A;  4YB1 P;  5HRO B;  5CYM A;  1JJ4 A;  4QYZ J;  2XMM A;  1TUW A;  5E3C A;  3TZW A;  2P9G A;  2F4F A;  4I68 A;  1MU2 B;  1HNI B;  3UN3 A;  1EIY B; 
#chains in the Genus database with same CATH homology
 1P49 A;  4KM4 A;  1B8J A;  5GRR A;  2G9Y A;  4UOO A;  2RH6 A;  4LRB A;  3DPC A;  3WAX A;  1ALI A;  3UO0 A;  2W5Q A;  4GTZ A;  3BDF A;  1SHN A;  5AJ9 A;  3UN5 A;  3NKR A;  4FDJ A;  1ALK A;  3A52 A;  2W5S A;  1EQJ A;  4LR2 A;  5IJQ A;  4GTX A;  3NVL A;  3WAV A;  2XR9 A;  5LIA A;  4CYS A;  4LRC A;  2GA3 A;  3NKM A;  1EW9 A;  5LRN A;  1E1Z P;  5L0B A;  4KJG A;  4KAV A;  1EI6 A;  1KHN A;  2W8S A;  1FSU A;  1KHK A;  1ANI A;  2IFY A;  1AJC A;  4QAX A;  1HDH A;  4LR9 A;  1URA A;  3MK2 A;  1EJJ A;  3BDG A;  4LRD A;  2IUC A;  1EW2 A;  1ZED A;  4LRE A;  1URB A;  2GSU A;  1K7H A;  1ZEB A;  2ZKT A;  4MIV A;  5K4P A;  5L0K A;  1KH7 A;  4LR8 A;  5LRM A;  4N7T A;  3M8Z A;  2W5V A;  2GSO A;  5INH A;  1N2L A;  3Q3Q A;  5L0E A;  3BDH A;  3NKO A;  3KD8 A;  4GTY A;  1O98 A;  1Y6V A;  3BDG B;  3TG0 A;  2IUC B;  4UPL A;  1ED9 A;  5EGE A;  4YR1 A;  3WBH A;  3WAY A;  2VQR A;  3MK0 A;  3LXQ A;  5EGH A;  2W8D A;  1KH9 A;  3SZZ A;  4LRF A;  1AUK A;  1E33 P;  5DLW A;  1SHQ A;  1AJD A;  3UN2 A;  3E2D A;  4KJD A;  3WAW A;  1Y7A A;  3NKQ A;  3SZY A;  2GSN A;  3T02 A;  2W5X A;  3M7V A;  1AJB A;  1KHJ A;  2W5W A;  3DYC A;  5DLT A;  5DLV A;  1KHL A;  3T00 A;  5C66 A;  1AJA A;  1KH4 A;  4ZG6 A;  4FDI A;  4CYR A;  5GOV A;  3M8W A;  4GTW A;  4CXK A;  4B56 A;  4ZG9 A;  1ED8 A;  1E2S P;  1N2K A;  1HJK A;  4LR7 A;  1ANJ A;  1ZEF A;  2W5T A;  4CXS A;  1O99 A;  5IJS A;  3IDD A;  1E3C P;  5KXA A;  3TX0 A;  3IGZ B;  5HRT A;  1EW8 A;  2X98 A;  4CXU A;  4ZGA A;  3NKN A;  1ALH A;  3IGY B;  4MY4 A;  4UPH A;  4KAY A;  4UOR A;  4NWJ A;  1HQA A;  3ED4 A;  4LQY A;  1ALJ A;  5LQQ A;  4TN0 A;  4ZG7 A;  1ELZ A;  3B5Q A;  2D1G A;  4MHX A;  2XRG A;  4NWX A;  1ELX A;  4UPK A;  1ELY A;  4UPI A;  3CMR A;  3M8Y A;  3TWZ A;  3OT9 A;  3T01 A;  3MK1 A;  2QZU A;  2ANH A;  3UNY A;  4UOP A;  4LRA A;  3UN3 A;  1KH5 A;  3NKP A;  2W5R A;  5TJ3 A;  2GLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...