4LR8A

Phosphopentomutase s154a variant soaked with ribose 5-phosphate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTAADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 141
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lr8A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr8A01
2XR9A 5DLTA 3SZZA 4KJDA 2GSNA 2W5XA 4TN0A 1E2SP 1ALIA 2VQRA 3WBHA 4NWJA 4UPKA 1SHQA 1ZEDA 3A52A 4CXKA 4LRFA 5LRMA 4LREA 3MK1A 3UNYA 4YR1A 1EW8A 2GSOA 4QAXA 4LRAA 3DYCA 3UN5A 2XRGA 5K4PA 3TX0A 2W8SA 5KXAA 4UPLA 1KH4A 3WAYA 3BDFA 2W5TA 3KD8A 5DLVA 1ELXA 1EI6A 1O99A 1P49A 3ED4A 3Q3QA 4LQYA 4UORA 5LRNA 1HJKA 2W8DA 5LQQA 4CXUA 3TWZA 1ANIA 3WAWA 4UOOA 1EQJA 3MK0A 1HQAA 5HRTA 1AJDA 1ED8A 4GTZA 3DPCA 5INHA 4FDIA 3NKRA 4UPHA 5GOVA 1KH7A 3B5QA 3MK2A 3IGYB 3NKMA 4GTWA 4N7TA 3UN2A 2D1GA 5EGHA 3M8ZA 4ZGAA 4LRDA 3E2DA 4LRCA 1KHLA 4KJGA 4ZG9A 1E33P 4UPIA 4ZG7A 1ZEBA 2G9YA 4LR7A 1HDHA 1URBA 4MHXA 5IJQA 1Y7AA 5TJ3A 4MY4A 1AJBA 5IJSA 2GA3A 1N2LA 1ED9A 1AJCA 3M7VA 3NKPA 1AJAA 3IDDA 4B56A 1E1ZP 1ALHA 4CYRA 1B8JA 1ANJA 3TG0A 3BDGB 3IGZB 1URAA 5C66A 1KH5A 1K7HA 3LXQA 4LR2A 1ALJA 2W5WA 4ZG6A 2W5SA 2GLQA 1N2KA 4LRBA 4CXSA 1ELYA 1SHNA 2QZUA 5L0EA 3OT9A 2RH6A 1KHNA 3BDHA 1FSUA 4KAYA 4NWXA 3T02A 1KHKA 4KAVA 3UO0A 1KHJA 1O98A 4LR8A 2IUCA 2IUCB 3NVLA 1EJJA 3NKNA 5DLWA 1EW9A 1AUKA 4FDJA 2W5VA 1ZEFA 3NKQA 5L0BA 2IFYA 4GTXA 4GTYA 1ALKA 5LIAA 1E3CP 3T00A 4CYSA 2W5QA 3CMRA 4UOPA 4KM4A 3WAXA 3SZYA 3UN3A 3BDGA 1Y6VA 3M8YA 3WAVA 5GRRA 1EW2A 5L0KA 2X98A 5AJ9A 2GSUA 2ZKTA 2W5RA 3NKOA 3M8WA 2ANHA 5EGEA 1KH9A 3T01A 4MIVA 1ELZA 4LR9A
chains in the Genus database with same CATH superfamily
3M8QA 1RACB 1RCXB 2UU9J 2XMMA 4RL1A 1D0EA 4KJDA 4M8LA 1CJKB 2Q79A 4TN0A 1KR4A 1JXVA 3PJWA 4F04B 2YWFA 2CDQA 2MKJA 4OYMA 5K5MA 2G0JA 1UVIA 1KQKA 1SCJB 2YNGB 3MD3A 3SI8A 1SKWA 1C1CA 3V81B 3DOLA 2G2OA 2VC0A 2HHPA 2GMJA 1UTAA 3A3PB 2F8HA 5CHCB 2V6AA 4CLSA 2AEJA 3NMRA 3DC2A 4UUXA 2OELA 4URQU 2W8SA 1DJ0A 1KH4A 1G4CA 4WIQA 4FF4A 2Z2ZA 2C2DA 4X2BA 1RB0A 4TY8A 1RTHA 1NK9A 3ONQA 3V6KA 4ED5A 4B17A 2GHVC 4LQYA 1VJQA 2J7UA 2X1AA 1XMBA 3F0NA 3LANA 1VHIA 1Q8KA 1G1XA 4IRDA 2XG8A 1ANIA 4Z7CA 2UVVA 1VQOS 2I6WA 3VAHA 2FJWA 1NKBA 1LEOA 3MEEA 2ZH6A 4FNIA 4FBUA 3RRHA 4LMZA 1R8BA 2BV3A 3WAWA 4CIOA 2YNHA 3SFGA 2CUYA 2UP1A 4MK7A 2B43A 4FDIA 1Q7LB 1ELOA 1TFWA 3TJAA 1NHKL 2DGOA 3B5QA 3MEDA 3R1LA 2HAIA 1T9UA 2F5GA 3P45B 4LSLB 2KJVA 4R25A 2BJ8A 4JB8B 4YB6A 3CJ5A 2CQ2A 3HHLA 1DLOB 1EQ0A 1VQSA 1H2UX 4J37A 4NLUA 4DU7A 3TUPA 2X98A 4KB7A 4ZPAA 4QWAA 3OFFA 3MI7X 3BDEA 1HDHA 2M9KA 5B08A 2HHXA 1G6BA 2DEIA 3HCXA 5IJQA 3QATA 5A8RB 5I4MA 3E01B 3C3LA 1EP4B 2BM0A 3Q8SB 2DH7A 2XM3A 4QIFA 3EPGA 4JI3J 2J0SD 4P2FA 3CCMS 3NKPA 4H4OA 4NRUA 5H9FJ 2OEMA 2POKA 5L9XA 4CLKA 2XI2A 3CMAS 4LVNP 1U1LA 2ZBCA 1WC5A 3SQGB 4RW4A 2B7CB 2GGPA 4F0KA 4C48A 5C25A 2CYYA 1NH7A 5J1PA 2XY5A 3IGZB 3JAMY 3CCWA 5KFXA 4YB7A 2V8VA 3T6BA 3HP6A 4DWIA 2QYGA 4OI6A 3QMQA 1RWMB 4M1KA 1S79A 4LQ3A 3K5OA 2ZH9A 4L72B 1S6QA 3B4DA 4O3RA 1DTTA 2W5SA 4KAYA 2Q6BA 3HSZA 1BUXA 4USIA 2O3DA 4B9LA 1F0XA 4NLXA 1N5SA 4QWCA 2FY1A 1JNZB 2OTJS 4KFBB 3D9BA 3IXQA 2Z30B 4LR8A 2XCPA 1YJ7A 1TU0B 1BQMA 5A8KB 2UVRA 4FKYA 4K2XA 5K14A 4LF7F 1ZPWX 2C2EA 5LXRA 4QQBA 1JLQB 3V4MA 5K20B 1F9FA 1WI8A 2W24A 4H4KC 1LWXA 3V81A 1XQIA 2EEYA 4PYAA 1OSDA 2BJDA 2UUCF 1ZAVA 1RLDA 2EI5A 2FHOB 4UTGA 1X4GA 3CUNA 2N4CA 3DRRA 2QV6A 3HF5A 1AYEA 3Q2SC 2M88A 1BD6A 5CA5A 1NHUA 2FD2A 4L74A 4O3OA 3G6XA 5AE3A 4P6QA 1NJIT 2ZDOA 1VRUA 5HANA 3WZ0A 4DN0A 2V94A 4O3SA 4PWWA 1LW0A 3D7SB 3VQSA 4RUBA 5C42B 1N0VC 1U2CA 1UP1A 4UOGA 2ZE2B 2CZVC 2HRUA 2DTJA 3GQCA 1X4FA 3NCQA 1M5PC 1CS4A 2OAUA 3ZTRA 4PQUB 3EICA 3SZZA 2DHAA 3HHKA 3R9LA 4M5MA 2VPZB 2BEFA 1G3OA 5B0EA 2YKQA 1AB8A 4FPIA 1FESA 4ECYA 3MAAA 5J2PA 1T3NA 2H5EA 1T3OA 1IM4A 2SXLA 2IRXA 5IQ6A 3TVYA 4RLEA 2R7SA 2BXJA 4P72A 4J9KA 1HQ2A 4DV0F 3GYXB 2FZGB 2D3O1 2OH2A 2XRGA 2UUCJ 3RRGA 3L95X 4UPLA 1Y10A 4ZPCA 4U7CA 2L41A 1D8YA 3ISNC 2E1PA 4F0MA 5A6PA 2V2KA 3PTWA 4ID5B 5KFZA 2IM1A 3M30B 5EWGA 1RYSA 2VPWB 2VJVA 1KKHA 2D74B 2V50A 1WHWA 2PEBA 4ES1A 3NCRA 3T1HJ 3QRQA 3K5PA 2MGZB 2KKHA 2XO6A 1F6TA 1YK9A 2HFUA 4RO0A 1RTJA 5C24A 4YFUA 3OHAA 2M2BA 3D67A 1HMVA 3IMQJ 1IBCB 3MEGB 3O6QA 2GA7A 1AROP 2KG0A 1S1VB 4X62F 1W2IA 2EBEA 1CJTA 4A4JA 2VJUA 2VG7A 5KT6A 5F41A 2RS2A 1NK6A 4OMFG 3P49B 2ACMA 2HGLA 1OWXA 3GWCA 1WC4A 3BPDA 4OZ3A 5D0EA 4DL5A 2PMWA 5AXKA 3KLFA 3MAAB 4LBPA 5K8PA 4U95A 1ZM4A 4C0OC 3V5RA 4JI8J 5FJ4A 4DL7A 5DG8A 3UE2A 1J5OA 2MTLA 1TKZB 3DNCA 4X64J 1KHLA 2DITA 4PQUA 2QE5A 2CJYB 1XTZA 3PKYA 2GVDA 4FN5A 2WB4A 1T9WA 4AL7A 2FLPA 4J7CA 1ZEBA 3IRXB 1VOMA 1ZS6A 1HBUB 2M8HA 3MPVA 5HVGA 2DT9A 2DPJA 2AV5A 1Y7AA 5TJ3A 3EGNA 4IG0A 1TKZA 3MCOA 3DCAA 1SKSA 4FF3A 1N6QA 2KB2A 1AJAA 2P8IA 2W2PP 2K06A 4ZVUB 3OTBA 3GP9A 4EU0A 3IRWP 2G4BA 2DGVA 2HVHA 3CVKA 4NLOA 5I3PA 3DLEA 2BW7A 3SIPB 4KHPF 3A8IA 5L1LA 2M3DA 1XNRF 2VKRA 4CO5A 5HK4A 1TAQA 3M6XA 3HKZD 3NGKA 4HDGA 4N5SA 1CSJA 1PGZA 2W5WA 2MZRA 3OLAA 2AGQA 2GAHC 4JBCA 4LRBA 5DG9A 2QZUA 2LU2A 1GXTA 1T7PA 2A2DA 3VV2B 2B8QA 4ELVA 3LP1A 2V68A 2FB0A 1DHMA 1JLQA 3TARA 2Z56B 3BGRB 2GV1A 1CEZA 1AZSB 2QL5B 3RBEA 1UJ6A 1VK8A 2ZC3A 2JSXA 4RPFA 2QEXS 4XIUA 3AD8C 3C14A 4DX7A 4W90B 4RKUC 1UZDA 2ROGA 3CJ3A 3MPYA 4FVCA 1HNVB 3LAKA 4B3RJ 3J81Y 2A6MA 2Z2YB 5EX3A 2YX1A 2YNIA 5KFNA 3G8SA 2Y8WA 3QIPA 1SC1B 4I0WA 1ZEFA 3TP2A 3OPKA 4DV5F 3R7NB 3C6UB 4PPZA 1M5VC 5D0RA 3MPWA 5DGAA 3RAXA 2XB2D 4NLVA 4CYSA 1WWHA 2MZ1A 1HIYA 3ICLA 2ZITA 4TYBA 4CTAB 5CAAA 1R0BG 2B6AB 2F1FA 2RSQA 2LECA 1VBYA 3UN3A 3V6DB 2R7WA 4U67Q 1A6LA 2OPSB 3T6JA 1C0UB 5C2CA 3SQGA 1FF2A 2F3JA 3DYAB 4PABA 4ETXA 5HSPA 2QSFA 2PGCA 4FXWA 4CDIA 4ZJLA 3JSYA 1XNQF 3HK2A 2MDAA 4JI1J 5J1EA 2AZ1A 4JI6J 2R4FA 3P8BB 2ADCA 3DRPA 1EP4A 1MMDA 4LF6F 4NXNJ 4OX9J 4JV5J 1OYEA 3BB5A 4K4SA 4DS5A 2KT2A 2ZOGA 5F0WA 1RBOB 1ZOTA 4D3GA 4RNOA 3QGGA 3I87A 2PI5A 1R6VA 1KN6A 4WFNQ 5LL6d 3THVA 2KJWA 1VQ5S 4Q7AA 2KVIA 5DZ7A 2F40A 3GG1A 3EUNA 4HT5A 3W2WA 3TEHB 1HBNA 5CYMB 3KK1A 3MEDB 4DV4F 1B7YB 4RWXA 2XLKA 4OI3A 3S6EA 5HBMB 2LA4A 4P71A 3N9UC 2EK1A 4XAKA 5E7OB 3KK2A 1GTHA 2HIYA 3O8WA 3BH6B 2C28A 1LWFB 2J0XA 3FEZA 4F4YA 1BC6A 4OJ3A 2BJ9A 2GIQA 4LQ9A 1S9EA 4PG6A 1H72C 1NO8A 3ZZRA 1R31A 2AQ4A 2OMOA 4JI4J 1WG4A 3GG0A 3M2UA 4WP8A 3R1HA 3ELHA 3FKBA 2E7VA 3JXOA 4OI4A 5FDLB 3RG6A 4OV1A 4RUAA 3CJKB 1IKVA 4C2MA 3MMCA 2J9DE 1S6PB 2LDIA 4ZP8A 5T7LB 3CDWA 3L7PA 4KJIA 1EIYB 4ECXA 3M2RB 1QE1A 4ZPWR 2JC0A 3EGVA 1HWIA 3CJQA 3T1HF 2UUTA 2OPPA 1NK8A 4GMKA 2A18A 1REVA 2Q43A 1Z2ZA 3HHLD 4M5DA 5LSRA 1GEHA 2CJXB 3ENWA 2QZ8A 1RTIA 2MLZA 3IS9B 3OQ2A 2CJAA 3Q22A 2CNLB 3I0SB 1HBNB 5CYMA 3IGYB 4HI1A 3TQ1A 2X3GA 2ZZMA 1PILA 4O44A 3W66A 3PIPQ 2X1BA 3NGTA 3E01A 3P3DA 4FYVB 4LRCA 4ZVOB 4LF5F 5D3GA 4DZ6A 3VAFA 1HNXJ 4ZPDA 2YKAA 3DRYA 2F63A 5C7PA 2VKZG 1VK3A 3ZTQA 1YJRA 3PW7A 1IKYB 1UWBB 3MZIA 4CLTA 4FZVA 2W9CA 1IVZA 1GXUA 1Y5IB 4RU9A 3TO8A 2OO4A 3G82B 4IOBA 1LWEB 1ZBTA 1YTYA 2DHSA 3DHXA 3N01A 5EGYA 4Y2KA 3EZOA 3V6DA 2PDAA 4NCAA 1UVJA 2IJFA 3LXQA 3PX6A 4QWBA 2XZDB 5EX0A 2ACYA 1D3WA 4CO1A 2H1YA 1ZA1B 1DTQA 2ZJQQ 2DEJA 2RH6A 3QIDA 5KFWA 4MIAA 2OI2A 2VDHA 5T14A 1FA0A 3FBBA 3BDHA 3PFOA 3PX4A 2DRAA 5A8WB 2ZDPA 1S6OA 3MM9B 3CF5Q 3NGUA 3R5JB 4WXWA 4O3NA 1ZETA 4GKKJ 3HFVA 1V9OA 4OHVA 1N32J 2HGMA 2YVSA 3HZGA 1OJ4A 2VFVA 3QQCD 4NA2A 4F50A 4ZN1A 3NGDA 2EVZA 4CQ1A 4LF5J 4P75A 2AJFE 4CO4A 2I8EA 5DQIA 2XQCA 4OX7A 3WIVA 5DQGA 1D9FA 2BABA 1FDDA 1Y9OA 2IVMA 3MM8B 2QMUB 5LOQA 2AP6A 3PYDA 1S9GA 4CH0S 3H2UB 4F4ZA 2APOA 1URRA 4KH1B 3OHBA 2DO4A 5KFTA 1YLXA 2QLJB 3AQPA 3IG1A 4NYZA 3PXGa 4A8OA 2JEJA 4DF4A 3M6WA 4MFBB 1NDLA 4J91A 1RE1B 1RI7A 5ETLA 4F3MA 2WB1D 4DV7J 4DSJA 3DLEB 2JX2A 1Y3KA 2VQEJ 5DGBA 1U1RA 1QSLA 2D3UA 3Q83A 3PNIA 1HNZJ 3DRPB 1RABB 2MXYA 2CJBA 3P6YC 4LJMA 4CNYA 2W2MP 2VASA 1FNMA 2WVCA 5BYQA 3C6TA 4C3KA 4ZLJA 1M0SA 3K8WA 2HHSA 4JI7F 2GJFA 2RRBA 3GTYX 2JH3A 2VD3A 2GVDB 4FYXB 1IM6A 3GV5B 1N32F 2ZNZA 2FJAB 5KG0A 3QZ7A 1QUPA 5AJ3J 2V2ZA 3HJFA 1WEYA 1Q78A 3O5TB 2J9DA 3S1TA 4CXKA 2CPZA 2V67A 3ULHA 4QIGA 2DIUA 4QR2A 3BS9A 5F9LA 1VRTA 3CJSA 2O67A 2QFIA 2B4PA 3PW0A 1UFWA 4DL6A 3BEGB 1GMWA 2I5JA 4DV4J 4ZVQB 1YRXA 2KTQA 5CZXA 1HPZB 4K2JA 2UXCJ 2E5GA 1K1QA 5KFYA 3GFXA 2ZH5A 2B9YA 2BZ2A 3SSQA 5BJRA 1H7XA 2HPUA 3PX0A 2LMIA 1EETB 3F41A 3FVYA 4ICLA 4ICLB 1GX6A 2HWIA 3FMWA 1LWCB 2Q1LA 2XMJA 5D0HA 2WK4A 1Y7PA 2RKIB 4RW6A 4JI4F 1HJKA 3HULA 5KTQA 5EHHA 2HBYB 3HVRA 4WZQA 4OHXA 1PSDA 1YI2S 2MKCA 1U1QA 1SI9A 1T11A 1FK9B 5FD1A 1FHTA 1YBUA 1UPMB 1SVDA 4DU8A 5FLXY 1TK8A 1S1UB 3N79A 1NCLA 3TNVA 1N48A 3RB3A 3QGHA 3H4DA 1U8SA 2AKWB 1M1HA 2B7BB 1RAEB 1XIQA 2NXCA 4ZGAA 3MXHP 4ILLA 3CJ4A 1XC9A 1QUVA 1R8PA 3OFEA 4ZG7A 1GFWB 2GNKA 3FSYA 2HIQA 3I5CA 3LP0A 2MYFA 1TL1A 2V8DA 1PC5A 2CPEA 2XMTA 2VG6B 3DGPB 1IKXA 3Q8QB 2GA3A 4MY4A 3BV8A 1FWPA 1PKUA 2NXUA 1VRUB 3MCNA 4TU7A 4DR6J 3W9HA 4C6AA 3CJ0A 3CSKA 4NLSA 2JLFA 5DM7Q 3BQ2A 4OYPA 1U02A 2HHUA 3IAS9 3NS5A 1ANJA 2QIFA 8RUCA 3GJRB 4Q45A 4KQZA 1WC1A 2DB1A 2CPIA 2FVCA 2B56A 4NLRA 5LJ5Y 4ECWA 4Z2XA 2R2UA 4IR9A 2F4VF 4ZG6A 4YR0A 3KMSA 5KFQA 3G6VA 2N3OA 3GJQB 4UZBA 4JV1A 3NBPB 3QRPA 3TW0A 2UZAA 3MR5A 2F4FA 4KGZB 1SHNA 5JMNA 3KLHB 2OP5A 2KM8B 2HHHF 1FSUA 2AYMA 1F2GA 2VF3A 3CT9A 4NA3A 3ISND 4PZVA 5HJXA 3TA2A 1HR0F 3MR7A 4DV2F 1KP6A 4MTPA 1NLKL 3QJPA 5A8KA 1S0MA 3PO5A 2BE9B 2PC6A 1HPZA 3M6VA 4OJHA 4Q0BA 1UL3A 1S48A 3R5DA 5KFMA 2RIJA 1IXKA 5DRKA 2OD4A 1DTTB 4LF7J 2Z2LA 1NDCA 3FZ2A 2QL7B 2YY3A 1ZH5A 2PSZA 4I68A 5LM7E 4GTYA 2MKYA 5K8NA 1T8EA 1KQGB 1MMNA 2W5QA 4ALZA 4PWDA 4DEZA 2I1RA 4Y2AA 4DSFA 3D5MA 3BDGA 3BO3A 1FXDA 2GGPB 4U7UD 5ITHA 3JYTA 2DNQA 2FZCB 3MUVP 2YKMB 4ITSA 3NRBA 2V4RA 5C42A 4DR5J 1U1PA 3LF0A 1VQNS 4JI5F 3BBCA 2Y1RI 3PIOQ 3M8SA 3W3SA 1RKIA 1RA6A 1ZAXA 5F8LA 2KFZA 2E44A 1BXNA 3VAGA 4AQYJ 2XS2A 2EC2A 1T05B 5HO4A 2RAQA 2YWHA 3HHLB 4QW9A 4DS4A 3M32B 4ENOA 3IG1B 3ZZTA 4A47A 5M2UA 4ZOSA 2U2FA 3MMBA 4BC7A 1YZ7A 5ETPA 1WHYA 1WOSA 1HA1A 5LXYA 1MROB 1S7HA 3I9ZA 5BYRA 1HBMB 3I6PA 3WDOA 2W9BA 2AYBA 1EW8A 1KLMA 3EPIA 2BMBA 4ZLLA 2HVZA 3LP2A 4EWTA 4ZJQA 2DBBA 4C3MA 1JJ2R 3NY0A 5KXAA 1X8DA 1X4DA 4USMA 3A13A 4ZCMA 3D6TB 1UFLA 2J9EA 5K14B 2ABYA 5CCMA 3M2RA 5HLFA 1L3VA 3SCIE 1L5UA 4DQRA 2D9PA 2LEAA 4H4KA 4B9SA 3T5KA 1DFDA 1K1SA 2HS3A 2OFHX 2XZTB 3QFHA 3TJ9A 3UVJA 3T3FA 1JX4A 4FF2A 1P49A 4PXCA 1UW9A 3T5JA 3TUZC 3ZFVA 1NJWA 1N36F 1LW2B 5GMDA 2CJKA 4JI5J 2R2SA 3F56A 3PHEA 3H59A 3SYZA 1S9EB 1Q95G 3PY8A 3R8YA 1EQJA 4B08A 2Y8YA 2WAQD 5DDPC 4IRCA 2IJNA 2UVWA 1UMJA 3Q24A 2LXIA 3PHTA 2L08A 2WVDA 2YNGA 1XR6A 4KSEB 1S76D 3KG1A 1KS2A 1YBTA 3GU0A 3H20A 4KO0B 5D4LA 3M8ZA 3NNHA 4C4WA 5JVHQ 1KLNA 1I3OB 1OIAA 1VQMS 3E2DA 2CZ4A 1NZAA 2IFXA 5GADI 4DFMA 1UA0A 1TKTB 4I6WA 1TP7A 4ERDA 1H3DA 4HT7A 4WIIA 3P5TL 4R8UA 3HPOA 4UQTA 3KLGB 1BQNA 1CC7A 3BH7B 3W60A 4PXEA 2XC9A 4JI2F 3ZZPA 2FQQB 2KXNB 4F4KA 4IFVA 4ECUA 4NLGA 4PRFA 2G2ZA 5B0AA 3JYTB 2DISA 3N6NA 3DYAA 1ALHA 4B9NA 1B8JA 1UPPA 4JV2A 1V5IB 3AOCA 4I1TA 5B0BA 3MURP 1N36J 2RMLA 4FPRA 4ZCLA 3ZNJ1 4Y3CA 4DCJB 3O1LA 3I56S 4PUOA 2IYGA 3FRZA 3FQLA 1Y11A 2NPIA 5HQMA 2VODA 3F73A 4DR7F 2E9RX 2M4MA 5IC4B 2B3TB 5T7LA 4TQSA 2F4VJ 1N4LA 1NEEA 3OTCA 1CVJA 2UUAF 1WF1A 1K44A 4WZMA 4M5HA 3T1AA 3UO0A 3RW6A 2YWKA 3C14B 4ZPBA 5B0FA 2CWXA 4AT1B 2AU0A 1KVKA 3Q0AA 1N5TA 4OYIA 1D9AA 4DG1B 4QWEA 4DV2J 3GV8B 3VVUA 4EZ6A 1O0PA 2HHQA 3NEKA 1EW9A 4FYDA 3FJ2A 4QR0A 5HBMA 4RW9A 2KFNA 2HS4A 1BGXT 2P9CA 3GB0A 3H42A 3KK1B 3BO2A 1QAIA 2IAJA 3T5HA 3MUMP 1VS3A 4HEA9 1L3KA 1T94A 3JS9A 4J9SA 4YY3F 3OSPA 2ASYA 3UCUP 1T05A 2HWTA 2FC9A 4WYWA 3BKTA 3FDSA 2WBMA 4KHMA 1WUUA 3VGVA 2HHVA 4ANDA 3AJ2A 2AF6A 9RUBA 3IO1A 1SUQB 3UFCX 4LF4F 3MR6A 1FJGF 2BBEA 5I42B 4OZ0A 2YKMA 4QJVA 3HVTA 3T9ZA 5I3UA 1ELZA 2BRLA 4P10A 3EVWA 4JI6F 4JI1F 2MSSA 4HVZA 2A1BA 3BSCA 3TZXA 2W9AA 2F9DA 1J5OB 2B51A 2DCUB 2HNZA 4NPOA 4WKYA 3WBHA 4CTAA 1NK7A 2G13A 3BBFA 4B3TF 4UPKA 3H25A 4LT6A 1J5EF 2AJ1A 2CNNB 2XNQA 1S0OA 2HURA 2HK3A 4DLGA 2QJ3A 2COLA 5CZVA 1OMSA 5LMNJ 5B7WA 5RUBA 2FLOA 3RB0A 3NCPA 3H98A 2DK2A 2MZTA 1N52B 1MU2A 3AHPA 2E29A 4PEOA 1Q53A 3ZZYA 3G8QA 1HLWA 2MKHA 1RTJB 3AXKA 1SV5A 2J6SA 2PI4A 2KYZA 2DGXA 3N0VA 2B0GA 4PCQA 4QBUA 1LXJA 5CCLA 2ZH3A 1LWCA 2B9WA 1FNXH 2HFZA 3H2VE 2C2NA 4KH0B 1HKAA 4ECTA 4LF4J 5KAKA 1RP5A 2F8MA 4KR0B 2G9OA 1SV5B 3I5AA 3KDNA 5F3TA 5GADU 3HD2A 1JJCB 1KOOA 3U02A 2RT3A 2E5LJ 1C4AA 2VG5B 3L3CA 5SZTA 5E33A 3NNAA 2M70A 2MY7A 2Y1IA 3AODA 1KOHA 3D0HE 2IDLA 1SC3B 1FEEA 2V4QA 2EK6A 1Q5YA 4EEYA 3O44A 4MH8A 1X9SA 3N6MA 3UN2A 3I32A 3BGUA 3VGTA 2PE8A 1RHKB 5ETSA 3BYRA 1JKHA 2D1GA 5AT1B 3DGPA 3GILA 3VHQA 4DOZA 2MY8A 2KI2A 3CW2C 2IM2A 3W2VB 1WOOA 3UQSA 2OTLS 1YVFA 3IRXA 4CCHA 1IUJA 3AA9A 4ZDNA 3G8TA 4ZIVA 2QLWA 2DNZA 1MNEA 2C1EB 4M5NA 1T03B 4DX6A 4NCGB 2MQPA 3M7VA 4RW7A 1EHWA 4ZPTR 4DUTA 4I69A 5HROB 2AJ4A 2BE2B 3TA0A 3OLBA 4CYRA 3VAKA 1ZM9A 4N41A 2HQCA 2VQFJ 4F2RA 2WONB 1FXLA 1WELA 4GVBA 4NMLA 2VG7B 4WP9A 4X66J 4F7VA 1KH5A 2F7VA 3LTOA 1SC4B 3D1HA 2VG5A 3UD3P 2VHGA 5L1JA 1TMMA 1TR0A 3UCGA 5BXIA 2GLQA 1IQTA 2IMWP 3QZ8A 1H7WA 3SCLE 3BGOP 1FJCA 2F65A 1HD1A 4P9SA 4C8YA 3BN7A 2N82B 3BPSP 4O0IA 4DFJA 3OD2A 5DG7A 3PV8A 1I94F 2IPOB 3ZZUA 2H9ZA 4C9DA 4ID5A 1N5QA 4YMEA 4F4XA 2L9WA 2NYHA 4HYKA 3AXMA 4DR2F 2IUCB 4EZ9A 2GO8A 1KSPA 4DSLA 1MU2B 2NUUG 1VQ8S 1WKLA 4ELUA 2ZH8A 2ATLA 1HBOA 2ZZTA 4HI2A 2XMWA 2WRMA 2VBYA 1DURA 2XO7A 1QSYA 4M5GA 4BC9A 1B3TA 4AFFA 5BR8J 3VAIA 2CPFA 2DNNA 4DDFA 4OX6A 4BHQA 2AX1A 1R8AA 2J7KA 4OYBA 5J2PB 1RSCA 1HHTP 2O66A 5LIAA 1R0AA 2E7XA 2JFDA 2L9NA 1FI4A 4FKXA 4FXVA 5KG6A 3MFHA 4EYIB 1FDNA 2HFVA 2L48A 4L6V3 1LFWA 3AD7C 1D1UA 4IKAA 2HNDB 3NKOA 1SH3A 1LW0B 4KKOB 3TEGA 4WFZA 4U6PA 4IO9Q 4RW8A 3VVTA 2XY7A 1R0CB 4I7FB 3K57A 3NOGA 4J9PA 4QYZK 3T01A 5CD4H 4MIVA 2HNYA 2RJZA 4TLRA 4WCEQ 1FDBA 3L9ZA 4YS2A 4QU6A 3KUHA 1ZZNA 5ETQA 3CCLS 1WTFA 4OJ1A 4CT8A 3OBIA 1NM2A 2V0NA 2EFOA 2DY9A 2NXJA 2YKOA 1RDRA 4LIRA 1IR0A 3W65A 1JLFA 3ZTOA 2EBGA 3QAUA 4OHYA 4P2MA 4PR6A 2BVZA 1NAQA 2B4OA 1Q1KA 3V2UC 3HT3A 2H4YB 4RW9B 4BWMA 4OI2A 3UNYA 4YDDB 1N56A 1IQZA 2PMHA 3DHWC 1HNWF 3MM8A 2OPQB 1KC8T 1NJYA 3RR8A 3C19A 3J7Z5 1J5EJ 3QT7A 4DLEA 2LLZA 1TUWA 4NLTA 2CVEA 2DRBA 1YIJS 3LW5C 1S49A 2QGFB 2VL1A 2O1PA 3PRDA 5LMNF 3D6HB 3H2LA 4PG7A 3TQEA 4DQQA 1LK7A 1TV6B 5KG3A 2B4VA 1IKVB 1WJ9A 3BKUA 4K5SA 4ZP6A 4EI2A 2YQ3A 1RCOB 3W5YA 1XR5A 1DTQB 1MN7A 2OEJA 3QSIA 4LSZB 4O4RA 1WKJA 2QN6B 3OVSA 1SL1A 4OYOA 3EZ5A 5HLFB 3AJ1A 2HMIB 2OD6A 4UOOA 1VLYA 4MAKA 4AQYF 4PUOB 1NSPA 1QD1A 1YZ6A 2WSCC 4YR3A 2CNOB 1AW0A 1CPZA 1AJDA 1ED8A 2FVSA 5C25B 2FPHX 1YJ9S 1KH7A 5LSLA 2NQPA 5D15A 1B70B 4WE1A 1KQFB 4JOUA 1U6ZA 4ANCA 2LA6A 2J0WA 2FGOA 2GQ2A 2V9KA 4PQAA 4U96A 4X4RA 1YG0A 3QO9B 3MUTP 3ILOA 2LDYA 2W2NP 3QGPA 2JDJA 5DZ6A 3NGSA 4C8ZA 3KMQA 2HKEA 4MT1A 6FD1A 3EZUA 1SB6A 3CPWR 2P6TA 2CA9A 3KJNB 4IDKB 2PN6A 1VMBA 4DCPB 4RUHA 1OPIA 4IQMA 3AOBA 4IYQA 4OZ1A 3RZAA 5BYSA 1MWYA 1XMQF 2ZZNA 3BSOA 5HQ8A 2G1DA 4KO0A 2BUNA 2HLUA 3M8RA 4PG5A 3DLBA 2BJ3A 2VUGA 4DPYA 2ZH4A 3TUJC 2XS7A 3BN4A 2LQBA 1S1TA 2XYPB 1V6HA 2LQ5A 3HD1A 3IC1A 3IS9A 4WK3A 3RTVA 3IWLA 4C8LA 3MAQA 2FYXA 3DU5A 1R6YA 2HK2A 5C66A 4IQXA 4QW8A 2OPPB 1Y5LB 2MZSA 2R9LA 2FTRA 3CC2S 4X4VA 8ATCB 3GIIA 2CQPA 5LRMA 1FVSA 2DGWA 3B8HA 3KG4A 1UW4A 3R7BB 2VQFF 4CXSA 1FWKA 1MWZA 1XWLA 1U26A 2GJ2A 1S1XB 2RE1A 3RBZA 4X66F 4N47A 2DD8S 3PYGA 1SJQA 2IBOA 3I4HX 2YNIB 2XMAA 2R7TA 2BJEA 2W8KA 4XTTA 3GJTB 2BRKA 4XK8C 4KAVA 2BOPA 1TKDA 4PXBA 4C8MA 1RWWB 2IUCA 3TZYA 4DV5J 1AZSA 1I94J 4IRKA 5IV4A 2RRAA 2EWHA 3RRKA 1Q79A 1O51A 1XMOF 1N5VA 2QA4S 5ETRA 1X31C 1MROA 2RF2A 8AT1B 2ZWPA 5G0RA 3KK3A 5L0BA 4MIBA 3MMBB 2PT0A 4ATNA 1HARA 3MM6A 1VBXA 1S77D 2D1CA 2GHWA 3GCXP 4KBIA 1FXRA 4WU2A 4ZVGA 3OTEA 1RUSA 2ILZA 2MSTA 4DPWA 4EFAC 4XDCA 4EBCA 2JFKA 2W1BA 2YBVA 3BZQA 4WBFA 4U8VA 4J9RA 3K5NA 4NXNF 1V5VA 3RJMB 1NPPA 1N54B 1B0PA 4MKBA 5FLXU 2HW3A 2HNYB 2KL8A 3R5AA 5EUHA 2ZH2A 3VAMA 2GCFA 1ZAWA 2Q3PA 3RUBL 1X5SA 3UDEA 4LFAJ 3LH2S 2R8IA 4NL5A 3Q23A 4NCGA 1RTDB 2ANHA 2VG6A 1RWPB 2MZJA 3G6ES 4DV3J 1Z2LA 1RLCL 2LYVA 3IM9A 3U7JA 2V8PA 2W25A 1C0TA 5KFEA 3D6MB 5GAEI 4ZA1A 1GK8A 5JJBA 1WF0A 4ZHRA 5IWAF 1B7FA 2V4JB 2VPXB 2Y3YA 3K17A 4LF1A 5DS7A 1CLFA 4PWDB 1OS5A 2IA0A 4PYDA 1LXNA 2DNGA 3R97A 2OIHA 1KQSR 3NL0A 7FDRA 1U0HB 3O2IA 4LFCJ 5E3CA 2VBWA 3TVZA 3PCOB 4I64A 2I2YA 1VC0A 3I0RB 2IJRA 4J9UE 4BBYA 3RR7A 2EG2A 1NHVA 1NSAA 4URGA 1SJ3P 4XDDA 3UN5A 2QX0A 1TVRB 3JB9k 3TX0A 3T1YJ 3K58A 3WAYA 1QY7A 1L3SA 4NZ0A 2UU9F 3VGUA 1UVMA 1ED9A 2W01A 3IFEA 2HS0A 4ZJOA 3Q89A 4KY3A 2MGZA 1EI6A 3OV7A 3ED4A 3IA0A 4CLFA 2DH8A 4TN2A 1QTNB 2YTCA 3LP1B 3D0GE 4RBUA 5A6WA 3M30A 5AXNA 3QRRA 3OTOJ 3FQKA 2V8GA 2M5YA 2MMYA 5A76A 5IZHA 4ZVEA 4MMOA 1HW9A 5H9EJ 5CXTA 1R27B 2G2YA 2M0GB 2MQLA 2RS8A 1CJUB 3D3CJ 3ENVA 2ZBQA 4RNHA 4X65F 1GMVA 3JTOA 3H4BA 3MPDA 3CCUS 4K4ZA 1VLOA 1BWEA 5INHA 1S59A 2BOAA 5CYQA 5IWAJ 1H6KX 1FT8A 3PM9A 2AT1B 2AX0A 4YEAA 2DO0A 4GO5X 1UJ5A 3MPUB 3ETOA 1BMQB 1JLAB 2BANA 2VFUA 3NS6A 3QAEA 1SQFA 5J2QA 4MIWA 1QAJA 4UY85 2XSJB 2CQ1A 4K0KJ 2CQHA 2DGUA 4MYUA 1JLEB 3DLGB 1Q0NA 2ZBPA 5KFHA 2JRSA 3HSDA 2VPYB 3MF5A 3HT0A 3R3TA 3UDVA 2HLTA 5KFAA 4ZHRB 5J2NA 2G9YA 2KHCA 3KNGA 5MAOA 1S1WA 2RVJA 1U2FA 1HQUA 1YWXA 3EDRB 4EUVA 4DQIA 1AJBA 4Y00A 1SKUB 2EKYA 4G1PA 4YQWA 2GC8A 2NYIA 4ID8A 1BQXA 1M1GA 2N7YA 2OSQA 3TVKA 5DDRC 4A46A 5J2QB 2Z0GA 1S4EA 5CD4A 4ELTA 1WORA 1DQAA 4LF2A 3RGIA 5L1KA 1M5OC 1WEXA 4B3MJ 1JJHA 1I1GA 2XTJP 4GRSA 4ZPVR 2V8HA 4NOHA 5CYQB 4NLYA 1XMQJ 1LFPA 3TANA 3TAMA 3RB6A 4B3SF 1N5YB 4B3OA 3GIMA 5KFPA 3TAPA 4LSNB 3ILLA 4FS1A 2Y1JA 4Y0FA 3A4TA 2E5LF 1XNQJ 2IAJB 2KHDA 3NP5A 4DPXA 5EDWA 4J9OA 3M2VB 4DR3F 5HQLA 1OPZA 1VBZA 4QIWD 4F26A 4DBQA 1TKXA 3HFKA 2CWKA 3IBWA 4UUWA 3WIUA 2KRBA 4LUBA 2UUBJ 3TZWA 1KHNA 1RAOA 4IH6A 4GKJF 1EETA 3HZEA 4DG1A 3RB4A 1AJCA 1RAGB 3NNCA 2BKNA 4F67A 1ZTWA 1BLUA 3TOQA 1TL7B 2P9EA 3J80U 3NVLA 3W61A 3H5SA 5M2RA 3MM9A 5DLWA 2IVFB 2EFQA 3NWGA 3CIZA 3ZNUA 5CYJA 5KT7A 3C46A 1N0UA 3MTKA 1NDPA 3R6GB 3POTB 4DMZA 2G0IA 2CPYA 2CJQA 2C3MA 4DV7F 1KNZA 1G2EA 1NMEB 3ET6B 1X9WA 3D28A 4WXOA 4C11B 4NEYA 4EYHB 3WAXA 2WBRA 5DETA 1FDAA 2B9EA 3NS7B 1YHQS 1U1MA 5U47A 3AB4B 1M1KT 2DR6A 1BE4A 1GXLA 4DSIA 1HYSB 2ZHAA 2QYCA 2ZFHA 2PEHA 4XPCA 3C2PA 4M95A 1M90T 4J9MA 2WZ1A 1F5AA 1SUQA 2HRTA 3R5GA 3THPA 4D3HA 4ED8A 3KLGA 1RTZA 2W4PA 1RKJA 1SL2A 1JXLA 2VOPA 4OZLA 5AJ3F 4C0BA 3PYEA 4BLGA 1SJ1A 4ECRA 2DR9A 1KDNA 1TKTA 5DLTA 2CG4A 2FIUA 4DUYF 3A12A 2EW9A 1DLOA 1JK9B 3MR2A 2QA2A 4TYAA 2GSNA 2HHWA 2A2CA 1XEZA 1RWNB 3VALA 1ZEDA 5AE1A 1WC0A 4WYLA 3DDKA 2LQJA 2RF2B 1RU2A 4IG3A 4IH7A 1FRMA 1NUEA 3W9JA 3CJ2A 3GJSB 4ECVA 2D69A 3TA1A 3TRGA 5ADZA 4FVMA 4USWA 3J7ZT 3VTIA 2ZOMA 3T1YF 2GZOA 2HVDA 2HMIA 2MQOA 3MEEB 7FD1A 2XLIA 2C2RA 3J81U 2ZJPQ 2VIHA 2B8PA 3D68A 3WHIA 4C0HA 3UWTA 4K59A 1TL3B 1TL3A 2R8JA 1RT3B 2QO3A 3UVJB 2HQ3A 4X62J 3JSMB 1GQEA 1RTHB 3C66A 1VI7A 1RT1B 2DIVA 3UW1A 5GAHU 1FE0A 2OMLA 2IHR1 2VC1A 4Q44A 5ETTA 2KT5A 2YX4A 1T9TA 5HRTA 4EO8A 2IYIA 1JQGA 4JI8F 3D66A 1KLMB 1N34F 2ZUGA 1B99A 3W7BA 3C15A 5DQHA 3DOLB 1YGYA 3Q2TC 3CMQA 1JLCA 1B0TA 3GZ7A 4M5IA 3DDIA 1NKCA 5J1NA 3ISZA 3LGMA 4ZVHA 4B9MA 3A8EA 2KDOA 4MKVA 5GRRA 2W9CB 3HXMA 2F8EX 2R42A 1VC5A 2H5IB 3W64A 3K59A 1QVFR 2HRYA 3MM5B 2DR8A 4UPIA 1RXOB 2AIRB 3W62A 1HFEL 3BR9A 3OTDA 1FO1A 4DPUA 1PYSB 2P6SA 1GMUA 3GCWP 1RWKB 2BYCA 2IIHA 2WVEA 5D3GB 2V34A 2R7XA 1K47A 4J90A 4KHPJ 4K5RA 4DSKA 1NZ8A 4DV6J 4UT4A 1AUDA 4KKOA 4NMXA 3T9NA 3FC9A 4LSLA 3H40A 3MECB 1FJEB 1XNRJ 1I5OB 3OJUA 5KFLA 1YJNS 2XWXA 4ED6A 1VIXA 4C98A 5B0CA 3C15B 3JSRA 3KHHA 1J2VA 2YNHB 4X4OA 1WC6A 1GAOA 3MFIA 4M5DB 4FS2A 2CPHA 4ED2A 2A0FB 4CYUB 1RJJA 3D2WA 1R0AB 3QGIA 4CLUA 3VQTA 4TLQA 1QJHA 1F3FA 2J9CA 3KG0A 4O23A 3FEXB 4HTJA 2R3VA 5B0DA 2YNFB 5HMXA 4YHHJ 1VQ4S 3POTA 4DR4F 1MWQA 3JSMA 4F2SA 2ASDA 2AWZA 5AXMA 1RT3A 2RU3A 3R2DJ 2Z4PA 4Y28C 4NWXA 3GFHA 4AUKA 4DR3J 1TV6A 1VFJA 2B5JA 3KJQB 3Q8YA 1FERA 1HW8A 3KLEA 4O3PA 2ASJA 1HL6A 2VOOA 2UXBJ 1KHJA 2NPFA 3GIRA 4GKKF 4A48A 3THTA 1FRIA 1BHNA 4KAIA 2AJ0A 1N8RT 3V6HA 2FJEB 5JXSA 3KNAA 3ILJA 4PG8A 3R7SB 1VGYA 2KO1A 4ES2A 2EC0A 2W5VA 3SCJE 2RQKA 3JTPA 2N7CA 2AHOB 3NBPA 3TI0A 3AH6A 1JLBB 1PIEA 2JZ5A 3W8PA 1CJKA 4PKDB 3TAMB 1PYOB 3A1YG 4I6AA 4B3OB 2R7UA 1UEKA 3QPIA 1A0OB 2A10A 1HWKA 2CVIA 2MPUA 2DXEA 3OL8A 4L75A 3T41A 4ZITA 3W5ZA 4PXDA 5HROA 1U6BA 1H0HB 2PA8D 4J9NA 4N8NA 4O4GB 3NAHA 4LVOP 5L9NA 1A7GE 1XJWB 3IP0A 3ENQA 4NLPA 2GO9A 2QA1A 4HDHA 4K4WA 1MW7A 3UCZP 1HQUB 5GMKa 4FXDA 5HL7Q 1OO0B 2WOMB 3G2XA 1RT6B 3ZXWA 3EVMA 1KONA 5A0YB 2GW8A 5KG4A 3GR1A 1B64A 4KPCA 2W5XA 3LOUA 4UOFA 2XSJA 1QVGR 2VQRA 4C11A 1V3SA 2DY1A 2KU7A 4FDFA 1JLAA 2BANB 2NZ4A 4KE5A 1RWXB 2PD1A 2V2VA 2GX8A 4YR1A 2BW2A 2GSOA 4FNHA 4K4VA 1NXIA 3CMES 4LRAA 1D09B 1EJ7L 1TQLA 5IV3A 1I6JA 2BACA 1RHRB 4EK2A 2CQ0A 2RQCA 4F8RA 4IOAQ 1ITPA 2UUWA 1JXEA 1VQPS 3KOAA 5C24B 2HQDA 2KVQE 2RDDA 4HHUA 6AT1B 3K5LA 2PFDA 1F9EB 1ELXA 4NYPA 1HNIA 3VWSA 3H0PA 2RH3A 3GFYA 4LBHA 3QFWA 1HWUA 2ZH7A 3VAJA 3ZZZA 1K0VA 4M5JA 3KLHA 2QMWA 4CO3A 4JUZA 4URSA 2D3ZA 4Z37A 3DXBA 4HLBA 3M2VA 3TWZA 4LFAF 4OI0A 5KFIA 4CZCA 3ILIA 4XPEA 1P27B 1TVRA 1SJRA 2IM0A 2HG4A 1H2TZ 1NBEB 2GQCA 2VU5A 3M1VA 2DVIA 5GAGI 3W5XA 2WONA 2NSBA 2X7IA 4CO2A 2YKNA 2DCLA 2CAJA 2PO4A 3QLHB 4TU9A 5ETNA 2BX6A 2WW8A 5JVGQ 3CD7A 3SV4A 1BWVA 4M94A 3M05A 2FC8A 3CGIA 1UAWA 1X4AA 1ZYQA 4JI2J 4K8RA 1KEKA 3PW2A 1NPKA 3QJLA 4BDPA 1MMLA 3W2VA 2HFNA 2JLEA 3MM7A 3NLCA 4QOTA 1FKOB 4DPTA 5DLGA 2ALZA 5IJSA 5G4DA 4KC5A 2C2ZB 3OXGA 3K5MA 1WI6A 2C3UA 2JC1A 3SXLA 2DNHA 1VCTA 2W7PA 4C8KA 4B56A 2DGTA 2GMLA 3FBEA 1RAFB 4KGKA 3TX8A 5B09A 3NG8A 1WTBA 1RT5B 3OTOF 2DR7A 1APSA 4DJBA 2FHKA 4G65A 3M6UA 1IKWA 5EWFA 3CDAA 4Y6IA 1ALJA 1SXLA 3I31A 4X65J 3MM6B 2W8LA 2UUAJ 3K89A 4QPTA 4LF6J 4JV5F 2XBPA 3LPYA 5L0EA 2J8SA 2P9GA 2RKIA 4OHZA 2XZWA 3UNGC 4KPYA 4NEZA 4CLWA 4WFAQ 4EMDA 2AJ2A 2PMZD 4USVA 3G71S 3OW2R 1TFYA 1V3ZA 1S97A 2H54B 3T02A 4W4MA 2EFVA 4DR4J 1FKAF 5IM0A 2CADA 4IH5A 4CNZA 4TU8A 1X5OA 3FNNA 2V9WA 4EBDA 2GAGC 2WHOA 3ENAA 3N4WA 4ZMMA 4WFBQ 3M9MB 3OR1A 1KHWA 5KFUA 3DM2B 1NJZA 2DNOA 3DXSX 3E3XA 5H9EK 2IY5B 1S12A 2FVQA 3CCQS 4ANEA 3PW4A 1N88A 1Q8IA 2BA9A 2HVEA 2VFRA 4I6YA 4WJBA 3EM1A 3HHDA 3MGJA 1RHUB 4GC6A 1XR7A 2NLWA 5D6GA 3PW5A 2QMXA 3SZYA 2E9TA 3BGFA 3CD5A 2H48B 5HN0A 4B3SJ 1FE4A 2ZBIA 5HAOA 5IXUA 2RUSA 3G82A 4AXJA 4H4OB 1N33J 4Q43A 3OSNA 4ZVFA 5DDOC 2KT3A 1FVQA 2E7WA 2AJQA 2LEPA 2A6OA 1S57A 4HHHA 3G86A 2RDIA 4YN3B 3MOJB 2YWWA 3U1LA 2XR9A 4C8OA 2FVRA 1TMJA 1WC3A 1FD2A 3LUYA 2MKIA 2AW0A 3I9V9 2J76E 5D77A 1XERA 5ETKA 3K0JA 4MFBA 1P1LA 2C2MB 2CQGA 3CEDA 3UDCA 5DM6Q 1E6VB 3H90A 5J2MA 3JTNA 2Y9HA 3UD4P 1SHQA 3DMJB 2CRLA 4A8WA 3W9IA 4UY8T 3S7RA 3BYPA 2RU9A 5IS2A 3PR4A 4XO0A 1DY3A 1RTIB 3HHEA 3HO1A 4ZK7M 2DNRA 1LNQA 1YQHA 1R7IA 4W98A 4CM2A 3MK1A 1K9MT 2KH9A 1E6YA 2E1AA 2JVOA 1ZM2A 2H3EB 3MCSA 1GH8A 1RT1A 3P96A 3KD8A 4N8OA 3I96A 4ZCKA 3CO9A 3IR6B 3QBCA 4OZ5A 1RAAB 2LP4A 1M5SA 4KGMA 1Y4ZB 1UVKA 1VHFA 2MKKA 4WU3A 1K8AT 1AXQA 1ZZFA 1IBLF 1PJ6A 3M2UB 3AB2B 2RUGA 3GFZA 4O3QA 5E41A 3M9OB 3ADAC 2X3DA 4WK1A 1PO6A 2DNLA 2PA3A 1E6YB 3UR3C 4RBTA 3JSBA 2C2KB 1JLGB 2EXUA 2QRRA 1CQNA 3SSSA 4DL4A 1FJ7A 2OPQA 2BQRA 1JWWA 1KVIA 3GMGA 3GIKA 2CFXA 3D4JA 1C4CA 4UZCA 3ZZ0A 1VQLS 2WVFA 3DKDA 4RR5A 4X84A 2JEGA 5HVHA 2NSCA 2QTWA 2BKOA 1NSKL 2H65B 3MECA 2E66A 4F25A 4TXSA 2JEFA 2VA2A 2FUG9 2D3OR 5EGHA 4LF9F 3BBBA 5GVQA 2XS5A 4RNFA 4DR6F 3M8QB 2P5VA 5E3PA 2K3IA 4K4TA 2ADBA 1VQ9S 5L38A 2RQ4A 2J8AA 4I7FA 3W1YC 3N6LA 4V19X 1U1NA 3B4MA 4O44B 4HL9A 1K0TA 1YJUA 2R8GA 4H54A 2W4DA 2IMOA 2ATCB 3I0SA 4OYXA 5D0GA 4DFKA 1SJFA 1PG5B 3KJVB 4E0DA 3DLHA 3LGHA 4AL6A 3EX7B 1IBLJ 2BM1A 3ETMA 4DF8A 3HX9A 1UVNA 3IN5A 1UJ4A 2KM8C 1K7HA 4DV1J 4QIVA 2MEWA 1HR0J 5D4PA 4F3OA 1FTRA 2RQMA 3C6UA 2IDEA 5KFSA 2UV8A 3H8YA 3FBCA 4I4BA 4OYZA 5E2QA 1S4FA 5ETOA 1RT7B 4I2QB 2DXFA 2IVYA 3BQ1A 3C8YA 3DLJA 2JJ4D 3UD5A 1JNRB 2VB6A 3US5A 1CJVB 3PG9A 3QT6A 4KV8A 6FDRA 5KFJA 3ZTPA 1YX2A 1NB7A 2NUHA 4YB5A 4ED7A 1IR1A 5BR8F 2WSFC 1LKZA 3DRSA 2CQIA 4LF9J 2ZC4A 4B3TJ 3A52A 1F3VA 2KRRA 2KXHA 2CQDA 2CQ3A 4NZ6A 4U9RA 1Q81T 4DPOA 5D78A 3KK2B 1TKXB 4B3RF 4HH0A 4P7TA 4DV6F 1ALKA 3W2WB 4DL2A 2DRDA 1SC6A 1RA7A 4A8KA 1W26A 2M8DB 4UOPA 2XMVA 3M32A 2EFNA 2ZD1A 4JV0A 2XI3A 2HZVA 3AA8A 2Z8QA 4GVBB 3ZC4A 1NU4A 3QWPA 2ZKUA 3SEOA 3FCHA 4IOCQ 2QSWA 2NZCA 3MEKA 1PAUB 4Y2CA 2CZ9A 3PZPA 1JB0C 1T9YA 3UR0A 3RU0A 1NRKA 3GR0A 1N6QB 4ES3A 4NLDA 1RT2A 1Y00A 1IBKJ 1IKXB 1S0VA 3CDUA 3QT5A 3MM7B 2Q6CA 2HZCA 2KG1A 1FTCA 1HBUA 2OUGA 5KFKA 2BR0A 3DPCA 4V1Ak 5KT4A 2RHQB 3DOKA 2OPSA 5CABA 2VDIA 5L8RC 1S7IA 1RADB 5C2GA 1IBMJ 3H5XA 2AD9A 5H9FK 2B6AA 1E2SP 1ALIA 4X64F 1OY9A 2FJXA 1UWAA 3OUYB 2E1MC 3HHLC 4MKYA 3CO0P 1FD8A 1H98A 1U09A 2K3KA 3CCTA 1UFKA 3QLHA 4LRFA 4NRTA 3L09A 2C3YA 3HKWA 3FSXA 2R2RA 2LVWA 2ZBRA 4A8QA 1JIHA 1FX2A 1CJTB 4DL3A 4A8SA 4ZCIA 1YJWS 2AYGA 3KTQA 5K4PA 1Y0HA 5F3ZA 2F9JA 2H51B 1HMVB 3MEGA 3NGRA 2AZ3A 3KKFA 3HMJG 3DN9A 3R27A 4RW6B 5CQGA 3OVAA 3DGVA 5HI7A 1O99A 5F8GA 1URNA 1RHQB 3V6JA 1UEVA 1FWLA 3KYLA 4I2PB 1YJVA 2CKWA 3R6LB 4RWWA 1U45A 3DOMB 1RAHB 2MLXA 4V19J 1H38A 3QNWB 1GNKA 1RISA 1IKWB 2CPDA 2D41A 3MDFA 5D8HB 2OLWA 2N3LA 3I82A 2IRUA 2OPRA 3GV7B 1DBDA 4USHA 3I0RA 1HHQA 1NK5A 1IBMF 4NLWA 1WKKA 4GTWA 1WSRA 5D4NA 4N7TA 1SIWB 4F4AA 4GO7X 2IA6A 1KTVA 2K7KA 3M9NB 3FSIA 1FKPB 4LRDA 2R7RA 3SQOP 4K4YA 1X4HA 5LJ3Y 4KJGA 5KFBA 1ULRA 2FGCA 1VR6A 3DOKB 4B9UA 4DV0J 3EXCX 4WP3A 2FDNA 2D9OA 3HVTB 2JL9A 2ZOFA 3PRBA 1P9QC 3DI6A 3DLGA 3DLLQ 5IT9Y 2VICA 1N2LA 1U25A 2J0QD 4CO0A 4KTQA 4NYOA 4RNNA 4Q2LA 5A2QU 1NB2A 2OJ3A 5F8HA 2NS1B 3UPFA 1SIZA 4RUCA 2NR0A 3CIMA 1MG7A 4QPXA 5KG7A 2XYGB 4MKAA 3G9CA 2K8GA 3G87A 4N77A 3BO4A 3X1LB 4DR7J 4PPDA 3TUIC 4C3LA 4LR2A 2RHSB 1FK9A 2YPZA 5HATA 1V3RA 3WX8A 2R2TA 1S9GB 3KXDA 4BWJA 4I2PA 4EO6A 5KT5A 2ALYB 1NDKA 2XULA 3NWRA 4C8NA 2Z58B 3MD1A 2XCAA 1X4EA 3H5YA 1KWMA 2QG9B 4K50A 4FBTA 3IGNA 3EXYA 3R5CA 1U8WA 3CB4A 2IC3A 4E98A 1HI0P 1F60B 4HR2A 5LMUJ 4ED1A 5T41A 2B5JB 5F8JA 2VFSA 4CLZA 1TL5A 1RU1A 1FRHA 1KHVA 1AT1B 1CULA 2L3MA 4NASA 2VONA 4HACA 3CULA 4PAAA 1RWOB 3LQVA 4M63A 4Q8FA 1S6QB 3E8OA 2BE7D 4ZVTB 4CLYA 4AYBD 3LWLA 3KHRA 4BCAA 1Z4UA 4K4XA 2E1CA 1U0HA 1D9DA 2Y0BB 2JNJA 3FMBA 1E3CP 5HVFA 5EWEA 4H4MA 5E3RA 4CYUA 2HNZB 1WG5A 5F8IA 1SL0A 1KRPA 3IBCB 5L46A 3TAQA 4WWSA 1YKWA 2OSRA 3M8YA 1U49A 1S1TB 5B0GA 1C0TB 4QR1A 3KJVA 1EW2A 4LBIA 5THWA 2WOMA 5A0YA 1EKRA 3CJTA 1MN9A 3I4PA 5C5JA 4DQSA 3OR2B 4BS2A 1REGX 4F02A 1NKEA 4PG4A 1W7WA 1IKYA 2DXDA 1UWBA 2DNYA 2YQ1A 1BQNB 5A8RA 1MLAA 1HI1A 3FZBA 4OI1A 5KFVA 1WOPA 4M5KA 4CLPA 5KOXA 5KFDA 1QDUB 1PJ7A 1IJFB 2MHEA 2RB7A 3A8KA 3G4SS 1XN9A 3HSGA 5KFOA 1HNZF 5K9FA 4ZIWA 2DNKA 4MYTA 4MK9A 2GHPA 4JI7J 1RQ0A 2GMHA 1JLBA 2PIIA 3PJ9A 1J27A 4RX6A 5G0RB 3KK3B 3U1MA 4ILRA 1KTQA 3VZIA 3CCRS 3CDEA 1PCAA 2FLNA 2CXEA 2C3OA 2WVBA 3MWBA 5GAGU 1QTMA 2E5JA 1P6TA 1WDTA 3AT1B 2R7QA 2R8HA 4F4WA 1SJ4P 1U4BA 2FJBB 3S01A 3V4IA 1QE1B 3QJJA 3FCWA 5HP1B 3OL7A 3KLEB 3CXCR 1ACMB 1CJVA 1T02A 4KFBA 4KV8B 5IQQA 1OSCA 5HMZA 4DCOB 4B9VA 5LRNA 4ZVRB 2CIMA 2QC3A 4NI2B 2O01C 4OX8A 1S1XA 4YUDA 3PRVA 4ZLPA 3PVXA 1ZM3A 2VBZA 2YNFA 5HP1A 3HHNB 1KFSA 5LQQA 3MMJA 4OZNA 4UF4A 4R0JA 3MR3A 4DV1F 3MK0A 2NCKL 1LWFA 2DNPA 2OHDA 1FRKA 4KRWA 4TVAB 1EZZB 3D1QA 4ZN3A 4YR2A 1F1BB 4GTZA 2JLGA 1PJ5A 4RW4B 2JHEA 1RHMB 4Q5VA 3I5BA 4W92B 1O6XA 1VJWA 4NLQA 5E3QA 5ETVA 3NKMA 2YWEA 5HMYA 4CI0B 1T95A 1Q86T 1E6VA 5J2MB 3NXZA 5D4OA 1Q5VA 2NXNA 4UQGA 4Y34A 5AXLA 1R89A 1VYAA 2LEBA 2GIRA 2HZAA 4MHXA 3MM5A 2QLXA 1SH2A 2D7SA 2C22A 2DHHA 2QT7A 2HYIB 2BDPA 2CPXA 2ZJRQ 2X51A 4ER8A 4OZJA 2HNDA 1QM9A 2YH0A 5M2PA 3LPEA 1C0UA 5F9NA 2I9SA 2DJWA 3TG0A 3BQ0A 2MB0B 4C97A 1REVB 2M52A 1JLGA 3CC4S 4G1QB 4JI0F 2MHNA 4X4TA 3D54A 1TUVA 5KG1A 3L7UA 2C42A 4ECSA 3VZHA 3EYZA 3N5BA 1X0PA 3NMAA 3B54A 3D0IE 4DR2J 3KHLA 3WC2A 4NX9A 3ITHA 4PWUA 3QIPB 2M7SA 4RJVA 4AD6A 3MMCB 3FBFA 2LQ8A 4QIEA 4ZLNA 1WNEA 2WSEC 4IUFA 1GMWD 5FDLA 2UXDJ 4L73A 1KHKA 4HH1A 2AYEA 4ZVSB 2BQ3A 4TY8B 1TL7A 1T9VA 2IC3B 3A3OB 2MQNA 3PO4A 2HQGA 3SDEA 2KZZA 4J9VA 4I67A 2XHCA 3NKNA 1JMTA 3OXLA 1HNXF 3JQMA 1M5HA 1X5PA 3HLUA 3Q8VA 2MJUA 1AUKA 3NKQA 2VA3A 5LMUF 3EJMA 1EB0A 2IFYA 2YXLA 4EBEA 5SUHA 1W2BR 1WHXA 2K1RA 1JLFB 2LCWA 4OFZA 5KG2A 1T9XA 4DXLA 4KM4A 1FEHA 1KFDA 1N5YA 2CG8A 4OL8A 3HJVA 3DFEA 1XBWA 3M8PA 5ETMA 3TR5A 2LU1A 3VCDA 2ZHOA 1WEZA 3WAVA 4NXMF 3TZZA 4JI0J 2FHMA 2NREA 2W5RA 4A8FA 2WCXA 2XYHB 3MAHA 2WW4A 1RK8A 2GVZA 5HMWA 5J1EB 1WSVA 2XHWA 2XSFA 1VRQC 1IR2A 2LXUA 1PBUA 3LP0B 3P4UB 2FZKB 3KLIB 3HSJA 4IFYB 2R7OA 1FFSB 2VFTA 3K2YA 5H1SV 1HWLA 3B78A 3QT8A 1N33F 3HDSA 4USTA 3JAMU 2YQ0A 4UOHA 3VF0B 3TJ8A 1L3TA 4OX9F 3BDPA 1Q8LA 1TUGB 1PYTA 3OL9A 3PYFA 1LK5A 2YWGA 1X9MA 3LALA 3D1OA 3T19A 1B0VA 1WDDA 3DRXA 3T5LA 2AGPA 1YITS 1NK4A 1RBAA 4GC7A 4LREA 2XWYA 1AUSL 4NE9C 3A8JA 3SFUA 1S6UA 3DYCA 4DQPA 1EAYC 2E5HA 2EFPA 2YPYA 3MMAB 4HACB 4KIAA 4C7QA 4DZDA 3GSDA 1LQ9A 4I56A 2GIFA 3KUGA 1TK5A 1S0NA 2W5TA 3BDFA 4OHWA 4CT9A 4DHVA 5LT5A 1KBRA 4YY3J 2W7OA 2A3JA 2JOQA 7AT1B 3Q3QA 4CLLA 4ZP9A 4NXMJ 1TELA 3BGLA 3U27A 1AFJA 3Q86A 1U48A 1IBKF 4LF8F 2ZUAA 4IO1A 4LIWA 2HEKA 4TNOA 1VQ7S 4CRJA 2XGQA 4QYRA 1YDLA 2CNKB 2HWHA 1I51B 3RBDA 2KFYA 2V63A 1U1KA 3MHYA 2YH1A 1Y5NB 3CE8A 4UPHA 2DNMA 2RILA 3HM9A 4USJC 3PR5B 4UOCA 3CJ8A 4DX5A 4N76A 2OEKA 2MQQA 4RU2A 2HQIA 3ZO7A 1RWVB 4KYZA 1C1BB 1X60A 4IG0B 2CQ4A 2KYXA 3DI6B 2FJDB 1HI8A 1NNDA 1TL1B 1S1WB 1HD0A 1VDHA 3SCKE 1E33P 3J7A1 3IM8A 1RT6A 3E51A 1URBA 1F2HA 2FHJD 1ROFA 2MJNA 2DHXA 2VH7A 5J2NB 1SH0A 3J7AN 1C1BA 1U0SA 4B9TA 5F8NA 1O5JA 4L76A 3PEHA 1AA1B 5DJBA 3IDDA 3R2CJ 4ED0A 2OGUA 3QWUA 2ZHBA 1E1ZP 1R8CA 2W2OP 2YKNB 4OIXA 1S1UA 5KFGA 2ASLA 4NA1A 3M8PB 2V69A 3NAIA 4J9LA 1Q82T 1XK8A 1ZA2B 1HQEB 5DDQC 1S1VA 4S0MA 3BDGB 3A3NB 3DOMA 2RNEA 3ZZOA 1VC6A 2R7VA 3OT9A 1S10A 3ZTSA 4P2XA 2FJVA 4QU7A 2UXBF 2XGPA 2DPIA 2J6TA 1VBKA 2LQ9A 3J7YU 3BF4A 4L3KA 2AMCB 5E5NA 1B4SA 1HNIB 4Q8EA 1F5CA 1YJTA 5FIIA 3D6FB 4DUYJ 1XMOJ 1O98A 1MSWD 1EARA 1BQMB 3RYLA 2L9DA 1UEUA 2LXFA 3UI3A 5KOWA 1QSSA 2PFFB 2HAFA 3GE9A 1EKSA 1EX8A 2FY8A 2RRNA 1X4CA 3FFIA 1T0TV 3ITHB 3U1NA 2ILYA 5K8MA 2ERRA 1NJXA 1CBKA 2J5AA 2X1FA 3W63A 3SV3A 1OQ6A 2J6UA 3OJSA 5MLCV 3FCVA 5GAHI 1UZHA 3SZ2A 3L7OA 4ZVPB 4CWBA 3OUYA 2ZM6J 2JEIA 3CMRA 3T00A 1WHVA 2RD5C 3CCZA 1UETA 3NKYA 4EGLA 4RZRA 4O0NA 4OYWA 2V4JA 2HVIA 1Z1ZA 4QZVB 4CP5A 2W7AA 3GPAA 2W4CA 4DV3F 1VQKS 3KFWX 1EQMA 3GLJA 3KLIA 4R0EA 1LWEA 3S8SA 3PJXA 5I3UB 1LV5A 2UVUA 4IFVB 3CC7S 1AFIA 1OQ3A 5KT2A 2GVZB 2CDRB 3IR5B 5E3AA 4DN9A 4DX8H 5EGEA 4HTIA 4NCBA 1BY9A 1OY8A 1IJEB 3FEYB 2GJIA 2VZ9A 3IWXA 4ZS6A 3KUEA 2VQEF 4YOEA 1O8BA 4LFCF 4RBVA 1RWUA 5F8MA 5IOLA 4L3NA 4DUZF 3K7RA 2YX7A 2ZD1B 1WD6A 2QL9B 4B02A 1HHSA 2XNRA 1U1OA 4WE1B 1FX4A 4QWDA 2XLJA 3B6BA 5HJYA 4AE5A 4QYZJ 2EG1A 1NH8A 1YBAA 3DU6A 3OXFA 5LSOA 4OYAA 4E8UA 4KGXB 3AJDA 3EMTA 2B4UA 2DGSA 3AFGA 4MK8A 4E2FB 2ZM6F 1F5BA 3H7HB 3SDEB 4OLOA 2BKPA 4X4QA 4OV6A 3J80Y 2MKSA 5IC6B 1RGVA 1X5TA 4P7VA 4YB1P 1S6PA 1FRLA 4NI2A 4UORA 5A8WA 3I55S 3LAMA 4JP8A 2UXCF 2MLYA 1DAXA 2ZVIA 4ECQA 3IBFB 3LA0A 3UDLA 2W8DA 4G1IA 4IR1A 2XMUA 3V4IB 1GX5A 3AY0A 2C2OB 1CG2A 1CC8A 3EVOA 3HFZB 4G1QA 3LP2B 2LFVA 1OYDA 3OFGA 1UA1A 1HQAA 3QYYA 3NKRA 1DQ8A 1P8GA 2NXEA 2HGNA 4IG3B 3MK2A 3Q8PB 2Z57B 3BJYA 1TL4A 2K7JA 1RAIB 4K4UA 1HNWJ 2DKOB 5GAEU 4IDKA 3E2EA 2EFGA 2VV5A 4R8UB 2FLLA 1OY6A 2Y0SD 1SKRA 3CTRA 2U1AA 3FUYA 4USKA 4Y2IA 3GIJA 4R5PB 4WF9Q 3QO9A 4OZ2A 2R8KA 5JUMA 2XEXA 4RW8B 4X4PA 5IT4A 1SQGA 4DR1F 2HFSA 1VIOA 5KFRA 2Q66A 2BJ7A 1ICEB 1JLCB 2FHJA 2C3PA 3AQOA 3D3BJ 3VR1A 1UVLA 2LKZA 2H4WB 4HHJA 4NWBA 4GVLA 1URAA 1WF2A 4DSEA 1D8ZA 4Y2MA 2KN4A 3CWJA 4H4MB 3ET6A 3PDNA 1DARA 3N5FA 5DO2A 4F36A 1U6FA 4ZP7A 3RAMA 4FF1A 2H5JB 1ELYA 1IN0A 2GQQA 2V2QA 1KVJA 2HQFA 1LW2A 1NSQA 1U24A 4ZKAA 3OVBA 3FFIB 4ED4A 3GYNA 3CJKA 3OR1B 3PEJA 3WC0A 1SBRA 1CULB 1K73T 3DLKB 2FVPA 4Q0BB 1HNVA 3PFEA 1A9NB 5IM0B 3P5BP 4LFBJ 2CJ9A 2QLFB 2HHHJ 1GT8A 1Q8BA 1R3NA 4FYWB 1H2VZ 4P52A 1NK0A 5I3QA 3W8GA 1QLNA 3IWNC 3BGRA 2BJ1A 9ATCB 2UV8G 4G6VB 5F0UA 4FDJA 1HBMA 2W9BB 4KT0C 2EPIA 1C1CB 1C2PA 2VBXA 2JWNA 2B9XA 3DMJA 3MTJA 4U8YA 5IT0A 3KHGA 3G6YA 3FK4A 4LSNA 3WX4A 3L4BC 1U47A 4G3IA 1WG1A 2BQUA 3HVAA 3DDNA 1RT5A 2HSEB 5DLFA 5CH7B 1ZTTA 2DHGA 2IBKA 2N4DA 1Y6VA 2KXFA 3X3UA 3FGVA 2BE2A 5AJ9A 1FRJA 3IAM9 2AGOA 1RHJB 1YSJA 4ILMA 3PACA 1PBAA 5K8OA 4MJKA 3SBMA 1Y3JA 3O3LA 1KH9A 1FKOA 3OR2A 1FFWB 1FRXA 2QLBB 3Q8UA 4UW2A 4WPAA 1HYSA 5E0OA 4ZG9A 4CM0A 4LR9A 4YP3A 3BREA 3TYTA 4DR5F 4KHRA 1Q4RA 4ECZA 2OKQA 1PC4A 3AD9C 3MCMA 1JLEA 3GONA 1FKPA 4LFBF 5IT9U 2V5HG 4QCLA 4NWJA 1X0FA 3JQJA 4HKQA 2MQ8A 3LGNA 4AXIA 5A2QY 4U7UK 3KLFB 5GOVA 3AOAA 4DUZJ 1F9HA 2ROEA 4A8YA 4Y65A 4QAXA 2OPRB 5EN1A 1R8HA 3AAWB 3C16A 3DM2A 2G0CA 4OLPA 1HWJA 1JJ4A 1HBOB 3KLVA 4CH7A 1U7LA 2AEMA 3F44A 1RT4B 4TQRA 4YDXA 2AEFA 1S9FA 4F3QA 3RW7A 1TTHB 3LWMA 1RAJA 2XY6A 2ZH1A 3CCES 2KZMA 2DR5A 5DLVA 4ETZA 3J7YI 5AE2A 3BSAA 1KD1T 1YRTA 3H5UA 4FYYB 3EE3A 2JVRA 1RBLA 1VQ6S 1QAYA 2I0XA 4TKTA 1N34J 1S5ZA 4A8XA 4WTOB 3BSNA 4CXUA 2DH9A 1YRUA 3IGVA 3CCVS 4USUA 3RBXA 1GTEA 3LO3A 1VQYA 3CCJS 1RT4A 1FJGJ 2I5JB 2UXDF 4FP9A 1HQEA 2J7WA 4P2SA 1DZ5A 2E5IA 4OJGA 3SMZA 3OL6A 4WKRA 3VGSA 4WFXA 1H73A 4GKJJ 2IRYA 4X4SA 5L39A 4RW7B 2XMKA 2ZNYA 2MQMA 2X1GA 4K7QA 1SQEA 1CS4B 4JI3F 3EDQB 4LR7A 4JYAJ 2DYAA 3HI9A 2CQCA 2O5DA 1RYRA 3N28A 2RDJA 4ED3A 2CQBA 3K8VA 1RTDA 2G1HA 1RT2B 5GMEA 1JKHB 4M5LA 1X4BA 1WACA 1U2RA 3CCSS 4J9QA 1TAUA 1IWGA 4Z7YA 2E9ZA 1L3UA 1PAEX 3GYGA 4YHHF 4DFPA 4P74A 2GFFA 3CDBA 4DR1J 3EWGA 3HVWA 3M1VB 1UKUA 3DRRB 3JQKA 3BM7A 4LF8J 2K2PA 2Y1LB 3CNQP 1CJUA 1FFGB 3FRYA 3IR7B 2K1RB 1DQ9A 1M5KC 1N2KA 1FNOA 2HBZB 1P1TA 1TZ0A 2HFOA 2WTFA 1S72S 4AL5A 2CPJA 1VISA 4DL0C 3EGZA 2EKNA 3CD0A 3GSIA 3SSRA 4X4UA 1X7VA 2I38A 4J5OA 4OQJA 4K0KF 1IWAA 3DRSB 2W2QP 5KG5A 3CD6S 1Q16B 3R5BA 3WQPA 2ROPA 5KT3A 1P9YA 1RZMA 2YKPA 3J81j 3DLKA 2MZQA 3OFHA 1ZPVA 3KJFB 4NZ7A 1EJJA 3MMAA 4TY9A 1S99A 4WTYA 2QFJA 4JYAF 3C16B 4N56A 1VRTB 3BR8A 1RT7A 1FCAA 4I2QA 2HBRB 5L1IA 3PKMA 1W25A 3B82A 4GTXA 3NOCA 1T03A 3WBZA 2ZEJA 2HBQB 2HHTA 2ZWOA 1NPRA 3M4XA 4P73A 3Q8RB 5KFCA 1G7CB 2P2CB 2GS8A 3KWMA 4B3MF 2QA4G 2IM3A 4KGVB 5KFFA 1QAXA 3KDOA 2Z2MA 3BKFA 3QSYB 4X4NA 1Q7YT 2E1RA 5L0KA 4IFYA 3MOZA 2ZE2A 2ZKTA 3G96A 3EGWB 5I42A 3C6TB 2GSUA 3CJRA 1CQMA 4F0HA 3M8WA 1DRZA 1LOUA 1H74A 4Q2MA 1UCNA 2ZVSA 4CH1A 1SPBP 4O4GA 3RAQA 4A8MP 2OFGX 4RNMA 4DI6A 1R43A 2DGQA 4WFYA 5IFMA 4R5PA 1TK0A 2UUBF
chains in the Genus database with same CATH topology
2XR9A 5DLTA 3SZZA 4KJDA 2GSNA 2W5XA 4TN0A 1E2SP 1ALIA 2VQRA 3WBHA 4NWJA 4UPKA 1SHQA 1ZEDA 3A52A 4CXKA 4LRFA 5LRMA 4LREA 3MK1A 3UNYA 4YR1A 1EW8A 2GSOA 4QAXA 4LRAA 3DYCA 3UN5A 2XRGA 5K4PA 3TX0A 2W8SA 5KXAA 4UPLA 1KH4A 3WAYA 3BDFA 2W5TA 3KD8A 5DLVA 1ELXA 1EI6A 1O99A 1P49A 3ED4A 3Q3QA 4LQYA 4UORA 5LRNA 1HJKA 2W8DA 5LQQA 4CXUA 3TWZA 1ANIA 3WAWA 4UOOA 1EQJA 3MK0A 1HQAA 5HRTA 1AJDA 1ED8A 4GTZA 3DPCA 5INHA 4FDIA 3NKRA 4UPHA 5GOVA 1KH7A 3B5QA 3MK2A 3IGYB 3NKMA 4GTWA 4N7TA 3UN2A 2D1GA 5EGHA 3M8ZA 4ZGAA 4LRDA 3E2DA 4LRCA 1KHLA 4KJGA 4ZG9A 1E33P 4UPIA 4ZG7A 1ZEBA 2G9YA 4LR7A 1HDHA 1URBA 4MHXA 5IJQA 1Y7AA 5TJ3A 4MY4A 1AJBA 5IJSA 2GA3A 1N2LA 1ED9A 1AJCA 3M7VA 3NKPA 1AJAA 3IDDA 4B56A 1E1ZP 1ALHA 4CYRA 1B8JA 1ANJA 3TG0A 3BDGB 3IGZB 1URAA 5C66A 1KH5A 1K7HA 3LXQA 4LR2A 1ALJA 2W5WA 4ZG6A 2W5SA 2GLQA 1N2KA 4LRBA 4CXSA 1ELYA 1SHNA 2QZUA 5L0EA 3OT9A 2RH6A 1KHNA 3BDHA 1FSUA 4KAYA 4NWXA 3T02A 1KHKA 4KAVA 3UO0A 1KHJA 1O98A 4LR8A 2IUCA 2IUCB 3NVLA 1EJJA 3NKNA 5DLWA 1EW9A 1AUKA 4FDJA 2W5VA 1ZEFA 3NKQA 5L0BA 2IFYA 4GTXA 4GTYA 1ALKA 5LIAA 1E3CP 3T00A 4CYSA 2W5QA 3CMRA 4UOPA 4KM4A 3WAXA 3SZYA 3UN3A 3BDGA 1Y6VA 3M8YA 3WAVA 5GRRA 1EW2A 5L0KA 2X98A 5AJ9A 2GSUA 2ZKTA 2W5RA 3NKOA 3M8WA 2ANHA 5EGEA 1KH9A 3T01A 4MIVA 1ELZA 4LR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XR9 A;  5DLT A;  3SZZ A;  4KJD A;  2GSN A;  2W5X A;  4TN0 A;  1E2S P;  1ALI A;  2VQR A;  3WBH A;  4NWJ A;  4UPK A;  1SHQ A;  1ZED A;  3A52 A;  4CXK A;  4LRF A;  5LRM A;  4LRE A;  3MK1 A;  3UNY A;  4YR1 A;  1EW8 A;  2GSO A;  4QAX A;  4LRA A;  3DYC A;  3UN5 A;  2XRG A;  5K4P A;  3TX0 A;  2W8S A;  5KXA A;  4UPL A;  1KH4 A;  3WAY A;  3BDF A;  2W5T A;  3KD8 A;  5DLV A;  1ELX A;  1EI6 A;  1O99 A;  1P49 A;  3ED4 A;  3Q3Q A;  4LQY A;  4UOR A;  5LRN A;  1HJK A;  2W8D A;  5LQQ A;  4CXU A;  3TWZ A;  1ANI A;  3WAW A;  4UOO A;  1EQJ A;  3MK0 A;  1HQA A;  5HRT A;  1AJD A;  1ED8 A;  4GTZ A;  3DPC A;  5INH A;  4FDI A;  3NKR A;  4UPH A;  5GOV A;  1KH7 A;  3B5Q A;  3MK2 A;  3IGY B;  3NKM A;  4GTW A;  4N7T A;  3UN2 A;  2D1G A;  5EGH A;  3M8Z A;  4ZGA A;  4LRD A;  3E2D A;  4LRC A;  1KHL A;  4KJG A;  4ZG9 A;  1E33 P;  4UPI A;  4ZG7 A;  1ZEB A;  2G9Y A;  4LR7 A;  1HDH A;  1URB A;  4MHX A;  5IJQ A;  1Y7A A;  5TJ3 A;  4MY4 A;  1AJB A;  5IJS A;  2GA3 A;  1N2L A;  1ED9 A;  1AJC A;  3M7V A;  3NKP A;  1AJA A;  3IDD A;  4B56 A;  1E1Z P;  1ALH A;  4CYR A;  1B8J A;  1ANJ A;  3TG0 A;  3BDG B;  3IGZ B;  1URA A;  5C66 A;  1KH5 A;  1K7H A;  3LXQ A;  4LR2 A;  1ALJ A;  2W5W A;  4ZG6 A;  2W5S A;  2GLQ A;  1N2K A;  4LRB A;  4CXS A;  1ELY A;  1SHN A;  2QZU A;  5L0E A;  3OT9 A;  2RH6 A;  1KHN A;  3BDH A;  1FSU A;  4KAY A;  4NWX A;  3T02 A;  1KHK A;  4KAV A;  3UO0 A;  1KHJ A;  1O98 A;  4LR8 A;  2IUC A;  2IUC B;  3NVL A;  1EJJ A;  3NKN A;  5DLW A;  1EW9 A;  1AUK A;  4FDJ A;  2W5V A;  1ZEF A;  3NKQ A;  5L0B A;  2IFY A;  4GTX A;  4GTY A;  1ALK A;  5LIA A;  1E3C P;  3T00 A;  4CYS A;  2W5Q A;  3CMR A;  4UOP A;  4KM4 A;  3WAX A;  3SZY A;  3UN3 A;  3BDG A;  1Y6V A;  3M8Y A;  3WAV A;  5GRR A;  1EW2 A;  5L0K A;  2X98 A;  5AJ9 A;  2GSU A;  2ZKT A;  2W5R A;  3NKO A;  3M8W A;  2ANH A;  5EGE A;  1KH9 A;  3T01 A;  4MIV A;  1ELZ A;  4LR9 A; 
#chains in the Genus database with same CATH topology
 3M8Q A;  1RAC B;  1RCX B;  2UU9 J;  2XMM A;  4RL1 A;  1D0E A;  4KJD A;  4M8L A;  1CJK B;  2Q79 A;  4TN0 A;  1KR4 A;  1JXV A;  3PJW A;  4F04 B;  2YWF A;  2CDQ A;  2MKJ A;  4OYM A;  5K5M A;  2G0J A;  1UVI A;  1KQK A;  1SCJ B;  2YNG B;  3MD3 A;  3SI8 A;  1SKW A;  1C1C A;  3V81 B;  3DOL A;  2G2O A;  2VC0 A;  2HHP A;  2GMJ A;  1UTA A;  3A3P B;  2F8H A;  5CHC B;  2V6A A;  4CLS A;  2AEJ A;  3NMR A;  3DC2 A;  4UUX A;  2OEL A;  4URQ U;  2W8S A;  1DJ0 A;  1KH4 A;  1G4C A;  4WIQ A;  4FF4 A;  2Z2Z A;  2C2D A;  4X2B A;  1RB0 A;  4TY8 A;  1RTH A;  1NK9 A;  3ONQ A;  3V6K A;  4ED5 A;  4B17 A;  2GHV C;  4LQY A;  1VJQ A;  2J7U A;  2X1A A;  1XMB A;  3F0N A;  3LAN A;  1VHI A;  1Q8K A;  1G1X A;  4IRD A;  2XG8 A;  1ANI A;  4Z7C A;  2UVV A;  1VQO S;  2I6W A;  3VAH A;  2FJW A;  1NKB A;  1LEO A;  3MEE A;  2ZH6 A;  4FNI A;  4FBU A;  3RRH A;  4LMZ A;  1R8B A;  2BV3 A;  3WAW A;  4CIO A;  2YNH A;  3SFG A;  2CUY A;  2UP1 A;  4MK7 A;  2B43 A;  4FDI A;  1Q7L B;  1ELO A;  1TFW A;  3TJA A;  1NHK L;  2DGO A;  3B5Q A;  3MED A;  3R1L A;  2HAI A;  1T9U A;  2F5G A;  3P45 B;  4LSL B;  2KJV A;  4R25 A;  2BJ8 A;  4JB8 B;  4YB6 A;  3CJ5 A;  2CQ2 A;  3HHL A;  1DLO B;  1EQ0 A;  1VQS A;  1H2U X;  4J37 A;  4NLU A;  4DU7 A;  3TUP A;  2X98 A;  4KB7 A;  4ZPA A;  4QWA A;  3OFF A;  3MI7 X;  3BDE A;  1HDH A;  2M9K A;  5B08 A;  2HHX A;  1G6B A;  2DEI A;  3HCX A;  5IJQ A;  3QAT A;  5A8R B;  5I4M A;  3E01 B;  3C3L A;  1EP4 B;  2BM0 A;  3Q8S B;  2DH7 A;  2XM3 A;  4QIF A;  3EPG A;  4JI3 J;  2J0S D;  4P2F A;  3CCM S;  3NKP A;  4H4O A;  4NRU A;  5H9F J;  2OEM A;  2POK A;  5L9X A;  4CLK A;  2XI2 A;  3CMA S;  4LVN P;  1U1L A;  2ZBC A;  1WC5 A;  3SQG B;  4RW4 A;  2B7C B;  2GGP A;  4F0K A;  4C48 A;  5C25 A;  2CYY A;  1NH7 A;  5J1P A;  2XY5 A;  3IGZ B;  3JAM Y;  3CCW A;  5KFX A;  4YB7 A;  2V8V A;  3T6B A;  3HP6 A;  4DWI A;  2QYG A;  4OI6 A;  3QMQ A;  1RWM B;  4M1K A;  1S79 A;  4LQ3 A;  3K5O A;  2ZH9 A;  4L72 B;  1S6Q A;  3B4D A;  4O3R A;  1DTT A;  2W5S A;  4KAY A;  2Q6B A;  3HSZ A;  1BUX A;  4USI A;  2O3D A;  4B9L A;  1F0X A;  4NLX A;  1N5S A;  4QWC A;  2FY1 A;  1JNZ B;  2OTJ S;  4KFB B;  3D9B A;  3IXQ A;  2Z30 B;  4LR8 A;  2XCP A;  1YJ7 A;  1TU0 B;  1BQM A;  5A8K B;  2UVR A;  4FKY A;  4K2X A;  5K14 A;  4LF7 F;  1ZPW X;  2C2E A;  5LXR A;  4QQB A;  1JLQ B;  3V4M A;  5K20 B;  1F9F A;  1WI8 A;  2W24 A;  4H4K C;  1LWX A;  3V81 A;  1XQI A;  2EEY A;  4PYA A;  1OSD A;  2BJD A;  2UUC F;  1ZAV A;  1RLD A;  2EI5 A;  2FHO B;  4UTG A;  1X4G A;  3CUN A;  2N4C A;  3DRR A;  2QV6 A;  3HF5 A;  1AYE A;  3Q2S C;  2M88 A;  1BD6 A;  5CA5 A;  1NHU A;  2FD2 A;  4L74 A;  4O3O A;  3G6X A;  5AE3 A;  4P6Q A;  1NJI T;  2ZDO A;  1VRU A;  5HAN A;  3WZ0 A;  4DN0 A;  2V94 A;  4O3S A;  4PWW A;  1LW0 A;  3D7S B;  3VQS A;  4RUB A;  5C42 B;  1N0V C;  1U2C A;  1UP1 A;  4UOG A;  2ZE2 B;  2CZV C;  2HRU A;  2DTJ A;  3GQC A;  1X4F A;  3NCQ A;  1M5P C;  1CS4 A;  2OAU A;  3ZTR A;  4PQU B;  3EIC A;  3SZZ A;  2DHA A;  3HHK A;  3R9L A;  4M5M A;  2VPZ B;  2BEF A;  1G3O A;  5B0E A;  2YKQ A;  1AB8 A;  4FPI A;  1FES A;  4ECY A;  3MAA A;  5J2P A;  1T3N A;  2H5E A;  1T3O A;  1IM4 A;  2SXL A;  2IRX A;  5IQ6 A;  3TVY A;  4RLE A;  2R7S A;  2BXJ A;  4P72 A;  4J9K A;  1HQ2 A;  4DV0 F;  3GYX B;  2FZG B;  2D3O 1;  2OH2 A;  2XRG A;  2UUC J;  3RRG A;  3L95 X;  4UPL A;  1Y10 A;  4ZPC A;  4U7C A;  2L41 A;  1D8Y A;  3ISN C;  2E1P A;  4F0M A;  5A6P A;  2V2K A;  3PTW A;  4ID5 B;  5KFZ A;  2IM1 A;  3M30 B;  5EWG A;  1RYS A;  2VPW B;  2VJV A;  1KKH A;  2D74 B;  2V50 A;  1WHW A;  2PEB A;  4ES1 A;  3NCR A;  3T1H J;  3QRQ A;  3K5P A;  2MGZ B;  2KKH A;  2XO6 A;  1F6T A;  1YK9 A;  2HFU A;  4RO0 A;  1RTJ A;  5C24 A;  4YFU A;  3OHA A;  2M2B A;  3D67 A;  1HMV A;  3IMQ J;  1IBC B;  3MEG B;  3O6Q A;  2GA7 A;  1ARO P;  2KG0 A;  1S1V B;  4X62 F;  1W2I A;  2EBE A;  1CJT A;  4A4J A;  2VJU A;  2VG7 A;  5KT6 A;  5F41 A;  2RS2 A;  1NK6 A;  4OMF G;  3P49 B;  2ACM A;  2HGL A;  1OWX A;  3GWC A;  1WC4 A;  3BPD A;  4OZ3 A;  5D0E A;  4DL5 A;  2PMW A;  5AXK A;  3KLF A;  3MAA B;  4LBP A;  5K8P A;  4U95 A;  1ZM4 A;  4C0O C;  3V5R A;  4JI8 J;  5FJ4 A;  4DL7 A;  5DG8 A;  3UE2 A;  1J5O A;  2MTL A;  1TKZ B;  3DNC A;  4X64 J;  1KHL A;  2DIT A;  4PQU A;  2QE5 A;  2CJY B;  1XTZ A;  3PKY A;  2GVD A;  4FN5 A;  2WB4 A;  1T9W A;  4AL7 A;  2FLP A;  4J7C A;  1ZEB A;  3IRX B;  1VOM A;  1ZS6 A;  1HBU B;  2M8H A;  3MPV A;  5HVG A;  2DT9 A;  2DPJ A;  2AV5 A;  1Y7A A;  5TJ3 A;  3EGN A;  4IG0 A;  1TKZ A;  3MCO A;  3DCA A;  1SKS A;  4FF3 A;  1N6Q A;  2KB2 A;  1AJA A;  2P8I A;  2W2P P;  2K06 A;  4ZVU B;  3OTB A;  3GP9 A;  4EU0 A;  3IRW P;  2G4B A;  2DGV A;  2HVH A;  3CVK A;  4NLO A;  5I3P A;  3DLE A;  2BW7 A;  3SIP B;  4KHP F;  3A8I A;  5L1L A;  2M3D A;  1XNR F;  2VKR A;  4CO5 A;  5HK4 A;  1TAQ A;  3M6X A;  3HKZ D;  3NGK A;  4HDG A;  4N5S A;  1CSJ A;  1PGZ A;  2W5W A;  2MZR A;  3OLA A;  2AGQ A;  2GAH C;  4JBC A;  4LRB A;  5DG9 A;  2QZU A;  2LU2 A;  1GXT A;  1T7P A;  2A2D A;  3VV2 B;  2B8Q A;  4ELV A;  3LP1 A;  2V68 A;  2FB0 A;  1DHM A;  1JLQ A;  3TAR A;  2Z56 B;  3BGR B;  2GV1 A;  1CEZ A;  1AZS B;  2QL5 B;  3RBE A;  1UJ6 A;  1VK8 A;  2ZC3 A;  2JSX A;  4RPF A;  2QEX S;  4XIU A;  3AD8 C;  3C14 A;  4DX7 A;  4W90 B;  4RKU C;  1UZD A;  2ROG A;  3CJ3 A;  3MPY A;  4FVC A;  1HNV B;  3LAK A;  4B3R J;  3J81 Y;  2A6M A;  2Z2Y B;  5EX3 A;  2YX1 A;  2YNI A;  5KFN A;  3G8S A;  2Y8W A;  3QIP A;  1SC1 B;  4I0W A;  1ZEF A;  3TP2 A;  3OPK A;  4DV5 F;  3R7N B;  3C6U B;  4PPZ A;  1M5V C;  5D0R A;  3MPW A;  5DGA A;  3RAX A;  2XB2 D;  4NLV A;  4CYS A;  1WWH A;  2MZ1 A;  1HIY A;  3ICL A;  2ZIT A;  4TYB A;  4CTA B;  5CAA A;  1R0B G;  2B6A B;  2F1F A;  2RSQ A;  2LEC A;  1VBY A;  3UN3 A;  3V6D B;  2R7W A;  4U67 Q;  1A6L A;  2OPS B;  3T6J A;  1C0U B;  5C2C A;  3SQG A;  1FF2 A;  2F3J A;  3DYA B;  4PAB A;  4ETX A;  5HSP A;  2QSF A;  2PGC A;  4FXW A;  4CDI A;  4ZJL A;  3JSY A;  1XNQ F;  3HK2 A;  2MDA A;  4JI1 J;  5J1E A;  2AZ1 A;  4JI6 J;  2R4F A;  3P8B B;  2ADC A;  3DRP A;  1EP4 A;  1MMD A;  4LF6 F;  4NXN J;  4OX9 J;  4JV5 J;  1OYE A;  3BB5 A;  4K4S A;  4DS5 A;  2KT2 A;  2ZOG A;  5F0W A;  1RBO B;  1ZOT A;  4D3G A;  4RNO A;  3QGG A;  3I87 A;  2PI5 A;  1R6V A;  1KN6 A;  4WFN Q;  5LL6 d;  3THV A;  2KJW A;  1VQ5 S;  4Q7A A;  2KVI A;  5DZ7 A;  2F40 A;  3GG1 A;  3EUN A;  4HT5 A;  3W2W A;  3TEH B;  1HBN A;  5CYM B;  3KK1 A;  3MED B;  4DV4 F;  1B7Y B;  4RWX A;  2XLK A;  4OI3 A;  3S6E A;  5HBM B;  2LA4 A;  4P71 A;  3N9U C;  2EK1 A;  4XAK A;  5E7O B;  3KK2 A;  1GTH A;  2HIY A;  3O8W A;  3BH6 B;  2C28 A;  1LWF B;  2J0X A;  3FEZ A;  4F4Y A;  1BC6 A;  4OJ3 A;  2BJ9 A;  2GIQ A;  4LQ9 A;  1S9E A;  4PG6 A;  1H72 C;  1NO8 A;  3ZZR A;  1R31 A;  2AQ4 A;  2OMO A;  4JI4 J;  1WG4 A;  3GG0 A;  3M2U A;  4WP8 A;  3R1H A;  3ELH A;  3FKB A;  2E7V A;  3JXO A;  4OI4 A;  5FDL B;  3RG6 A;  4OV1 A;  4RUA A;  3CJK B;  1IKV A;  4C2M A;  3MMC A;  2J9D E;  1S6P B;  2LDI A;  4ZP8 A;  5T7L B;  3CDW A;  3L7P A;  4KJI A;  1EIY B;  4ECX A;  3M2R B;  1QE1 A;  4ZPW R;  2JC0 A;  3EGV A;  1HWI A;  3CJQ A;  3T1H F;  2UUT A;  2OPP A;  1NK8 A;  4GMK A;  2A18 A;  1REV A;  2Q43 A;  1Z2Z A;  3HHL D;  4M5D A;  5LSR A;  1GEH A;  2CJX B;  3ENW A;  2QZ8 A;  1RTI A;  2MLZ A;  3IS9 B;  3OQ2 A;  2CJA A;  3Q22 A;  2CNL B;  3I0S B;  1HBN B;  5CYM A;  3IGY B;  4HI1 A;  3TQ1 A;  2X3G A;  2ZZM A;  1PIL A;  4O44 A;  3W66 A;  3PIP Q;  2X1B A;  3NGT A;  3E01 A;  3P3D A;  4FYV B;  4LRC A;  4ZVO B;  4LF5 F;  5D3G A;  4DZ6 A;  3VAF A;  1HNX J;  4ZPD A;  2YKA A;  3DRY A;  2F63 A;  5C7P A;  2VKZ G;  1VK3 A;  3ZTQ A;  1YJR A;  3PW7 A;  1IKY B;  1UWB B;  3MZI A;  4CLT A;  4FZV A;  2W9C A;  1IVZ A;  1GXU A;  1Y5I B;  4RU9 A;  3TO8 A;  2OO4 A;  3G82 B;  4IOB A;  1LWE B;  1ZBT A;  1YTY A;  2DHS A;  3DHX A;  3N01 A;  5EGY A;  4Y2K A;  3EZO A;  3V6D A;  2PDA A;  4NCA A;  1UVJ A;  2IJF A;  3LXQ A;  3PX6 A;  4QWB A;  2XZD B;  5EX0 A;  2ACY A;  1D3W A;  4CO1 A;  2H1Y A;  1ZA1 B;  1DTQ A;  2ZJQ Q;  2DEJ A;  2RH6 A;  3QID A;  5KFW A;  4MIA A;  2OI2 A;  2VDH A;  5T14 A;  1FA0 A;  3FBB A;  3BDH A;  3PFO A;  3PX4 A;  2DRA A;  5A8W B;  2ZDP A;  1S6O A;  3MM9 B;  3CF5 Q;  3NGU A;  3R5J B;  4WXW A;  4O3N A;  1ZET A;  4GKK J;  3HFV A;  1V9O A;  4OHV A;  1N32 J;  2HGM A;  2YVS A;  3HZG A;  1OJ4 A;  2VFV A;  3QQC D;  4NA2 A;  4F50 A;  4ZN1 A;  3NGD A;  2EVZ A;  4CQ1 A;  4LF5 J;  4P75 A;  2AJF E;  4CO4 A;  2I8E A;  5DQI A;  2XQC A;  4OX7 A;  3WIV A;  5DQG A;  1D9F A;  2BAB A;  1FDD A;  1Y9O A;  2IVM A;  3MM8 B;  2QMU B;  5LOQ A;  2AP6 A;  3PYD A;  1S9G A;  4CH0 S;  3H2U B;  4F4Z A;  2APO A;  1URR A;  4KH1 B;  3OHB A;  2DO4 A;  5KFT A;  1YLX A;  2QLJ B;  3AQP A;  3IG1 A;  4NYZ A;  3PXG a;  4A8O A;  2JEJ A;  4DF4 A;  3M6W A;  4MFB B;  1NDL A;  4J91 A;  1RE1 B;  1RI7 A;  5ETL A;  4F3M A;  2WB1 D;  4DV7 J;  4DSJ A;  3DLE B;  2JX2 A;  1Y3K A;  2VQE J;  5DGB A;  1U1R A;  1QSL A;  2D3U A;  3Q83 A;  3PNI A;  1HNZ J;  3DRP B;  1RAB B;  2MXY A;  2CJB A;  3P6Y C;  4LJM A;  4CNY A;  2W2M P;  2VAS A;  1FNM A;  2WVC A;  5BYQ A;  3C6T A;  4C3K A;  4ZLJ A;  1M0S A;  3K8W A;  2HHS A;  4JI7 F;  2GJF A;  2RRB A;  3GTY X;  2JH3 A;  2VD3 A;  2GVD B;  4FYX B;  1IM6 A;  3GV5 B;  1N32 F;  2ZNZ A;  2FJA B;  5KG0 A;  3QZ7 A;  1QUP A;  5AJ3 J;  2V2Z A;  3HJF A;  1WEY A;  1Q78 A;  3O5T B;  2J9D A;  3S1T A;  4CXK A;  2CPZ A;  2V67 A;  3ULH A;  4QIG A;  2DIU A;  4QR2 A;  3BS9 A;  5F9L A;  1VRT A;  3CJS A;  2O67 A;  2QFI A;  2B4P A;  3PW0 A;  1UFW A;  4DL6 A;  3BEG B;  1GMW A;  2I5J A;  4DV4 J;  4ZVQ B;  1YRX A;  2KTQ A;  5CZX A;  1HPZ B;  4K2J A;  2UXC J;  2E5G A;  1K1Q A;  5KFY A;  3GFX A;  2ZH5 A;  2B9Y A;  2BZ2 A;  3SSQ A;  5BJR A;  1H7X A;  2HPU A;  3PX0 A;  2LMI A;  1EET B;  3F41 A;  3FVY A;  4ICL A;  4ICL B;  1GX6 A;  2HWI A;  3FMW A;  1LWC B;  2Q1L A;  2XMJ A;  5D0H A;  2WK4 A;  1Y7P A;  2RKI B;  4RW6 A;  4JI4 F;  1HJK A;  3HUL A;  5KTQ A;  5EHH A;  2HBY B;  3HVR A;  4WZQ A;  4OHX A;  1PSD A;  1YI2 S;  2MKC A;  1U1Q A;  1SI9 A;  1T11 A;  1FK9 B;  5FD1 A;  1FHT A;  1YBU A;  1UPM B;  1SVD A;  4DU8 A;  5FLX Y;  1TK8 A;  1S1U B;  3N79 A;  1NCL A;  3TNV A;  1N48 A;  3RB3 A;  3QGH A;  3H4D A;  1U8S A;  2AKW B;  1M1H A;  2B7B B;  1RAE B;  1XIQ A;  2NXC A;  4ZGA A;  3MXH P;  4ILL A;  3CJ4 A;  1XC9 A;  1QUV A;  1R8P A;  3OFE A;  4ZG7 A;  1GFW B;  2GNK A;  3FSY A;  2HIQ A;  3I5C A;  3LP0 A;  2MYF A;  1TL1 A;  2V8D A;  1PC5 A;  2CPE A;  2XMT A;  2VG6 B;  3DGP B;  1IKX A;  3Q8Q B;  2GA3 A;  4MY4 A;  3BV8 A;  1FWP A;  1PKU A;  2NXU A;  1VRU B;  3MCN A;  4TU7 A;  4DR6 J;  3W9H A;  4C6A A;  3CJ0 A;  3CSK A;  4NLS A;  2JLF A;  5DM7 Q;  3BQ2 A;  4OYP A;  1U02 A;  2HHU A;  3IAS 9;  3NS5 A;  1ANJ A;  2QIF A;  8RUC A;  3GJR B;  4Q45 A;  4KQZ A;  1WC1 A;  2DB1 A;  2CPI A;  2FVC A;  2B56 A;  4NLR A;  5LJ5 Y;  4ECW A;  4Z2X A;  2R2U A;  4IR9 A;  2F4V F;  4ZG6 A;  4YR0 A;  3KMS A;  5KFQ A;  3G6V A;  2N3O A;  3GJQ B;  4UZB A;  4JV1 A;  3NBP B;  3QRP A;  3TW0 A;  2UZA A;  3MR5 A;  2F4F A;  4KGZ B;  1SHN A;  5JMN A;  3KLH B;  2OP5 A;  2KM8 B;  2HHH F;  1FSU A;  2AYM A;  1F2G A;  2VF3 A;  3CT9 A;  4NA3 A;  3ISN D;  4PZV A;  5HJX A;  3TA2 A;  1HR0 F;  3MR7 A;  4DV2 F;  1KP6 A;  4MTP A;  1NLK L;  3QJP A;  5A8K A;  1S0M A;  3PO5 A;  2BE9 B;  2PC6 A;  1HPZ A;  3M6V A;  4OJH A;  4Q0B A;  1UL3 A;  1S48 A;  3R5D A;  5KFM A;  2RIJ A;  1IXK A;  5DRK A;  2OD4 A;  1DTT B;  4LF7 J;  2Z2L A;  1NDC A;  3FZ2 A;  2QL7 B;  2YY3 A;  1ZH5 A;  2PSZ A;  4I68 A;  5LM7 E;  4GTY A;  2MKY A;  5K8N A;  1T8E A;  1KQG B;  1MMN A;  2W5Q A;  4ALZ A;  4PWD A;  4DEZ A;  2I1R A;  4Y2A A;  4DSF A;  3D5M A;  3BDG A;  3BO3 A;  1FXD A;  2GGP B;  4U7U D;  5ITH A;  3JYT A;  2DNQ A;  2FZC B;  3MUV P;  2YKM B;  4ITS A;  3NRB A;  2V4R A;  5C42 A;  4DR5 J;  1U1P A;  3LF0 A;  1VQN S;  4JI5 F;  3BBC A;  2Y1R I;  3PIO Q;  3M8S A;  3W3S A;  1RKI A;  1RA6 A;  1ZAX A;  5F8L A;  2KFZ A;  2E44 A;  1BXN A;  3VAG A;  4AQY J;  2XS2 A;  2EC2 A;  1T05 B;  5HO4 A;  2RAQ A;  2YWH A;  3HHL B;  4QW9 A;  4DS4 A;  3M32 B;  4ENO A;  3IG1 B;  3ZZT A;  4A47 A;  5M2U A;  4ZOS A;  2U2F A;  3MMB A;  4BC7 A;  1YZ7 A;  5ETP A;  1WHY A;  1WOS A;  1HA1 A;  5LXY A;  1MRO B;  1S7H A;  3I9Z A;  5BYR A;  1HBM B;  3I6P A;  3WDO A;  2W9B A;  2AYB A;  1EW8 A;  1KLM A;  3EPI A;  2BMB A;  4ZLL A;  2HVZ A;  3LP2 A;  4EWT A;  4ZJQ A;  2DBB A;  4C3M A;  1JJ2 R;  3NY0 A;  5KXA A;  1X8D A;  1X4D A;  4USM A;  3A13 A;  4ZCM A;  3D6T B;  1UFL A;  2J9E A;  5K14 B;  2ABY A;  5CCM A;  3M2R A;  5HLF A;  1L3V A;  3SCI E;  1L5U A;  4DQR A;  2D9P A;  2LEA A;  4H4K A;  4B9S A;  3T5K A;  1DFD A;  1K1S A;  2HS3 A;  2OFH X;  2XZT B;  3QFH A;  3TJ9 A;  3UVJ A;  3T3F A;  1JX4 A;  4FF2 A;  1P49 A;  4PXC A;  1UW9 A;  3T5J A;  3TUZ C;  3ZFV A;  1NJW A;  1N36 F;  1LW2 B;  5GMD A;  2CJK A;  4JI5 J;  2R2S A;  3F56 A;  3PHE A;  3H59 A;  3SYZ A;  1S9E B;  1Q95 G;  3PY8 A;  3R8Y A;  1EQJ A;  4B08 A;  2Y8Y A;  2WAQ D;  5DDP C;  4IRC A;  2IJN A;  2UVW A;  1UMJ A;  3Q24 A;  2LXI A;  3PHT A;  2L08 A;  2WVD A;  2YNG A;  1XR6 A;  4KSE B;  1S76 D;  3KG1 A;  1KS2 A;  1YBT A;  3GU0 A;  3H20 A;  4KO0 B;  5D4L A;  3M8Z A;  3NNH A;  4C4W A;  5JVH Q;  1KLN A;  1I3O B;  1OIA A;  1VQM S;  3E2D A;  2CZ4 A;  1NZA A;  2IFX A;  5GAD I;  4DFM A;  1UA0 A;  1TKT B;  4I6W A;  1TP7 A;  4ERD A;  1H3D A;  4HT7 A;  4WII A;  3P5T L;  4R8U A;  3HPO A;  4UQT A;  3KLG B;  1BQN A;  1CC7 A;  3BH7 B;  3W60 A;  4PXE A;  2XC9 A;  4JI2 F;  3ZZP A;  2FQQ B;  2KXN B;  4F4K A;  4IFV A;  4ECU A;  4NLG A;  4PRF A;  2G2Z A;  5B0A A;  3JYT B;  2DIS A;  3N6N A;  3DYA A;  1ALH A;  4B9N A;  1B8J A;  1UPP A;  4JV2 A;  1V5I B;  3AOC A;  4I1T A;  5B0B A;  3MUR P;  1N36 J;  2RML A;  4FPR A;  4ZCL A;  3ZNJ 1;  4Y3C A;  4DCJ B;  3O1L A;  3I56 S;  4PUO A;  2IYG A;  3FRZ A;  3FQL A;  1Y11 A;  2NPI A;  5HQM A;  2VOD A;  3F73 A;  4DR7 F;  2E9R X;  2M4M A;  5IC4 B;  2B3T B;  5T7L A;  4TQS A;  2F4V J;  1N4L A;  1NEE A;  3OTC A;  1CVJ A;  2UUA F;  1WF1 A;  1K44 A;  4WZM A;  4M5H A;  3T1A A;  3UO0 A;  3RW6 A;  2YWK A;  3C14 B;  4ZPB A;  5B0F A;  2CWX A;  4AT1 B;  2AU0 A;  1KVK A;  3Q0A A;  1N5T A;  4OYI A;  1D9A A;  4DG1 B;  4QWE A;  4DV2 J;  3GV8 B;  3VVU A;  4EZ6 A;  1O0P A;  2HHQ A;  3NEK A;  1EW9 A;  4FYD A;  3FJ2 A;  4QR0 A;  5HBM A;  4RW9 A;  2KFN A;  2HS4 A;  1BGX T;  2P9C A;  3GB0 A;  3H42 A;  3KK1 B;  3BO2 A;  1QAI A;  2IAJ A;  3T5H A;  3MUM P;  1VS3 A;  4HEA 9;  1L3K A;  1T94 A;  3JS9 A;  4J9S A;  4YY3 F;  3OSP A;  2ASY A;  3UCU P;  1T05 A;  2HWT A;  2FC9 A;  4WYW A;  3BKT A;  3FDS A;  2WBM A;  4KHM A;  1WUU A;  3VGV A;  2HHV A;  4AND A;  3AJ2 A;  2AF6 A;  9RUB A;  3IO1 A;  1SUQ B;  3UFC X;  4LF4 F;  3MR6 A;  1FJG F;  2BBE A;  5I42 B;  4OZ0 A;  2YKM A;  4QJV A;  3HVT A;  3T9Z A;  5I3U A;  1ELZ A;  2BRL A;  4P10 A;  3EVW A;  4JI6 F;  4JI1 F;  2MSS A;  4HVZ A;  2A1B A;  3BSC A;  3TZX A;  2W9A A;  2F9D A;  1J5O B;  2B51 A;  2DCU B;  2HNZ A;  4NPO A;  4WKY A;  3WBH A;  4CTA A;  1NK7 A;  2G13 A;  3BBF A;  4B3T F;  4UPK A;  3H25 A;  4LT6 A;  1J5E F;  2AJ1 A;  2CNN B;  2XNQ A;  1S0O A;  2HUR A;  2HK3 A;  4DLG A;  2QJ3 A;  2COL A;  5CZV A;  1OMS A;  5LMN J;  5B7W A;  5RUB A;  2FLO A;  3RB0 A;  3NCP A;  3H98 A;  2DK2 A;  2MZT A;  1N52 B;  1MU2 A;  3AHP A;  2E29 A;  4PEO A;  1Q53 A;  3ZZY A;  3G8Q A;  1HLW A;  2MKH A;  1RTJ B;  3AXK A;  1SV5 A;  2J6S A;  2PI4 A;  2KYZ A;  2DGX A;  3N0V A;  2B0G A;  4PCQ A;  4QBU A;  1LXJ A;  5CCL A;  2ZH3 A;  1LWC A;  2B9W A;  1FNX H;  2HFZ A;  3H2V E;  2C2N A;  4KH0 B;  1HKA A;  4ECT A;  4LF4 J;  5KAK A;  1RP5 A;  2F8M A;  4KR0 B;  2G9O A;  1SV5 B;  3I5A A;  3KDN A;  5F3T A;  5GAD U;  3HD2 A;  1JJC B;  1KOO A;  3U02 A;  2RT3 A;  2E5L J;  1C4A A;  2VG5 B;  3L3C A;  5SZT A;  5E33 A;  3NNA A;  2M70 A;  2MY7 A;  2Y1I A;  3AOD A;  1KOH A;  3D0H E;  2IDL A;  1SC3 B;  1FEE A;  2V4Q A;  2EK6 A;  1Q5Y A;  4EEY A;  3O44 A;  4MH8 A;  1X9S A;  3N6M A;  3UN2 A;  3I32 A;  3BGU A;  3VGT A;  2PE8 A;  1RHK B;  5ETS A;  3BYR A;  1JKH A;  2D1G A;  5AT1 B;  3DGP A;  3GIL A;  3VHQ A;  4DOZ A;  2MY8 A;  2KI2 A;  3CW2 C;  2IM2 A;  3W2V B;  1WOO A;  3UQS A;  2OTL S;  1YVF A;  3IRX A;  4CCH A;  1IUJ A;  3AA9 A;  4ZDN A;  3G8T A;  4ZIV A;  2QLW A;  2DNZ A;  1MNE A;  2C1E B;  4M5N A;  1T03 B;  4DX6 A;  4NCG B;  2MQP A;  3M7V A;  4RW7 A;  1EHW A;  4ZPT R;  4DUT A;  4I69 A;  5HRO B;  2AJ4 A;  2BE2 B;  3TA0 A;  3OLB A;  4CYR A;  3VAK A;  1ZM9 A;  4N41 A;  2HQC A;  2VQF J;  4F2R A;  2WON B;  1FXL A;  1WEL A;  4GVB A;  4NML A;  2VG7 B;  4WP9 A;  4X66 J;  4F7V A;  1KH5 A;  2F7V A;  3LTO A;  1SC4 B;  3D1H A;  2VG5 A;  3UD3 P;  2VHG A;  5L1J A;  1TMM A;  1TR0 A;  3UCG A;  5BXI A;  2GLQ A;  1IQT A;  2IMW P;  3QZ8 A;  1H7W A;  3SCL E;  3BGO P;  1FJC A;  2F65 A;  1HD1 A;  4P9S A;  4C8Y A;  3BN7 A;  2N82 B;  3BPS P;  4O0I A;  4DFJ A;  3OD2 A;  5DG7 A;  3PV8 A;  1I94 F;  2IPO B;  3ZZU A;  2H9Z A;  4C9D A;  4ID5 A;  1N5Q A;  4YME A;  4F4X A;  2L9W A;  2NYH A;  4HYK A;  3AXM A;  4DR2 F;  2IUC B;  4EZ9 A;  2GO8 A;  1KSP A;  4DSL A;  1MU2 B;  2NUU G;  1VQ8 S;  1WKL A;  4ELU A;  2ZH8 A;  2ATL A;  1HBO A;  2ZZT A;  4HI2 A;  2XMW A;  2WRM A;  2VBY A;  1DUR A;  2XO7 A;  1QSY A;  4M5G A;  4BC9 A;  1B3T A;  4AFF A;  5BR8 J;  3VAI A;  2CPF A;  2DNN A;  4DDF A;  4OX6 A;  4BHQ A;  2AX1 A;  1R8A A;  2J7K A;  4OYB A;  5J2P B;  1RSC A;  1HHT P;  2O66 A;  5LIA A;  1R0A A;  2E7X A;  2JFD A;  2L9N A;  1FI4 A;  4FKX A;  4FXV A;  5KG6 A;  3MFH A;  4EYI B;  1FDN A;  2HFV A;  2L48 A;  4L6V 3;  1LFW A;  3AD7 C;  1D1U A;  4IKA A;  2HND B;  3NKO A;  1SH3 A;  1LW0 B;  4KKO B;  3TEG A;  4WFZ A;  4U6P A;  4IO9 Q;  4RW8 A;  3VVT A;  2XY7 A;  1R0C B;  4I7F B;  3K57 A;  3NOG A;  4J9P A;  4QYZ K;  3T01 A;  5CD4 H;  4MIV A;  2HNY A;  2RJZ A;  4TLR A;  4WCE Q;  1FDB A;  3L9Z A;  4YS2 A;  4QU6 A;  3KUH A;  1ZZN A;  5ETQ A;  3CCL S;  1WTF A;  4OJ1 A;  4CT8 A;  3OBI A;  1NM2 A;  2V0N A;  2EFO A;  2DY9 A;  2NXJ A;  2YKO A;  1RDR A;  4LIR A;  1IR0 A;  3W65 A;  1JLF A;  3ZTO A;  2EBG A;  3QAU A;  4OHY A;  4P2M A;  4PR6 A;  2BVZ A;  1NAQ A;  2B4O A;  1Q1K A;  3V2U C;  3HT3 A;  2H4Y B;  4RW9 B;  4BWM A;  4OI2 A;  3UNY A;  4YDD B;  1N56 A;  1IQZ A;  2PMH A;  3DHW C;  1HNW F;  3MM8 A;  2OPQ B;  1KC8 T;  1NJY A;  3RR8 A;  3C19 A;  3J7Z 5;  1J5E J;  3QT7 A;  4DLE A;  2LLZ A;  1TUW A;  4NLT A;  2CVE A;  2DRB A;  1YIJ S;  3LW5 C;  1S49 A;  2QGF B;  2VL1 A;  2O1P A;  3PRD A;  5LMN F;  3D6H B;  3H2L A;  4PG7 A;  3TQE A;  4DQQ A;  1LK7 A;  1TV6 B;  5KG3 A;  2B4V A;  1IKV B;  1WJ9 A;  3BKU A;  4K5S A;  4ZP6 A;  4EI2 A;  2YQ3 A;  1RCO B;  3W5Y A;  1XR5 A;  1DTQ B;  1MN7 A;  2OEJ A;  3QSI A;  4LSZ B;  4O4R A;  1WKJ A;  2QN6 B;  3OVS A;  1SL1 A;  4OYO A;  3EZ5 A;  5HLF B;  3AJ1 A;  2HMI B;  2OD6 A;  4UOO A;  1VLY A;  4MAK A;  4AQY F;  4PUO B;  1NSP A;  1QD1 A;  1YZ6 A;  2WSC C;  4YR3 A;  2CNO B;  1AW0 A;  1CPZ A;  1AJD A;  1ED8 A;  2FVS A;  5C25 B;  2FPH X;  1YJ9 S;  1KH7 A;  5LSL A;  2NQP A;  5D15 A;  1B70 B;  4WE1 A;  1KQF B;  4JOU A;  1U6Z A;  4ANC A;  2LA6 A;  2J0W A;  2FGO A;  2GQ2 A;  2V9K A;  4PQA A;  4U96 A;  4X4R A;  1YG0 A;  3QO9 B;  3MUT P;  3ILO A;  2LDY A;  2W2N P;  3QGP A;  2JDJ A;  5DZ6 A;  3NGS A;  4C8Z A;  3KMQ A;  2HKE A;  4MT1 A;  6FD1 A;  3EZU A;  1SB6 A;  3CPW R;  2P6T A;  2CA9 A;  3KJN B;  4IDK B;  2PN6 A;  1VMB A;  4DCP B;  4RUH A;  1OPI A;  4IQM A;  3AOB A;  4IYQ A;  4OZ1 A;  3RZA A;  5BYS A;  1MWY A;  1XMQ F;  2ZZN A;  3BSO A;  5HQ8 A;  2G1D A;  4KO0 A;  2BUN A;  2HLU A;  3M8R A;  4PG5 A;  3DLB A;  2BJ3 A;  2VUG A;  4DPY A;  2ZH4 A;  3TUJ C;  2XS7 A;  3BN4 A;  2LQB A;  1S1T A;  2XYP B;  1V6H A;  2LQ5 A;  3HD1 A;  3IC1 A;  3IS9 A;  4WK3 A;  3RTV A;  3IWL A;  4C8L A;  3MAQ A;  2FYX A;  3DU5 A;  1R6Y A;  2HK2 A;  5C66 A;  4IQX A;  4QW8 A;  2OPP B;  1Y5L B;  2MZS A;  2R9L A;  2FTR A;  3CC2 S;  4X4V A;  8ATC B;  3GII A;  2CQP A;  5LRM A;  1FVS A;  2DGW A;  3B8H A;  3KG4 A;  1UW4 A;  3R7B B;  2VQF F;  4CXS A;  1FWK A;  1MWZ A;  1XWL A;  1U26 A;  2GJ2 A;  1S1X B;  2RE1 A;  3RBZ A;  4X66 F;  4N47 A;  2DD8 S;  3PYG A;  1SJQ A;  2IBO A;  3I4H X;  2YNI B;  2XMA A;  2R7T A;  2BJE A;  2W8K A;  4XTT A;  3GJT B;  2BRK A;  4XK8 C;  4KAV A;  2BOP A;  1TKD A;  4PXB A;  4C8M A;  1RWW B;  2IUC A;  3TZY A;  4DV5 J;  1AZS A;  1I94 J;  4IRK A;  5IV4 A;  2RRA A;  2EWH A;  3RRK A;  1Q79 A;  1O51 A;  1XMO F;  1N5V A;  2QA4 S;  5ETR A;  1X31 C;  1MRO A;  2RF2 A;  8AT1 B;  2ZWP A;  5G0R A;  3KK3 A;  5L0B A;  4MIB A;  3MMB B;  2PT0 A;  4ATN A;  1HAR A;  3MM6 A;  1VBX A;  1S77 D;  2D1C A;  2GHW A;  3GCX P;  4KBI A;  1FXR A;  4WU2 A;  4ZVG A;  3OTE A;  1RUS A;  2ILZ A;  2MST A;  4DPW A;  4EFA C;  4XDC A;  4EBC A;  2JFK A;  2W1B A;  2YBV A;  3BZQ A;  4WBF A;  4U8V A;  4J9R A;  3K5N A;  4NXN F;  1V5V A;  3RJM B;  1NPP A;  1N54 B;  1B0P A;  4MKB A;  5FLX U;  2HW3 A;  2HNY B;  2KL8 A;  3R5A A;  5EUH A;  2ZH2 A;  3VAM A;  2GCF A;  1ZAW A;  2Q3P A;  3RUB L;  1X5S A;  3UDE A;  4LFA J;  3LH2 S;  2R8I A;  4NL5 A;  3Q23 A;  4NCG A;  1RTD B;  2ANH A;  2VG6 A;  1RWP B;  2MZJ A;  3G6E S;  4DV3 J;  1Z2L A;  1RLC L;  2LYV A;  3IM9 A;  3U7J A;  2V8P A;  2W25 A;  1C0T A;  5KFE A;  3D6M B;  5GAE I;  4ZA1 A;  1GK8 A;  5JJB A;  1WF0 A;  4ZHR A;  5IWA F;  1B7F A;  2V4J B;  2VPX B;  2Y3Y A;  3K17 A;  4LF1 A;  5DS7 A;  1CLF A;  4PWD B;  1OS5 A;  2IA0 A;  4PYD A;  1LXN A;  2DNG A;  3R97 A;  2OIH A;  1KQS R;  3NL0 A;  7FDR A;  1U0H B;  3O2I A;  4LFC J;  5E3C A;  2VBW A;  3TVZ A;  3PCO B;  4I64 A;  2I2Y A;  1VC0 A;  3I0R B;  2IJR A;  4J9U E;  4BBY A;  3RR7 A;  2EG2 A;  1NHV A;  1NSA A;  4URG A;  1SJ3 P;  4XDD A;  3UN5 A;  2QX0 A;  1TVR B;  3JB9 k;  3TX0 A;  3T1Y J;  3K58 A;  3WAY A;  1QY7 A;  1L3S A;  4NZ0 A;  2UU9 F;  3VGU A;  1UVM A;  1ED9 A;  2W01 A;  3IFE A;  2HS0 A;  4ZJO A;  3Q89 A;  4KY3 A;  2MGZ A;  1EI6 A;  3OV7 A;  3ED4 A;  3IA0 A;  4CLF A;  2DH8 A;  4TN2 A;  1QTN B;  2YTC A;  3LP1 B;  3D0G E;  4RBU A;  5A6W A;  3M30 A;  5AXN A;  3QRR A;  3OTO J;  3FQK A;  2V8G A;  2M5Y A;  2MMY A;  5A76 A;  5IZH A;  4ZVE A;  4MMO A;  1HW9 A;  5H9E J;  5CXT A;  1R27 B;  2G2Y A;  2M0G B;  2MQL A;  2RS8 A;  1CJU B;  3D3C J;  3ENV A;  2ZBQ A;  4RNH A;  4X65 F;  1GMV A;  3JTO A;  3H4B A;  3MPD A;  3CCU S;  4K4Z A;  1VLO A;  1BWE A;  5INH A;  1S59 A;  2BOA A;  5CYQ A;  5IWA J;  1H6K X;  1FT8 A;  3PM9 A;  2AT1 B;  2AX0 A;  4YEA A;  2DO0 A;  4GO5 X;  1UJ5 A;  3MPU B;  3ETO A;  1BMQ B;  1JLA B;  2BAN A;  2VFU A;  3NS6 A;  3QAE A;  1SQF A;  5J2Q A;  4MIW A;  1QAJ A;  4UY8 5;  2XSJ B;  2CQ1 A;  4K0K J;  2CQH A;  2DGU A;  4MYU A;  1JLE B;  3DLG B;  1Q0N A;  2ZBP A;  5KFH A;  2JRS A;  3HSD A;  2VPY B;  3MF5 A;  3HT0 A;  3R3T A;  3UDV A;  2HLT A;  5KFA A;  4ZHR B;  5J2N A;  2G9Y A;  2KHC A;  3KNG A;  5MAO A;  1S1W A;  2RVJ A;  1U2F A;  1HQU A;  1YWX A;  3EDR B;  4EUV A;  4DQI A;  1AJB A;  4Y00 A;  1SKU B;  2EKY A;  4G1P A;  4YQW A;  2GC8 A;  2NYI A;  4ID8 A;  1BQX A;  1M1G A;  2N7Y A;  2OSQ A;  3TVK A;  5DDR C;  4A46 A;  5J2Q B;  2Z0G A;  1S4E A;  5CD4 A;  4ELT A;  1WOR A;  1DQA A;  4LF2 A;  3RGI A;  5L1K A;  1M5O C;  1WEX A;  4B3M J;  1JJH A;  1I1G A;  2XTJ P;  4GRS A;  4ZPV R;  2V8H A;  4NOH A;  5CYQ B;  4NLY A;  1XMQ J;  1LFP A;  3TAN A;  3TAM A;  3RB6 A;  4B3S F;  1N5Y B;  4B3O A;  3GIM A;  5KFP A;  3TAP A;  4LSN B;  3ILL A;  4FS1 A;  2Y1J A;  4Y0F A;  3A4T A;  2E5L F;  1XNQ J;  2IAJ B;  2KHD A;  3NP5 A;  4DPX A;  5EDW A;  4J9O A;  3M2V B;  4DR3 F;  5HQL A;  1OPZ A;  1VBZ A;  4QIW D;  4F26 A;  4DBQ A;  1TKX A;  3HFK A;  2CWK A;  3IBW A;  4UUW A;  3WIU A;  2KRB A;  4LUB A;  2UUB J;  3TZW A;  1KHN A;  1RAO A;  4IH6 A;  4GKJ F;  1EET A;  3HZE A;  4DG1 A;  3RB4 A;  1AJC A;  1RAG B;  3NNC A;  2BKN A;  4F67 A;  1ZTW A;  1BLU A;  3TOQ A;  1TL7 B;  2P9E A;  3J80 U;  3NVL A;  3W61 A;  3H5S A;  5M2R A;  3MM9 A;  5DLW A;  2IVF B;  2EFQ A;  3NWG A;  3CIZ A;  3ZNU A;  5CYJ A;  5KT7 A;  3C46 A;  1N0U A;  3MTK A;  1NDP A;  3R6G B;  3POT B;  4DMZ A;  2G0I A;  2CPY A;  2CJQ A;  2C3M A;  4DV7 F;  1KNZ A;  1G2E A;  1NME B;  3ET6 B;  1X9W A;  3D28 A;  4WXO A;  4C11 B;  4NEY A;  4EYH B;  3WAX A;  2WBR A;  5DET A;  1FDA A;  2B9E A;  3NS7 B;  1YHQ S;  1U1M A;  5U47 A;  3AB4 B;  1M1K T;  2DR6 A;  1BE4 A;  1GXL A;  4DSI A;  1HYS B;  2ZHA A;  2QYC A;  2ZFH A;  2PEH A;  4XPC A;  3C2P A;  4M95 A;  1M90 T;  4J9M A;  2WZ1 A;  1F5A A;  1SUQ A;  2HRT A;  3R5G A;  3THP A;  4D3H A;  4ED8 A;  3KLG A;  1RTZ A;  2W4P A;  1RKJ A;  1SL2 A;  1JXL A;  2VOP A;  4OZL A;  5AJ3 F;  4C0B A;  3PYE A;  4BLG A;  1SJ1 A;  4ECR A;  2DR9 A;  1KDN A;  1TKT A;  5DLT A;  2CG4 A;  2FIU A;  4DUY F;  3A12 A;  2EW9 A;  1DLO A;  1JK9 B;  3MR2 A;  2QA2 A;  4TYA A;  2GSN A;  2HHW A;  2A2C A;  1XEZ A;  1RWN B;  3VAL A;  1ZED A;  5AE1 A;  1WC0 A;  4WYL A;  3DDK A;  2LQJ A;  2RF2 B;  1RU2 A;  4IG3 A;  4IH7 A;  1FRM A;  1NUE A;  3W9J A;  3CJ2 A;  3GJS B;  4ECV A;  2D69 A;  3TA1 A;  3TRG A;  5ADZ A;  4FVM A;  4USW A;  3J7Z T;  3VTI A;  2ZOM A;  3T1Y F;  2GZO A;  2HVD A;  2HMI A;  2MQO A;  3MEE B;  7FD1 A;  2XLI A;  2C2R A;  3J81 U;  2ZJP Q;  2VIH A;  2B8P A;  3D68 A;  3WHI A;  4C0H A;  3UWT A;  4K59 A;  1TL3 B;  1TL3 A;  2R8J A;  1RT3 B;  2QO3 A;  3UVJ B;  2HQ3 A;  4X62 J;  3JSM B;  1GQE A;  1RTH B;  3C66 A;  1VI7 A;  1RT1 B;  2DIV A;  3UW1 A;  5GAH U;  1FE0 A;  2OML A;  2IHR 1;  2VC1 A;  4Q44 A;  5ETT A;  2KT5 A;  2YX4 A;  1T9T A;  5HRT A;  4EO8 A;  2IYI A;  1JQG A;  4JI8 F;  3D66 A;  1KLM B;  1N34 F;  2ZUG A;  1B99 A;  3W7B A;  3C15 A;  5DQH A;  3DOL B;  1YGY A;  3Q2T C;  3CMQ A;  1JLC A;  1B0T A;  3GZ7 A;  4M5I A;  3DDI A;  1NKC A;  5J1N A;  3ISZ A;  3LGM A;  4ZVH A;  4B9M A;  3A8E A;  2KDO A;  4MKV A;  5GRR A;  2W9C B;  3HXM A;  2F8E X;  2R42 A;  1VC5 A;  2H5I B;  3W64 A;  3K59 A;  1QVF R;  2HRY A;  3MM5 B;  2DR8 A;  4UPI A;  1RXO B;  2AIR B;  3W62 A;  1HFE L;  3BR9 A;  3OTD A;  1FO1 A;  4DPU A;  1PYS B;  2P6S A;  1GMU A;  3GCW P;  1RWK B;  2BYC A;  2IIH A;  2WVE A;  5D3G B;  2V34 A;  2R7X A;  1K47 A;  4J90 A;  4KHP J;  4K5R A;  4DSK A;  1NZ8 A;  4DV6 J;  4UT4 A;  1AUD A;  4KKO A;  4NMX A;  3T9N A;  3FC9 A;  4LSL A;  3H40 A;  3MEC B;  1FJE B;  1XNR J;  1I5O B;  3OJU A;  5KFL A;  1YJN S;  2XWX A;  4ED6 A;  1VIX A;  4C98 A;  5B0C A;  3C15 B;  3JSR A;  3KHH A;  1J2V A;  2YNH B;  4X4O A;  1WC6 A;  1GAO A;  3MFI A;  4M5D B;  4FS2 A;  2CPH A;  4ED2 A;  2A0F B;  4CYU B;  1RJJ A;  3D2W A;  1R0A B;  3QGI A;  4CLU A;  3VQT A;  4TLQ A;  1QJH A;  1F3F A;  2J9C A;  3KG0 A;  4O23 A;  3FEX B;  4HTJ A;  2R3V A;  5B0D A;  2YNF B;  5HMX A;  4YHH J;  1VQ4 S;  3POT A;  4DR4 F;  1MWQ A;  3JSM A;  4F2S A;  2ASD A;  2AWZ A;  5AXM A;  1RT3 A;  2RU3 A;  3R2D J;  2Z4P A;  4Y28 C;  4NWX A;  3GFH A;  4AUK A;  4DR3 J;  1TV6 A;  1VFJ A;  2B5J A;  3KJQ B;  3Q8Y A;  1FER A;  1HW8 A;  3KLE A;  4O3P A;  2ASJ A;  1HL6 A;  2VOO A;  2UXB J;  1KHJ A;  2NPF A;  3GIR A;  4GKK F;  4A48 A;  3THT A;  1FRI A;  1BHN A;  4KAI A;  2AJ0 A;  1N8R T;  3V6H A;  2FJE B;  5JXS A;  3KNA A;  3ILJ A;  4PG8 A;  3R7S B;  1VGY A;  2KO1 A;  4ES2 A;  2EC0 A;  2W5V A;  3SCJ E;  2RQK A;  3JTP A;  2N7C A;  2AHO B;  3NBP A;  3TI0 A;  3AH6 A;  1JLB B;  1PIE A;  2JZ5 A;  3W8P A;  1CJK A;  4PKD B;  3TAM B;  1PYO B;  3A1Y G;  4I6A A;  4B3O B;  2R7U A;  1UEK A;  3QPI A;  1A0O B;  2A10 A;  1HWK A;  2CVI A;  2MPU A;  2DXE A;  3OL8 A;  4L75 A;  3T41 A;  4ZIT A;  3W5Z A;  4PXD A;  5HRO A;  1U6B A;  1H0H B;  2PA8 D;  4J9N A;  4N8N A;  4O4G B;  3NAH A;  4LVO P;  5L9N A;  1A7G E;  1XJW B;  3IP0 A;  3ENQ A;  4NLP A;  2GO9 A;  2QA1 A;  4HDH A;  4K4W A;  1MW7 A;  3UCZ P;  1HQU B;  5GMK a;  4FXD A;  5HL7 Q;  1OO0 B;  2WOM B;  3G2X A;  1RT6 B;  3ZXW A;  3EVM A;  1KON A;  5A0Y B;  2GW8 A;  5KG4 A;  3GR1 A;  1B64 A;  4KPC A;  2W5X A;  3LOU A;  4UOF A;  2XSJ A;  1QVG R;  2VQR A;  4C11 A;  1V3S A;  2DY1 A;  2KU7 A;  4FDF A;  1JLA A;  2BAN B;  2NZ4 A;  4KE5 A;  1RWX B;  2PD1 A;  2V2V A;  2GX8 A;  4YR1 A;  2BW2 A;  2GSO A;  4FNH A;  4K4V A;  1NXI A;  3CME S;  4LRA A;  1D09 B;  1EJ7 L;  1TQL A;  5IV3 A;  1I6J A;  2BAC A;  1RHR B;  4EK2 A;  2CQ0 A;  2RQC A;  4F8R A;  4IOA Q;  1ITP A;  2UUW A;  1JXE A;  1VQP S;  3KOA A;  5C24 B;  2HQD A;  2KVQ E;  2RDD A;  4HHU A;  6AT1 B;  3K5L A;  2PFD A;  1F9E B;  1ELX A;  4NYP A;  1HNI A;  3VWS A;  3H0P A;  2RH3 A;  3GFY A;  4LBH A;  3QFW A;  1HWU A;  2ZH7 A;  3VAJ A;  3ZZZ A;  1K0V A;  4M5J A;  3KLH A;  2QMW A;  4CO3 A;  4JUZ A;  4URS A;  2D3Z A;  4Z37 A;  3DXB A;  4HLB A;  3M2V A;  3TWZ A;  4LFA F;  4OI0 A;  5KFI A;  4CZC A;  3ILI A;  4XPE A;  1P27 B;  1TVR A;  1SJR A;  2IM0 A;  2HG4 A;  1H2T Z;  1NBE B;  2GQC A;  2VU5 A;  3M1V A;  2DVI A;  5GAG I;  3W5X A;  2WON A;  2NSB A;  2X7I A;  4CO2 A;  2YKN A;  2DCL A;  2CAJ A;  2PO4 A;  3QLH B;  4TU9 A;  5ETN A;  2BX6 A;  2WW8 A;  5JVG Q;  3CD7 A;  3SV4 A;  1BWV A;  4M94 A;  3M05 A;  2FC8 A;  3CGI A;  1UAW A;  1X4A A;  1ZYQ A;  4JI2 J;  4K8R A;  1KEK A;  3PW2 A;  1NPK A;  3QJL A;  4BDP A;  1MML A;  3W2V A;  2HFN A;  2JLE A;  3MM7 A;  3NLC A;  4QOT A;  1FKO B;  4DPT A;  5DLG A;  2ALZ A;  5IJS A;  5G4D A;  4KC5 A;  2C2Z B;  3OXG A;  3K5M A;  1WI6 A;  2C3U A;  2JC1 A;  3SXL A;  2DNH A;  1VCT A;  2W7P A;  4C8K A;  4B56 A;  2DGT A;  2GML A;  3FBE A;  1RAF B;  4KGK A;  3TX8 A;  5B09 A;  3NG8 A;  1WTB A;  1RT5 B;  3OTO F;  2DR7 A;  1APS A;  4DJB A;  2FHK A;  4G65 A;  3M6U A;  1IKW A;  5EWF A;  3CDA A;  4Y6I A;  1ALJ A;  1SXL A;  3I31 A;  4X65 J;  3MM6 B;  2W8L A;  2UUA J;  3K89 A;  4QPT A;  4LF6 J;  4JV5 F;  2XBP A;  3LPY A;  5L0E A;  2J8S A;  2P9G A;  2RKI A;  4OHZ A;  2XZW A;  3UNG C;  4KPY A;  4NEZ A;  4CLW A;  4WFA Q;  4EMD A;  2AJ2 A;  2PMZ D;  4USV A;  3G71 S;  3OW2 R;  1TFY A;  1V3Z A;  1S97 A;  2H54 B;  3T02 A;  4W4M A;  2EFV A;  4DR4 J;  1FKA F;  5IM0 A;  2CAD A;  4IH5 A;  4CNZ A;  4TU8 A;  1X5O A;  3FNN A;  2V9W A;  4EBD A;  2GAG C;  2WHO A;  3ENA A;  3N4W A;  4ZMM A;  4WFB Q;  3M9M B;  3OR1 A;  1KHW A;  5KFU A;  3DM2 B;  1NJZ A;  2DNO A;  3DXS X;  3E3X A;  5H9E K;  2IY5 B;  1S12 A;  2FVQ A;  3CCQ S;  4ANE A;  3PW4 A;  1N88 A;  1Q8I A;  2BA9 A;  2HVE A;  2VFR A;  4I6Y A;  4WJB A;  3EM1 A;  3HHD A;  3MGJ A;  1RHU B;  4GC6 A;  1XR7 A;  2NLW A;  5D6G A;  3PW5 A;  2QMX A;  3SZY A;  2E9T A;  3BGF A;  3CD5 A;  2H48 B;  5HN0 A;  4B3S J;  1FE4 A;  2ZBI A;  5HAO A;  5IXU A;  2RUS A;  3G82 A;  4AXJ A;  4H4O B;  1N33 J;  4Q43 A;  3OSN A;  4ZVF A;  5DDO C;  2KT3 A;  1FVQ A;  2E7W A;  2AJQ A;  2LEP A;  2A6O A;  1S57 A;  4HHH A;  3G86 A;  2RDI A;  4YN3 B;  3MOJ B;  2YWW A;  3U1L A;  2XR9 A;  4C8O A;  2FVR A;  1TMJ A;  1WC3 A;  1FD2 A;  3LUY A;  2MKI A;  2AW0 A;  3I9V 9;  2J76 E;  5D77 A;  1XER A;  5ETK A;  3K0J A;  4MFB A;  1P1L A;  2C2M B;  2CQG A;  3CED A;  3UDC A;  5DM6 Q;  1E6V B;  3H90 A;  5J2M A;  3JTN A;  2Y9H A;  3UD4 P;  1SHQ A;  3DMJ B;  2CRL A;  4A8W A;  3W9I A;  4UY8 T;  3S7R A;  3BYP A;  2RU9 A;  5IS2 A;  3PR4 A;  4XO0 A;  1DY3 A;  1RTI B;  3HHE A;  3HO1 A;  4ZK7 M;  2DNR A;  1LNQ A;  1YQH A;  1R7I A;  4W98 A;  4CM2 A;  3MK1 A;  1K9M T;  2KH9 A;  1E6Y A;  2E1A A;  2JVO A;  1ZM2 A;  2H3E B;  3MCS A;  1GH8 A;  1RT1 A;  3P96 A;  3KD8 A;  4N8O A;  3I96 A;  4ZCK A;  3CO9 A;  3IR6 B;  3QBC A;  4OZ5 A;  1RAA B;  2LP4 A;  1M5S A;  4KGM A;  1Y4Z B;  1UVK A;  1VHF A;  2MKK A;  4WU3 A;  1K8A T;  1AXQ A;  1ZZF A;  1IBL F;  1PJ6 A;  3M2U B;  3AB2 B;  2RUG A;  3GFZ A;  4O3Q A;  5E41 A;  3M9O B;  3ADA C;  2X3D A;  4WK1 A;  1PO6 A;  2DNL A;  2PA3 A;  1E6Y B;  3UR3 C;  4RBT A;  3JSB A;  2C2K B;  1JLG B;  2EXU A;  2QRR A;  1CQN A;  3SSS A;  4DL4 A;  1FJ7 A;  2OPQ A;  2BQR A;  1JWW A;  1KVI A;  3GMG A;  3GIK A;  2CFX A;  3D4J A;  1C4C A;  4UZC A;  3ZZ0 A;  1VQL S;  2WVF A;  3DKD A;  4RR5 A;  4X84 A;  2JEG A;  5HVH A;  2NSC A;  2QTW A;  2BKO A;  1NSK L;  2H65 B;  3MEC A;  2E66 A;  4F25 A;  4TXS A;  2JEF A;  2VA2 A;  2FUG 9;  2D3O R;  5EGH A;  4LF9 F;  3BBB A;  5GVQ A;  2XS5 A;  4RNF A;  4DR6 F;  3M8Q B;  2P5V A;  5E3P A;  2K3I A;  4K4T A;  2ADB A;  1VQ9 S;  5L38 A;  2RQ4 A;  2J8A A;  4I7F A;  3W1Y C;  3N6L A;  4V19 X;  1U1N A;  3B4M A;  4O44 B;  4HL9 A;  1K0T A;  1YJU A;  2R8G A;  4H54 A;  2W4D A;  2IMO A;  2ATC B;  3I0S A;  4OYX A;  5D0G A;  4DFK A;  1SJF A;  1PG5 B;  3KJV B;  4E0D A;  3DLH A;  3LGH A;  4AL6 A;  3EX7 B;  1IBL J;  2BM1 A;  3ETM A;  4DF8 A;  3HX9 A;  1UVN A;  3IN5 A;  1UJ4 A;  2KM8 C;  1K7H A;  4DV1 J;  4QIV A;  2MEW A;  1HR0 J;  5D4P A;  4F3O A;  1FTR A;  2RQM A;  3C6U A;  2IDE A;  5KFS A;  2UV8 A;  3H8Y A;  3FBC A;  4I4B A;  4OYZ A;  5E2Q A;  1S4F A;  5ETO A;  1RT7 B;  4I2Q B;  2DXF A;  2IVY A;  3BQ1 A;  3C8Y A;  3DLJ A;  2JJ4 D;  3UD5 A;  1JNR B;  2VB6 A;  3US5 A;  1CJV B;  3PG9 A;  3QT6 A;  4KV8 A;  6FDR A;  5KFJ A;  3ZTP A;  1YX2 A;  1NB7 A;  2NUH A;  4YB5 A;  4ED7 A;  1IR1 A;  5BR8 F;  2WSF C;  1LKZ A;  3DRS A;  2CQI A;  4LF9 J;  2ZC4 A;  4B3T J;  3A52 A;  1F3V A;  2KRR A;  2KXH A;  2CQD A;  2CQ3 A;  4NZ6 A;  4U9R A;  1Q81 T;  4DPO A;  5D78 A;  3KK2 B;  1TKX B;  4B3R F;  4HH0 A;  4P7T A;  4DV6 F;  1ALK A;  3W2W B;  4DL2 A;  2DRD A;  1SC6 A;  1RA7 A;  4A8K A;  1W26 A;  2M8D B;  4UOP A;  2XMV A;  3M32 A;  2EFN A;  2ZD1 A;  4JV0 A;  2XI3 A;  2HZV A;  3AA8 A;  2Z8Q A;  4GVB B;  3ZC4 A;  1NU4 A;  3QWP A;  2ZKU A;  3SEO A;  3FCH A;  4IOC Q;  2QSW A;  2NZC A;  3MEK A;  1PAU B;  4Y2C A;  2CZ9 A;  3PZP A;  1JB0 C;  1T9Y A;  3UR0 A;  3RU0 A;  1NRK A;  3GR0 A;  1N6Q B;  4ES3 A;  4NLD A;  1RT2 A;  1Y00 A;  1IBK J;  1IKX B;  1S0V A;  3CDU A;  3QT5 A;  3MM7 B;  2Q6C A;  2HZC A;  2KG1 A;  1FTC A;  1HBU A;  2OUG A;  5KFK A;  2BR0 A;  3DPC A;  4V1A k;  5KT4 A;  2RHQ B;  3DOK A;  2OPS A;  5CAB A;  2VDI A;  5L8R C;  1S7I A;  1RAD B;  5C2G A;  1IBM J;  3H5X A;  2AD9 A;  5H9F K;  2B6A A;  1E2S P;  1ALI A;  4X64 F;  1OY9 A;  2FJX A;  1UWA A;  3OUY B;  2E1M C;  3HHL C;  4MKY A;  3CO0 P;  1FD8 A;  1H98 A;  1U09 A;  2K3K A;  3CCT A;  1UFK A;  3QLH A;  4LRF A;  4NRT A;  3L09 A;  2C3Y A;  3HKW A;  3FSX A;  2R2R A;  2LVW A;  2ZBR A;  4A8Q A;  1JIH A;  1FX2 A;  1CJT B;  4DL3 A;  4A8S A;  4ZCI A;  1YJW S;  2AYG A;  3KTQ A;  5K4P A;  1Y0H A;  5F3Z A;  2F9J A;  2H51 B;  1HMV B;  3MEG A;  3NGR A;  2AZ3 A;  3KKF A;  3HMJ G;  3DN9 A;  3R27 A;  4RW6 B;  5CQG A;  3OVA A;  3DGV A;  5HI7 A;  1O99 A;  5F8G A;  1URN A;  1RHQ B;  3V6J A;  1UEV A;  1FWL A;  3KYL A;  4I2P B;  1YJV A;  2CKW A;  3R6L B;  4RWW A;  1U45 A;  3DOM B;  1RAH B;  2MLX A;  4V19 J;  1H38 A;  3QNW B;  1GNK A;  1RIS A;  1IKW B;  2CPD A;  2D41 A;  3MDF A;  5D8H B;  2OLW A;  2N3L A;  3I82 A;  2IRU A;  2OPR A;  3GV7 B;  1DBD A;  4USH A;  3I0R A;  1HHQ A;  1NK5 A;  1IBM F;  4NLW A;  1WKK A;  4GTW A;  1WSR A;  5D4N A;  4N7T A;  1SIW B;  4F4A A;  4GO7 X;  2IA6 A;  1KTV A;  2K7K A;  3M9N B;  3FSI A;  1FKP B;  4LRD A;  2R7R A;  3SQO P;  4K4Y A;  1X4H A;  5LJ3 Y;  4KJG A;  5KFB A;  1ULR A;  2FGC A;  1VR6 A;  3DOK B;  4B9U A;  4DV0 J;  3EXC X;  4WP3 A;  2FDN A;  2D9O A;  3HVT B;  2JL9 A;  2ZOF A;  3PRB A;  1P9Q C;  3DI6 A;  3DLG A;  3DLL Q;  5IT9 Y;  2VIC A;  1N2L A;  1U25 A;  2J0Q D;  4CO0 A;  4KTQ A;  4NYO A;  4RNN A;  4Q2L A;  5A2Q U;  1NB2 A;  2OJ3 A;  5F8H A;  2NS1 B;  3UPF A;  1SIZ A;  4RUC A;  2NR0 A;  3CIM A;  1MG7 A;  4QPX A;  5KG7 A;  2XYG B;  4MKA A;  3G9C A;  2K8G A;  3G87 A;  4N77 A;  3BO4 A;  3X1L B;  4DR7 J;  4PPD A;  3TUI C;  4C3L A;  4LR2 A;  2RHS B;  1FK9 A;  2YPZ A;  5HAT A;  1V3R A;  3WX8 A;  2R2T A;  1S9G B;  3KXD A;  4BWJ A;  4I2P A;  4EO6 A;  5KT5 A;  2ALY B;  1NDK A;  2XUL A;  3NWR A;  4C8N A;  2Z58 B;  3MD1 A;  2XCA A;  1X4E A;  3H5Y A;  1KWM A;  2QG9 B;  4K50 A;  4FBT A;  3IGN A;  3EXY A;  3R5C A;  1U8W A;  3CB4 A;  2IC3 A;  4E98 A;  1HI0 P;  1F60 B;  4HR2 A;  5LMU J;  4ED1 A;  5T41 A;  2B5J B;  5F8J A;  2VFS A;  4CLZ A;  1TL5 A;  1RU1 A;  1FRH A;  1KHV A;  1AT1 B;  1CUL A;  2L3M A;  4NAS A;  2VON A;  4HAC A;  3CUL A;  4PAA A;  1RWO B;  3LQV A;  4M63 A;  4Q8F A;  1S6Q B;  3E8O A;  2BE7 D;  4ZVT B;  4CLY A;  4AYB D;  3LWL A;  3KHR A;  4BCA A;  1Z4U A;  4K4X A;  2E1C A;  1U0H A;  1D9D A;  2Y0B B;  2JNJ A;  3FMB A;  1E3C P;  5HVF A;  5EWE A;  4H4M A;  5E3R A;  4CYU A;  2HNZ B;  1WG5 A;  5F8I A;  1SL0 A;  1KRP A;  3IBC B;  5L46 A;  3TAQ A;  4WWS A;  1YKW A;  2OSR A;  3M8Y A;  1U49 A;  1S1T B;  5B0G A;  1C0T B;  4QR1 A;  3KJV A;  1EW2 A;  4LBI A;  5THW A;  2WOM A;  5A0Y A;  1EKR A;  3CJT A;  1MN9 A;  3I4P A;  5C5J A;  4DQS A;  3OR2 B;  4BS2 A;  1REG X;  4F02 A;  1NKE A;  4PG4 A;  1W7W A;  1IKY A;  2DXD A;  1UWB A;  2DNY A;  2YQ1 A;  1BQN B;  5A8R A;  1MLA A;  1HI1 A;  3FZB A;  4OI1 A;  5KFV A;  1WOP A;  4M5K A;  4CLP A;  5KOX A;  5KFD A;  1QDU B;  1PJ7 A;  1IJF B;  2MHE A;  2RB7 A;  3A8K A;  3G4S S;  1XN9 A;  3HSG A;  5KFO A;  1HNZ F;  5K9F A;  4ZIW A;  2DNK A;  4MYT A;  4MK9 A;  2GHP A;  4JI7 J;  1RQ0 A;  2GMH A;  1JLB A;  2PII A;  3PJ9 A;  1J27 A;  4RX6 A;  5G0R B;  3KK3 B;  3U1M A;  4ILR A;  1KTQ A;  3VZI A;  3CCR S;  3CDE A;  1PCA A;  2FLN A;  2CXE A;  2C3O A;  2WVB A;  3MWB A;  5GAG U;  1QTM A;  2E5J A;  1P6T A;  1WDT A;  3AT1 B;  2R7Q A;  2R8H A;  4F4W A;  1SJ4 P;  1U4B A;  2FJB B;  3S01 A;  3V4I A;  1QE1 B;  3QJJ A;  3FCW A;  5HP1 B;  3OL7 A;  3KLE B;  3CXC R;  1ACM B;  1CJV A;  1T02 A;  4KFB A;  4KV8 B;  5IQQ A;  1OSC A;  5HMZ A;  4DCO B;  4B9V A;  5LRN A;  4ZVR B;  2CIM A;  2QC3 A;  4NI2 B;  2O01 C;  4OX8 A;  1S1X A;  4YUD A;  3PRV A;  4ZLP A;  3PVX A;  1ZM3 A;  2VBZ A;  2YNF A;  5HP1 A;  3HHN B;  1KFS A;  5LQQ A;  3MMJ A;  4OZN A;  4UF4 A;  4R0J A;  3MR3 A;  4DV1 F;  3MK0 A;  2NCK L;  1LWF A;  2DNP A;  2OHD A;  1FRK A;  4KRW A;  4TVA B;  1EZZ B;  3D1Q A;  4ZN3 A;  4YR2 A;  1F1B B;  4GTZ A;  2JLG A;  1PJ5 A;  4RW4 B;  2JHE A;  1RHM B;  4Q5V A;  3I5B A;  4W92 B;  1O6X A;  1VJW A;  4NLQ A;  5E3Q A;  5ETV A;  3NKM A;  2YWE A;  5HMY A;  4CI0 B;  1T95 A;  1Q86 T;  1E6V A;  5J2M B;  3NXZ A;  5D4O A;  1Q5V A;  2NXN A;  4UQG A;  4Y34 A;  5AXL A;  1R89 A;  1VYA A;  2LEB A;  2GIR A;  2HZA A;  4MHX A;  3MM5 A;  2QLX A;  1SH2 A;  2D7S A;  2C22 A;  2DHH A;  2QT7 A;  2HYI B;  2BDP A;  2CPX A;  2ZJR Q;  2X51 A;  4ER8 A;  4OZJ A;  2HND A;  1QM9 A;  2YH0 A;  5M2P A;  3LPE A;  1C0U A;  5F9N A;  2I9S A;  2DJW A;  3TG0 A;  3BQ0 A;  2MB0 B;  4C97 A;  1REV B;  2M52 A;  1JLG A;  3CC4 S;  4G1Q B;  4JI0 F;  2MHN A;  4X4T A;  3D54 A;  1TUV A;  5KG1 A;  3L7U A;  2C42 A;  4ECS A;  3VZH A;  3EYZ A;  3N5B A;  1X0P A;  3NMA A;  3B54 A;  3D0I E;  4DR2 J;  3KHL A;  3WC2 A;  4NX9 A;  3ITH A;  4PWU A;  3QIP B;  2M7S A;  4RJV A;  4AD6 A;  3MMC B;  3FBF A;  2LQ8 A;  4QIE A;  4ZLN A;  1WNE A;  2WSE C;  4IUF A;  1GMW D;  5FDL A;  2UXD J;  4L73 A;  1KHK A;  4HH1 A;  2AYE A;  4ZVS B;  2BQ3 A;  4TY8 B;  1TL7 A;  1T9V A;  2IC3 B;  3A3O B;  2MQN A;  3PO4 A;  2HQG A;  3SDE A;  2KZZ A;  4J9V A;  4I67 A;  2XHC A;  3NKN A;  1JMT A;  3OXL A;  1HNX F;  3JQM A;  1M5H A;  1X5P A;  3HLU A;  3Q8V A;  2MJU A;  1AUK A;  3NKQ A;  2VA3 A;  5LMU F;  3EJM A;  1EB0 A;  2IFY A;  2YXL A;  4EBE A;  5SUH A;  1W2B R;  1WHX A;  2K1R A;  1JLF B;  2LCW A;  4OFZ A;  5KG2 A;  1T9X A;  4DXL A;  4KM4 A;  1FEH A;  1KFD A;  1N5Y A;  2CG8 A;  4OL8 A;  3HJV A;  3DFE A;  1XBW A;  3M8P A;  5ETM A;  3TR5 A;  2LU1 A;  3VCD A;  2ZHO A;  1WEZ A;  3WAV A;  4NXM F;  3TZZ A;  4JI0 J;  2FHM A;  2NRE A;  2W5R A;  4A8F A;  2WCX A;  2XYH B;  3MAH A;  2WW4 A;  1RK8 A;  2GVZ A;  5HMW A;  5J1E B;  1WSV A;  2XHW A;  2XSF A;  1VRQ C;  1IR2 A;  2LXU A;  1PBU A;  3LP0 B;  3P4U B;  2FZK B;  3KLI B;  3HSJ A;  4IFY B;  2R7O A;  1FFS B;  2VFT A;  3K2Y A;  5H1S V;  1HWL A;  3B78 A;  3QT8 A;  1N33 F;  3HDS A;  4UST A;  3JAM U;  2YQ0 A;  4UOH A;  3VF0 B;  3TJ8 A;  1L3T A;  4OX9 F;  3BDP A;  1Q8L A;  1TUG B;  1PYT A;  3OL9 A;  3PYF A;  1LK5 A;  2YWG A;  1X9M A;  3LAL A;  3D1O A;  3T19 A;  1B0V A;  1WDD A;  3DRX A;  3T5L A;  2AGP A;  1YIT S;  1NK4 A;  1RBA A;  4GC7 A;  4LRE A;  2XWY A;  1AUS L;  4NE9 C;  3A8J A;  3SFU A;  1S6U A;  3DYC A;  4DQP A;  1EAY C;  2E5H A;  2EFP A;  2YPY A;  3MMA B;  4HAC B;  4KIA A;  4C7Q A;  4DZD A;  3GSD A;  1LQ9 A;  4I56 A;  2GIF A;  3KUG A;  1TK5 A;  1S0N A;  2W5T A;  3BDF A;  4OHW A;  4CT9 A;  4DHV A;  5LT5 A;  1KBR A;  4YY3 J;  2W7O A;  2A3J A;  2JOQ A;  7AT1 B;  3Q3Q A;  4CLL A;  4ZP9 A;  4NXM J;  1TEL A;  3BGL A;  3U27 A;  1AFJ A;  3Q86 A;  1U48 A;  1IBK F;  4LF8 F;  2ZUA A;  4IO1 A;  4LIW A;  2HEK A;  4TNO A;  1VQ7 S;  4CRJ A;  2XGQ A;  4QYR A;  1YDL A;  2CNK B;  2HWH A;  1I51 B;  3RBD A;  2KFY A;  2V63 A;  1U1K A;  3MHY A;  2YH1 A;  1Y5N B;  3CE8 A;  4UPH A;  2DNM A;  2RIL A;  3HM9 A;  4USJ C;  3PR5 B;  4UOC A;  3CJ8 A;  4DX5 A;  4N76 A;  2OEK A;  2MQQ A;  4RU2 A;  2HQI A;  3ZO7 A;  1RWV B;  4KYZ A;  1C1B B;  1X60 A;  4IG0 B;  2CQ4 A;  2KYX A;  3DI6 B;  2FJD B;  1HI8 A;  1NND A;  1TL1 B;  1S1W B;  1HD0 A;  1VDH A;  3SCK E;  1E33 P;  3J7A 1;  3IM8 A;  1RT6 A;  3E51 A;  1URB A;  1F2H A;  2FHJ D;  1ROF A;  2MJN A;  2DHX A;  2VH7 A;  5J2N B;  1SH0 A;  3J7A N;  1C1B A;  1U0S A;  4B9T A;  5F8N A;  1O5J A;  4L76 A;  3PEH A;  1AA1 B;  5DJB A;  3IDD A;  3R2C J;  4ED0 A;  2OGU A;  3QWU A;  2ZHB A;  1E1Z P;  1R8C A;  2W2O P;  2YKN B;  4OIX A;  1S1U A;  5KFG A;  2ASL A;  4NA1 A;  3M8P B;  2V69 A;  3NAI A;  4J9L A;  1Q82 T;  1XK8 A;  1ZA2 B;  1HQE B;  5DDQ C;  1S1V A;  4S0M A;  3BDG B;  3A3N B;  3DOM A;  2RNE A;  3ZZO A;  1VC6 A;  2R7V A;  3OT9 A;  1S10 A;  3ZTS A;  4P2X A;  2FJV A;  4QU7 A;  2UXB F;  2XGP A;  2DPI A;  2J6T A;  1VBK A;  2LQ9 A;  3J7Y U;  3BF4 A;  4L3K A;  2AMC B;  5E5N A;  1B4S A;  1HNI B;  4Q8E A;  1F5C A;  1YJT A;  5FII A;  3D6F B;  4DUY J;  1XMO J;  1O98 A;  1MSW D;  1EAR A;  1BQM B;  3RYL A;  2L9D A;  1UEU A;  2LXF A;  3UI3 A;  5KOW A;  1QSS A;  2PFF B;  2HAF A;  3GE9 A;  1EKS A;  1EX8 A;  2FY8 A;  2RRN A;  1X4C A;  3FFI A;  1T0T V;  3ITH B;  3U1N A;  2ILY A;  5K8M A;  2ERR A;  1NJX A;  1CBK A;  2J5A A;  2X1F A;  3W63 A;  3SV3 A;  1OQ6 A;  2J6U A;  3OJS A;  5MLC V;  3FCV A;  5GAH I;  1UZH A;  3SZ2 A;  3L7O A;  4ZVP B;  4CWB A;  3OUY A;  2ZM6 J;  2JEI A;  3CMR A;  3T00 A;  1WHV A;  2RD5 C;  3CCZ A;  1UET A;  3NKY A;  4EGL A;  4RZR A;  4O0N A;  4OYW A;  2V4J A;  2HVI A;  1Z1Z A;  4QZV B;  4CP5 A;  2W7A A;  3GPA A;  2W4C A;  4DV3 F;  1VQK S;  3KFW X;  1EQM A;  3GLJ A;  3KLI A;  4R0E A;  1LWE A;  3S8S A;  3PJX A;  5I3U B;  1LV5 A;  2UVU A;  4IFV B;  3CC7 S;  1AFI A;  1OQ3 A;  5KT2 A;  2GVZ B;  2CDR B;  3IR5 B;  5E3A A;  4DN9 A;  4DX8 H;  5EGE A;  4HTI A;  4NCB A;  1BY9 A;  1OY8 A;  1IJE B;  3FEY B;  2GJI A;  2VZ9 A;  3IWX A;  4ZS6 A;  3KUE A;  2VQE F;  4YOE A;  1O8B A;  4LFC F;  4RBV A;  1RWU A;  5F8M A;  5IOL A;  4L3N A;  4DUZ F;  3K7R A;  2YX7 A;  2ZD1 B;  1WD6 A;  2QL9 B;  4B02 A;  1HHS A;  2XNR A;  1U1O A;  4WE1 B;  1FX4 A;  4QWD A;  2XLJ A;  3B6B A;  5HJY A;  4AE5 A;  4QYZ J;  2EG1 A;  1NH8 A;  1YBA A;  3DU6 A;  3OXF A;  5LSO A;  4OYA A;  4E8U A;  4KGX B;  3AJD A;  3EMT A;  2B4U A;  2DGS A;  3AFG A;  4MK8 A;  4E2F B;  2ZM6 F;  1F5B A;  3H7H B;  3SDE B;  4OLO A;  2BKP A;  4X4Q A;  4OV6 A;  3J80 Y;  2MKS A;  5IC6 B;  1RGV A;  1X5T A;  4P7V A;  4YB1 P;  1S6P A;  1FRL A;  4NI2 A;  4UOR A;  5A8W A;  3I55 S;  3LAM A;  4JP8 A;  2UXC F;  2MLY A;  1DAX A;  2ZVI A;  4ECQ A;  3IBF B;  3LA0 A;  3UDL A;  2W8D A;  4G1I A;  4IR1 A;  2XMU A;  3V4I B;  1GX5 A;  3AY0 A;  2C2O B;  1CG2 A;  1CC8 A;  3EVO A;  3HFZ B;  4G1Q A;  3LP2 B;  2LFV A;  1OYD A;  3OFG A;  1UA1 A;  1HQA A;  3QYY A;  3NKR A;  1DQ8 A;  1P8G A;  2NXE A;  2HGN A;  4IG3 B;  3MK2 A;  3Q8P B;  2Z57 B;  3BJY A;  1TL4 A;  2K7J A;  1RAI B;  4K4U A;  1HNW J;  2DKO B;  5GAE U;  4IDK A;  3E2E A;  2EFG A;  2VV5 A;  4R8U B;  2FLL A;  1OY6 A;  2Y0S D;  1SKR A;  3CTR A;  2U1A A;  3FUY A;  4USK A;  4Y2I A;  3GIJ A;  4R5P B;  4WF9 Q;  3QO9 A;  4OZ2 A;  2R8K A;  5JUM A;  2XEX A;  4RW8 B;  4X4P A;  5IT4 A;  1SQG A;  4DR1 F;  2HFS A;  1VIO A;  5KFR A;  2Q66 A;  2BJ7 A;  1ICE B;  1JLC B;  2FHJ A;  2C3P A;  3AQO A;  3D3B J;  3VR1 A;  1UVL A;  2LKZ A;  2H4W B;  4HHJ A;  4NWB A;  4GVL A;  1URA A;  1WF2 A;  4DSE A;  1D8Z A;  4Y2M A;  2KN4 A;  3CWJ A;  4H4M B;  3ET6 A;  3PDN A;  1DAR A;  3N5F A;  5DO2 A;  4F36 A;  1U6F A;  4ZP7 A;  3RAM A;  4FF1 A;  2H5J B;  1ELY A;  1IN0 A;  2GQQ A;  2V2Q A;  1KVJ A;  2HQF A;  1LW2 A;  1NSQ A;  1U24 A;  4ZKA A;  3OVB A;  3FFI B;  4ED4 A;  3GYN A;  3CJK A;  3OR1 B;  3PEJ A;  3WC0 A;  1SBR A;  1CUL B;  1K73 T;  3DLK B;  2FVP A;  4Q0B B;  1HNV A;  3PFE A;  1A9N B;  5IM0 B;  3P5B P;  4LFB J;  2CJ9 A;  2QLF B;  2HHH J;  1GT8 A;  1Q8B A;  1R3N A;  4FYW B;  1H2V Z;  4P52 A;  1NK0 A;  5I3Q A;  3W8G A;  1QLN A;  3IWN C;  3BGR A;  2BJ1 A;  9ATC B;  2UV8 G;  4G6V B;  5F0U A;  4FDJ A;  1HBM A;  2W9B B;  4KT0 C;  2EPI A;  1C1C B;  1C2P A;  2VBX A;  2JWN A;  2B9X A;  3DMJ A;  3MTJ A;  4U8Y A;  5IT0 A;  3KHG A;  3G6Y A;  3FK4 A;  4LSN A;  3WX4 A;  3L4B C;  1U47 A;  4G3I A;  1WG1 A;  2BQU A;  3HVA A;  3DDN A;  1RT5 A;  2HSE B;  5DLF A;  5CH7 B;  1ZTT A;  2DHG A;  2IBK A;  2N4D A;  1Y6V A;  2KXF A;  3X3U A;  3FGV A;  2BE2 A;  5AJ9 A;  1FRJ A;  3IAM 9;  2AGO A;  1RHJ B;  1YSJ A;  4ILM A;  3PAC A;  1PBA A;  5K8O A;  4MJK A;  3SBM A;  1Y3J A;  3O3L A;  1KH9 A;  1FKO A;  3OR2 A;  1FFW B;  1FRX A;  2QLB B;  3Q8U A;  4UW2 A;  4WPA A;  1HYS A;  5E0O A;  4ZG9 A;  4CM0 A;  4LR9 A;  4YP3 A;  3BRE A;  3TYT A;  4DR5 F;  4KHR A;  1Q4R A;  4ECZ A;  2OKQ A;  1PC4 A;  3AD9 C;  3MCM A;  1JLE A;  3GON A;  1FKP A;  4LFB F;  5IT9 U;  2V5H G;  4QCL A;  4NWJ A;  1X0F A;  3JQJ A;  4HKQ A;  2MQ8 A;  3LGN A;  4AXI A;  5A2Q Y;  4U7U K;  3KLF B;  5GOV A;  3AOA A;  4DUZ J;  1F9H A;  2ROE A;  4A8Y A;  4Y65 A;  4QAX A;  2OPR B;  5EN1 A;  1R8H A;  3AAW B;  3C16 A;  3DM2 A;  2G0C A;  4OLP A;  1HWJ A;  1JJ4 A;  1HBO B;  3KLV A;  4CH7 A;  1U7L A;  2AEM A;  3F44 A;  1RT4 B;  4TQR A;  4YDX A;  2AEF A;  1S9F A;  4F3Q A;  3RW7 A;  1TTH B;  3LWM A;  1RAJ A;  2XY6 A;  2ZH1 A;  3CCE S;  2KZM A;  2DR5 A;  5DLV A;  4ETZ A;  3J7Y I;  5AE2 A;  3BSA A;  1KD1 T;  1YRT A;  3H5U A;  4FYY B;  3EE3 A;  2JVR A;  1RBL A;  1VQ6 S;  1QAY A;  2I0X A;  4TKT A;  1N34 J;  1S5Z A;  4A8X A;  4WTO B;  3BSN A;  4CXU A;  2DH9 A;  1YRU A;  3IGV A;  3CCV S;  4USU A;  3RBX A;  1GTE A;  3LO3 A;  1VQY A;  3CCJ S;  1RT4 A;  1FJG J;  2I5J B;  2UXD F;  4FP9 A;  1HQE A;  2J7W A;  4P2S A;  1DZ5 A;  2E5I A;  4OJG A;  3SMZ A;  3OL6 A;  4WKR A;  3VGS A;  4WFX A;  1H73 A;  4GKJ J;  2IRY A;  4X4S A;  5L39 A;  4RW7 B;  2XMK A;  2ZNY A;  2MQM A;  2X1G A;  4K7Q A;  1SQE A;  1CS4 B;  4JI3 F;  3EDQ B;  4LR7 A;  4JYA J;  2DYA A;  3HI9 A;  2CQC A;  2O5D A;  1RYR A;  3N28 A;  2RDJ A;  4ED3 A;  2CQB A;  3K8V A;  1RTD A;  2G1H A;  1RT2 B;  5GME A;  1JKH B;  4M5L A;  1X4B A;  1WAC A;  1U2R A;  3CCS S;  4J9Q A;  1TAU A;  1IWG A;  4Z7Y A;  2E9Z A;  1L3U A;  1PAE X;  3GYG A;  4YHH F;  4DFP A;  4P74 A;  2GFF A;  3CDB A;  4DR1 J;  3EWG A;  3HVW A;  3M1V B;  1UKU A;  3DRR B;  3JQK A;  3BM7 A;  4LF8 J;  2K2P A;  2Y1L B;  3CNQ P;  1CJU A;  1FFG B;  3FRY A;  3IR7 B;  2K1R B;  1DQ9 A;  1M5K C;  1N2K A;  1FNO A;  2HBZ B;  1P1T A;  1TZ0 A;  2HFO A;  2WTF A;  1S72 S;  4AL5 A;  2CPJ A;  1VIS A;  4DL0 C;  3EGZ A;  2EKN A;  3CD0 A;  3GSI A;  3SSR A;  4X4U A;  1X7V A;  2I38 A;  4J5O A;  4OQJ A;  4K0K F;  1IWA A;  3DRS B;  2W2Q P;  5KG5 A;  3CD6 S;  1Q16 B;  3R5B A;  3WQP A;  2ROP A;  5KT3 A;  1P9Y A;  1RZM A;  2YKP A;  3J81 j;  3DLK A;  2MZQ A;  3OFH A;  1ZPV A;  3KJF B;  4NZ7 A;  1EJJ A;  3MMA A;  4TY9 A;  1S99 A;  4WTY A;  2QFJ A;  4JYA F;  3C16 B;  4N56 A;  1VRT B;  3BR8 A;  1RT7 A;  1FCA A;  4I2Q A;  2HBR B;  5L1I A;  3PKM A;  1W25 A;  3B82 A;  4GTX A;  3NOC A;  1T03 A;  3WBZ A;  2ZEJ A;  2HBQ B;  2HHT A;  2ZWO A;  1NPR A;  3M4X A;  4P73 A;  3Q8R B;  5KFC A;  1G7C B;  2P2C B;  2GS8 A;  3KWM A;  4B3M F;  2QA4 G;  2IM3 A;  4KGV B;  5KFF A;  1QAX A;  3KDO A;  2Z2M A;  3BKF A;  3QSY B;  4X4N A;  1Q7Y T;  2E1R A;  5L0K A;  4IFY A;  3MOZ A;  2ZE2 A;  2ZKT A;  3G96 A;  3EGW B;  5I42 A;  3C6T B;  2GSU A;  3CJR A;  1CQM A;  4F0H A;  3M8W A;  1DRZ A;  1LOU A;  1H74 A;  4Q2M A;  1UCN A;  2ZVS A;  4CH1 A;  1SPB P;  4O4G A;  3RAQ A;  4A8M P;  2OFG X;  4RNM A;  4DI6 A;  1R43 A;  2DGQ A;  4WFY A;  5IFM A;  4R5P A;  1TK0 A;  2UUB F; 
#chains in the Genus database with same CATH homology
 2XR9 A;  5DLT A;  3SZZ A;  4KJD A;  2GSN A;  2W5X A;  4TN0 A;  1E2S P;  1ALI A;  2VQR A;  3WBH A;  4NWJ A;  4UPK A;  1SHQ A;  1ZED A;  3A52 A;  4CXK A;  4LRF A;  5LRM A;  4LRE A;  3MK1 A;  3UNY A;  4YR1 A;  1EW8 A;  2GSO A;  4QAX A;  4LRA A;  3DYC A;  3UN5 A;  2XRG A;  5K4P A;  3TX0 A;  2W8S A;  5KXA A;  4UPL A;  1KH4 A;  3WAY A;  3BDF A;  2W5T A;  3KD8 A;  5DLV A;  1ELX A;  1EI6 A;  1O99 A;  1P49 A;  3ED4 A;  3Q3Q A;  4LQY A;  4UOR A;  5LRN A;  1HJK A;  2W8D A;  5LQQ A;  4CXU A;  3TWZ A;  1ANI A;  3WAW A;  4UOO A;  1EQJ A;  3MK0 A;  1HQA A;  5HRT A;  1AJD A;  1ED8 A;  4GTZ A;  3DPC A;  5INH A;  4FDI A;  3NKR A;  4UPH A;  5GOV A;  1KH7 A;  3B5Q A;  3MK2 A;  3IGY B;  3NKM A;  4GTW A;  4N7T A;  3UN2 A;  2D1G A;  5EGH A;  3M8Z A;  4ZGA A;  4LRD A;  3E2D A;  4LRC A;  1KHL A;  4KJG A;  4ZG9 A;  1E33 P;  4UPI A;  4ZG7 A;  1ZEB A;  2G9Y A;  4LR7 A;  1HDH A;  1URB A;  4MHX A;  5IJQ A;  1Y7A A;  5TJ3 A;  4MY4 A;  1AJB A;  5IJS A;  2GA3 A;  1N2L A;  1ED9 A;  1AJC A;  3M7V A;  3NKP A;  1AJA A;  3IDD A;  4B56 A;  1E1Z P;  1ALH A;  4CYR A;  1B8J A;  1ANJ A;  3TG0 A;  3BDG B;  3IGZ B;  1URA A;  5C66 A;  1KH5 A;  1K7H A;  3LXQ A;  4LR2 A;  1ALJ A;  2W5W A;  4ZG6 A;  2W5S A;  2GLQ A;  1N2K A;  4LRB A;  4CXS A;  1ELY A;  1SHN A;  2QZU A;  5L0E A;  3OT9 A;  2RH6 A;  1KHN A;  3BDH A;  1FSU A;  4KAY A;  4NWX A;  3T02 A;  1KHK A;  4KAV A;  3UO0 A;  1KHJ A;  1O98 A;  4LR8 A;  2IUC A;  2IUC B;  3NVL A;  1EJJ A;  3NKN A;  5DLW A;  1EW9 A;  1AUK A;  4FDJ A;  2W5V A;  1ZEF A;  3NKQ A;  5L0B A;  2IFY A;  4GTX A;  4GTY A;  1ALK A;  5LIA A;  1E3C P;  3T00 A;  4CYS A;  2W5Q A;  3CMR A;  4UOP A;  4KM4 A;  3WAX A;  3SZY A;  3UN3 A;  3BDG A;  1Y6V A;  3M8Y A;  3WAV A;  5GRR A;  1EW2 A;  5L0K A;  2X98 A;  5AJ9 A;  2GSU A;  2ZKT A;  2W5R A;  3NKO A;  3M8W A;  2ANH A;  5EGE A;  1KH9 A;  3T01 A;  4MIV A;  1ELZ A;  4LR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...