4LR9A

Phosphopentomutase s154a variant soaked with 2,3-dideoxyribose 5-phosphate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTAADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 138
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lr9A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr9A01
4CXUA 4KJGA 5DLWA 4LR7A 1EW8A 5L0EA 1KH9A 3NKOA 4B56A 4LRAA 3KD8A 4CYSA 4CXSA 3MK2A 3WAYA 4UOPA 3T02A 4MY4A 5EGHA 3ED4A 4ZG7A 3NKQA 1ANJA 1ELXA 5IJSA 4KAVA 4UPLA 3NKNA 2W5QA 5EGEA 1E33P 3TG0A 1SHNA 1ALJA 1FSUA 3DYCA 5HRTA 2GA3A 2W5VA 4UPIA 3DPCA 4KAYA 3MK1A 1ALKA 4NWJA 5C66A 2W5TA 1ELZA 3E2DA 5DLTA 5GRRA 3BDGA 3A52A 3T01A 5INHA 4MIVA 4ZG9A 3UN2A 3UN5A 4GTXA 2IUCA 3T00A 4LRBA 3NKMA 4LRFA 1ED8A 4FDJA 4ZGAA 3M8WA 3WBHA 3BDGB 2RH6A 3M8YA 5AJ9A 1URAA 1E2SP 2IUCB 1N2LA 1ZEDA 3WAVA 1E1ZP 3SZZA 5LQQA 2ANHA 1KH7A 4LRCA 3OT9A 4TN0A 2W5SA 2X98A 1AUKA 1ZEBA 1HDHA 4LRDA 4YR1A 1AJDA 3TWZA 1SHQA 4GTZA 1O99A 4LQYA 3M7VA 1KHKA 1K7HA 3SZYA 1ALIA 2IFYA 1HJKA 2D1GA 2W5RA 3MK0A 4GTWA 5L0KA 1ELYA 1B8JA 3IGZB 5IJQA 3UNYA 3IGYB 1EI6A 1ED9A 5LRMA 1EJJA 1E3CP 4QAXA 4UPHA 1ALHA 1URBA 3NKRA 4LR2A 4UOOA 4MHXA 2GSUA 1O98A 1Y6VA 5KXAA 2GLQA 1ZEFA 2ZKTA 3NVLA 3B5QA 4KJDA 4UORA 1Y7AA 4N7TA 3UO0A 3BDHA 1HQAA 4LR8A 1KHLA 1KH5A 2G9YA 5LRNA 2XR9A 4NWXA 3IDDA 1ANIA 4CXKA 3CMRA 3TX0A 2W5WA 4KM4A 1AJCA 5GOVA 5DLVA 3UN3A 1N2KA 4CYRA 2GSOA 4UPKA 1EW2A 1EW9A 3WAXA 1KH4A 5L0BA 4LR9A 1KHJA 3NKPA 2QZUA 4GTYA 5TJ3A 4LREA 3LXQA 1EQJA 3Q3QA 4ZG6A 1P49A 5K4PA 3M8ZA 1AJBA 2XRGA 3WAWA 1KHNA 5LIAA 3BDFA 4FDIA 2W8DA 2VQRA 1AJAA 2W8SA 2GSNA 2W5XA
chains in the Genus database with same CATH superfamily
5GADI 5G0RB 3SEOA 4HACA 3WBZA 3V6KA 3CWJA 2CVEA 2DHAA 3Q8SB 1HHSA 1KWMA 4OFZA 4I67A 2MLXA 1AZSA 2KL8A 4YR0A 4RW8A 1BMQB 2VL1A 5EWFA 1PYTA 1S0VA 2V8DA 3GWCA 2DGQA 4K4XA 4RJVA 1DTQB 2XZTB 1U1MA 2VKRA 1Q16B 1WNEA 1RHMB 4NASA 3H5XA 1Q1KA 4CH1A 1X5PA 5CCLA 4ZPAA 3TI0A 4EZ9A 3M8QB 4FYYB 2EVZA 3H25A 4TU7A 1F2GA 2HHQA 2OGUA 5DS7A 1X5TA 4X4NA 4A8KA 1K73T 1WHVA 2XSJB 4KHPF 1HW8A 1XBWA 5EX3A 3MMCA 5KFLA 3MPVA 3OV7A 1EW9A 3VR1A 3TEHB 5K14A 1FJGJ 1WF1A 1JJ2R 1HQ2A 5HMWA 1S1VB 4EYIB 4K4VA 2HHXA 1WUUA 3IGVA 4ECTA 2KFNA 4QBUA 1FF2A 4FF3A 2LA6A 3K89A 4F25A 2YWFA 4Y2AA 5DO2A 1ELXA 5KFNA 3M6VA 3GIMA 4HI1A 1YBTA 3QYYA 4MKVA 1SJQA 1F2HA 2LQ8A 3R5BA 4NZ0A 5DLTA 4QWEA 3BN7A 2GQ2A 1N5VA 3RB0A 1ELOA 1L3VA 1KD1T 4QW8A 5HVGA 1VCTA 3AXKA 4G6VB 2V2VA 1YWXA 1VK8A 3TA1A 2DIUA 3MTJA 3QT7A 1EQMA 5KFTA 4N5SA 5GADU 3FEXB 3GIRA 2KH9A 2GJFA 2JLGA 1NZ8A 1EJJA 1YJWS 2VH7A 4X4UA 3KG0A 4WP3A 4NLRA 4WWSA 5I3UB 2HRUA 5ETKA 2ZH9A 1WG5A 4TKTA 2W5WA 3BDEA 5J2NA 5CCMA 2AGQA 2ZHOA 1WSVA 4BHQA 1TFWA 4PAAA 1EX8A 2QL5B 2DCUB 4NLQA 3LO3A 4RKUC 1RLCL 3FEYB 2G0IA 5B0BA 1Q8IA 2XEXA 4B02A 3KK1B 1LWXA 1LFPA 2J5AA 2LEAA 3QBCA 5M2RA 2LVWA 5M2PA 2KXHA 4UPLA 3UR3C 3SQOP 2VG5B 3DPCA 3MCMA 5EWEA 1OYEA 2EK6A 1TKXB 2B9EA 4F50A 5EHHA 2CPXA 4MFBA 1URNA 3FZBA 1FWLA 5KFVA 1E2SP 3GV7B 3QFWA 1GFWB 4OHWA 4LQYA 4K0KF 1X4HA 5CAAA 3OSPA 3N01A 3CSKA 5JVHQ 5GMEA 4PWWA 5D4OA 5AT1B 2B7CB 1WC3A 3C16B 2NXEA 2XLIA 3UW1A 2WTFA 3KK3A 4WYWA 3HSGA 4O3NA 4DSFA 2XO7A 5BYRA 1YQHA 3M8PB 2HVIA 4DZDA 3DLEB 2RDIA 4KY3A 3N28A 2HK3A 2COLA 2WCXA 1Q5VA 5A76A 5K9FA 4J9LA 3PYDA 2W7AA 3EE3A 4NL5A 2ZUGA 1CJKA 4ZJQA 1C1BA 1E6VB 5C24B 3GFHA 2FYXA 1IJFB 1FX2A 1MWYA 3H98A 2OH2A 2ZZMA 3HP6A 5KAKA 4I2QA 3GJSB 3HCXA 2IVFB 3EXCX 1UFLA 2WVBA 2W8KA 3GYNA 3NWGA 4USUA 1YIJS 2NSCA 2Z2LA 2QE5A 2JL9A 2PN6A 3PZPA 4CM0A 2QA1A 5IM0A 5A8KA 1JX4A 1WG4A 4IG3B 2B5JA 3T1YF 4Q0BB 2HVDA 2CADA 2PGCA 5H9EJ 3J81j 2CNKB 4M5MA 1KQGB 1VRTB 4KJDA 3ITHB 2B9XA 3CEDA 4EBEA 3GIKA 1OY6A 3QO9B 3O6QA 4RNOA 2CQDA 2GHWA 4ZPVR 4GTYA 4ILLA 1QSSA 2LECA 2GW8A 1B0TA 3C15A 2ROPA 1NPRA 2M4MA 1Y9OA 4DMZA 5LSRA 3KXDA 3UNGC 4UY8T 3PYFA 1CSJA 2UVWA 2G0CA 2Z2MA 1SBRA 4G3IA 1K1QA 3MR3A 3CJ5A 3IFEA 3EMTA 1IBLJ 3OBIA 3D6MB 3DDNA 3E2DA 3T6BA 2FLLA 3OLAA 1D8ZA 3Q22A 3NKMA 4ZPBA 1VQMS 1E6YB 2GHVC 4F36A 4ZVTB 1CJTB 2XS2A 4YR1A 2ALYB 4F2RA 3HT3A 3OL9A 4U7UK 3DLKA 2E7XA 2DGOA 3GFXA 1KONA 1WF2A 2YXLA 3M2VB 4O4GB 1GX5A 2HPUA 4EBDA 4J9MA 1WKKA 1G6BA 3A8EA 2AYGA 3TOQA 1N32F 3W3SA 3C19A 3D68A 1SVDA 1BQNA 3BSAA 5IWAJ 2QX0A 1ZEFA 2KN4A 4N41A 2JEFA 3TUJC 1BHNA 3SQGB 4WFXA 5HBMA 4C8NA 1JXVA 4B3RJ 4Q2MA 5JXSA 1Y10A 3ISZA 6AT1B 1YJUA 4E2FB 1ZZNA 3KD8A 1VQSA 3WAYA 2MLYA 4NLYA 3FCWA 2XMTA 4NPOA 5EX0A 2V69A 2ZEJA 3I87A 2FHKA 2C2RA 2ZOFA 4I7FB 2YPYA 3GCXP 2PFDA 3JS9A 5KT4A 3THVA 2XGPA 1ED8A 1RACB 1RBOB 1JLCB 4NX9A 2XLKA 1IBMJ 3M2RA 4LSNB 2MHNA 2QJ3A 1T9WA 1U1PA 2ASYA 1ACMB 3GONA 1RB0A 4UUWA 4UOGA 1TTHB 4QIEA 3N5FA 3NGTA 2MYFA 3BPSP 4WP9A 3ZTRA 3FCHA 4DR3F 4LMZA 2ZH6A 4JI0F 2Y0BB 3KFWX 4DV0J 3MTKA 3CJKA 4LF9F 5CZVA 4NLPA 4A8WA 1I94F 4OZLA 2V0NA 1OYDA 2A1BA 4DR2F 1S77D 1O5JA 2RH3A 5SUHA 1I51B 5K5MA 4F02A 2DHSA 3QLHB 4B17A 5KT5A 3P5TL 1RWUA 2V8VA 1UPPA 1HPZA 5H9FK 2JFDA 1XC9A 4YDDB 3G82B 2UUBF 2HIYA 1Z4UA 1IQZA 2C2KB 2HNYB 4ALZA 4M5JA 3LWLA 2MSSA 5KFCA 3KWMA 1HJKA 4C8KA 1NB2A 1RLDA 1YITS 2RS2A 2YH0A 1MU2A 1ALHA 4TLQA 3D67A 3K17A 2ZWOA 3B82A 3CJ4A 2R8HA 5LJ5Y 2IJFA 2ZDPA 4O23A 4FYDA 1RT5B 5FIIA 5LRNA 1QLNA 2E9TA 2CQ1A 1I6JA 5C25B 2GFFA 1FJ7A 4Y65A 1NHUA 4I6YA 2M0GB 2GC8A 1M1HA 4PYDA 2DR5A 3CJ0A 2BE9B 1VBKA 2DKOB 2DGXA 3PM9A 1RABB 1VBXA 4UQGA 2ZOGA 4RUBA 3RG6A 4WU2A 2CJ9A 2B8QA 5HVFA 4DV5J 4OMFG 1N0UA 2Q6BA 4ECRA 3HKZD 3ZC4A 3MWBA 2C2DA 1OS5A 4ZN1A 2W7PA 2BABA 3IRXB 2B3TB 1XR7A 1EQ0A 4JI4F 4K8RA 4ICLB 1VQ5S 2CRLA 4F4AA 3NGSA 2F9JA 2DY1A 2MY7A 1X60A 4DLEA 4X65F 2DGSA 1ZA2B 1YTYA 2CPYA 2HNZA 4CO2A 4JI7J 2F5GA 1FE4A 4FXDA 3ENVA 3AQPA 3AFGA 3K5NA 4J9UE 4DX8H 1KFSA 1IQTA 2MKYA 3KJVB 3TANA 2BX6A 4FVMA 2M7SA 1R7IA 1N6QA 2IMOA 3UN3A 4Z7YA 1WKLA 1EW2A 3D6FB 3OJUA 2BE2A 1HYSB 4X84A 5H1SV 2IHR1 4AXIA 1QM9A 5HLFA 3NGRA 4CNYA 3I96A 3BREA 1YJTA 1RQ0A 3LAKA 1QSYA 4DUZJ 3OR2A 2X51A 1YRTA 3FUYA 5D77A 2RUGA 2W2MP 4ID5A 1X0FA 2AX1A 1IWGA 1LWEB 2QC3A 1X5SA 1FEEA 2VQEF 1EKRA 4FF1A 2JVRA 1S9GA 3OW2R 4WTOB 3IM8A 2V9WA 3FMWA 2Y8YA 1Q8BA 5A8RA 1U0HA 2NSBA 2O66A 3MI7X 1R0BG 1X9MA 2OI2A 4OZ3A 2B4UA 3R5AA 3OFGA 3TA2A 3K58A 2C3MA 1WD6A 2R4FA 2BEFA 5SZTA 5ETSA 2MKKA 1N33F 4IR1A 4IDKA 4QJVA 3J81Y 3RBDA 2V2QA 2FHMA 1VC5A 3NLCA 2N4DA 3DYAB 3GMGA 3UD4P 4OZNA 1RP5A 4RW7A 2L08A 2DXEA 3GQCA 4DV1J 1RWKB 2AMCB 1S7HA 1V3ZA 1H38A 2XTJP 2UVRA 4QIVA 5CYQB 4ED4A 3W64A 1I5OB 5CHCB 2J9DA 2J6TA 2BJDA 3KDNA 4ZG7A 4ED1A 4WF9Q 1EETA 4GKKJ 1DBDA 3EVOA 2G2YA 2DO0A 2QT7A 5F0UA 2C3UA 2KB2A 1M5KC 5CYMB 1MROB 2OSRA 2VG7B 4MIVA 4LF2A 2IUCA 4RBUA 4LRFA 1F60B 2RH6A 3PNIA 4TY8A 1F3FA 1RKIA 3TA0A 2XMMA 2KT3A 2GV1A 2QG9B 4DR7J 3MFIA 2E44A 4YOEA 3JQJA 1Y4ZB 4UPHA 1RCOB 3C14A 3DRRB 2VQFJ 1Q7LB 1FKPA 2Z4PA 1M5SA 1SIZA 2FJVA 3JSMA 2VJVA 2ZKUA 1RZMA 2YWEA 4QR2A 1G4CA 2DISA 2BVZA 5DLVA 2D9PA 2CUYA 2J76E 1Q7YT 1HNZF 1LWCA 4ZHRA 3MM9A 2A2CA 5LIAA 2G9OA 3LW5C 3UDEA 2YNFB 5KT6A 5IT9Y 1UW9A 3NNAA 3L3CA 1O51A 1BWEA 4L75A 1OIAA 4MK7A 1KS2A 3E51A 4AL6A 1BY9A 1AROP 3BKTA 2F4FA 1AUSL 3KLIA 4DQQA 4HL9A 9ATCB 1HNWF 4G1IA 3AD9C 4NEZA 3LUYA 4BBYA 3CJQA 2F4VJ 4LRBA 1QE1A 1AFJA 2W9CB 3QAEA 1PBUA 2Y1LB 2HHVA 4BCAA 2VPYB 5BJRA 2WSEC 3BPDA 4LRCA 3OVSA 3MMAA 3DN9A 1TL4A 4NXMJ 2IFXA 2CQCA 2V8PA 3BBFA 1F9HA 1U24A 3D3CJ 3KK2B 3J7YI 2GSUA 3IR6B 4FYXB 1NZAA 2XNRA 3HZEA 3NVLA 5J2PA 4URSA 2KJVA 5JMNA 4LF7F 4Q44A 4FF2A 1QTMA 2AYEA 3MR6A 2CPHA 2YWWA 3ISNC 2VONA 2X1BA 2ASLA 1IKYB 1IN0A 4TNOA 1VLOA 1R89A 1WWHA 3VZHA 2JWNA 4RW9B 4J9NA 4NLXA 1SJ1A 4C11B 1TU0B 3V6DB 3L95X 2GA3A 3KYLA 3DM2B 3BYRA 2AYBA 4GKJJ 2GX8A 1PIEA 1GH8A 3M2UB 3PW4A 1WHYA 3GP9A 2WB1D 2HWTA 3CCJS 1CULA 5M2UA 3SSSA 4YEAA 5T7LA 1S6OA 5LRMA 2MQPA 2XGQA 3FVYA 2HHUA 1Y6VA 3MPDA 2JRSA 2CDQA 3FBBA 3FBEA 4KR0B 2HNDA 3PFEA 4CLYA 1U1NA 2Y0SD 3LANA 3DLGA 3NGKA 3J7A1 3NS5A 3UVJA 1R0CB 5TJ3A 1BQMB 2NZCA 3WAWA 3R1LA 3M32A 2XWXA 3GG1A 3IM9A 4YB6A 5IT9U 3CDAA 1TL3B 2W4CA 4C3KA 3GJQB 3OFFA 4KGXB 1EP4B 3V4IA 4OYAA 1T9YA 1DZ5A 5EUHA 2NUHA 3GR1A 4X4OA 2CPZA 4RU9A 2IDLA 3DNCA 3J7YU 3KLFA 2Q66A 3KLHA 3HVWA 5ETTA 4ZVUB 3EWGA 3OTDA 2RAQA 4JB8B 1C1CB 3MM7B 1HMVB 3D66A 3DU5A 1E1ZP 1FWPA 4OHZA 1RKJA 4OV1A 2H5JB 4DV3J 2RE1A 2ZC4A 3GJRB 1AYEA 1K0VA 2E1AA 2OP5A 1KQFB 1CJVB 3CD0A 2UP1A 3BBCA 4D3HA 2MZ1A 4X2BA 1KEKA 3EX7B 1YZ7A 4MMOA 5FLXY 1SQEA 5DM6Q 4X66J 2J0QD 4LF5F 1B4SA 2Z2ZA 2C2EA 4QIGA 2F1FA 4NLWA 3NMRA 5KOWA 4OYZA 4CO4A 4ZK7M 3R5CA 5HI7A 3FQLA 2OPSB 1F5AA 1FERA 3IS9A 2EBGA 3O3LA 3BR8A 3GFZA 3ENWA 2V6AA 2VICA 4OX9F 1FA0A 3GIJA 2E29A 1HD0A 3NCQA 4IFYA 2P6TA 2UV8A 5DQHA 3GFYA 3DRSB 2AD9A 3RBXA 1UJ6A 3ZZYA 4OI1A 2EPIA 5K8OA 3TUPA 3P4UB 2P6SA 2YWHA 1WJ9A 5B08A 4FNIA 1Z1ZA 2AKWB 2BW7A 2YPZA 3ZZOA 1F9EB 5C2GA 4NCGA 5KFOA 1OPZA 4ETZA 4YHHF 4F4YA 1HHTP 2VPZB 2CVIA 4KFBA 3C6UB 4OX6A 5B7WA 1VHIA 4H4KA 4B9LA 2V4JA 5I3PA 3BKUA 1IKVB 2Z2YB 3HD2A 3OL8A 3CCQS 2BJ8A 3CIMA 2DNNA 2DXFA 2DEIA 2MZTA 1VC0A 4WZQA 1RHQB 2GS8A 3QRQA 3PTWA 3GV5B 3DOMA 3AH6A 3R27A 5I42B 1S6PA 2PA3A 2YQ0A 1N56A 1N88A 1N48A 3I5BA 3TR5A 2EKNA 1FO1A 1QUPA 3Q8PB 2P9CA 4LIRA 2L3MA 3DI6B 4WFNQ 5LMNF 4LRAA 2DNHA 2F40A 1UVIA 1ANJA 2NYIA 3OR1A 1JLEB 1TAQA 4UPIA 3BJYA 1RAOA 2VBYA 2F63A 2FJEB 4KHPJ 3E01A 4B3OB 4F26A 1NDCA 4C0BA 2JNJA 1S1UA 3HHDA 1U8WA 2BMBA 2UZAA 1HBNA 3AJDA 2DH8A 2EG1A 5ADZA 1M90T 2XMWA 2KI2A 1HWLA 1JLBB 1WC5A 3SMZA 2L48A 3L7PA 2NS1B 2BM0A 1KBRA 3U1MA 4AYBD 4ZVGA 2GO9A 3HX9A 4QAXA 1FJCA 3BSOA 2QYCA 4P71A 3AQOA 4WFAQ 3A12A 3TO8A 4X4PA 1TL1B 2VBWA 1JKHA 1D1UA 3W5YA 4LT6A 1VIOA 2XY7A 1TKZA 4C8MA 4EBCA 3V6HA 1S7IA 2V5HG 5F41A 2EXUA 5KFBA 1HARA 2RS8A 4MKAA 2G2ZA 3KLEA 1WI8A 5IS2A 2BUNA 1JNZB 1QJHA 1RYSA 2R7SA 4WIQA 3S01A 1SV5B 1TP7A 4QZVB 4CT8A 2E7VA 3Q24A 1NH7A 2CWXA 2Q79A 1PO6A 5ETVA 2MZRA 4Q5VA 3OXGA 3SCLE 4O3SA 3M05A 2AJ2A 4IQMA 1RT4B 4IDKB 1OJ4A 4OI0A 2WBRA 5A0YB 5HROB 5D3GA 3HHLB 3MEEB 4PWUA 3MECA 2LMIA 2V63A 3QIPA 2FHJA 4OYXA 5F8LA 1RK8A 1FNOA 1S1XA 3AJ2A 1FTCA 1RTHB 1JLQB 4W98A 2EFVA 3G8SA 3HT0A 1PAUB 3KHLA 2LDIA 3D28A 3EGVA 1HQEB 1NM2A 5HQ8A 4F7VA 1S12A 1X4AA 1FXDA 5IOLA 4I56A 4PQUB 4NLVA 1T02A 1C4AA 3R8YA 4KC5A 2IM3A 3BZQA 2OTLS 3LP1A 2LP4A 3D9BA 3CUNA 4K0KJ 3MXHP 5BR8F 1REVB 2QSFA 5THWA 5J2QA 4FF4A 1LEOA 3LF0A 1OY8A 4QIWD 2GNKA 2HK2A 2MMYA 1DJ0A 1GEHA 3X3UA 5MLCV 3UWTA 2ZD1A 4C2MA 1WC1A 3DXSX 3NS6A 2W24A 3AT1B 1TL5A 1X9SA 2KVIA 4YMEA 2LEPA 2YNIA 1F6TA 3WAVA 3ONQA 3SYZA 2EC2A 3W2VA 1SHQA 3G6XA 1S0MA 4Q43A 2UUTA 3JSMB 2YQ3A 1TKTA 1SKRA 2Q3PA 2HFZA 1FRHA 4CT9A 2HURA 3R2CJ 1W2BR 1CS4B 1FD8A 4XDCA 3ETOA 1JLFB 4PKDB 3PW0A 3TEGA 3IG1A 3VAGA 2ZWPA 5AXMA 4JI3J 2WVDA 1Q0NA 1OY9A 1KNZA 2PDAA 4LF6F 1XNRF 1WORA 1ZPVA 2DYAA 1NJZA 3R7BB 4PPDA 5EDWA 3LP2A 3DFEA 2RILA 4DLGA 1PYSB 4LF4F 2HIQA 2XB2D 3NKQA 3T1YJ 1AXQA 4O3PA 1URRA 4CNZA 1HR0J 3HFZB 2HQGA 2DR7A 3RGIA 1KRPA 1IBLF 4F4ZA 5B0FA 2L9WA 2Z8QA 3W60A 3OTOF 4GVLA 2QFIA 5L0KA 1FD2A 1DQAA 4OHXA 4PXCA 1AT1B 3BYPA 2CPIA 4DR1F 3B8HA 1URBA 3H4BA 3QIDA 4CLPA 2VG6B 1S0NA 3RZAA 5L38A 2R9LA 4EI2A 2QFJA 4B9NA 2CQIA 1HWUA 3HVTB 3CULA 1UTAA 1FKOB 3Q3QA 3HJVA 5IWAF 4QOTA 8AT1B 3HULA 3A13A 3BQ2A 2R3VA 4B56A 3DGVA 4FBUA 1WEYA 3IMQJ 3CE8A 1IKWB 5HO4A 1N32J 2OEKA 3SCKE 2R7XA 1BGXT 2LFVA 5HSPA 2I8EA 2ZC3A 5IC6B 2DNYA 2OJ3A 3D2WA 3PEJA 4MIBA 4B3SF 3KHHA 1J27A 2G13A 5AXLA 4A8FA 2XI2A 2BANA 1Z2LA 4OV6A 1RAFB 1TUWA 4GVBA 1NAQA 5KTQA 5KFGA 2MSTA 3N5BA 2OMLA 3ETMA 2QYGA 4CM2A 3C8YA 1IBMF 1U09A 3KLGB 1BLUA 1HLWA 4MK8A 1MSWD 1F3VA 1MMDA 2LQ5A 2OMOA 3NAHA 1FRXA 4Y2MA 4IH6A 2QLXA 1U45A 4LFAF 4KKOA 1R0AA 1AJAA 1PC5A 2VIHA 3ZNJ1 4AD6A 3W1YC 4LUBA 3NCPA 1RTIB 3ED4A 3GILA 3PV8A 5JJBA 1X4GA 2V4QA 4JI0J 1VLYA 2FVQA 4IFVB 4JV5F 1R8HA 4QR0A 4H4MA 4ANDA 5E2QA 3POTA 2Z57B 4PUOB 1JB0C 4LF9J 1C0TB 2ZOMA 1VIXA 1SQGA 2PFFB 1XR6A 2IMWP 1N5YA 1FDBA 1N2LA 2XO6A 4DR2J 2DRAA 2OLWA 1UEKA 4ZN3A 3BBBA 3LALA 4HI2A 1T05A 1GAOA 4EEYA 1EAYC 3NRBA 4X4RA 1U8SA 4NA1A 1VQNS 2KYXA 1NO8A 1RHUB 5T14A 2A6OA 2WBMA 3JYTB 1RTJA 3SIPB 2J7WA 2PC6A 3L4BC 1UETA 1WG1A 2GMJA 4WCEQ 1LWFB 2RQMA 2DH9A 3EUNA 3M1VB 2J9CA 5G0RA 4IFYB 3VHQA 3GB0A 3LXQA 5B0GA 2BM1A 4YB5A 4DR6F 2HHSA 4AL5A 3K5LA 1NHKL 1W2IA 1GX6A 3AA9A 3ILLA 4OZJA 3TVYA 2E66A 2I1RA 1NB7A 2PI5A 3CCRS 2H9ZA 1FNXH 2AWZA 1NUEA 1DTQA 1KHWA 4CYUB 2KU7A 2NPFA 1RXOB 4J9SA 2HMIB 3PR4A 3RAXA 4H4KC 3GJTB 3LGMA 4USIA 2R8GA 2OEJA 4DV5F 4N8NA 4NYPA 3M8QA 3WC2A 3BDPA 2RHSB 4ITSA 4AXJA 2H51B 1Q82T 2ZJPQ 1VRQC 2XSJA 2R7OA 4K4YA 3D4JA 4P2XA 3OPKA 1FXLA 1YVFA 4ZP8A 4USMA 4N7TA 2GAHC 4OZ2A 2PIIA 1VRUB 1NKBA 1AJCA 2RU9A 2KG1A 1S1VA 4MAKA 4A8SA 4USHA 1O8BA 3M8ZA 2ZBCA 3THPA 3V81B 4NMLA 4JI4J 1KN6A 4XAKA 2XC9A 4RU2A 2HAFA 3ET6B 4X65J 3SI8A 1Y5LB 3FGVA 2X1FA 3KDOA 5EGYA 2ACMA 4WFYA 1KQSR 4NE9C 3WBHA 3P49B 4B9UA 3H5YA 1IM6A 1QTNB 3FEZA 4Z37A 2JZ5A 4YR3A 1NJWA 4YR2A 3F0NA 3KG4A 4ZIVA 4DV7F 1HWKA 1S97A 1S6QB 5F9NA 5I3UA 1Z2ZA 5A2QY 3W2WB 4X4TA 2IJNA 2MDAA 2ZBQA 4PR6A 1SI9A 4LSLB 2EKYA 3D1HA 3NNCA 1QUVA 4FYVB 3KK1A 1YLXA 2W8SA 1JK9B 2CJXB 1RT3B 1L3TA 3CT9A 4FZVA 4DV1F 3WQPA 1N33J 3TAMB 2FY1A 3FNNA 2VUGA 1XJWB 2POKA 2V9KA 2VG5A 4KGZB 2HYIB 2K1RB 3G86A 4KJIA 3MD3A 1NK9A 1TKXA 4RO0A 5D4PA 3NY0A 2W5VA 4P2FA 4PABA 1UJ4A 3BEGB 5L9NA 2AYMA 1PCAA 2HZAA 2D3OR 4ZGAA 3WZ0A 4DV4F 5HANA 4UQTA 4M5DB 3TQEA 2ZVSA 8ATCB 3D3BJ 1QAYA 5C42B 1KHKA 1WOPA 2PE8A 2IVMA 4ED2A 2VODA 2BJ3A 3BGFA 3C16A 1RT2B 3JTOA 2WB4A 2AF6A 2J0WA 1VQ6S 1XNQF 3EVMA 2CJYB 1PG5B 1R8BA 1K0TA 4EO6A 3V2UC 2R7WA 3M8PA 3PRBA 3DLEA 4NZ6A 1WACA 1FXRA 4UPKA 2ERRA 4OJ1A 2ZUAA 4G65A 3G9CA 1NDKA 3Q89A 2B6AB 2FC8A 1F5CA 5L46A 1ZM9A 1E6VA 2HGMA 4FBTA 4BDPA 4AFFA 1G2EA 5C24A 4F67A 2MQOA 3CGIA 2DD8S 4IH5A 4CO5A 2HWHA 3T41A 2HFOA 2UXDJ 3BGUA 2QTWA 3PCOB 3G6YA 1U1KA 5DLFA 4ZVQB 1TV6B 2KRBA 2CJQA 4KSEB 2JH3A 1FT8A 3KHRA 1HNVB 2IRYA 1ZYQA 1V9OA 1Y5NB 1KTVA 4IG3A 3MK0A 2F4VF 4Q0BA 2NLWA 4NCAA 5F8GA 3CMQA 3QGHA 4KYZA 1U2FA 3HPOA 1VRTA 4MTPA 3KKFA 3ITHA 4JOUA 3EVWA 4NXMF 3QO9A 5A2QU 2MQ8A 1KHLA 1HNWJ 1CVJA 5CYJA 3OFHA 1F5BA 3E3XA 2WSCC 1XTZA 3AB4B 4Q2LA 2GSNA 3BH7B 4WBFA 1U2RA 3Q0AA 1NSPA 4LBIA 5A6PA 2HBYB 1WF0A 1SH2A 1FRLA 5E3QA 4NLGA 3L7UA 3E8OA 3M30B 3DLHA 2VASA 1E6YA 2EWHA 4NWBA 3E2EA 4S0MA 4HHUA 2RHQB 4ZLNA 2J0XA 3C2PA 1D3WA 3BDGB 1CJTA 3T5JA 4DBQA 3SZZA 1SKSA 2KG0A 3M2VA 4P2SA 4O4GA 1HL6A 2HZCA 3CC7S 4Q8EA 4UOFA 3M9MB 4JUZA 2ZFHA 1AFIA 3SZ2A 3TUZC 3NCRA 2OFHX 4EK2A 3CJTA 3AY0A 3QGPA 2ATCB 5DZ7A 3SQGA 4ZP7A 4PZVA 4ZVEA 3CCMS 2YNHB 5HVHA 3C3LA 1SKUB 3WHIA 3PJXA 4QIFA 1N36F 2WONB 4CO3A 1A9NB 4RBVA 3U02A 2KXFA 3S8SA 5DM7Q 3LPYA 1WC4A 3F73A 2MKHA 1WC0A 2FUG9 5KG1A 2B51A 2N3OA 1FDNA 4ZP6A 4I7FA 2AT1B 4K59A 5HP1B 2MJNA 3MM8B 3QAUA 2RRNA 3H2VE 2IA6A 1H98A 2VC0A 2M2BA 2UUCJ 4GO5X 5H9FJ 2O01C 3H5SA 3EJMA 1JLCA 1TQLA 1ZAXA 3I4HX 4LSNA 2SXLA 4P75A 3H8YA 3R5GA 4DCJB 3EZ5A 2ZVIA 2OPRB 4C98A 3TWZA 1QAXA 3CCZA 1PSDA 2NXJA 3SZYA 1S1TB 4FXWA 3HHLD 4IQXA 1RT7B 3TRGA 4GC7A 3T19A 8RUCA 4UF4A 2YKPA 1OSCA 3QWPA 2FY8A 3HD1A 5DGBA 4M5HA 4M5NA 2M3DA 3P96A 2ZE2B 2FJDB 1JLAB 1WOSA 2YKOA 3I5AA 2GSOA 4FYWB 3QZ7A 2CQ4A 1KH4A 3IBWA 4KB7A 4I2PB 2H4WB 3OLBA 4LBPA 3N0VA 3QLHA 1AUDA 1ZM2A 3QJJA 5B0EA 1APSA 1SC3B 3PJWA 5GVQA 3D6HB 2XYHB 3WIVA 4FN5A 3G82A 1QAIA 4F0MA 2GVZB 1UAWA 2QRRA 2AIRB 3FK4A 2DK2A 2HNYA 3I4PA 2HRYA 3QT8A 1NSKL 3UPFA 2UXCF 1YSJA 4PXDA 4G1QB 5BYQA 4TQRA 1S9FA 1MG7A 2L9NA 5DDOC 5B0DA 2HZVA 3R2DJ 4QPTA 1NLKL 1JJ4A 1IR0A 1S59A 2LA4A 4OX9J 2K06A 3NBPB 1BE4A 3I0SB 4KQZA 2CQ0A 1RT5A 1HBMB 1X4EA 4CLUA 2ATLA 1ZA1B 2R2TA 1Y7AA 4U67Q 3US5A 5C25A 3BDHA 2QGFB 1FCAA 3MUMP 4DPUA 1WSRA 4EGLA 4P6QA 1PJ5A 1FDDA 4M95A 2B4OA 3R7SB 4XK8C 2EEYA 4YHHJ 2ZNYA 4C0OC 1TK0A 5CD4H 1DURA 4L73A 3Q8QB 1M5OC 4ED7A 2WVFA 3PW5A 2BJEA 2C3OA 2HLUA 5IT4A 4CLLA 3LOUA 4G1PA 3MOZA 3NS7B 4CDIA 1S79A 3IRXA 3F41A 4WJBA 1CJUB 1RADB 3MMBB 4USWA 2DNKA 4ICLA 3OT9A 2R8IA 1H0HB 2I38A 3MCSA 1ALIA 1GXLA 5IC4B 5LMNJ 1T3NA 3JXOA 5IJQA 2E9ZA 2E5LF 2MGZB 1U49A 2B7BB 2CQ2A 4DF8A 2IVYA 3H20A 3KJVA 3ZXWA 1T0TV 3RB4A 1FRKA 4YS2A 3CCLS 2B0GA 4ZJLA 2KRRA 3JTPA 1HYSA 4JYAJ 4YP3A 4OYWA 3TZZA 4FNHA 4CYRA 1I1GA 3AHPA 2C2MB 2XY5A 2W2OP 4FDFA 2L41A 3MEGB 2I2YA 2XI3A 1SC1B 3EDQB 5B0AA 4RBTA 2WOMB 3HJFA 4KGKA 1LWEA 2Y1RI 4ECVA 2CAJA 3HHNB 4QU6A 2CQHA 1HW9A 1S76D 3ADAC 1EKSA 4RNHA 2JC1A 3OD2A 1VQYA 3GLJA 3M8YA 2FJWA 2YKMB 3NXZA 3VQTA 1Y00A 4YY3F 3LPEA 2QL9B 2VFSA 1FJEB 3QT5A 2D1GA 4OI4A 1CBKA 3OUYB 4XO0A 1DFDA 3IGZB 2ROEA 3DYAA 3DMJB 5J2MB 4HH1A 3W5ZA 1S1WB 2I5JB 5CA5A 2ILZA 4F3MA 4QPXA 3LTOA 4W4MA 4CQ1A 2BJ9A 1GTEA 1MMNA 3GYGA 1VC6A 2ZH3A 4R5PB 3G4SS 3QMQA 2ZJQQ 4DL2A 4DXLA 5LXYA 4LREA 1P49A 5CYQA 1YI2S 2W5XA 3O44A 1NU4A 4DL6A 4N47A 4QR1A 3JSRA 3MAAB 1YJ7A 3J7ZT 1GMUA 5CYMA 1MROA 1U26A 2DR9A 1UCNA 5T41A 2VG7A 4AT1B 3MEKA 1UVLA 2B4VA 2FC9A 5HJYA 3PJ9A 2J9DE 2IM1A 1UVMA 4RLEA 4R0EA 3IC1A 1N52B 5AJ9A 2AJ4A 2A2DA 1BWVA 5D0GA 1SUQB 4HR2A 3VF0B 2ALZA 1Y11A 1HDHA 3ZTSA 2KZMA 4XPEA 1NK8A 1RHRB 4KV8B 5BR8J 5KFJA 3DRRA 3R6LB 4Y2KA 1EI6A 4C8LA 1P1LA 2MHEA 2YNGB 1NMEB 1YRUA 3DOKB 3B5QA 3KJNB 2PT0A 1TAUA 2NR0A 2VKZG 1RAGB 1OQ3A 3JAMY 2B56A 4KM4A 4ZOSA 1U6ZA 3ZZUA 1O6XA 1LQ9A 2QZUA 1SJ4P 2YNFA 3ULHA 4KE5A 1QD1A 1KHNA 3CDUA 3MGJA 4KAIA 1S72S 1LFWA 2LLZA 1NDPA 2QIFA 2JC0A 2KO1A 4RW6B 2ZITA 1GQEA 1Q53A 3OQ2A 3PX0A 4JI3F 4OLPA 2KKHA 1K44A 5D4LA 4OJGA 2EK1A 1NCLA 3B6BA 3D0GE 3ZTPA 4CO0A 3O1LA 1R6VA 1FTRA 2O3DA 3W5XA 1NK6A 5LT5A 2W9CA 4PPZA 1SPBP 2HBZB 1IKXB 3CJRA 4LIWA 3SXLA 4C97A 1RWOB 1JLGB 4NRTA 3VGTA 4KO0B 2XS5A 2K3IA 3IBCB 4CTAB 2DNOA 1HR0F 4LF6J 1XNRJ 3FRYA 2FQQB 1K7HA 3I0RB 1JWWA 3KK2A 1W26A 4ZJOA 1J2VA 4IKAA 1SKWA 4LF4J 4L74A 4MT1A 3BF4A 3FFIA 1UVJA 2X1GA 3AOCA 5DG8A 2C2OB 4GMKA 2C22A 3ENQA 3PO5A 4HVZA 3I9V9 3T9ZA 3FSYA 1J5EJ 1IKYA 2W8DA 2C2NA 3LQVA 5HMXA 1FE0A 4DFPA 2RU3A 4KJGA 4LF8F 1SCJB 5L0EA 3OTOJ 2D7SA 4HT7A 4RW9A 3MM6B 4C11A 2DCLA 3V6DA 3BB5A 4DR1J 3CCES 2QSWA 5E33A 3DM2A 1RA6A 5J1EB 4HLBA 1G7CB 3MEDB 4J5OA 3M2UA 3KUEA 1TFYA 1QDUB 2E5JA 3PX6A 4FKYA 4C3MA 4TU9A 1N5TA 2HBRB 3CCVS 5G4DA 3R5JB 2LXIA 3GPAA 3TJ9A 2L9DA 4X62J 5FDLB 2ZJRQ 2IRUA 2WK4A 4ECXA 4J9PA 3CNQP 3MUVP 1OMSA 2ZH5A 4K7QA 1NXIA 1NK0A 4IOAQ 1L3UA 1GTHA 2DNMA 3HLUA 4ZVRB 3CMRA 4HDHA 1BQMA 4B3SJ 2DNQA 4L6V3 3MHYA 3TX8A 3EPGA 4CZCA 1TL3A 3DRPB 3CJ8A 1EP4A 4CP5A 3D0IE 4W92B 3IA0A 3DGPB 5EGHA 2V2ZA 3EZOA 2FGCA 4DSJA 3AD7C 3I55S 4DFMA 1C1CA 3MM7A 1HMVA 1H7XA 2V67A 4K2XA 3DDKA 1RI7A 1H2UX 5DZ6A 2W9AA 3AXMA 1B99A 2HHPA 1DTTB 3CD5A 3G96A 3NMAA 4LFAJ 1CJVA 5CH7B 4BWMA 2FHJD 1RE1B 2RB7A 4KT0C 2QLBB 1KVJA 3UCUP 4NLSA 3IXQA 4C0HA 5IQ6A 4PWDB 3MDFA 3CCTA 4JV5J 2YKNB 1AB8A 4R25A 2QA4S 2OPSA 1TK8A 2UV8G 4ZS6A 3SBMA 1KDNA 4ZPTR 3WAXA 5E5NA 5ETMA 3W61A 2R7TA 1BD6A 4DN0A 4WK3A 3M4XA 4V19X 3VWSA 4CXUA 3DRSA 3VV2B 3W8PA 3NGDA 4NI2B 2G4BA 3DC2A 3B4DA 3T5LA 4D3GA 1VI7A 2XZDB 1QSLA 2GGPB 1UVKA 4ERDA 2PMZD 1YRXA 4KAYA 1HQUB 3CDEA 1GMVA 4NYZA 5IXUA 2RUSA 4IUFA 4AE5A 2X3GA 4KGVB 4EMDA 4DX5A 2H5IB 2E1MC 4IO9Q 3M8WA 4AL7A 4KBIA 4LVOP 2KHCA 2Y9HA 5ETQA 2OELA 3V5RA 4OYOA 2JEIA 1NBEB 3C6UA 3QNWB 4DR6J 1IKVA 4EFAC 1VQ8S 3OFEA 4M1KA 2XQCA 3VVUA 1KSPA 1QVGR 2YBVA 4P7VA 2QN6B 5I42A 1LK5A 2JLEA 3O2IA 1NEEA 3QJLA 4TXSA 1R8PA 1VGYA 5KFAA 4OI2A 3DI6A 1VFJA 2VDIA 2AGPA 2DGWA 1SJ3P 4WE1B 3HK2A 4O44B 2P8IA 1J5OB 1HKAA 1JLEA 2EFGA 3AOAA 1DY3A 4B3OA 4NCBA 1TL7B 3B78A 3BSNA 4P52A 5I4MA 4RZRA 2D3ZA 2DIVA 3T01A 3TW0A 1ZS6A 2AJ0A 1LW2B 1JLBA 1IUJA 4U9RA 2AV5A 4DV2F 2Q1LA 4LFBJ 1NK4A 1UFWA 4E0DA 3UD3P 1T95A 5K8PA 2AGOA 5LQQA 2XMAA 1MLAA 3K59A 5KFMA 4EYHB 3UI3A 4X4SA 3PW7A 3OSNA 5CZXA 2KT5A 4ECUA 1TL1A 1UJ5A 3MR7A 1ULRA 5C7PA 5IQQA 4UOOA 3T1HF 4ED0A 4DX6A 4ZPDA 1RWPB 2FD2A 7AT1B 2GVDB 1L5UA 1SXLA 1SC4B 3LAMA 3H5UA 5GMDA 2ZM6F 2BOPA 3W65A 2MKCA 1SV5A 3TZYA 2D3O1 2K8GA 2CKWA 2PMHA 1RAIB 3M9OB 1EIYB 2FLOA 4DV7J 2R8KA 1GK8A 3TG0A 1JJHA 2CNLB 4EUVA 3OHAA 1ELZA 1HNIB 1GMWD 1RT4A 2Y8WA 2P9EA 3IP0A 1VQKS 5A0YA 1EZZB 5HROA 3NL0A 2LYVA 4E8UA 1W25A 3HHLA 1WTFA 2DR8A 3MEEA 1ZEDA 1YJVA 1KR4A 4OX7A 2DNRA 2DBBA 2YQ1A 2R8JA 1S10A 1CQNA 3NAIA 4H4OB 1RTHA 1JLQA 3HF5A 2HQFA 3BV8A 2O1PA 1N5SA 4ZVPB 3M6UA 1HQEA 1OQ6A 4PCQA 1SJFA 3CCWA 4EU0A 3RJMB 3LP0B 3NWRA 2OPQB 3ENAA 4PQUA 1NRKA 2OUGA 4TYAA 4DSLA 4DV4J 4NLDA 3SDEB 1REVA 4NOHA 2KFYA 1VJWA 3NGUA 1U48A 2CPFA 4I69A 3WDOA 1RWXB 3W9JA 2OPPB 4DSEA 4A47A 4LBHA 3CO0P 4ZLJA 3MPUB 3DOLB 2KFZA 1XNQJ 2F8MA 2U1AA 1N0VC 5GAHI 4CLKA 3PYGA 3UN2A 2BKOA 1VBYA 3P8BB 3B4MA 3GG0A 4JI2J 1URAA 1NPKA 4DQRA 2PO4A 1DHMA 2CYYA 2ANHA 3QT6A 5ETNA 1RBAA 3HDSA 2UXDF 2JHEA 2FVRA 2IA0A 1TVRB 3TARA 1N4LA 2XLJA 2JLFA 3QZ8A 1HBUB 3MAQA 1NDLA 3HM9A 4USJC 4DU7A 2HSEB 2M8DB 3MFHA 1CS4A 1KP6A 4FXVA 1IM4A 4DZ6A 4KPCA 1HHQA 1JLFA 4J37A 3R5DA 5KFDA 2N7CA 4UORA 4F8RA 1C0UB 4DCPB 1X7VA 2AEFA 1IWAA 5EN1A 4HYKA 3IAS9 3FDSA 1LXNA 3THTA 3H2LA 4F3QA 4F3OA 2O5DA 2YVSA 3IAM9 2KZZA 1ZBTA 4R8UB 2BV3A 2BXJA 1AA1B 4CLZA 1HBOB 4LSZB 1E33P 3MPWA 4EO8A 4HHHA 5F8NA 3BO4A 4IOBA 5IFMA 4O0IA 2AEJA 1LK7A 4H54A 5KG7A 4KIAA 1TKDA 1D09B 3J81U 4B9TA 5F8JA 5CQGA 4P73A 3BGOP 3SSQA 4CCHA 2XMKA 1VQ9S 1ZZFA 3FFIB 5MAOA 4UZBA 2GIFA 2R42A 1LOUA 1UZHA 2VG6A 2QLWA 2MQQA 3VGVA 3DDIA 4CLWA 4ILRA 2DPIA 3VQSA 2ADCA 3HVTA 2DHGA 1M1KT 3DHXA 3F44A 1V3RA 1FKOA 1XMQF 3PFOA 5KFRA 2BQUA 1NSAA 3V4MA 5GAHU 4M5LA 5LMUF 2HVZA 2UVUA 5HL7Q 2A6MA 5IV4A 3N6LA 4KTQA 3BDFA 2ZBPA 1IKWA 4DWIA 1KH9A 2H54B 1NJIT 1RWWB 3BSCA 2XULA 3C6TB 1T03B 1UMJA 1UVNA 2W5QA 3HSDA 4RUCA 2JSXA 2XHWA 3D0HE 4A8XA 5F8IA 2WVEA 2UUWA 3BQ1A 3W63A 1N36J 4RNNA 4ZIWA 1PJ7A 3RRGA 4CIOA 2J8AA 4TN0A 4FS2A 2UUCF 2WW4A 1NKEA 1MNEA 1XERA 2VPXB 1V5VA 4M5GA 4NLTA 5D0HA 3KLGA 2RQKA 2IDEA 2XMJA 3NKRA 3PHEA 4Y0FA 1RTDB 5GAEI 1S9EB 1QVFR 4X64J 1CPZA 3QGIA 1X4DA 2IC3B 1VDHA 4XPCA 3JB9k 2MPUA 2AU0A 3HZGA 2W8LA 2ZDOA 2MKSA 5DETA 3KMQA 2V68A 4YFUA 3R1HA 4P2MA 3RBEA 1RTIA 2RIJA 1LXJA 2CZVC 3ZZTA 3CCUS 1IR1A 4A8MP 1RAHB 4JI8F 4IFVA 2AEMA 4DR5F 2R2UA 2N4CA 1FVSA 4PUOA 1DLOB 3P3DA 4JI1F 4CLSA 1C0TA 2NXCA 4PQAA 2XS7A 4K2JA 3ZFVA 5DJBA 1KLMB 2CA9A 3ELHA 3LGNA 3W8GA 1XMBA 3H4DA 3FKBA 2AHOB 1RCXB 4GTZA 3VAKA 2AZ1A 5ETOA 2LDYA 2P5VA 3FRZA 2MZQA 2CXEA 4FPIA 2APOA 4UOHA 3U7JA 2A3JA 2ADBA 1X9WA 5J1NA 3JYTA 3FZ2A 2E1RA 3B54A 3IO1A 5K8NA 4DPOA 1FHTA 1SC6A 1LWFA 3M8SA 1LW0B 2DJWA 2BRLA 3M1VA 4HHJA 2XR9A 4KH1B 2IAJB 2UXCJ 1GNKA 3I6PA 4OYPA 5L0BA 4LR9A 4ATNA 3JQKA 2K2PA 4RWWA 2VFVA 3CVKA 4OYMA 2C1EB 2RRAA 2VU5A 4CYSA 2C2ZB 3JSBA 1BXNA 4LF1A 4CYUA 5KFSA 2BZ2A 3MK1A 3KOAA 2EG2A 4A46A 4NMXA 2RT3A 2BQRA 5GAEU 2HMIA 2RDDA 3UE2A 3UDCA 3QRPA 4M8LA 3G87A 3IWLA 2H3EB 2MB0B 4Y34A 3GTYX 4RW4B 2I9SA 1SJRA 4IG0B 2Z30B 1FDAA 1TELA 2QA4G 1RT1B 2W2PP 4ZVSB 1UWBB 4CH0S 1VRUA 2PSZA 3RR7A 3HI9A 1AW0A 2HVEA 5A8WB 4LR8A 4DG1B 2K3KA 4I64A 3DLBA 1XK8A 4ES2A 5DRKA 5KFQA 1SL2A 4DX7A 3V81A 3DRXA 3W9HA 5E0OA 5K4PA 3EZUA 5D0RA 4W90B 3PDNA 3ET6A 4NZ7A 1D8YA 4M63A 2GAGC 4JYAF 2E7WA 3DLJA 3T02A 1WC6A 4NXNJ 2E5LJ 2RMLA 3K5PA 2OAUA 2PI4A 3F56A 1CQMA 4BWJA 1QAJA 5LXRA 3D1OA 3KTQA 4B3MJ 2QMXA 2YKAA 2KM8C 4FP9A 2U2FA 3BM7A 4C9DA 3HSZA 1FK9B 3NP5A 2P2CB 1Q5YA 1RAEB 3U27A 1U1OA 4ECQA 2JJ4D 5GMKa 1AUKA 5FLXU 2FPHX 4I0WA 4K4SA 3QATA 5LL6d 1VHFA 1B8JA 1T3OA 1S6QA 2BDPA 3W2WA 3N6NA 1UEVA 2MQNA 5KXAA 4DQPA 2DGUA 4J9RA 3FC9A 2HGNA 2LQJA 3UO0A 4LSLA 1M0SA 1RT6B 2G2OA 1N2KA 1Q8KA 6FD1A 4ELUA 4JI6J 4DL4A 5HATA 2CQPA 1I3OB 2E1CA 4WU3A 2AZ3A 3HO1A 1RT3A 5D78A 4A4JA 1AJBA 3TAMA 2W9BB 4YY3J 3V6JA 3AAWB 5KFXA 2K1RA 2DXDA 3PYEA 1VQPS 1S4EA 1GXUA 5KT3A 2UVVA 1ZTTA 1PAEX 1FFWB 5EGEA 2VOOA 1FRMA 3CO9A 1HFEL 5HRTA 3HHLC 4IR9A 1K1SA 2X1AA 4YDXA 2CIMA 4AQYF 1GXTA 1P9YA 2JVOA 4M5DA 1S49A 3UR0A 4B3TF 4J9QA 4I68A 1DRZA 6FDRA 5C42A 1F9FA 4MYTA 2RF2B 2KVQE 3KJFB 1FEHA 2V8GA 1FRJA 3PRDA 1RT2A 1B7FA 2GJ2A 3CC2S 3K5OA 2N3LA 1S5ZA 3I5CA 3MF5A 2YX1A 2UU9F 3T6JA 4DUYF 2VV5A 4L3KA 2ZH1A 4JI5F 3BGRB 4P72A 4NEYA 4OI3A 3T5KA 1RJJA 3MUTP 1DQ8A 2OIHA 2B6AA 3K0JA 3FSIA 1HNXJ 3VAFA 3HKWA 3PKMA 4A8QA 2WZ1A 2OKQA 3R97A 2VOPA 2W25A 2OO4A 3K2YA 1VYAA 2XYPB 3GIIA 1FNMA 2LU1A 1IBKF 1S48A 5EWGA 2CPEA 3GE9A 2DY9A 1TV6A 4OYBA 3CJ2A 4F4WA 4DL5A 4Y28C 5K20B 3CD6S 1HNVA 1FI4A 5E3AA 1P6TA 2CJKA 4DN9A 2IM0A 2MQLA 3FBFA 3MM5B 3BGLA 4KPYA 3HFVA 4ZPWR 3DHWC 4DF4A 4GO7X 4OX8A 4QCLA 5BYSA 2IRXA 1ELYA 4DEZA 5JUMA 2HQDA 4K50A 4RNFA 2AJ1A 3TVZA 2F65A 5D8HB 1YZ6A 4CLFA 3EXYA 2GJIA 4O3QA 1KH5A 2O67A 1ANIA 3BR9A 2W2NP 4IO1A 3HMJG 1VJQA 1L3KA 3G6VA 4Z7CA 1U02A 1EQJA 4IOCQ 2XRGA 2A10A 4ED8A 1KHVA 1VMBA 2RKIB 2ZH2A 4MJKA 3W66A 4MIAA 1EW8A 3W62A 3MURP 4NYOA 4URQU 3C46A 4IRDA 2VF3A 5L1IA 4HACB 1H73A 1PYOB 4C4WA 3M30A 1YJRA 3RRHA 1J5EF 1SHNA 2CQ3A 4RPFA 4ED3A 2BBEA 1M5VC 3EM1A 2DGTA 1AZSB 5E3CA 2VD3A 3RU0A 3BDGA 4RW8B 2HFSA 1FWKA 4LQ3A 1M1GA 1D9FA 1WEXA 1SH3A 3OL6A 2J9EA 2KHDA 2EFOA 3QWUA 4A48A 4LF8J 1N54B 4N56A 4GTWA 3GR0A 4DR4F 2VC1A 5B09A 1ZAVA 5AXNA 4QYZK 1ED9A 3DXBA 1IBCB 4C8OA 2YNHA 4K4WA 4XTTA 2E5HA 2P9GA 4K4TA 2CG4A 1TMJA 2BW2A 2FJBB 2WONA 4X62F 2VDHA 2BRKA 2DHHA 2B9YA 3MMCB 4ELTA 5HN0A 4ZG6A 4EZ6A 1ROFA 3L7OA 1YBUA 5K14B 2QLJB 2PD1A 4K4ZA 2MQMA 3NKOA 1GMWA 5HP1A 3MM8A 2QA2A 2ABYA 3MCOA 1V3SA 4LJMA 4I6AA 2J6UA 3TQ1A 3RW6A 3J80Y 4CH7A 2D41A 1EHWA 3AODA 2HVHA 4NA2A 4DCOB 2OPRA 4QQBA 3RB6A 4LVNP 2CJBA 3AB2B 5F3TA 3PIPQ 1S1TA 1JQGA 1RT7A 2HHWA 3G8QA 3OXFA 4Q8FA 2ZE2A 1JLAA 2B43A 2MY8A 5AE3A 1ZM3A 5DGAA 1FKAF 2G9YA 2VJUA 3FMBA 2YY3A 3Q83A 3G2XA 4I2PA 3IR5B 3NKPA 1R8CA 3CMES 5J2NB 1KTQA 5D15A 2HGLA 2FJXA 1H2VZ 1U4BA 4PG6A 3D5MA 4MH8A 1ICEB 3CW2C 2ZHBA 3PKYA 2GVZA 1F0XA 4PG5A 1ZETA 2UXBF 1VR6A 4K5RA 2CNNB 1Y7PA 4G1QA 1T9TA 4ZCKA 2V34A 4ZA1A 1N5QA 1IXKA 2YH1A 2A0FB 4OZ1A 4Q7AA 4CRJA 2RSQA 1RWNB 2YWKA 4MFBB 2FVPA 4F0HA 3MPYA 3NBPA 3TJAA 2LQ9A 1ZEBA 1EARA 1FX4A 5LOQA 4J9OA 3I0SA 2FTRA 1WDTA 5DDPC 3AJ1A 2XMUA 3IGYB 1HBMA 4OJHA 1SB6A 3I82A 2IJRA 3SCIE 2GZOA 1Q86T 1N34F 7FD1A 4MKYA 5KFPA 3UDVA 4WXOA 1H3DA 3KK3B 5KG3A 2XBPA 2OTJS 3P6YC 2YTCA 2GQCA 4N77A 1KOHA 1MN9A 1WDDA 1R43A 5DLWA 1G1XA 4C8YA 5KG5A 4ED6A 1CJKB 4XIUA 1JXEA 3LGHA 3UQSA 2JOQA 1C1BB 1Q8LA 5D4NA 3SV4A 2ZH7A 4TQSA 2XNQA 3J80U 1ZOTA 1RA7A 1CJUA 3MMBA 2BACA 3MOJB 4FDJA 1DARA 4DQIA 1TUGB 1B64A 1MWQA 2LQBA 5AE2A 1YDLA 4I2QB 2X98A 2BA9A 1P1TA 2B9WA 2RNEA 2MGZA 3AD8C 4NLUA 2FLPA 2LU2A 1KC8T 3K57A 1KKHA 3H0PA 4LFBF 2CQBA 5IM0B 5A8KB 2ROGA 2W4PA 2B5JB 1BC6A 4NWXA 5GAGI 2NPIA 3EGNA 4DV2J 1ZM4A 3HHEA 2H4YB 3MEGA 5KFKA 4URGA 2GA7A 2HHHF 3VVTA 4FDIA 2GCFA 1S4FA 2WOMA 1YGYA 1LV5A 2H65B 2C3YA 3S6EA 2Y1IA 4F2SA 3U1NA 3MK2A 4CXSA 2RQ4A 2RDJA 3C15B 1SIWB 4R0JA 1JIHA 4OIXA 3T1HJ 2CPDA 2BYCA 2MKJA 1ALJA 1XMOF 3AA8A 4ANEA 2QV6A 2YKMA 5FD1A 1K47A 2ZM6J 3EDRB 2E1PA 1Y3KA 1WELA 4DV6F 3BS9A 1KFDA 1XQIA 2FGOA 3Q2SC 3OUYA 3DMJA 1ZAWA 4ED5A 4RNMA 5J2MA 2BJ7A 5DQGA 2DTJA 1G3OA 1S1WA 2I5JA 3D6TB 2BKPA 1YX2A 3DLKB 4CI0B 5D0EA 4ZCMA 3IN5A 3RBZA 1Y3JA 2F7VA 2XMVA 5H9EK 5CABA 3SCJE 1R6YA 4KGMA 1X4BA 2EBEA 2EFPA 2V2KA 4ZLPA 4WP8A 1A6LA 4R5PA 1BQNB 1UP1A 5B0CA 4QYRA 1X4CA 1CG2A 4OQJA 2R7UA 2UUAF 4NA3A 3PW2A 2JDJA 5HBMB 4LFCF 3MAAA 4DUTA 1X5OA 1D0EA 3HFKA 1C4CA 4USTA 1OPIA 1KOOA 1KLNA 4M94A 2KDOA 3S7RA 3IWNC 3K7RA 2HG4A 3N79A 2DVIA 4P7TA 2HLTA 2Q43A 3GZ7A 2JX2A 3UFCX 5F8MA 4WTYA 4TU8A 3R7NB 2WW8A 4GTXA 1SUQA 5HJXA 5GAGU 4U6PA 2B4PA 3J7Z5 4KV8A 2NUUG 3RRKA 9RUBA 2LXUA 4DPWA 2PEBA 3M2RB 2FJAB 2IY5B 3WIUA 5KFFA 1YHQS 5KFIA 3UNYA 2YNGA 4JI2F 4DQSA 4Y3CA 4FKXA 3DOKA 3VTIA 1U6BA 1HI1A 2VBXA 4FPRA 1C2PA 1H72C 3NG8A 2DRDA 2XCAA 5ETPA 1F1BB 2NXUA 4FS1A 2KYZA 2R2SA 4O3RA 4MIWA 2IYGA 4ZDNA 1HWIA 4USVA 3CJKB 2FDNA 2BOAA 4ANCA 2NQPA 4RW6A 4Y2IA 3UDLA 3TAPA 4RUAA 2ACYA 3CF5Q 3CIZA 2YX4A 1UFKA 1OWXA 2KXNB 1Q4RA 2MZSA 4UOPA 5DG7A 1HD1A 4MY4A 4O4RA 4AUKA 1XN9A 2BR0A 2IYIA 1K8AT 3NKNA 3G8TA 3MR2A 1IKXA 3OTEA 3CXCR 2HQIA 1JLGA 5AJ3J 3ILOA 5INHA 4KO0A 4ZG9A 1HPZB 4UUXA 4CTAA 2G1DA 3PY8A 4OZ5A 3I0RA 3L09A 4DSIA 2G1HA 4X4QA 3TYTA 1SQFA 5FJ4A 2NREA 4L76A 2OD4A 2DB1A 4TN2A 2RQCA 2VFRA 2BJ1A 1MU2B 2WHOA 2CFXA 5KG0A 1RDRA 2H48B 1X4FA 2D3UA 1T9VA 4N8OA 1UA0A 1UL3A 2PEHA 2OEMA 1UZDA 4QWCA 3PEHA 2GHPA 1H74A 3MM6A 4J9KA 4J90A 2PA8D 4WYLA 2WSFC 5J1EA 3GCWP 4DSKA 3D7SB 3MEDA 4DU8A 3H40A 3VAJA 2W4DA 4ES3A 2FB0A 2E9RX 1ITPA 2HKEA 1XMQJ 1RWVB 3DKDA 3R3TA 4YN3B 4WFZA 3QSIA 5LMUJ 3MCNA 5HQMA 1FJGF 4PEOA 1B0PA 1HIYA 4ECYA 2WAQD 4UZCA 2W5SA 3ZZ0A 3ZNUA 5FDLA 7FDRA 1SL0A 1NHVA 2HW3A 2NYHA 3BO2A 3QRRA 3IR7B 4Q45A 2QLFB 4F0KA 2HNZB 2D74B 1FVQA 2KM8B 2HAIA 3HHKA 4ZKAA 2R7QA 3DRPA 4KHRA 1DQ9A 1PKUA 1N6QB 2XYGB 4DPTA 4PYAA 2BE2B 4X64F 3DGPA 4UT4A 2QZ8A 5J1PA 1CLFA 1TR0A 2IPOB 3FJ2A 5HLFB 4L72B 2FZCB 5ETRA 4P10A 4C6AA 3Q8YA 2ZBIA 1U1RA 4DL3A 3OR2B 3LWMA 2JEJA 3MMJA 1O0PA 2AJQA 3A3NB 2MKIA 1NJXA 4ID5B 2VA3A 1FRIA 1DTTA 2VZ9A 1CC7A 2J7KA 2HWIA 2YWGA 3T5HA 1S9GB 4Y6IA 2DNGA 5DLGA 2ZH8A 1TUVA 2J6SA 5A8RB 1U0HB 4PG4A 2BQ3A 4DFJA 5IT0A 3D1QA 5JVGQ 3A3OB 4BLGA 5IZHA 4PWDA 3Q8RB 2DT9A 3KLVA 4JI8J 2YKNA 3ZTQA 5KT7A 4DR5J 1IJEB 2ZKTA 1VISA 1EB0A 3C66A 2BE7D 2EW9A 3GSIA 4JI1J 1HQAA 3W7BA 4GC6A 5DDQC 2XZWA 4RW7B 4B9VA 3R9LA 3CJ3A 2F9DA 4QWAA 4NI2A 1UA1A 1T11A 3MR5A 2GGPA 1P9QC 1VBZA 1HQUA 1T9XA 5RUBA 2NCKL 3HXMA 1EETB 4ETXA 4L3NA 2DNLA 3ILIA 1XWLA 2D9OA 2A18A 1B3TA 1RU1A 2IUCB 1FESA 3WX4A 4ZITA 4DS5A 2IBKA 2N7YA 4ECZA 1T7PA 4TY8B 1ZH5A 2QMUB 4UW2A 2D1CA 4C3LA 1O98A 2YX7A 3QFHA 2V8HA 5DDRC 1CC8A 3OL7A 2GO8A 3C14B 3RTVA 4I1TA 4ES1A 3K8VA 1FKPB 3U1LA 4JBCA 4WK1A 4DFKA 1S6UA 4DPXA 2PMWA 3TZXA 2AQ4A 3Q86A 4TVAB 3CMAS 4WE1A 1U25A 2M9KA 4O44A 3PG9A 1J5OA 1LWCB 3Q2TC 1QY7A 4ZHRB 2LKZA 3OTCA 4CLTA 3MM9B 2IM2A 4JV2A 3MAHA 4KHMA 3DLLQ 4MK9A 1TL7A 1BUXA 2VBZA 2RD5C 2HFNA 1LW2A 4HH0A 1H6KX 1OSDA 2W5TA 1N8RT 2K7KA 4WIIA 1T8EA 4ELVA 3L9ZA 2ZBRA 3KLIB 4NLOA 4NXNF 1D9DA 3MD1A 2J7UA 3CDWA 3M8RA 3PX4A 2Z0GA 1QE1B 3UCZP 3NOGA 4JP8A 5F8HA 2FZGB 5HMZA 2FHOB 1V6HA 2EFQA 1Q81T 3TJ8A 4B3MF 1H2TZ 3MMAB 3IRWP 2XSFA 5IV3A 4U8YA 3G6ES 2WVCA 5L1LA 2QEXS 1PBAA 2M70A 2GVDA 2GLQA 2V4RA 1R8AA 5HAOA 2DH7A 5KFZA 4CXKA 4LQ9A 2FIUA 4V1Ak 2XCPA 5J2PB 2C42A 4B9MA 5KFUA 3A1YG 2XM3A 3KUHA 2HQ3A 4HEA9 5LJ3Y 5F9LA 2VFUA 2XWYA 4P74A 4JI6F 3ICLA 1HNIA 3N6MA 4ER8A 4HDGA 4F4XA 2RRBA 4HT5A 1RYRA 3PR5B 2DEJA 2GMLA 4B3RF 4U95A 4OL8A 3KMSA 5KFHA 4RR5A 1KH7A 4H4OA 2CG8A 3D54A 2KT2A 2RJZA 5CXTA 3WX8A 1IR2A 3G71S 1CULB 1MN7A 5D6GA 4MKBA 3CPWR 4LR2A 4XDDA 3BKFA 3LP0A 2OPQA 1WHXA 5L39A 2Y3YA 5T7LB 4NRUA 2ZZTA 4HKQA 4U7CA 2HRTA 4AQYJ 3PVXA 1WHWA 3SDEA 4B3TJ 2HNDB 1KVIA 1VK3A 2OFGX 1DAXA 2LCWA 3DLGB 4UTGA 2OPPA 3I9ZA 3UVJB 2EFNA 2DNPA 3GSDA 3EPIA 3DOLA 2C28A 3RUBL 3M32B 3PXGa 5L1JA 3BH6B 1RTZA 3CTRA 2NZ4A 1RWMB 2E5GA 2CDRB 3CC4S 1R31A 3KHGA 2UU9J 4DUYJ 1HNXF 2HFVA 4YB7A 4JI5J 1RU2A 3RAMA 3V4IB 2MZJA 3ZTOA 1ALKA 4NWJA 4BC7A 4DV0F 3FSXA 4OYIA 4OZ0A 1GT8A 3A52A 3NEKA 4F4KA 1NNDA 3KLFB 3DU6A 3KLHB 2AX0A 2DRBA 2DNZA 1VOMA 2MXYA 3PO4A 1TVRA 4I4BA 4DR3J 1HBUA 3FQKA 3O5TB 1JMTA 1P27B 3K8WA 2Z58B 4QW9A 3H42A 3SV3A 2HQCA 3WC0A 2XG8A 1E3CP 2ZNZA 4OHVA 1I94J 3KUGA 1C0UA 1IBKJ 1NKCA 1JJCB 2C3PA 3M9NB 5HMYA 2Q6CA 2EI5A 3LA0A 4B9SA 2W7OA 4DI6A 1M5HA 2GIRA 4M5KA 4R8UA 5F0WA 2X3DA 5BXIA 2UUBJ 3IS9B 1HBOA 2WRMA 4F04B 1VQ4S 4CO1A 4BS2A 1PGZA 4DS4A 2H1YA 4IRKA 2VPWB 1LNQA 4ECSA 1NK7A 3Q8UA 4PXBA 2I6WA 3CDBA 4I6WA 1RAJA 2GIQA 4U7UD 1S0OA 2HHTA 5F3ZA 4ZVHA 1R27B 1S57A 2EC0A 3T9NA 2JFKA 1HI0P 1RHJB 1PILA 2N82B 4ZPCA 4C8ZA 3VAIA 4NCGB 4RX6A 2H5EA 2F8EX 4MHXA 4KFBB 3KJQB 3JQMA 1CEZA 2V4JB 3P5BP 2KTQA 3H7HB 3I56S 2CZ4A 4RL1A 1YBAA 3IDDA 2AP6A 1VQLS 1U0SA 2W2QP 3T3FA 1U6FA 1YK9A 5E3RA 2DR6A 3DOMB 4OLOA 1S6PB 3SFGA 5AXKA 1Q95G 5KFWA 4QWBA 3GU0A 1S99A 3C6TA 4JV0A 5E41A 1T03A 4M5IA 4DR4J 1JNRB 4JI7F 4O3OA 1Q79A 3DCAA 2Y1JA 3DYCA 3R6GB 3GV8B 2QL7B 3EGWB 3ZZPA 3OR1B 3T00A 3E01B 5LSOA 3ISND 4YQWA 1S1UB 2DPJA 1HBNB 2R7RA 1WEZA 4LRDA 3RAQA 3M7VA 2HEKA 4EWTA 2IFYA 3M6WA 1K9MT 4DUZF 2DITA 3JAMU 1MWZA 3N9UC 1RTDA 3PACA 5LM7E 1L3SA 2NXNA 1S9EA 4FVCA 1RGVA 4DOZA 2IC3A 1JKHB 1FFGB 1TKZB 1MW7A 1TZ0A 1ZTWA 3HVRA 1RBLA 1HWJA 1NPPA 2XY6A 4WPAA 3IWXA 4DL7A 2LEBA 1R3NA 1NH8A 2M52A 3TNVA 2VQEJ 4DDFA 5DG9A 2CQGA 4ZVOB 2V50A 3KLEB 4WKYA 1YKWA 1WI6A 1A0OB 2RVJA 3ZZZA 4OJ3A 1DLOA 3OXLA 3K5MA 1FSUA 5C66A 4TLRA 2F8HA 2G0JA 3VCDA 1KLMA 1FFSB 1A7GE 2ASJA 3PHTA 5E3PA 5L1KA 4WKRA 3W9IA 2ZHAA 5ITHA 1ZPWX 2GMHA 1WOOA 1B7YB 1RAAB 1VQ7S 3I32A 3VGSA 3FBCA 1U47A 5D3GB 4C7QA 3HSJA 1B0VA 4PRFA 3MECB 1IVZA 2OSQA 2UXBJ 4GKKF 1VQOS 3QIPB 2JEGA 1LW0A 5K8MA 1S1XB 1UEUA 4RWXA 2IAJA 1T94A 2F3JA 3ZO7A 3NNHA 3A8JA 3QJPA 2FVCA 2HBQB 5A6WA 2QMWA 1KHJA 2VB6A 2CZ9A 4ZCLA 1SL1A 1JXLA 3T1AA 4DR7F 1HI8A 4USKA 3EYZA 5HQLA 1LKZA 1UPMB 4LR7A 3LP1B 3UCGA 2FZKB 1BQXA 3H2UB 3BQ0A 1NSQA 5J2QB 2VQFF 2CNOB 1TMMA 1N34J 3SFUA 2ZD1B 5GRRA 3A4TA 5E7OB 3UN5A 3QSYB 2OD6A 2E5IA 4RW4A 5AE1A 3EICA 1PJ6A 2OHDA 3IBFB 5C5JA 2M8HA 4IG0A 2YNIB 3N4WA 1W7WA 5KOXA 4OHYA 4ZVFA 3W2VB 1RT1A 3QQCD 4U96A 1UWBA 2DHXA 2ASDA 1UKUA 1HNZJ 4UOCA 4JV1A 5A8WA 3OHBA 2IBOA 1TKTB 3LH2S 4DG1A 3VZIA 2HS3A 1KVKA 4PG7A 3CCSS 2R7VA 1PC4A 3TVKA 4V19J 3A8KA 3PRVA 3BO3A 3A3PB 1OO0B 1NJYA 4A8YA 4QU7A 1B70B 3OVAA 3IG1B 1M5PC 4GRSA 3VAMA 3NOCA 2M88A 4Y2CA 4Z2XA 1Y0HA 1NK5A 4PG8A 1U1LA 2QO3A 4ZP9A 3LP2B 5IJSA 5KG4A 4RUHA 5KFYA 3CJSA 3S1TA 2CJAA 1FK9A 4TY9A 5LSLA 4J7CA 2AJFE 1U1QA 4J9VA 1T9UA 2D69A 2HHHJ 4CWBA 3KNAA 5KFEA 3TP2A 4ENOA 1O99A 3TZWA 1MMLA 3DRYA 2W5RA 4K5SA 3IGNA 2K7JA 4LF7J 4HTJA 4DJBA 3Q23A 1P8GA 4YUDA 4ZCIA 3TUIC 1UWAA 2FVSA 4UY85 2VFTA 3O8WA 1U7LA 1XMOJ 3SSRA 3OVBA 2CWKA 1RT6A 5CD4A 1Y5IB 3I31A 4GKJF 1X8DA 4WZMA 4DL0C 3TX0A 1REGX 2I0XA 2W01A 3AOBA 4ID8A 4ILMA 2W9BA 4O0NA 3H90A 2Z56B 1VS3A 3KG1A 4ECWA 4DV6J 2LXFA 3KNGA 1YJNS 2AW0A 5HK4A 2HS4A 2MEWA 4PXEA 5ETLA 1RISA 4IH7A 2ZH4A 4DPYA 4TYBA 3RB3A 2J0SD 3OJSA 1X0PA 2XHCA 2MTLA 3X1LB 3HVAA 4BC9A 2BKNA 2YKQA 1EJ7L 4DHVA 3NKYA 2RF2A 1X31C 1YG0A 4C48A 2UUAJ 1RHKB 1RUSA 4LFCJ 1U2CA 3RYLA 1Q78A 3ZZRA 2BANB 4B08A 4U8VA 3BN4A 3J7AN 4GVBB 5L8RC 1XEZA 2MJUA 2J8SA 3BGRA 2IIHA 4ZLLA 4X4VA 3GYXB 4MYUA 2B8PA 3UD5A 2KJWA 4KH0B 4KRWA 3A8IA 2X7IA 3Q8VA 5L9XA 4WFBQ 4P9SA 2VHGA 2M5YA 1HA1A 1RSCA 5KT2A 2DO4A 3TAQA 4K4UA 3M6XA 5C2CA 4DV3F 4QWDA 3H59A 3P45B 4J91A 3RR8A 4A8OA 4KKOB 1R0AB 1WTBA 1YJ9S 2FLNA 2MLZA 5I3QA 3PIOQ 2HFUA 2GQQA 2R2RA 4IYQA 4KAVA 1UW4A 4ZMMA 4Y00A 4IRCA 1WKJA 2CPJA 1H7WA 4E98A 1D9AA 4X66F 3EGZA 3MM5A 1XR5A 1TK5A 4HTIA 4H4MB 2ZZNA 3JTNA 4OI6A 2DGVA 2VA2A 3POTB 3MZIA 1SH0A 1AJDA 3QPIA 1N5YB 5AJ3F 2HS0A 3CB4A 4LF5J 5DQIA 3QGGA 3OTBA 3CD7A 4QYZJ 1T05B 3FCVA 3VAHA 4YB1P 2W1BA 4WXWA 1V5IB 2V94A 4N76A 5GOVA 1XIQA 5U47A 1KQKA 3ILJA 1RTJB 2ILYA 5KG2A 5KG6A 2RKIA 3VGUA 3RW7A 2VQRA 3JSYA 3VALA
chains in the Genus database with same CATH topology
4CXUA 4KJGA 5DLWA 4LR7A 1EW8A 5L0EA 1KH9A 3NKOA 4B56A 4LRAA 3KD8A 4CYSA 4CXSA 3MK2A 3WAYA 4UOPA 3T02A 4MY4A 5EGHA 3ED4A 4ZG7A 3NKQA 1ANJA 1ELXA 5IJSA 4KAVA 4UPLA 3NKNA 2W5QA 5EGEA 1E33P 3TG0A 1SHNA 1ALJA 1FSUA 3DYCA 5HRTA 2GA3A 2W5VA 4UPIA 3DPCA 4KAYA 3MK1A 1ALKA 4NWJA 5C66A 2W5TA 1ELZA 3E2DA 5DLTA 5GRRA 3BDGA 3A52A 3T01A 5INHA 4MIVA 4ZG9A 3UN2A 3UN5A 4GTXA 2IUCA 3T00A 4LRBA 3NKMA 4LRFA 1ED8A 4FDJA 4ZGAA 3M8WA 3WBHA 3BDGB 2RH6A 3M8YA 5AJ9A 1URAA 1E2SP 2IUCB 1N2LA 1ZEDA 3WAVA 1E1ZP 3SZZA 5LQQA 2ANHA 1KH7A 4LRCA 3OT9A 4TN0A 2W5SA 2X98A 1AUKA 1ZEBA 1HDHA 4LRDA 4YR1A 1AJDA 3TWZA 1SHQA 4GTZA 1O99A 4LQYA 3M7VA 1KHKA 1K7HA 3SZYA 1ALIA 2IFYA 1HJKA 2D1GA 2W5RA 3MK0A 4GTWA 5L0KA 1ELYA 1B8JA 3IGZB 5IJQA 3UNYA 3IGYB 1EI6A 1ED9A 5LRMA 1EJJA 1E3CP 4QAXA 4UPHA 1ALHA 1URBA 3NKRA 4LR2A 4UOOA 4MHXA 2GSUA 1O98A 1Y6VA 5KXAA 2GLQA 1ZEFA 2ZKTA 3NVLA 3B5QA 4KJDA 4UORA 1Y7AA 4N7TA 3UO0A 3BDHA 1HQAA 4LR8A 1KHLA 1KH5A 2G9YA 5LRNA 2XR9A 4NWXA 3IDDA 1ANIA 4CXKA 3CMRA 3TX0A 2W5WA 4KM4A 1AJCA 5GOVA 5DLVA 3UN3A 1N2KA 4CYRA 2GSOA 4UPKA 1EW2A 1EW9A 3WAXA 1KH4A 5L0BA 4LR9A 1KHJA 3NKPA 2QZUA 4GTYA 5TJ3A 4LREA 3LXQA 1EQJA 3Q3QA 4ZG6A 1P49A 5K4PA 3M8ZA 1AJBA 2XRGA 3WAWA 1KHNA 5LIAA 3BDFA 4FDIA 2W8DA 2VQRA 1AJAA 2W8SA 2GSNA 2W5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CXU A;  4KJG A;  5DLW A;  4LR7 A;  1EW8 A;  5L0E A;  1KH9 A;  3NKO A;  4B56 A;  4LRA A;  3KD8 A;  4CYS A;  4CXS A;  3MK2 A;  3WAY A;  4UOP A;  3T02 A;  4MY4 A;  5EGH A;  3ED4 A;  4ZG7 A;  3NKQ A;  1ANJ A;  1ELX A;  5IJS A;  4KAV A;  4UPL A;  3NKN A;  2W5Q A;  5EGE A;  1E33 P;  3TG0 A;  1SHN A;  1ALJ A;  1FSU A;  3DYC A;  5HRT A;  2GA3 A;  2W5V A;  4UPI A;  3DPC A;  4KAY A;  3MK1 A;  1ALK A;  4NWJ A;  5C66 A;  2W5T A;  1ELZ A;  3E2D A;  5DLT A;  5GRR A;  3BDG A;  3A52 A;  3T01 A;  5INH A;  4MIV A;  4ZG9 A;  3UN2 A;  3UN5 A;  4GTX A;  2IUC A;  3T00 A;  4LRB A;  3NKM A;  4LRF A;  1ED8 A;  4FDJ A;  4ZGA A;  3M8W A;  3WBH A;  3BDG B;  2RH6 A;  3M8Y A;  5AJ9 A;  1URA A;  1E2S P;  2IUC B;  1N2L A;  1ZED A;  3WAV A;  1E1Z P;  3SZZ A;  5LQQ A;  2ANH A;  1KH7 A;  4LRC A;  3OT9 A;  4TN0 A;  2W5S A;  2X98 A;  1AUK A;  1ZEB A;  1HDH A;  4LRD A;  4YR1 A;  1AJD A;  3TWZ A;  1SHQ A;  4GTZ A;  1O99 A;  4LQY A;  3M7V A;  1KHK A;  1K7H A;  3SZY A;  1ALI A;  2IFY A;  1HJK A;  2D1G A;  2W5R A;  3MK0 A;  4GTW A;  5L0K A;  1ELY A;  1B8J A;  3IGZ B;  5IJQ A;  3UNY A;  3IGY B;  1EI6 A;  1ED9 A;  5LRM A;  1EJJ A;  1E3C P;  4QAX A;  4UPH A;  1ALH A;  1URB A;  3NKR A;  4LR2 A;  4UOO A;  4MHX A;  2GSU A;  1O98 A;  1Y6V A;  5KXA A;  2GLQ A;  1ZEF A;  2ZKT A;  3NVL A;  3B5Q A;  4KJD A;  4UOR A;  1Y7A A;  4N7T A;  3UO0 A;  3BDH A;  1HQA A;  4LR8 A;  1KHL A;  1KH5 A;  2G9Y A;  5LRN A;  2XR9 A;  4NWX A;  3IDD A;  1ANI A;  4CXK A;  3CMR A;  3TX0 A;  2W5W A;  4KM4 A;  1AJC A;  5GOV A;  5DLV A;  3UN3 A;  1N2K A;  4CYR A;  2GSO A;  4UPK A;  1EW2 A;  1EW9 A;  3WAX A;  1KH4 A;  5L0B A;  4LR9 A;  1KHJ A;  3NKP A;  2QZU A;  4GTY A;  5TJ3 A;  4LRE A;  3LXQ A;  1EQJ A;  3Q3Q A;  4ZG6 A;  1P49 A;  5K4P A;  3M8Z A;  1AJB A;  2XRG A;  3WAW A;  1KHN A;  5LIA A;  3BDF A;  4FDI A;  2W8D A;  2VQR A;  1AJA A;  2W8S A;  2GSN A;  2W5X A; 
#chains in the Genus database with same CATH topology
 5GAD I;  5G0R B;  3SEO A;  4HAC A;  3WBZ A;  3V6K A;  3CWJ A;  2CVE A;  2DHA A;  3Q8S B;  1HHS A;  1KWM A;  4OFZ A;  4I67 A;  2MLX A;  1AZS A;  2KL8 A;  4YR0 A;  4RW8 A;  1BMQ B;  2VL1 A;  5EWF A;  1PYT A;  1S0V A;  2V8D A;  3GWC A;  2DGQ A;  4K4X A;  4RJV A;  1DTQ B;  2XZT B;  1U1M A;  2VKR A;  1Q16 B;  1WNE A;  1RHM B;  4NAS A;  3H5X A;  1Q1K A;  4CH1 A;  1X5P A;  5CCL A;  4ZPA A;  3TI0 A;  4EZ9 A;  3M8Q B;  4FYY B;  2EVZ A;  3H25 A;  4TU7 A;  1F2G A;  2HHQ A;  2OGU A;  5DS7 A;  1X5T A;  4X4N A;  4A8K A;  1K73 T;  1WHV A;  2XSJ B;  4KHP F;  1HW8 A;  1XBW A;  5EX3 A;  3MMC A;  5KFL A;  3MPV A;  3OV7 A;  1EW9 A;  3VR1 A;  3TEH B;  5K14 A;  1FJG J;  1WF1 A;  1JJ2 R;  1HQ2 A;  5HMW A;  1S1V B;  4EYI B;  4K4V A;  2HHX A;  1WUU A;  3IGV A;  4ECT A;  2KFN A;  4QBU A;  1FF2 A;  4FF3 A;  2LA6 A;  3K89 A;  4F25 A;  2YWF A;  4Y2A A;  5DO2 A;  1ELX A;  5KFN A;  3M6V A;  3GIM A;  4HI1 A;  1YBT A;  3QYY A;  4MKV A;  1SJQ A;  1F2H A;  2LQ8 A;  3R5B A;  4NZ0 A;  5DLT A;  4QWE A;  3BN7 A;  2GQ2 A;  1N5V A;  3RB0 A;  1ELO A;  1L3V A;  1KD1 T;  4QW8 A;  5HVG A;  1VCT A;  3AXK A;  4G6V B;  2V2V A;  1YWX A;  1VK8 A;  3TA1 A;  2DIU A;  3MTJ A;  3QT7 A;  1EQM A;  5KFT A;  4N5S A;  5GAD U;  3FEX B;  3GIR A;  2KH9 A;  2GJF A;  2JLG A;  1NZ8 A;  1EJJ A;  1YJW S;  2VH7 A;  4X4U A;  3KG0 A;  4WP3 A;  4NLR A;  4WWS A;  5I3U B;  2HRU A;  5ETK A;  2ZH9 A;  1WG5 A;  4TKT A;  2W5W A;  3BDE A;  5J2N A;  5CCM A;  2AGQ A;  2ZHO A;  1WSV A;  4BHQ A;  1TFW A;  4PAA A;  1EX8 A;  2QL5 B;  2DCU B;  4NLQ A;  3LO3 A;  4RKU C;  1RLC L;  3FEY B;  2G0I A;  5B0B A;  1Q8I A;  2XEX A;  4B02 A;  3KK1 B;  1LWX A;  1LFP A;  2J5A A;  2LEA A;  3QBC A;  5M2R A;  2LVW A;  5M2P A;  2KXH A;  4UPL A;  3UR3 C;  3SQO P;  2VG5 B;  3DPC A;  3MCM A;  5EWE A;  1OYE A;  2EK6 A;  1TKX B;  2B9E A;  4F50 A;  5EHH A;  2CPX A;  4MFB A;  1URN A;  3FZB A;  1FWL A;  5KFV A;  1E2S P;  3GV7 B;  3QFW A;  1GFW B;  4OHW A;  4LQY A;  4K0K F;  1X4H A;  5CAA A;  3OSP A;  3N01 A;  3CSK A;  5JVH Q;  5GME A;  4PWW A;  5D4O A;  5AT1 B;  2B7C B;  1WC3 A;  3C16 B;  2NXE A;  2XLI A;  3UW1 A;  2WTF A;  3KK3 A;  4WYW A;  3HSG A;  4O3N A;  4DSF A;  2XO7 A;  5BYR A;  1YQH A;  3M8P B;  2HVI A;  4DZD A;  3DLE B;  2RDI A;  4KY3 A;  3N28 A;  2HK3 A;  2COL A;  2WCX A;  1Q5V A;  5A76 A;  5K9F A;  4J9L A;  3PYD A;  2W7A A;  3EE3 A;  4NL5 A;  2ZUG A;  1CJK A;  4ZJQ A;  1C1B A;  1E6V B;  5C24 B;  3GFH A;  2FYX A;  1IJF B;  1FX2 A;  1MWY A;  3H98 A;  2OH2 A;  2ZZM A;  3HP6 A;  5KAK A;  4I2Q A;  3GJS B;  3HCX A;  2IVF B;  3EXC X;  1UFL A;  2WVB A;  2W8K A;  3GYN A;  3NWG A;  4USU A;  1YIJ S;  2NSC A;  2Z2L A;  2QE5 A;  2JL9 A;  2PN6 A;  3PZP A;  4CM0 A;  2QA1 A;  5IM0 A;  5A8K A;  1JX4 A;  1WG4 A;  4IG3 B;  2B5J A;  3T1Y F;  4Q0B B;  2HVD A;  2CAD A;  2PGC A;  5H9E J;  3J81 j;  2CNK B;  4M5M A;  1KQG B;  1VRT B;  4KJD A;  3ITH B;  2B9X A;  3CED A;  4EBE A;  3GIK A;  1OY6 A;  3QO9 B;  3O6Q A;  4RNO A;  2CQD A;  2GHW A;  4ZPV R;  4GTY A;  4ILL A;  1QSS A;  2LEC A;  2GW8 A;  1B0T A;  3C15 A;  2ROP A;  1NPR A;  2M4M A;  1Y9O A;  4DMZ A;  5LSR A;  3KXD A;  3UNG C;  4UY8 T;  3PYF A;  1CSJ A;  2UVW A;  2G0C A;  2Z2M A;  1SBR A;  4G3I A;  1K1Q A;  3MR3 A;  3CJ5 A;  3IFE A;  3EMT A;  1IBL J;  3OBI A;  3D6M B;  3DDN A;  3E2D A;  3T6B A;  2FLL A;  3OLA A;  1D8Z A;  3Q22 A;  3NKM A;  4ZPB A;  1VQM S;  1E6Y B;  2GHV C;  4F36 A;  4ZVT B;  1CJT B;  2XS2 A;  4YR1 A;  2ALY B;  4F2R A;  3HT3 A;  3OL9 A;  4U7U K;  3DLK A;  2E7X A;  2DGO A;  3GFX A;  1KON A;  1WF2 A;  2YXL A;  3M2V B;  4O4G B;  1GX5 A;  2HPU A;  4EBD A;  4J9M A;  1WKK A;  1G6B A;  3A8E A;  2AYG A;  3TOQ A;  1N32 F;  3W3S A;  3C19 A;  3D68 A;  1SVD A;  1BQN A;  3BSA A;  5IWA J;  2QX0 A;  1ZEF A;  2KN4 A;  4N41 A;  2JEF A;  3TUJ C;  1BHN A;  3SQG B;  4WFX A;  5HBM A;  4C8N A;  1JXV A;  4B3R J;  4Q2M A;  5JXS A;  1Y10 A;  3ISZ A;  6AT1 B;  1YJU A;  4E2F B;  1ZZN A;  3KD8 A;  1VQS A;  3WAY A;  2MLY A;  4NLY A;  3FCW A;  2XMT A;  4NPO A;  5EX0 A;  2V69 A;  2ZEJ A;  3I87 A;  2FHK A;  2C2R A;  2ZOF A;  4I7F B;  2YPY A;  3GCX P;  2PFD A;  3JS9 A;  5KT4 A;  3THV A;  2XGP A;  1ED8 A;  1RAC B;  1RBO B;  1JLC B;  4NX9 A;  2XLK A;  1IBM J;  3M2R A;  4LSN B;  2MHN A;  2QJ3 A;  1T9W A;  1U1P A;  2ASY A;  1ACM B;  3GON A;  1RB0 A;  4UUW A;  4UOG A;  1TTH B;  4QIE A;  3N5F A;  3NGT A;  2MYF A;  3BPS P;  4WP9 A;  3ZTR A;  3FCH A;  4DR3 F;  4LMZ A;  2ZH6 A;  4JI0 F;  2Y0B B;  3KFW X;  4DV0 J;  3MTK A;  3CJK A;  4LF9 F;  5CZV A;  4NLP A;  4A8W A;  1I94 F;  4OZL A;  2V0N A;  1OYD A;  2A1B A;  4DR2 F;  1S77 D;  1O5J A;  2RH3 A;  5SUH A;  1I51 B;  5K5M A;  4F02 A;  2DHS A;  3QLH B;  4B17 A;  5KT5 A;  3P5T L;  1RWU A;  2V8V A;  1UPP A;  1HPZ A;  5H9F K;  2JFD A;  1XC9 A;  4YDD B;  3G82 B;  2UUB F;  2HIY A;  1Z4U A;  1IQZ A;  2C2K B;  2HNY B;  4ALZ A;  4M5J A;  3LWL A;  2MSS A;  5KFC A;  3KWM A;  1HJK A;  4C8K A;  1NB2 A;  1RLD A;  1YIT S;  2RS2 A;  2YH0 A;  1MU2 A;  1ALH A;  4TLQ A;  3D67 A;  3K17 A;  2ZWO A;  3B82 A;  3CJ4 A;  2R8H A;  5LJ5 Y;  2IJF A;  2ZDP A;  4O23 A;  4FYD A;  1RT5 B;  5FII A;  5LRN A;  1QLN A;  2E9T A;  2CQ1 A;  1I6J A;  5C25 B;  2GFF A;  1FJ7 A;  4Y65 A;  1NHU A;  4I6Y A;  2M0G B;  2GC8 A;  1M1H A;  4PYD A;  2DR5 A;  3CJ0 A;  2BE9 B;  1VBK A;  2DKO B;  2DGX A;  3PM9 A;  1RAB B;  1VBX A;  4UQG A;  2ZOG A;  4RUB A;  3RG6 A;  4WU2 A;  2CJ9 A;  2B8Q A;  5HVF A;  4DV5 J;  4OMF G;  1N0U A;  2Q6B A;  4ECR A;  3HKZ D;  3ZC4 A;  3MWB A;  2C2D A;  1OS5 A;  4ZN1 A;  2W7P A;  2BAB A;  3IRX B;  2B3T B;  1XR7 A;  1EQ0 A;  4JI4 F;  4K8R A;  4ICL B;  1VQ5 S;  2CRL A;  4F4A A;  3NGS A;  2F9J A;  2DY1 A;  2MY7 A;  1X60 A;  4DLE A;  4X65 F;  2DGS A;  1ZA2 B;  1YTY A;  2CPY A;  2HNZ A;  4CO2 A;  4JI7 J;  2F5G A;  1FE4 A;  4FXD A;  3ENV A;  3AQP A;  3AFG A;  3K5N A;  4J9U E;  4DX8 H;  1KFS A;  1IQT A;  2MKY A;  3KJV B;  3TAN A;  2BX6 A;  4FVM A;  2M7S A;  1R7I A;  1N6Q A;  2IMO A;  3UN3 A;  4Z7Y A;  1WKL A;  1EW2 A;  3D6F B;  3OJU A;  2BE2 A;  1HYS B;  4X84 A;  5H1S V;  2IHR 1;  4AXI A;  1QM9 A;  5HLF A;  3NGR A;  4CNY A;  3I96 A;  3BRE A;  1YJT A;  1RQ0 A;  3LAK A;  1QSY A;  4DUZ J;  3OR2 A;  2X51 A;  1YRT A;  3FUY A;  5D77 A;  2RUG A;  2W2M P;  4ID5 A;  1X0F A;  2AX1 A;  1IWG A;  1LWE B;  2QC3 A;  1X5S A;  1FEE A;  2VQE F;  1EKR A;  4FF1 A;  2JVR A;  1S9G A;  3OW2 R;  4WTO B;  3IM8 A;  2V9W A;  3FMW A;  2Y8Y A;  1Q8B A;  5A8R A;  1U0H A;  2NSB A;  2O66 A;  3MI7 X;  1R0B G;  1X9M A;  2OI2 A;  4OZ3 A;  2B4U A;  3R5A A;  3OFG A;  3TA2 A;  3K58 A;  2C3M A;  1WD6 A;  2R4F A;  2BEF A;  5SZT A;  5ETS A;  2MKK A;  1N33 F;  4IR1 A;  4IDK A;  4QJV A;  3J81 Y;  3RBD A;  2V2Q A;  2FHM A;  1VC5 A;  3NLC A;  2N4D A;  3DYA B;  3GMG A;  3UD4 P;  4OZN A;  1RP5 A;  4RW7 A;  2L08 A;  2DXE A;  3GQC A;  4DV1 J;  1RWK B;  2AMC B;  1S7H A;  1V3Z A;  1H38 A;  2XTJ P;  2UVR A;  4QIV A;  5CYQ B;  4ED4 A;  3W64 A;  1I5O B;  5CHC B;  2J9D A;  2J6T A;  2BJD A;  3KDN A;  4ZG7 A;  4ED1 A;  4WF9 Q;  1EET A;  4GKK J;  1DBD A;  3EVO A;  2G2Y A;  2DO0 A;  2QT7 A;  5F0U A;  2C3U A;  2KB2 A;  1M5K C;  5CYM B;  1MRO B;  2OSR A;  2VG7 B;  4MIV A;  4LF2 A;  2IUC A;  4RBU A;  4LRF A;  1F60 B;  2RH6 A;  3PNI A;  4TY8 A;  1F3F A;  1RKI A;  3TA0 A;  2XMM A;  2KT3 A;  2GV1 A;  2QG9 B;  4DR7 J;  3MFI A;  2E44 A;  4YOE A;  3JQJ A;  1Y4Z B;  4UPH A;  1RCO B;  3C14 A;  3DRR B;  2VQF J;  1Q7L B;  1FKP A;  2Z4P A;  1M5S A;  1SIZ A;  2FJV A;  3JSM A;  2VJV A;  2ZKU A;  1RZM A;  2YWE A;  4QR2 A;  1G4C A;  2DIS A;  2BVZ A;  5DLV A;  2D9P A;  2CUY A;  2J76 E;  1Q7Y T;  1HNZ F;  1LWC A;  4ZHR A;  3MM9 A;  2A2C A;  5LIA A;  2G9O A;  3LW5 C;  3UDE A;  2YNF B;  5KT6 A;  5IT9 Y;  1UW9 A;  3NNA A;  3L3C A;  1O51 A;  1BWE A;  4L75 A;  1OIA A;  4MK7 A;  1KS2 A;  3E51 A;  4AL6 A;  1BY9 A;  1ARO P;  3BKT A;  2F4F A;  1AUS L;  3KLI A;  4DQQ A;  4HL9 A;  9ATC B;  1HNW F;  4G1I A;  3AD9 C;  4NEZ A;  3LUY A;  4BBY A;  3CJQ A;  2F4V J;  4LRB A;  1QE1 A;  1AFJ A;  2W9C B;  3QAE A;  1PBU A;  2Y1L B;  2HHV A;  4BCA A;  2VPY B;  5BJR A;  2WSE C;  3BPD A;  4LRC A;  3OVS A;  3MMA A;  3DN9 A;  1TL4 A;  4NXM J;  2IFX A;  2CQC A;  2V8P A;  3BBF A;  1F9H A;  1U24 A;  3D3C J;  3KK2 B;  3J7Y I;  2GSU A;  3IR6 B;  4FYX B;  1NZA A;  2XNR A;  3HZE A;  3NVL A;  5J2P A;  4URS A;  2KJV A;  5JMN A;  4LF7 F;  4Q44 A;  4FF2 A;  1QTM A;  2AYE A;  3MR6 A;  2CPH A;  2YWW A;  3ISN C;  2VON A;  2X1B A;  2ASL A;  1IKY B;  1IN0 A;  4TNO A;  1VLO A;  1R89 A;  1WWH A;  3VZH A;  2JWN A;  4RW9 B;  4J9N A;  4NLX A;  1SJ1 A;  4C11 B;  1TU0 B;  3V6D B;  3L95 X;  2GA3 A;  3KYL A;  3DM2 B;  3BYR A;  2AYB A;  4GKJ J;  2GX8 A;  1PIE A;  1GH8 A;  3M2U B;  3PW4 A;  1WHY A;  3GP9 A;  2WB1 D;  2HWT A;  3CCJ S;  1CUL A;  5M2U A;  3SSS A;  4YEA A;  5T7L A;  1S6O A;  5LRM A;  2MQP A;  2XGQ A;  3FVY A;  2HHU A;  1Y6V A;  3MPD A;  2JRS A;  2CDQ A;  3FBB A;  3FBE A;  4KR0 B;  2HND A;  3PFE A;  4CLY A;  1U1N A;  2Y0S D;  3LAN A;  3DLG A;  3NGK A;  3J7A 1;  3NS5 A;  3UVJ A;  1R0C B;  5TJ3 A;  1BQM B;  2NZC A;  3WAW A;  3R1L A;  3M32 A;  2XWX A;  3GG1 A;  3IM9 A;  4YB6 A;  5IT9 U;  3CDA A;  1TL3 B;  2W4C A;  4C3K A;  3GJQ B;  3OFF A;  4KGX B;  1EP4 B;  3V4I A;  4OYA A;  1T9Y A;  1DZ5 A;  5EUH A;  2NUH A;  3GR1 A;  4X4O A;  2CPZ A;  4RU9 A;  2IDL A;  3DNC A;  3J7Y U;  3KLF A;  2Q66 A;  3KLH A;  3HVW A;  5ETT A;  4ZVU B;  3EWG A;  3OTD A;  2RAQ A;  4JB8 B;  1C1C B;  3MM7 B;  1HMV B;  3D66 A;  3DU5 A;  1E1Z P;  1FWP A;  4OHZ A;  1RKJ A;  4OV1 A;  2H5J B;  4DV3 J;  2RE1 A;  2ZC4 A;  3GJR B;  1AYE A;  1K0V A;  2E1A A;  2OP5 A;  1KQF B;  1CJV B;  3CD0 A;  2UP1 A;  3BBC A;  4D3H A;  2MZ1 A;  4X2B A;  1KEK A;  3EX7 B;  1YZ7 A;  4MMO A;  5FLX Y;  1SQE A;  5DM6 Q;  4X66 J;  2J0Q D;  4LF5 F;  1B4S A;  2Z2Z A;  2C2E A;  4QIG A;  2F1F A;  4NLW A;  3NMR A;  5KOW A;  4OYZ A;  4CO4 A;  4ZK7 M;  3R5C A;  5HI7 A;  3FQL A;  2OPS B;  1F5A A;  1FER A;  3IS9 A;  2EBG A;  3O3L A;  3BR8 A;  3GFZ A;  3ENW A;  2V6A A;  2VIC A;  4OX9 F;  1FA0 A;  3GIJ A;  2E29 A;  1HD0 A;  3NCQ A;  4IFY A;  2P6T A;  2UV8 A;  5DQH A;  3GFY A;  3DRS B;  2AD9 A;  3RBX A;  1UJ6 A;  3ZZY A;  4OI1 A;  2EPI A;  5K8O A;  3TUP A;  3P4U B;  2P6S A;  2YWH A;  1WJ9 A;  5B08 A;  4FNI A;  1Z1Z A;  2AKW B;  2BW7 A;  2YPZ A;  3ZZO A;  1F9E B;  5C2G A;  4NCG A;  5KFO A;  1OPZ A;  4ETZ A;  4YHH F;  4F4Y A;  1HHT P;  2VPZ B;  2CVI A;  4KFB A;  3C6U B;  4OX6 A;  5B7W A;  1VHI A;  4H4K A;  4B9L A;  2V4J A;  5I3P A;  3BKU A;  1IKV B;  2Z2Y B;  3HD2 A;  3OL8 A;  3CCQ S;  2BJ8 A;  3CIM A;  2DNN A;  2DXF A;  2DEI A;  2MZT A;  1VC0 A;  4WZQ A;  1RHQ B;  2GS8 A;  3QRQ A;  3PTW A;  3GV5 B;  3DOM A;  3AH6 A;  3R27 A;  5I42 B;  1S6P A;  2PA3 A;  2YQ0 A;  1N56 A;  1N88 A;  1N48 A;  3I5B A;  3TR5 A;  2EKN A;  1FO1 A;  1QUP A;  3Q8P B;  2P9C A;  4LIR A;  2L3M A;  3DI6 B;  4WFN Q;  5LMN F;  4LRA A;  2DNH A;  2F40 A;  1UVI A;  1ANJ A;  2NYI A;  3OR1 A;  1JLE B;  1TAQ A;  4UPI A;  3BJY A;  1RAO A;  2VBY A;  2F63 A;  2FJE B;  4KHP J;  3E01 A;  4B3O B;  4F26 A;  1NDC A;  4C0B A;  2JNJ A;  1S1U A;  3HHD A;  1U8W A;  2BMB A;  2UZA A;  1HBN A;  3AJD A;  2DH8 A;  2EG1 A;  5ADZ A;  1M90 T;  2XMW A;  2KI2 A;  1HWL A;  1JLB B;  1WC5 A;  3SMZ A;  2L48 A;  3L7P A;  2NS1 B;  2BM0 A;  1KBR A;  3U1M A;  4AYB D;  4ZVG A;  2GO9 A;  3HX9 A;  4QAX A;  1FJC A;  3BSO A;  2QYC A;  4P71 A;  3AQO A;  4WFA Q;  3A12 A;  3TO8 A;  4X4P A;  1TL1 B;  2VBW A;  1JKH A;  1D1U A;  3W5Y A;  4LT6 A;  1VIO A;  2XY7 A;  1TKZ A;  4C8M A;  4EBC A;  3V6H A;  1S7I A;  2V5H G;  5F41 A;  2EXU A;  5KFB A;  1HAR A;  2RS8 A;  4MKA A;  2G2Z A;  3KLE A;  1WI8 A;  5IS2 A;  2BUN A;  1JNZ B;  1QJH A;  1RYS A;  2R7S A;  4WIQ A;  3S01 A;  1SV5 B;  1TP7 A;  4QZV B;  4CT8 A;  2E7V A;  3Q24 A;  1NH7 A;  2CWX A;  2Q79 A;  1PO6 A;  5ETV A;  2MZR A;  4Q5V A;  3OXG A;  3SCL E;  4O3S A;  3M05 A;  2AJ2 A;  4IQM A;  1RT4 B;  4IDK B;  1OJ4 A;  4OI0 A;  2WBR A;  5A0Y B;  5HRO B;  5D3G A;  3HHL B;  3MEE B;  4PWU A;  3MEC A;  2LMI A;  2V63 A;  3QIP A;  2FHJ A;  4OYX A;  5F8L A;  1RK8 A;  1FNO A;  1S1X A;  3AJ2 A;  1FTC A;  1RTH B;  1JLQ B;  4W98 A;  2EFV A;  3G8S A;  3HT0 A;  1PAU B;  3KHL A;  2LDI A;  3D28 A;  3EGV A;  1HQE B;  1NM2 A;  5HQ8 A;  4F7V A;  1S12 A;  1X4A A;  1FXD A;  5IOL A;  4I56 A;  4PQU B;  4NLV A;  1T02 A;  1C4A A;  3R8Y A;  4KC5 A;  2IM3 A;  3BZQ A;  2OTL S;  3LP1 A;  2LP4 A;  3D9B A;  3CUN A;  4K0K J;  3MXH P;  5BR8 F;  1REV B;  2QSF A;  5THW A;  5J2Q A;  4FF4 A;  1LEO A;  3LF0 A;  1OY8 A;  4QIW D;  2GNK A;  2HK2 A;  2MMY A;  1DJ0 A;  1GEH A;  3X3U A;  5MLC V;  3UWT A;  2ZD1 A;  4C2M A;  1WC1 A;  3DXS X;  3NS6 A;  2W24 A;  3AT1 B;  1TL5 A;  1X9S A;  2KVI A;  4YME A;  2LEP A;  2YNI A;  1F6T A;  3WAV A;  3ONQ A;  3SYZ A;  2EC2 A;  3W2V A;  1SHQ A;  3G6X A;  1S0M A;  4Q43 A;  2UUT A;  3JSM B;  2YQ3 A;  1TKT A;  1SKR A;  2Q3P A;  2HFZ A;  1FRH A;  4CT9 A;  2HUR A;  3R2C J;  1W2B R;  1CS4 B;  1FD8 A;  4XDC A;  3ETO A;  1JLF B;  4PKD B;  3PW0 A;  3TEG A;  3IG1 A;  3VAG A;  2ZWP A;  5AXM A;  4JI3 J;  2WVD A;  1Q0N A;  1OY9 A;  1KNZ A;  2PDA A;  4LF6 F;  1XNR F;  1WOR A;  1ZPV A;  2DYA A;  1NJZ A;  3R7B B;  4PPD A;  5EDW A;  3LP2 A;  3DFE A;  2RIL A;  4DLG A;  1PYS B;  4LF4 F;  2HIQ A;  2XB2 D;  3NKQ A;  3T1Y J;  1AXQ A;  4O3P A;  1URR A;  4CNZ A;  1HR0 J;  3HFZ B;  2HQG A;  2DR7 A;  3RGI A;  1KRP A;  1IBL F;  4F4Z A;  5B0F A;  2L9W A;  2Z8Q A;  3W60 A;  3OTO F;  4GVL A;  2QFI A;  5L0K A;  1FD2 A;  1DQA A;  4OHX A;  4PXC A;  1AT1 B;  3BYP A;  2CPI A;  4DR1 F;  3B8H A;  1URB A;  3H4B A;  3QID A;  4CLP A;  2VG6 B;  1S0N A;  3RZA A;  5L38 A;  2R9L A;  4EI2 A;  2QFJ A;  4B9N A;  2CQI A;  1HWU A;  3HVT B;  3CUL A;  1UTA A;  1FKO B;  3Q3Q A;  3HJV A;  5IWA F;  4QOT A;  8AT1 B;  3HUL A;  3A13 A;  3BQ2 A;  2R3V A;  4B56 A;  3DGV A;  4FBU A;  1WEY A;  3IMQ J;  3CE8 A;  1IKW B;  5HO4 A;  1N32 J;  2OEK A;  3SCK E;  2R7X A;  1BGX T;  2LFV A;  5HSP A;  2I8E A;  2ZC3 A;  5IC6 B;  2DNY A;  2OJ3 A;  3D2W A;  3PEJ A;  4MIB A;  4B3S F;  3KHH A;  1J27 A;  2G13 A;  5AXL A;  4A8F A;  2XI2 A;  2BAN A;  1Z2L A;  4OV6 A;  1RAF B;  1TUW A;  4GVB A;  1NAQ A;  5KTQ A;  5KFG A;  2MST A;  3N5B A;  2OML A;  3ETM A;  2QYG A;  4CM2 A;  3C8Y A;  1IBM F;  1U09 A;  3KLG B;  1BLU A;  1HLW A;  4MK8 A;  1MSW D;  1F3V A;  1MMD A;  2LQ5 A;  2OMO A;  3NAH A;  1FRX A;  4Y2M A;  4IH6 A;  2QLX A;  1U45 A;  4LFA F;  4KKO A;  1R0A A;  1AJA A;  1PC5 A;  2VIH A;  3ZNJ 1;  4AD6 A;  3W1Y C;  4LUB A;  3NCP A;  1RTI B;  3ED4 A;  3GIL A;  3PV8 A;  5JJB A;  1X4G A;  2V4Q A;  4JI0 J;  1VLY A;  2FVQ A;  4IFV B;  4JV5 F;  1R8H A;  4QR0 A;  4H4M A;  4AND A;  5E2Q A;  3POT A;  2Z57 B;  4PUO B;  1JB0 C;  4LF9 J;  1C0T B;  2ZOM A;  1VIX A;  1SQG A;  2PFF B;  1XR6 A;  2IMW P;  1N5Y A;  1FDB A;  1N2L A;  2XO6 A;  4DR2 J;  2DRA A;  2OLW A;  1UEK A;  4ZN3 A;  3BBB A;  3LAL A;  4HI2 A;  1T05 A;  1GAO A;  4EEY A;  1EAY C;  3NRB A;  4X4R A;  1U8S A;  4NA1 A;  1VQN S;  2KYX A;  1NO8 A;  1RHU B;  5T14 A;  2A6O A;  2WBM A;  3JYT B;  1RTJ A;  3SIP B;  2J7W A;  2PC6 A;  3L4B C;  1UET A;  1WG1 A;  2GMJ A;  4WCE Q;  1LWF B;  2RQM A;  2DH9 A;  3EUN A;  3M1V B;  2J9C A;  5G0R A;  4IFY B;  3VHQ A;  3GB0 A;  3LXQ A;  5B0G A;  2BM1 A;  4YB5 A;  4DR6 F;  2HHS A;  4AL5 A;  3K5L A;  1NHK L;  1W2I A;  1GX6 A;  3AA9 A;  3ILL A;  4OZJ A;  3TVY A;  2E66 A;  2I1R A;  1NB7 A;  2PI5 A;  3CCR S;  2H9Z A;  1FNX H;  2AWZ A;  1NUE A;  1DTQ A;  1KHW A;  4CYU B;  2KU7 A;  2NPF A;  1RXO B;  4J9S A;  2HMI B;  3PR4 A;  3RAX A;  4H4K C;  3GJT B;  3LGM A;  4USI A;  2R8G A;  2OEJ A;  4DV5 F;  4N8N A;  4NYP A;  3M8Q A;  3WC2 A;  3BDP A;  2RHS B;  4ITS A;  4AXJ A;  2H51 B;  1Q82 T;  2ZJP Q;  1VRQ C;  2XSJ A;  2R7O A;  4K4Y A;  3D4J A;  4P2X A;  3OPK A;  1FXL A;  1YVF A;  4ZP8 A;  4USM A;  4N7T A;  2GAH C;  4OZ2 A;  2PII A;  1VRU B;  1NKB A;  1AJC A;  2RU9 A;  2KG1 A;  1S1V A;  4MAK A;  4A8S A;  4USH A;  1O8B A;  3M8Z A;  2ZBC A;  3THP A;  3V81 B;  4NML A;  4JI4 J;  1KN6 A;  4XAK A;  2XC9 A;  4RU2 A;  2HAF A;  3ET6 B;  4X65 J;  3SI8 A;  1Y5L B;  3FGV A;  2X1F A;  3KDO A;  5EGY A;  2ACM A;  4WFY A;  1KQS R;  4NE9 C;  3WBH A;  3P49 B;  4B9U A;  3H5Y A;  1IM6 A;  1QTN B;  3FEZ A;  4Z37 A;  2JZ5 A;  4YR3 A;  1NJW A;  4YR2 A;  3F0N A;  3KG4 A;  4ZIV A;  4DV7 F;  1HWK A;  1S97 A;  1S6Q B;  5F9N A;  5I3U A;  1Z2Z A;  5A2Q Y;  3W2W B;  4X4T A;  2IJN A;  2MDA A;  2ZBQ A;  4PR6 A;  1SI9 A;  4LSL B;  2EKY A;  3D1H A;  3NNC A;  1QUV A;  4FYV B;  3KK1 A;  1YLX A;  2W8S A;  1JK9 B;  2CJX B;  1RT3 B;  1L3T A;  3CT9 A;  4FZV A;  4DV1 F;  3WQP A;  1N33 J;  3TAM B;  2FY1 A;  3FNN A;  2VUG A;  1XJW B;  2POK A;  2V9K A;  2VG5 A;  4KGZ B;  2HYI B;  2K1R B;  3G86 A;  4KJI A;  3MD3 A;  1NK9 A;  1TKX A;  4RO0 A;  5D4P A;  3NY0 A;  2W5V A;  4P2F A;  4PAB A;  1UJ4 A;  3BEG B;  5L9N A;  2AYM A;  1PCA A;  2HZA A;  2D3O R;  4ZGA A;  3WZ0 A;  4DV4 F;  5HAN A;  4UQT A;  4M5D B;  3TQE A;  2ZVS A;  8ATC B;  3D3B J;  1QAY A;  5C42 B;  1KHK A;  1WOP A;  2PE8 A;  2IVM A;  4ED2 A;  2VOD A;  2BJ3 A;  3BGF A;  3C16 A;  1RT2 B;  3JTO A;  2WB4 A;  2AF6 A;  2J0W A;  1VQ6 S;  1XNQ F;  3EVM A;  2CJY B;  1PG5 B;  1R8B A;  1K0T A;  4EO6 A;  3V2U C;  2R7W A;  3M8P A;  3PRB A;  3DLE A;  4NZ6 A;  1WAC A;  1FXR A;  4UPK A;  2ERR A;  4OJ1 A;  2ZUA A;  4G65 A;  3G9C A;  1NDK A;  3Q89 A;  2B6A B;  2FC8 A;  1F5C A;  5L46 A;  1ZM9 A;  1E6V A;  2HGM A;  4FBT A;  4BDP A;  4AFF A;  1G2E A;  5C24 A;  4F67 A;  2MQO A;  3CGI A;  2DD8 S;  4IH5 A;  4CO5 A;  2HWH A;  3T41 A;  2HFO A;  2UXD J;  3BGU A;  2QTW A;  3PCO B;  3G6Y A;  1U1K A;  5DLF A;  4ZVQ B;  1TV6 B;  2KRB A;  2CJQ A;  4KSE B;  2JH3 A;  1FT8 A;  3KHR A;  1HNV B;  2IRY A;  1ZYQ A;  1V9O A;  1Y5N B;  1KTV A;  4IG3 A;  3MK0 A;  2F4V F;  4Q0B A;  2NLW A;  4NCA A;  5F8G A;  3CMQ A;  3QGH A;  4KYZ A;  1U2F A;  3HPO A;  1VRT A;  4MTP A;  3KKF A;  3ITH A;  4JOU A;  3EVW A;  4NXM F;  3QO9 A;  5A2Q U;  2MQ8 A;  1KHL A;  1HNW J;  1CVJ A;  5CYJ A;  3OFH A;  1F5B A;  3E3X A;  2WSC C;  1XTZ A;  3AB4 B;  4Q2L A;  2GSN A;  3BH7 B;  4WBF A;  1U2R A;  3Q0A A;  1NSP A;  4LBI A;  5A6P A;  2HBY B;  1WF0 A;  1SH2 A;  1FRL A;  5E3Q A;  4NLG A;  3L7U A;  3E8O A;  3M30 B;  3DLH A;  2VAS A;  1E6Y A;  2EWH A;  4NWB A;  3E2E A;  4S0M A;  4HHU A;  2RHQ B;  4ZLN A;  2J0X A;  3C2P A;  1D3W A;  3BDG B;  1CJT A;  3T5J A;  4DBQ A;  3SZZ A;  1SKS A;  2KG0 A;  3M2V A;  4P2S A;  4O4G A;  1HL6 A;  2HZC A;  3CC7 S;  4Q8E A;  4UOF A;  3M9M B;  4JUZ A;  2ZFH A;  1AFI A;  3SZ2 A;  3TUZ C;  3NCR A;  2OFH X;  4EK2 A;  3CJT A;  3AY0 A;  3QGP A;  2ATC B;  5DZ7 A;  3SQG A;  4ZP7 A;  4PZV A;  4ZVE A;  3CCM S;  2YNH B;  5HVH A;  3C3L A;  1SKU B;  3WHI A;  3PJX A;  4QIF A;  1N36 F;  2WON B;  4CO3 A;  1A9N B;  4RBV A;  3U02 A;  2KXF A;  3S8S A;  5DM7 Q;  3LPY A;  1WC4 A;  3F73 A;  2MKH A;  1WC0 A;  2FUG 9;  5KG1 A;  2B51 A;  2N3O A;  1FDN A;  4ZP6 A;  4I7F A;  2AT1 B;  4K59 A;  5HP1 B;  2MJN A;  3MM8 B;  3QAU A;  2RRN A;  3H2V E;  2IA6 A;  1H98 A;  2VC0 A;  2M2B A;  2UUC J;  4GO5 X;  5H9F J;  2O01 C;  3H5S A;  3EJM A;  1JLC A;  1TQL A;  1ZAX A;  3I4H X;  4LSN A;  2SXL A;  4P75 A;  3H8Y A;  3R5G A;  4DCJ B;  3EZ5 A;  2ZVI A;  2OPR B;  4C98 A;  3TWZ A;  1QAX A;  3CCZ A;  1PSD A;  2NXJ A;  3SZY A;  1S1T B;  4FXW A;  3HHL D;  4IQX A;  1RT7 B;  3TRG A;  4GC7 A;  3T19 A;  8RUC A;  4UF4 A;  2YKP A;  1OSC A;  3QWP A;  2FY8 A;  3HD1 A;  5DGB A;  4M5H A;  4M5N A;  2M3D A;  3P96 A;  2ZE2 B;  2FJD B;  1JLA B;  1WOS A;  2YKO A;  3I5A A;  2GSO A;  4FYW B;  3QZ7 A;  2CQ4 A;  1KH4 A;  3IBW A;  4KB7 A;  4I2P B;  2H4W B;  3OLB A;  4LBP A;  3N0V A;  3QLH A;  1AUD A;  1ZM2 A;  3QJJ A;  5B0E A;  1APS A;  1SC3 B;  3PJW A;  5GVQ A;  3D6H B;  2XYH B;  3WIV A;  4FN5 A;  3G82 A;  1QAI A;  4F0M A;  2GVZ B;  1UAW A;  2QRR A;  2AIR B;  3FK4 A;  2DK2 A;  2HNY A;  3I4P A;  2HRY A;  3QT8 A;  1NSK L;  3UPF A;  2UXC F;  1YSJ A;  4PXD A;  4G1Q B;  5BYQ A;  4TQR A;  1S9F A;  1MG7 A;  2L9N A;  5DDO C;  5B0D A;  2HZV A;  3R2D J;  4QPT A;  1NLK L;  1JJ4 A;  1IR0 A;  1S59 A;  2LA4 A;  4OX9 J;  2K06 A;  3NBP B;  1BE4 A;  3I0S B;  4KQZ A;  2CQ0 A;  1RT5 A;  1HBM B;  1X4E A;  4CLU A;  2ATL A;  1ZA1 B;  2R2T A;  1Y7A A;  4U67 Q;  3US5 A;  5C25 A;  3BDH A;  2QGF B;  1FCA A;  3MUM P;  4DPU A;  1WSR A;  4EGL A;  4P6Q A;  1PJ5 A;  1FDD A;  4M95 A;  2B4O A;  3R7S B;  4XK8 C;  2EEY A;  4YHH J;  2ZNY A;  4C0O C;  1TK0 A;  5CD4 H;  1DUR A;  4L73 A;  3Q8Q B;  1M5O C;  4ED7 A;  2WVF A;  3PW5 A;  2BJE A;  2C3O A;  2HLU A;  5IT4 A;  4CLL A;  3LOU A;  4G1P A;  3MOZ A;  3NS7 B;  4CDI A;  1S79 A;  3IRX A;  3F41 A;  4WJB A;  1CJU B;  1RAD B;  3MMB B;  4USW A;  2DNK A;  4ICL A;  3OT9 A;  2R8I A;  1H0H B;  2I38 A;  3MCS A;  1ALI A;  1GXL A;  5IC4 B;  5LMN J;  1T3N A;  3JXO A;  5IJQ A;  2E9Z A;  2E5L F;  2MGZ B;  1U49 A;  2B7B B;  2CQ2 A;  4DF8 A;  2IVY A;  3H20 A;  3KJV A;  3ZXW A;  1T0T V;  3RB4 A;  1FRK A;  4YS2 A;  3CCL S;  2B0G A;  4ZJL A;  2KRR A;  3JTP A;  1HYS A;  4JYA J;  4YP3 A;  4OYW A;  3TZZ A;  4FNH A;  4CYR A;  1I1G A;  3AHP A;  2C2M B;  2XY5 A;  2W2O P;  4FDF A;  2L41 A;  3MEG B;  2I2Y A;  2XI3 A;  1SC1 B;  3EDQ B;  5B0A A;  4RBT A;  2WOM B;  3HJF A;  4KGK A;  1LWE A;  2Y1R I;  4ECV A;  2CAJ A;  3HHN B;  4QU6 A;  2CQH A;  1HW9 A;  1S76 D;  3ADA C;  1EKS A;  4RNH A;  2JC1 A;  3OD2 A;  1VQY A;  3GLJ A;  3M8Y A;  2FJW A;  2YKM B;  3NXZ A;  3VQT A;  1Y00 A;  4YY3 F;  3LPE A;  2QL9 B;  2VFS A;  1FJE B;  3QT5 A;  2D1G A;  4OI4 A;  1CBK A;  3OUY B;  4XO0 A;  1DFD A;  3IGZ B;  2ROE A;  3DYA A;  3DMJ B;  5J2M B;  4HH1 A;  3W5Z A;  1S1W B;  2I5J B;  5CA5 A;  2ILZ A;  4F3M A;  4QPX A;  3LTO A;  4W4M A;  4CQ1 A;  2BJ9 A;  1GTE A;  1MMN A;  3GYG A;  1VC6 A;  2ZH3 A;  4R5P B;  3G4S S;  3QMQ A;  2ZJQ Q;  4DL2 A;  4DXL A;  5LXY A;  4LRE A;  1P49 A;  5CYQ A;  1YI2 S;  2W5X A;  3O44 A;  1NU4 A;  4DL6 A;  4N47 A;  4QR1 A;  3JSR A;  3MAA B;  1YJ7 A;  3J7Z T;  1GMU A;  5CYM A;  1MRO A;  1U26 A;  2DR9 A;  1UCN A;  5T41 A;  2VG7 A;  4AT1 B;  3MEK A;  1UVL A;  2B4V A;  2FC9 A;  5HJY A;  3PJ9 A;  2J9D E;  2IM1 A;  1UVM A;  4RLE A;  4R0E A;  3IC1 A;  1N52 B;  5AJ9 A;  2AJ4 A;  2A2D A;  1BWV A;  5D0G A;  1SUQ B;  4HR2 A;  3VF0 B;  2ALZ A;  1Y11 A;  1HDH A;  3ZTS A;  2KZM A;  4XPE A;  1NK8 A;  1RHR B;  4KV8 B;  5BR8 J;  5KFJ A;  3DRR A;  3R6L B;  4Y2K A;  1EI6 A;  4C8L A;  1P1L A;  2MHE A;  2YNG B;  1NME B;  1YRU A;  3DOK B;  3B5Q A;  3KJN B;  2PT0 A;  1TAU A;  2NR0 A;  2VKZ G;  1RAG B;  1OQ3 A;  3JAM Y;  2B56 A;  4KM4 A;  4ZOS A;  1U6Z A;  3ZZU A;  1O6X A;  1LQ9 A;  2QZU A;  1SJ4 P;  2YNF A;  3ULH A;  4KE5 A;  1QD1 A;  1KHN A;  3CDU A;  3MGJ A;  4KAI A;  1S72 S;  1LFW A;  2LLZ A;  1NDP A;  2QIF A;  2JC0 A;  2KO1 A;  4RW6 B;  2ZIT A;  1GQE A;  1Q53 A;  3OQ2 A;  3PX0 A;  4JI3 F;  4OLP A;  2KKH A;  1K44 A;  5D4L A;  4OJG A;  2EK1 A;  1NCL A;  3B6B A;  3D0G E;  3ZTP A;  4CO0 A;  3O1L A;  1R6V A;  1FTR A;  2O3D A;  3W5X A;  1NK6 A;  5LT5 A;  2W9C A;  4PPZ A;  1SPB P;  2HBZ B;  1IKX B;  3CJR A;  4LIW A;  3SXL A;  4C97 A;  1RWO B;  1JLG B;  4NRT A;  3VGT A;  4KO0 B;  2XS5 A;  2K3I A;  3IBC B;  4CTA B;  2DNO A;  1HR0 F;  4LF6 J;  1XNR J;  3FRY A;  2FQQ B;  1K7H A;  3I0R B;  1JWW A;  3KK2 A;  1W26 A;  4ZJO A;  1J2V A;  4IKA A;  1SKW A;  4LF4 J;  4L74 A;  4MT1 A;  3BF4 A;  3FFI A;  1UVJ A;  2X1G A;  3AOC A;  5DG8 A;  2C2O B;  4GMK A;  2C22 A;  3ENQ A;  3PO5 A;  4HVZ A;  3I9V 9;  3T9Z A;  3FSY A;  1J5E J;  1IKY A;  2W8D A;  2C2N A;  3LQV A;  5HMX A;  1FE0 A;  4DFP A;  2RU3 A;  4KJG A;  4LF8 F;  1SCJ B;  5L0E A;  3OTO J;  2D7S A;  4HT7 A;  4RW9 A;  3MM6 B;  4C11 A;  2DCL A;  3V6D A;  3BB5 A;  4DR1 J;  3CCE S;  2QSW A;  5E33 A;  3DM2 A;  1RA6 A;  5J1E B;  4HLB A;  1G7C B;  3MED B;  4J5O A;  3M2U A;  3KUE A;  1TFY A;  1QDU B;  2E5J A;  3PX6 A;  4FKY A;  4C3M A;  4TU9 A;  1N5T A;  2HBR B;  3CCV S;  5G4D A;  3R5J B;  2LXI A;  3GPA A;  3TJ9 A;  2L9D A;  4X62 J;  5FDL B;  2ZJR Q;  2IRU A;  2WK4 A;  4ECX A;  4J9P A;  3CNQ P;  3MUV P;  1OMS A;  2ZH5 A;  4K7Q A;  1NXI A;  1NK0 A;  4IOA Q;  1L3U A;  1GTH A;  2DNM A;  3HLU A;  4ZVR B;  3CMR A;  4HDH A;  1BQM A;  4B3S J;  2DNQ A;  4L6V 3;  3MHY A;  3TX8 A;  3EPG A;  4CZC A;  1TL3 A;  3DRP B;  3CJ8 A;  1EP4 A;  4CP5 A;  3D0I E;  4W92 B;  3IA0 A;  3DGP B;  5EGH A;  2V2Z A;  3EZO A;  2FGC A;  4DSJ A;  3AD7 C;  3I55 S;  4DFM A;  1C1C A;  3MM7 A;  1HMV A;  1H7X A;  2V67 A;  4K2X A;  3DDK A;  1RI7 A;  1H2U X;  5DZ6 A;  2W9A A;  3AXM A;  1B99 A;  2HHP A;  1DTT B;  3CD5 A;  3G96 A;  3NMA A;  4LFA J;  1CJV A;  5CH7 B;  4BWM A;  2FHJ D;  1RE1 B;  2RB7 A;  4KT0 C;  2QLB B;  1KVJ A;  3UCU P;  4NLS A;  3IXQ A;  4C0H A;  5IQ6 A;  4PWD B;  3MDF A;  3CCT A;  4JV5 J;  2YKN B;  1AB8 A;  4R25 A;  2QA4 S;  2OPS A;  1TK8 A;  2UV8 G;  4ZS6 A;  3SBM A;  1KDN A;  4ZPT R;  3WAX A;  5E5N A;  5ETM A;  3W61 A;  2R7T A;  1BD6 A;  4DN0 A;  4WK3 A;  3M4X A;  4V19 X;  3VWS A;  4CXU A;  3DRS A;  3VV2 B;  3W8P A;  3NGD A;  4NI2 B;  2G4B A;  3DC2 A;  3B4D A;  3T5L A;  4D3G A;  1VI7 A;  2XZD B;  1QSL A;  2GGP B;  1UVK A;  4ERD A;  2PMZ D;  1YRX A;  4KAY A;  1HQU B;  3CDE A;  1GMV A;  4NYZ A;  5IXU A;  2RUS A;  4IUF A;  4AE5 A;  2X3G A;  4KGV B;  4EMD A;  4DX5 A;  2H5I B;  2E1M C;  4IO9 Q;  3M8W A;  4AL7 A;  4KBI A;  4LVO P;  2KHC A;  2Y9H A;  5ETQ A;  2OEL A;  3V5R A;  4OYO A;  2JEI A;  1NBE B;  3C6U A;  3QNW B;  4DR6 J;  1IKV A;  4EFA C;  1VQ8 S;  3OFE A;  4M1K A;  2XQC A;  3VVU A;  1KSP A;  1QVG R;  2YBV A;  4P7V A;  2QN6 B;  5I42 A;  1LK5 A;  2JLE A;  3O2I A;  1NEE A;  3QJL A;  4TXS A;  1R8P A;  1VGY A;  5KFA A;  4OI2 A;  3DI6 A;  1VFJ A;  2VDI A;  2AGP A;  2DGW A;  1SJ3 P;  4WE1 B;  3HK2 A;  4O44 B;  2P8I A;  1J5O B;  1HKA A;  1JLE A;  2EFG A;  3AOA A;  1DY3 A;  4B3O A;  4NCB A;  1TL7 B;  3B78 A;  3BSN A;  4P52 A;  5I4M A;  4RZR A;  2D3Z A;  2DIV A;  3T01 A;  3TW0 A;  1ZS6 A;  2AJ0 A;  1LW2 B;  1JLB A;  1IUJ A;  4U9R A;  2AV5 A;  4DV2 F;  2Q1L A;  4LFB J;  1NK4 A;  1UFW A;  4E0D A;  3UD3 P;  1T95 A;  5K8P A;  2AGO A;  5LQQ A;  2XMA A;  1MLA A;  3K59 A;  5KFM A;  4EYH B;  3UI3 A;  4X4S A;  3PW7 A;  3OSN A;  5CZX A;  2KT5 A;  4ECU A;  1TL1 A;  1UJ5 A;  3MR7 A;  1ULR A;  5C7P A;  5IQQ A;  4UOO A;  3T1H F;  4ED0 A;  4DX6 A;  4ZPD A;  1RWP B;  2FD2 A;  7AT1 B;  2GVD B;  1L5U A;  1SXL A;  1SC4 B;  3LAM A;  3H5U A;  5GMD A;  2ZM6 F;  2BOP A;  3W65 A;  2MKC A;  1SV5 A;  3TZY A;  2D3O 1;  2K8G A;  2CKW A;  2PMH A;  1RAI B;  3M9O B;  1EIY B;  2FLO A;  4DV7 J;  2R8K A;  1GK8 A;  3TG0 A;  1JJH A;  2CNL B;  4EUV A;  3OHA A;  1ELZ A;  1HNI B;  1GMW D;  1RT4 A;  2Y8W A;  2P9E A;  3IP0 A;  1VQK S;  5A0Y A;  1EZZ B;  5HRO A;  3NL0 A;  2LYV A;  4E8U A;  1W25 A;  3HHL A;  1WTF A;  2DR8 A;  3MEE A;  1ZED A;  1YJV A;  1KR4 A;  4OX7 A;  2DNR A;  2DBB A;  2YQ1 A;  2R8J A;  1S10 A;  1CQN A;  3NAI A;  4H4O B;  1RTH A;  1JLQ A;  3HF5 A;  2HQF A;  3BV8 A;  2O1P A;  1N5S A;  4ZVP B;  3M6U A;  1HQE A;  1OQ6 A;  4PCQ A;  1SJF A;  3CCW A;  4EU0 A;  3RJM B;  3LP0 B;  3NWR A;  2OPQ B;  3ENA A;  4PQU A;  1NRK A;  2OUG A;  4TYA A;  4DSL A;  4DV4 J;  4NLD A;  3SDE B;  1REV A;  4NOH A;  2KFY A;  1VJW A;  3NGU A;  1U48 A;  2CPF A;  4I69 A;  3WDO A;  1RWX B;  3W9J A;  2OPP B;  4DSE A;  4A47 A;  4LBH A;  3CO0 P;  4ZLJ A;  3MPU B;  3DOL B;  2KFZ A;  1XNQ J;  2F8M A;  2U1A A;  1N0V C;  5GAH I;  4CLK A;  3PYG A;  3UN2 A;  2BKO A;  1VBY A;  3P8B B;  3B4M A;  3GG0 A;  4JI2 J;  1URA A;  1NPK A;  4DQR A;  2PO4 A;  1DHM A;  2CYY A;  2ANH A;  3QT6 A;  5ETN A;  1RBA A;  3HDS A;  2UXD F;  2JHE A;  2FVR A;  2IA0 A;  1TVR B;  3TAR A;  1N4L A;  2XLJ A;  2JLF A;  3QZ8 A;  1HBU B;  3MAQ A;  1NDL A;  3HM9 A;  4USJ C;  4DU7 A;  2HSE B;  2M8D B;  3MFH A;  1CS4 A;  1KP6 A;  4FXV A;  1IM4 A;  4DZ6 A;  4KPC A;  1HHQ A;  1JLF A;  4J37 A;  3R5D A;  5KFD A;  2N7C A;  4UOR A;  4F8R A;  1C0U B;  4DCP B;  1X7V A;  2AEF A;  1IWA A;  5EN1 A;  4HYK A;  3IAS 9;  3FDS A;  1LXN A;  3THT A;  3H2L A;  4F3Q A;  4F3O A;  2O5D A;  2YVS A;  3IAM 9;  2KZZ A;  1ZBT A;  4R8U B;  2BV3 A;  2BXJ A;  1AA1 B;  4CLZ A;  1HBO B;  4LSZ B;  1E33 P;  3MPW A;  4EO8 A;  4HHH A;  5F8N A;  3BO4 A;  4IOB A;  5IFM A;  4O0I A;  2AEJ A;  1LK7 A;  4H54 A;  5KG7 A;  4KIA A;  1TKD A;  1D09 B;  3J81 U;  4B9T A;  5F8J A;  5CQG A;  4P73 A;  3BGO P;  3SSQ A;  4CCH A;  2XMK A;  1VQ9 S;  1ZZF A;  3FFI B;  5MAO A;  4UZB A;  2GIF A;  2R42 A;  1LOU A;  1UZH A;  2VG6 A;  2QLW A;  2MQQ A;  3VGV A;  3DDI A;  4CLW A;  4ILR A;  2DPI A;  3VQS A;  2ADC A;  3HVT A;  2DHG A;  1M1K T;  3DHX A;  3F44 A;  1V3R A;  1FKO A;  1XMQ F;  3PFO A;  5KFR A;  2BQU A;  1NSA A;  3V4M A;  5GAH U;  4M5L A;  5LMU F;  2HVZ A;  2UVU A;  5HL7 Q;  2A6M A;  5IV4 A;  3N6L A;  4KTQ A;  3BDF A;  2ZBP A;  1IKW A;  4DWI A;  1KH9 A;  2H54 B;  1NJI T;  1RWW B;  3BSC A;  2XUL A;  3C6T B;  1T03 B;  1UMJ A;  1UVN A;  2W5Q A;  3HSD A;  4RUC A;  2JSX A;  2XHW A;  3D0H E;  4A8X A;  5F8I A;  2WVE A;  2UUW A;  3BQ1 A;  3W63 A;  1N36 J;  4RNN A;  4ZIW A;  1PJ7 A;  3RRG A;  4CIO A;  2J8A A;  4TN0 A;  4FS2 A;  2UUC F;  2WW4 A;  1NKE A;  1MNE A;  1XER A;  2VPX B;  1V5V A;  4M5G A;  4NLT A;  5D0H A;  3KLG A;  2RQK A;  2IDE A;  2XMJ A;  3NKR A;  3PHE A;  4Y0F A;  1RTD B;  5GAE I;  1S9E B;  1QVF R;  4X64 J;  1CPZ A;  3QGI A;  1X4D A;  2IC3 B;  1VDH A;  4XPC A;  3JB9 k;  2MPU A;  2AU0 A;  3HZG A;  2W8L A;  2ZDO A;  2MKS A;  5DET A;  3KMQ A;  2V68 A;  4YFU A;  3R1H A;  4P2M A;  3RBE A;  1RTI A;  2RIJ A;  1LXJ A;  2CZV C;  3ZZT A;  3CCU S;  1IR1 A;  4A8M P;  1RAH B;  4JI8 F;  4IFV A;  2AEM A;  4DR5 F;  2R2U A;  2N4C A;  1FVS A;  4PUO A;  1DLO B;  3P3D A;  4JI1 F;  4CLS A;  1C0T A;  2NXC A;  4PQA A;  2XS7 A;  4K2J A;  3ZFV A;  5DJB A;  1KLM B;  2CA9 A;  3ELH A;  3LGN A;  3W8G A;  1XMB A;  3H4D A;  3FKB A;  2AHO B;  1RCX B;  4GTZ A;  3VAK A;  2AZ1 A;  5ETO A;  2LDY A;  2P5V A;  3FRZ A;  2MZQ A;  2CXE A;  4FPI A;  2APO A;  4UOH A;  3U7J A;  2A3J A;  2ADB A;  1X9W A;  5J1N A;  3JYT A;  3FZ2 A;  2E1R A;  3B54 A;  3IO1 A;  5K8N A;  4DPO A;  1FHT A;  1SC6 A;  1LWF A;  3M8S A;  1LW0 B;  2DJW A;  2BRL A;  3M1V A;  4HHJ A;  2XR9 A;  4KH1 B;  2IAJ B;  2UXC J;  1GNK A;  3I6P A;  4OYP A;  5L0B A;  4LR9 A;  4ATN A;  3JQK A;  2K2P A;  4RWW A;  2VFV A;  3CVK A;  4OYM A;  2C1E B;  2RRA A;  2VU5 A;  4CYS A;  2C2Z B;  3JSB A;  1BXN A;  4LF1 A;  4CYU A;  5KFS A;  2BZ2 A;  3MK1 A;  3KOA A;  2EG2 A;  4A46 A;  4NMX A;  2RT3 A;  2BQR A;  5GAE U;  2HMI A;  2RDD A;  3UE2 A;  3UDC A;  3QRP A;  4M8L A;  3G87 A;  3IWL A;  2H3E B;  2MB0 B;  4Y34 A;  3GTY X;  4RW4 B;  2I9S A;  1SJR A;  4IG0 B;  2Z30 B;  1FDA A;  1TEL A;  2QA4 G;  1RT1 B;  2W2P P;  4ZVS B;  1UWB B;  4CH0 S;  1VRU A;  2PSZ A;  3RR7 A;  3HI9 A;  1AW0 A;  2HVE A;  5A8W B;  4LR8 A;  4DG1 B;  2K3K A;  4I64 A;  3DLB A;  1XK8 A;  4ES2 A;  5DRK A;  5KFQ A;  1SL2 A;  4DX7 A;  3V81 A;  3DRX A;  3W9H A;  5E0O A;  5K4P A;  3EZU A;  5D0R A;  4W90 B;  3PDN A;  3ET6 A;  4NZ7 A;  1D8Y A;  4M63 A;  2GAG C;  4JYA F;  2E7W A;  3DLJ A;  3T02 A;  1WC6 A;  4NXN J;  2E5L J;  2RML A;  3K5P A;  2OAU A;  2PI4 A;  3F56 A;  1CQM A;  4BWJ A;  1QAJ A;  5LXR A;  3D1O A;  3KTQ A;  4B3M J;  2QMX A;  2YKA A;  2KM8 C;  4FP9 A;  2U2F A;  3BM7 A;  4C9D A;  3HSZ A;  1FK9 B;  3NP5 A;  2P2C B;  1Q5Y A;  1RAE B;  3U27 A;  1U1O A;  4ECQ A;  2JJ4 D;  5GMK a;  1AUK A;  5FLX U;  2FPH X;  4I0W A;  4K4S A;  3QAT A;  5LL6 d;  1VHF A;  1B8J A;  1T3O A;  1S6Q A;  2BDP A;  3W2W A;  3N6N A;  1UEV A;  2MQN A;  5KXA A;  4DQP A;  2DGU A;  4J9R A;  3FC9 A;  2HGN A;  2LQJ A;  3UO0 A;  4LSL A;  1M0S A;  1RT6 B;  2G2O A;  1N2K A;  1Q8K A;  6FD1 A;  4ELU A;  4JI6 J;  4DL4 A;  5HAT A;  2CQP A;  1I3O B;  2E1C A;  4WU3 A;  2AZ3 A;  3HO1 A;  1RT3 A;  5D78 A;  4A4J A;  1AJB A;  3TAM A;  2W9B B;  4YY3 J;  3V6J A;  3AAW B;  5KFX A;  2K1R A;  2DXD A;  3PYE A;  1VQP S;  1S4E A;  1GXU A;  5KT3 A;  2UVV A;  1ZTT A;  1PAE X;  1FFW B;  5EGE A;  2VOO A;  1FRM A;  3CO9 A;  1HFE L;  5HRT A;  3HHL C;  4IR9 A;  1K1S A;  2X1A A;  4YDX A;  2CIM A;  4AQY F;  1GXT A;  1P9Y A;  2JVO A;  4M5D A;  1S49 A;  3UR0 A;  4B3T F;  4J9Q A;  4I68 A;  1DRZ A;  6FDR A;  5C42 A;  1F9F A;  4MYT A;  2RF2 B;  2KVQ E;  3KJF B;  1FEH A;  2V8G A;  1FRJ A;  3PRD A;  1RT2 A;  1B7F A;  2GJ2 A;  3CC2 S;  3K5O A;  2N3L A;  1S5Z A;  3I5C A;  3MF5 A;  2YX1 A;  2UU9 F;  3T6J A;  4DUY F;  2VV5 A;  4L3K A;  2ZH1 A;  4JI5 F;  3BGR B;  4P72 A;  4NEY A;  4OI3 A;  3T5K A;  1RJJ A;  3MUT P;  1DQ8 A;  2OIH A;  2B6A A;  3K0J A;  3FSI A;  1HNX J;  3VAF A;  3HKW A;  3PKM A;  4A8Q A;  2WZ1 A;  2OKQ A;  3R97 A;  2VOP A;  2W25 A;  2OO4 A;  3K2Y A;  1VYA A;  2XYP B;  3GII A;  1FNM A;  2LU1 A;  1IBK F;  1S48 A;  5EWG A;  2CPE A;  3GE9 A;  2DY9 A;  1TV6 A;  4OYB A;  3CJ2 A;  4F4W A;  4DL5 A;  4Y28 C;  5K20 B;  3CD6 S;  1HNV A;  1FI4 A;  5E3A A;  1P6T A;  2CJK A;  4DN9 A;  2IM0 A;  2MQL A;  3FBF A;  3MM5 B;  3BGL A;  4KPY A;  3HFV A;  4ZPW R;  3DHW C;  4DF4 A;  4GO7 X;  4OX8 A;  4QCL A;  5BYS A;  2IRX A;  1ELY A;  4DEZ A;  5JUM A;  2HQD A;  4K50 A;  4RNF A;  2AJ1 A;  3TVZ A;  2F65 A;  5D8H B;  1YZ6 A;  4CLF A;  3EXY A;  2GJI A;  4O3Q A;  1KH5 A;  2O67 A;  1ANI A;  3BR9 A;  2W2N P;  4IO1 A;  3HMJ G;  1VJQ A;  1L3K A;  3G6V A;  4Z7C A;  1U02 A;  1EQJ A;  4IOC Q;  2XRG A;  2A10 A;  4ED8 A;  1KHV A;  1VMB A;  2RKI B;  2ZH2 A;  4MJK A;  3W66 A;  4MIA A;  1EW8 A;  3W62 A;  3MUR P;  4NYO A;  4URQ U;  3C46 A;  4IRD A;  2VF3 A;  5L1I A;  4HAC B;  1H73 A;  1PYO B;  4C4W A;  3M30 A;  1YJR A;  3RRH A;  1J5E F;  1SHN A;  2CQ3 A;  4RPF A;  4ED3 A;  2BBE A;  1M5V C;  3EM1 A;  2DGT A;  1AZS B;  5E3C A;  2VD3 A;  3RU0 A;  3BDG A;  4RW8 B;  2HFS A;  1FWK A;  4LQ3 A;  1M1G A;  1D9F A;  1WEX A;  1SH3 A;  3OL6 A;  2J9E A;  2KHD A;  2EFO A;  3QWU A;  4A48 A;  4LF8 J;  1N54 B;  4N56 A;  4GTW A;  3GR0 A;  4DR4 F;  2VC1 A;  5B09 A;  1ZAV A;  5AXN A;  4QYZ K;  1ED9 A;  3DXB A;  1IBC B;  4C8O A;  2YNH A;  4K4W A;  4XTT A;  2E5H A;  2P9G A;  4K4T A;  2CG4 A;  1TMJ A;  2BW2 A;  2FJB B;  2WON A;  4X62 F;  2VDH A;  2BRK A;  2DHH A;  2B9Y A;  3MMC B;  4ELT A;  5HN0 A;  4ZG6 A;  4EZ6 A;  1ROF A;  3L7O A;  1YBU A;  5K14 B;  2QLJ B;  2PD1 A;  4K4Z A;  2MQM A;  3NKO A;  1GMW A;  5HP1 A;  3MM8 A;  2QA2 A;  2ABY A;  3MCO A;  1V3S A;  4LJM A;  4I6A A;  2J6U A;  3TQ1 A;  3RW6 A;  3J80 Y;  4CH7 A;  2D41 A;  1EHW A;  3AOD A;  2HVH A;  4NA2 A;  4DCO B;  2OPR A;  4QQB A;  3RB6 A;  4LVN P;  2CJB A;  3AB2 B;  5F3T A;  3PIP Q;  1S1T A;  1JQG A;  1RT7 A;  2HHW A;  3G8Q A;  3OXF A;  4Q8F A;  2ZE2 A;  1JLA A;  2B43 A;  2MY8 A;  5AE3 A;  1ZM3 A;  5DGA A;  1FKA F;  2G9Y A;  2VJU A;  3FMB A;  2YY3 A;  3Q83 A;  3G2X A;  4I2P A;  3IR5 B;  3NKP A;  1R8C A;  3CME S;  5J2N B;  1KTQ A;  5D15 A;  2HGL A;  2FJX A;  1H2V Z;  1U4B A;  4PG6 A;  3D5M A;  4MH8 A;  1ICE B;  3CW2 C;  2ZHB A;  3PKY A;  2GVZ A;  1F0X A;  4PG5 A;  1ZET A;  2UXB F;  1VR6 A;  4K5R A;  2CNN B;  1Y7P A;  4G1Q A;  1T9T A;  4ZCK A;  2V34 A;  4ZA1 A;  1N5Q A;  1IXK A;  2YH1 A;  2A0F B;  4OZ1 A;  4Q7A A;  4CRJ A;  2RSQ A;  1RWN B;  2YWK A;  4MFB B;  2FVP A;  4F0H A;  3MPY A;  3NBP A;  3TJA A;  2LQ9 A;  1ZEB A;  1EAR A;  1FX4 A;  5LOQ A;  4J9O A;  3I0S A;  2FTR A;  1WDT A;  5DDP C;  3AJ1 A;  2XMU A;  3IGY B;  1HBM A;  4OJH A;  1SB6 A;  3I82 A;  2IJR A;  3SCI E;  2GZO A;  1Q86 T;  1N34 F;  7FD1 A;  4MKY A;  5KFP A;  3UDV A;  4WXO A;  1H3D A;  3KK3 B;  5KG3 A;  2XBP A;  2OTJ S;  3P6Y C;  2YTC A;  2GQC A;  4N77 A;  1KOH A;  1MN9 A;  1WDD A;  1R43 A;  5DLW A;  1G1X A;  4C8Y A;  5KG5 A;  4ED6 A;  1CJK B;  4XIU A;  1JXE A;  3LGH A;  3UQS A;  2JOQ A;  1C1B B;  1Q8L A;  5D4N A;  3SV4 A;  2ZH7 A;  4TQS A;  2XNQ A;  3J80 U;  1ZOT A;  1RA7 A;  1CJU A;  3MMB A;  2BAC A;  3MOJ B;  4FDJ A;  1DAR A;  4DQI A;  1TUG B;  1B64 A;  1MWQ A;  2LQB A;  5AE2 A;  1YDL A;  4I2Q B;  2X98 A;  2BA9 A;  1P1T A;  2B9W A;  2RNE A;  2MGZ A;  3AD8 C;  4NLU A;  2FLP A;  2LU2 A;  1KC8 T;  3K57 A;  1KKH A;  3H0P A;  4LFB F;  2CQB A;  5IM0 B;  5A8K B;  2ROG A;  2W4P A;  2B5J B;  1BC6 A;  4NWX A;  5GAG I;  2NPI A;  3EGN A;  4DV2 J;  1ZM4 A;  3HHE A;  2H4Y B;  3MEG A;  5KFK A;  4URG A;  2GA7 A;  2HHH F;  3VVT A;  4FDI A;  2GCF A;  1S4F A;  2WOM A;  1YGY A;  1LV5 A;  2H65 B;  2C3Y A;  3S6E A;  2Y1I A;  4F2S A;  3U1N A;  3MK2 A;  4CXS A;  2RQ4 A;  2RDJ A;  3C15 B;  1SIW B;  4R0J A;  1JIH A;  4OIX A;  3T1H J;  2CPD A;  2BYC A;  2MKJ A;  1ALJ A;  1XMO F;  3AA8 A;  4ANE A;  2QV6 A;  2YKM A;  5FD1 A;  1K47 A;  2ZM6 J;  3EDR B;  2E1P A;  1Y3K A;  1WEL A;  4DV6 F;  3BS9 A;  1KFD A;  1XQI A;  2FGO A;  3Q2S C;  3OUY A;  3DMJ A;  1ZAW A;  4ED5 A;  4RNM A;  5J2M A;  2BJ7 A;  5DQG A;  2DTJ A;  1G3O A;  1S1W A;  2I5J A;  3D6T B;  2BKP A;  1YX2 A;  3DLK B;  4CI0 B;  5D0E A;  4ZCM A;  3IN5 A;  3RBZ A;  1Y3J A;  2F7V A;  2XMV A;  5H9E K;  5CAB A;  3SCJ E;  1R6Y A;  4KGM A;  1X4B A;  2EBE A;  2EFP A;  2V2K A;  4ZLP A;  4WP8 A;  1A6L A;  4R5P A;  1BQN B;  1UP1 A;  5B0C A;  4QYR A;  1X4C A;  1CG2 A;  4OQJ A;  2R7U A;  2UUA F;  4NA3 A;  3PW2 A;  2JDJ A;  5HBM B;  4LFC F;  3MAA A;  4DUT A;  1X5O A;  1D0E A;  3HFK A;  1C4C A;  4UST A;  1OPI A;  1KOO A;  1KLN A;  4M94 A;  2KDO A;  3S7R A;  3IWN C;  3K7R A;  2HG4 A;  3N79 A;  2DVI A;  4P7T A;  2HLT A;  2Q43 A;  3GZ7 A;  2JX2 A;  3UFC X;  5F8M A;  4WTY A;  4TU8 A;  3R7N B;  2WW8 A;  4GTX A;  1SUQ A;  5HJX A;  5GAG U;  4U6P A;  2B4P A;  3J7Z 5;  4KV8 A;  2NUU G;  3RRK A;  9RUB A;  2LXU A;  4DPW A;  2PEB A;  3M2R B;  2FJA B;  2IY5 B;  3WIU A;  5KFF A;  1YHQ S;  5KFI A;  3UNY A;  2YNG A;  4JI2 F;  4DQS A;  4Y3C A;  4FKX A;  3DOK A;  3VTI A;  1U6B A;  1HI1 A;  2VBX A;  4FPR A;  1C2P A;  1H72 C;  3NG8 A;  2DRD A;  2XCA A;  5ETP A;  1F1B B;  2NXU A;  4FS1 A;  2KYZ A;  2R2S A;  4O3R A;  4MIW A;  2IYG A;  4ZDN A;  1HWI A;  4USV A;  3CJK B;  2FDN A;  2BOA A;  4ANC A;  2NQP A;  4RW6 A;  4Y2I A;  3UDL A;  3TAP A;  4RUA A;  2ACY A;  3CF5 Q;  3CIZ A;  2YX4 A;  1UFK A;  1OWX A;  2KXN B;  1Q4R A;  2MZS A;  4UOP A;  5DG7 A;  1HD1 A;  4MY4 A;  4O4R A;  4AUK A;  1XN9 A;  2BR0 A;  2IYI A;  1K8A T;  3NKN A;  3G8T A;  3MR2 A;  1IKX A;  3OTE A;  3CXC R;  2HQI A;  1JLG A;  5AJ3 J;  3ILO A;  5INH A;  4KO0 A;  4ZG9 A;  1HPZ B;  4UUX A;  4CTA A;  2G1D A;  3PY8 A;  4OZ5 A;  3I0R A;  3L09 A;  4DSI A;  2G1H A;  4X4Q A;  3TYT A;  1SQF A;  5FJ4 A;  2NRE A;  4L76 A;  2OD4 A;  2DB1 A;  4TN2 A;  2RQC A;  2VFR A;  2BJ1 A;  1MU2 B;  2WHO A;  2CFX A;  5KG0 A;  1RDR A;  2H48 B;  1X4F A;  2D3U A;  1T9V A;  4N8O A;  1UA0 A;  1UL3 A;  2PEH A;  2OEM A;  1UZD A;  4QWC A;  3PEH A;  2GHP A;  1H74 A;  3MM6 A;  4J9K A;  4J90 A;  2PA8 D;  4WYL A;  2WSF C;  5J1E A;  3GCW P;  4DSK A;  3D7S B;  3MED A;  4DU8 A;  3H40 A;  3VAJ A;  2W4D A;  4ES3 A;  2FB0 A;  2E9R X;  1ITP A;  2HKE A;  1XMQ J;  1RWV B;  3DKD A;  3R3T A;  4YN3 B;  4WFZ A;  3QSI A;  5LMU J;  3MCN A;  5HQM A;  1FJG F;  4PEO A;  1B0P A;  1HIY A;  4ECY A;  2WAQ D;  4UZC A;  2W5S A;  3ZZ0 A;  3ZNU A;  5FDL A;  7FDR A;  1SL0 A;  1NHV A;  2HW3 A;  2NYH A;  3BO2 A;  3QRR A;  3IR7 B;  4Q45 A;  2QLF B;  4F0K A;  2HNZ B;  2D74 B;  1FVQ A;  2KM8 B;  2HAI A;  3HHK A;  4ZKA A;  2R7Q A;  3DRP A;  4KHR A;  1DQ9 A;  1PKU A;  1N6Q B;  2XYG B;  4DPT A;  4PYA A;  2BE2 B;  4X64 F;  3DGP A;  4UT4 A;  2QZ8 A;  5J1P A;  1CLF A;  1TR0 A;  2IPO B;  3FJ2 A;  5HLF B;  4L72 B;  2FZC B;  5ETR A;  4P10 A;  4C6A A;  3Q8Y A;  2ZBI A;  1U1R A;  4DL3 A;  3OR2 B;  3LWM A;  2JEJ A;  3MMJ A;  1O0P A;  2AJQ A;  3A3N B;  2MKI A;  1NJX A;  4ID5 B;  2VA3 A;  1FRI A;  1DTT A;  2VZ9 A;  1CC7 A;  2J7K A;  2HWI A;  2YWG A;  3T5H A;  1S9G B;  4Y6I A;  2DNG A;  5DLG A;  2ZH8 A;  1TUV A;  2J6S A;  5A8R B;  1U0H B;  4PG4 A;  2BQ3 A;  4DFJ A;  5IT0 A;  3D1Q A;  5JVG Q;  3A3O B;  4BLG A;  5IZH A;  4PWD A;  3Q8R B;  2DT9 A;  3KLV A;  4JI8 J;  2YKN A;  3ZTQ A;  5KT7 A;  4DR5 J;  1IJE B;  2ZKT A;  1VIS A;  1EB0 A;  3C66 A;  2BE7 D;  2EW9 A;  3GSI A;  4JI1 J;  1HQA A;  3W7B A;  4GC6 A;  5DDQ C;  2XZW A;  4RW7 B;  4B9V A;  3R9L A;  3CJ3 A;  2F9D A;  4QWA A;  4NI2 A;  1UA1 A;  1T11 A;  3MR5 A;  2GGP A;  1P9Q C;  1VBZ A;  1HQU A;  1T9X A;  5RUB A;  2NCK L;  3HXM A;  1EET B;  4ETX A;  4L3N A;  2DNL A;  3ILI A;  1XWL A;  2D9O A;  2A18 A;  1B3T A;  1RU1 A;  2IUC B;  1FES A;  3WX4 A;  4ZIT A;  4DS5 A;  2IBK A;  2N7Y A;  4ECZ A;  1T7P A;  4TY8 B;  1ZH5 A;  2QMU B;  4UW2 A;  2D1C A;  4C3L A;  1O98 A;  2YX7 A;  3QFH A;  2V8H A;  5DDR C;  1CC8 A;  3OL7 A;  2GO8 A;  3C14 B;  3RTV A;  4I1T A;  4ES1 A;  3K8V A;  1FKP B;  3U1L A;  4JBC A;  4WK1 A;  4DFK A;  1S6U A;  4DPX A;  2PMW A;  3TZX A;  2AQ4 A;  3Q86 A;  4TVA B;  3CMA S;  4WE1 A;  1U25 A;  2M9K A;  4O44 A;  3PG9 A;  1J5O A;  1LWC B;  3Q2T C;  1QY7 A;  4ZHR B;  2LKZ A;  3OTC A;  4CLT A;  3MM9 B;  2IM2 A;  4JV2 A;  3MAH A;  4KHM A;  3DLL Q;  4MK9 A;  1TL7 A;  1BUX A;  2VBZ A;  2RD5 C;  2HFN A;  1LW2 A;  4HH0 A;  1H6K X;  1OSD A;  2W5T A;  1N8R T;  2K7K A;  4WII A;  1T8E A;  4ELV A;  3L9Z A;  2ZBR A;  3KLI B;  4NLO A;  4NXN F;  1D9D A;  3MD1 A;  2J7U A;  3CDW A;  3M8R A;  3PX4 A;  2Z0G A;  1QE1 B;  3UCZ P;  3NOG A;  4JP8 A;  5F8H A;  2FZG B;  5HMZ A;  2FHO B;  1V6H A;  2EFQ A;  1Q81 T;  3TJ8 A;  4B3M F;  1H2T Z;  3MMA B;  3IRW P;  2XSF A;  5IV3 A;  4U8Y A;  3G6E S;  2WVC A;  5L1L A;  2QEX S;  1PBA A;  2M70 A;  2GVD A;  2GLQ A;  2V4R A;  1R8A A;  5HAO A;  2DH7 A;  5KFZ A;  4CXK A;  4LQ9 A;  2FIU A;  4V1A k;  2XCP A;  5J2P B;  2C42 A;  4B9M A;  5KFU A;  3A1Y G;  2XM3 A;  3KUH A;  2HQ3 A;  4HEA 9;  5LJ3 Y;  5F9L A;  2VFU A;  2XWY A;  4P74 A;  4JI6 F;  3ICL A;  1HNI A;  3N6M A;  4ER8 A;  4HDG A;  4F4X A;  2RRB A;  4HT5 A;  1RYR A;  3PR5 B;  2DEJ A;  2GML A;  4B3R F;  4U95 A;  4OL8 A;  3KMS A;  5KFH A;  4RR5 A;  1KH7 A;  4H4O A;  2CG8 A;  3D54 A;  2KT2 A;  2RJZ A;  5CXT A;  3WX8 A;  1IR2 A;  3G71 S;  1CUL B;  1MN7 A;  5D6G A;  4MKB A;  3CPW R;  4LR2 A;  4XDD A;  3BKF A;  3LP0 A;  2OPQ A;  1WHX A;  5L39 A;  2Y3Y A;  5T7L B;  4NRU A;  2ZZT A;  4HKQ A;  4U7C A;  2HRT A;  4AQY J;  3PVX A;  1WHW A;  3SDE A;  4B3T J;  2HND B;  1KVI A;  1VK3 A;  2OFG X;  1DAX A;  2LCW A;  3DLG B;  4UTG A;  2OPP A;  3I9Z A;  3UVJ B;  2EFN A;  2DNP A;  3GSD A;  3EPI A;  3DOL A;  2C28 A;  3RUB L;  3M32 B;  3PXG a;  5L1J A;  3BH6 B;  1RTZ A;  3CTR A;  2NZ4 A;  1RWM B;  2E5G A;  2CDR B;  3CC4 S;  1R31 A;  3KHG A;  2UU9 J;  4DUY J;  1HNX F;  2HFV A;  4YB7 A;  4JI5 J;  1RU2 A;  3RAM A;  3V4I B;  2MZJ A;  3ZTO A;  1ALK A;  4NWJ A;  4BC7 A;  4DV0 F;  3FSX A;  4OYI A;  4OZ0 A;  1GT8 A;  3A52 A;  3NEK A;  4F4K A;  1NND A;  3KLF B;  3DU6 A;  3KLH B;  2AX0 A;  2DRB A;  2DNZ A;  1VOM A;  2MXY A;  3PO4 A;  1TVR A;  4I4B A;  4DR3 J;  1HBU A;  3FQK A;  3O5T B;  1JMT A;  1P27 B;  3K8W A;  2Z58 B;  4QW9 A;  3H42 A;  3SV3 A;  2HQC A;  3WC0 A;  2XG8 A;  1E3C P;  2ZNZ A;  4OHV A;  1I94 J;  3KUG A;  1C0U A;  1IBK J;  1NKC A;  1JJC B;  2C3P A;  3M9N B;  5HMY A;  2Q6C A;  2EI5 A;  3LA0 A;  4B9S A;  2W7O A;  4DI6 A;  1M5H A;  2GIR A;  4M5K A;  4R8U A;  5F0W A;  2X3D A;  5BXI A;  2UUB J;  3IS9 B;  1HBO A;  2WRM A;  4F04 B;  1VQ4 S;  4CO1 A;  4BS2 A;  1PGZ A;  4DS4 A;  2H1Y A;  4IRK A;  2VPW B;  1LNQ A;  4ECS A;  1NK7 A;  3Q8U A;  4PXB A;  2I6W A;  3CDB A;  4I6W A;  1RAJ A;  2GIQ A;  4U7U D;  1S0O A;  2HHT A;  5F3Z A;  4ZVH A;  1R27 B;  1S57 A;  2EC0 A;  3T9N A;  2JFK A;  1HI0 P;  1RHJ B;  1PIL A;  2N82 B;  4ZPC A;  4C8Z A;  3VAI A;  4NCG B;  4RX6 A;  2H5E A;  2F8E X;  4MHX A;  4KFB B;  3KJQ B;  3JQM A;  1CEZ A;  2V4J B;  3P5B P;  2KTQ A;  3H7H B;  3I56 S;  2CZ4 A;  4RL1 A;  1YBA A;  3IDD A;  2AP6 A;  1VQL S;  1U0S A;  2W2Q P;  3T3F A;  1U6F A;  1YK9 A;  5E3R A;  2DR6 A;  3DOM B;  4OLO A;  1S6P B;  3SFG A;  5AXK A;  1Q95 G;  5KFW A;  4QWB A;  3GU0 A;  1S99 A;  3C6T A;  4JV0 A;  5E41 A;  1T03 A;  4M5I A;  4DR4 J;  1JNR B;  4JI7 F;  4O3O A;  1Q79 A;  3DCA A;  2Y1J A;  3DYC A;  3R6G B;  3GV8 B;  2QL7 B;  3EGW B;  3ZZP A;  3OR1 B;  3T00 A;  3E01 B;  5LSO A;  3ISN D;  4YQW A;  1S1U B;  2DPJ A;  1HBN B;  2R7R A;  1WEZ A;  4LRD A;  3RAQ A;  3M7V A;  2HEK A;  4EWT A;  2IFY A;  3M6W A;  1K9M T;  4DUZ F;  2DIT A;  3JAM U;  1MWZ A;  3N9U C;  1RTD A;  3PAC A;  5LM7 E;  1L3S A;  2NXN A;  1S9E A;  4FVC A;  1RGV A;  4DOZ A;  2IC3 A;  1JKH B;  1FFG B;  1TKZ B;  1MW7 A;  1TZ0 A;  1ZTW A;  3HVR A;  1RBL A;  1HWJ A;  1NPP A;  2XY6 A;  4WPA A;  3IWX A;  4DL7 A;  2LEB A;  1R3N A;  1NH8 A;  2M52 A;  3TNV A;  2VQE J;  4DDF A;  5DG9 A;  2CQG A;  4ZVO B;  2V50 A;  3KLE B;  4WKY A;  1YKW A;  1WI6 A;  1A0O B;  2RVJ A;  3ZZZ A;  4OJ3 A;  1DLO A;  3OXL A;  3K5M A;  1FSU A;  5C66 A;  4TLR A;  2F8H A;  2G0J A;  3VCD A;  1KLM A;  1FFS B;  1A7G E;  2ASJ A;  3PHT A;  5E3P A;  5L1K A;  4WKR A;  3W9I A;  2ZHA A;  5ITH A;  1ZPW X;  2GMH A;  1WOO A;  1B7Y B;  1RAA B;  1VQ7 S;  3I32 A;  3VGS A;  3FBC A;  1U47 A;  5D3G B;  4C7Q A;  3HSJ A;  1B0V A;  4PRF A;  3MEC B;  1IVZ A;  2OSQ A;  2UXB J;  4GKK F;  1VQO S;  3QIP B;  2JEG A;  1LW0 A;  5K8M A;  1S1X B;  1UEU A;  4RWX A;  2IAJ A;  1T94 A;  2F3J A;  3ZO7 A;  3NNH A;  3A8J A;  3QJP A;  2FVC A;  2HBQ B;  5A6W A;  2QMW A;  1KHJ A;  2VB6 A;  2CZ9 A;  4ZCL A;  1SL1 A;  1JXL A;  3T1A A;  4DR7 F;  1HI8 A;  4USK A;  3EYZ A;  5HQL A;  1LKZ A;  1UPM B;  4LR7 A;  3LP1 B;  3UCG A;  2FZK B;  1BQX A;  3H2U B;  3BQ0 A;  1NSQ A;  5J2Q B;  2VQF F;  2CNO B;  1TMM A;  1N34 J;  3SFU A;  2ZD1 B;  5GRR A;  3A4T A;  5E7O B;  3UN5 A;  3QSY B;  2OD6 A;  2E5I A;  4RW4 A;  5AE1 A;  3EIC A;  1PJ6 A;  2OHD A;  3IBF B;  5C5J A;  2M8H A;  4IG0 A;  2YNI B;  3N4W A;  1W7W A;  5KOX A;  4OHY A;  4ZVF A;  3W2V B;  1RT1 A;  3QQC D;  4U96 A;  1UWB A;  2DHX A;  2ASD A;  1UKU A;  1HNZ J;  4UOC A;  4JV1 A;  5A8W A;  3OHB A;  2IBO A;  1TKT B;  3LH2 S;  4DG1 A;  3VZI A;  2HS3 A;  1KVK A;  4PG7 A;  3CCS S;  2R7V A;  1PC4 A;  3TVK A;  4V19 J;  3A8K A;  3PRV A;  3BO3 A;  3A3P B;  1OO0 B;  1NJY A;  4A8Y A;  4QU7 A;  1B70 B;  3OVA A;  3IG1 B;  1M5P C;  4GRS A;  3VAM A;  3NOC A;  2M88 A;  4Y2C A;  4Z2X A;  1Y0H A;  1NK5 A;  4PG8 A;  1U1L A;  2QO3 A;  4ZP9 A;  3LP2 B;  5IJS A;  5KG4 A;  4RUH A;  5KFY A;  3CJS A;  3S1T A;  2CJA A;  1FK9 A;  4TY9 A;  5LSL A;  4J7C A;  2AJF E;  1U1Q A;  4J9V A;  1T9U A;  2D69 A;  2HHH J;  4CWB A;  3KNA A;  5KFE A;  3TP2 A;  4ENO A;  1O99 A;  3TZW A;  1MML A;  3DRY A;  2W5R A;  4K5S A;  3IGN A;  2K7J A;  4LF7 J;  4HTJ A;  4DJB A;  3Q23 A;  1P8G A;  4YUD A;  4ZCI A;  3TUI C;  1UWA A;  2FVS A;  4UY8 5;  2VFT A;  3O8W A;  1U7L A;  1XMO J;  3SSR A;  3OVB A;  2CWK A;  1RT6 A;  5CD4 A;  1Y5I B;  3I31 A;  4GKJ F;  1X8D A;  4WZM A;  4DL0 C;  3TX0 A;  1REG X;  2I0X A;  2W01 A;  3AOB A;  4ID8 A;  4ILM A;  2W9B A;  4O0N A;  3H90 A;  2Z56 B;  1VS3 A;  3KG1 A;  4ECW A;  4DV6 J;  2LXF A;  3KNG A;  1YJN S;  2AW0 A;  5HK4 A;  2HS4 A;  2MEW A;  4PXE A;  5ETL A;  1RIS A;  4IH7 A;  2ZH4 A;  4DPY A;  4TYB A;  3RB3 A;  2J0S D;  3OJS A;  1X0P A;  2XHC A;  2MTL A;  3X1L B;  3HVA A;  4BC9 A;  2BKN A;  2YKQ A;  1EJ7 L;  4DHV A;  3NKY A;  2RF2 A;  1X31 C;  1YG0 A;  4C48 A;  2UUA J;  1RHK B;  1RUS A;  4LFC J;  1U2C A;  3RYL A;  1Q78 A;  3ZZR A;  2BAN B;  4B08 A;  4U8V A;  3BN4 A;  3J7A N;  4GVB B;  5L8R C;  1XEZ A;  2MJU A;  2J8S A;  3BGR A;  2IIH A;  4ZLL A;  4X4V A;  3GYX B;  4MYU A;  2B8P A;  3UD5 A;  2KJW A;  4KH0 B;  4KRW A;  3A8I A;  2X7I A;  3Q8V A;  5L9X A;  4WFB Q;  4P9S A;  2VHG A;  2M5Y A;  1HA1 A;  1RSC A;  5KT2 A;  2DO4 A;  3TAQ A;  4K4U A;  3M6X A;  5C2C A;  4DV3 F;  4QWD A;  3H59 A;  3P45 B;  4J91 A;  3RR8 A;  4A8O A;  4KKO B;  1R0A B;  1WTB A;  1YJ9 S;  2FLN A;  2MLZ A;  5I3Q A;  3PIO Q;  2HFU A;  2GQQ A;  2R2R A;  4IYQ A;  4KAV A;  1UW4 A;  4ZMM A;  4Y00 A;  4IRC A;  1WKJ A;  2CPJ A;  1H7W A;  4E98 A;  1D9A A;  4X66 F;  3EGZ A;  3MM5 A;  1XR5 A;  1TK5 A;  4HTI A;  4H4M B;  2ZZN A;  3JTN A;  4OI6 A;  2DGV A;  2VA2 A;  3POT B;  3MZI A;  1SH0 A;  1AJD A;  3QPI A;  1N5Y B;  5AJ3 F;  2HS0 A;  3CB4 A;  4LF5 J;  5DQI A;  3QGG A;  3OTB A;  3CD7 A;  4QYZ J;  1T05 B;  3FCV A;  3VAH A;  4YB1 P;  2W1B A;  4WXW A;  1V5I B;  2V94 A;  4N76 A;  5GOV A;  1XIQ A;  5U47 A;  1KQK A;  3ILJ A;  1RTJ B;  2ILY A;  5KG2 A;  5KG6 A;  2RKI A;  3VGU A;  3RW7 A;  2VQR A;  3JSY A;  3VAL A; 
#chains in the Genus database with same CATH homology
 4CXU A;  4KJG A;  5DLW A;  4LR7 A;  1EW8 A;  5L0E A;  1KH9 A;  3NKO A;  4B56 A;  4LRA A;  3KD8 A;  4CYS A;  4CXS A;  3MK2 A;  3WAY A;  4UOP A;  3T02 A;  4MY4 A;  5EGH A;  3ED4 A;  4ZG7 A;  3NKQ A;  1ANJ A;  1ELX A;  5IJS A;  4KAV A;  4UPL A;  3NKN A;  2W5Q A;  5EGE A;  1E33 P;  3TG0 A;  1SHN A;  1ALJ A;  1FSU A;  3DYC A;  5HRT A;  2GA3 A;  2W5V A;  4UPI A;  3DPC A;  4KAY A;  3MK1 A;  1ALK A;  4NWJ A;  5C66 A;  2W5T A;  1ELZ A;  3E2D A;  5DLT A;  5GRR A;  3BDG A;  3A52 A;  3T01 A;  5INH A;  4MIV A;  4ZG9 A;  3UN2 A;  3UN5 A;  4GTX A;  2IUC A;  3T00 A;  4LRB A;  3NKM A;  4LRF A;  1ED8 A;  4FDJ A;  4ZGA A;  3M8W A;  3WBH A;  3BDG B;  2RH6 A;  3M8Y A;  5AJ9 A;  1URA A;  1E2S P;  2IUC B;  1N2L A;  1ZED A;  3WAV A;  1E1Z P;  3SZZ A;  5LQQ A;  2ANH A;  1KH7 A;  4LRC A;  3OT9 A;  4TN0 A;  2W5S A;  2X98 A;  1AUK A;  1ZEB A;  1HDH A;  4LRD A;  4YR1 A;  1AJD A;  3TWZ A;  1SHQ A;  4GTZ A;  1O99 A;  4LQY A;  3M7V A;  1KHK A;  1K7H A;  3SZY A;  1ALI A;  2IFY A;  1HJK A;  2D1G A;  2W5R A;  3MK0 A;  4GTW A;  5L0K A;  1ELY A;  1B8J A;  3IGZ B;  5IJQ A;  3UNY A;  3IGY B;  1EI6 A;  1ED9 A;  5LRM A;  1EJJ A;  1E3C P;  4QAX A;  4UPH A;  1ALH A;  1URB A;  3NKR A;  4LR2 A;  4UOO A;  4MHX A;  2GSU A;  1O98 A;  1Y6V A;  5KXA A;  2GLQ A;  1ZEF A;  2ZKT A;  3NVL A;  3B5Q A;  4KJD A;  4UOR A;  1Y7A A;  4N7T A;  3UO0 A;  3BDH A;  1HQA A;  4LR8 A;  1KHL A;  1KH5 A;  2G9Y A;  5LRN A;  2XR9 A;  4NWX A;  3IDD A;  1ANI A;  4CXK A;  3CMR A;  3TX0 A;  2W5W A;  4KM4 A;  1AJC A;  5GOV A;  5DLV A;  3UN3 A;  1N2K A;  4CYR A;  2GSO A;  4UPK A;  1EW2 A;  1EW9 A;  3WAX A;  1KH4 A;  5L0B A;  4LR9 A;  1KHJ A;  3NKP A;  2QZU A;  4GTY A;  5TJ3 A;  4LRE A;  3LXQ A;  1EQJ A;  3Q3Q A;  4ZG6 A;  1P49 A;  5K4P A;  3M8Z A;  1AJB A;  2XRG A;  3WAW A;  1KHN A;  5LIA A;  3BDF A;  4FDI A;  2W8D A;  2VQR A;  1AJA A;  2W8S A;  2GSN A;  2W5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...