4LR9A

Phosphopentomutase s154a variant soaked with 2,3-dideoxyribose 5-phosphate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTAADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 138
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lr9A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr9A01
3UN2A 1KH4A 4LR9A 2GLQA 3T00A 1ED8A 3WAVA 3MK1A 5DLTA 4MHXA 3NVLA 4QAXA 5LIAA 4GTWA 4FDIA 1B8JA 3DYCA 3UN3A 4YR1A 1ELXA 3OT9A 2D1GA 1E2SP 1AUKA 1ZEBA 1SHQA 2W8SA 3WAYA 4B56A 4UPLA 5GRRA 4UPIA 3NKPA 4NWJA 4CXUA 3CMRA 4MIVA 3WAXA 1P49A 1Y7AA 1ELYA 3A52A 4ZG6A 4ZGAA 3TG0A 2W5TA 4UPHA 1SHNA 3IDDA 2XRGA 1EW9A 2W5QA 3M8WA 3TX0A 1ZEDA 2XR9A 3KD8A 1K7HA 3NKRA 5LRMA 4KAVA 1HDHA 1O99A 2IUCA 3LXQA 1ALJA 5IJSA 3M8YA 1E3CP 2GSUA 1AJAA 3ED4A 2W5SA 4MY4A 4LR7A 2IFYA 4CXSA 1Y6VA 3UO0A 1KHLA 1O98A 4FDJA 3T01A 3MK2A 5KXAA 4UOPA 1EW8A 1EW2A 4LRCA 2ANHA 4UOOA 3T02A 1ANIA 4LR2A 4LRBA 2W8DA 4CYRA 1EI6A 3BDGB 4UORA 1ALKA 2GSOA 1EJJA 1URAA 4GTXA 2GA3A 3M7VA 1E1ZP 2W5RA 4CXKA 2GSNA 3UN5A 4LREA 3WAWA 4LRDA 3UNYA 4KJGA 1URBA 5INHA 4GTZA 5EGHA 1FSUA 5L0BA 3IGYB 3Q3QA 4CYSA 1KHKA 1KH5A 4KJDA 5EGEA 3TWZA 4TN0A 4N7TA 1N2LA 3BDGA 4KAYA 1EQJA 5HRTA 1ED9A 3NKOA 1HJKA 5TJ3A 3IGZB 1ELZA 4LRAA 1KH7A 3SZYA 3BDFA 5IJQA 4ZG9A 3B5QA 3NKNA 1HQAA 1ALIA 3E2DA 4LRFA 1E33P 2W5WA 4KM4A 3DPCA 1KHJA 1KHNA 5LQQA 2IUCB 3MK0A 1ALHA 4UPKA 4LQYA 5C66A 2G9YA 5LRNA 5L0KA 1N2KA 4GTYA 1ANJA 2RH6A 3WBHA 4ZG7A 3BDHA 2QZUA 5DLVA 2VQRA 5AJ9A 2W5VA 2W5XA 1ZEFA 1KH9A 5GOVA 1AJBA 3NKMA 4LR8A 2X98A 5K4PA 4NWXA 5L0EA 3NKQA 5DLWA 1AJDA 1AJCA 3SZZA 3M8ZA 2ZKTA
chains in the Genus database with same CATH superfamily
1EKSA 1KQFB 4LF5J 1RACB 2WAQD 2YPYA 3R7BB 3GMGA 3DU5A 3KHGA 1VIXA 3KJFB 3MR2A 2FHJD 3MR7A 3IG1B 4DV0J 4FYDA 2R4FA 3ULHA 2UVRA 4PXBA 5B0BA 5F41A 1L3TA 4CO0A 1C2PA 4C11B 2Z2YB 2W2MP 4X62J 4CXSA 1R89A 2F63A 2FJBB 4YS2A 1X4EA 4ZIVA 2MZTA 4KKOA 4GKKF 4TXSA 4JI0F 5IT0A 4DSJA 1RA7A 3RU0A 1HNZF 5IC6B 4OV1A 2XLJA 1H7XA 3SQOP 1CJVA 1UVKA 1ZBTA 3BQ1A 4LFCF 1LW2A 1ZM4A 4PXEA 1I6JA 3B4MA 4JYAF 4Y2MA 4CO1A 4PWDA 3KNGA 1ZPVA 1TUGB 1F6TA 2QA4G 5JJBA 5IC4B 2GJIA 3O8WA 2LFVA 2HZVA 4F3QA 1YWXA 5LMUJ 3HVWA 3IBWA 5H9EK 1DZ5A 1HNXF 1RI7A 2K7KA 2JLEA 5FDLA 3T00A 4PG5A 3V81B 1HMVB 3EVMA 1S12A 1FD2A 2CQGA 1X7VA 1GX6A 2FVRA 5KFOA 2AW0A 1TUWA 1YRUA 3C46A 4OI2A 3WAXA 2C2NA 4PUOB 3BGUA 1FXRA 2VFUA 3MPYA 3TX0A 2PFDA 2GMLA 4DL2A 2E1MC 3RBDA 1S1VB 5EWFA 4DV5F 4IQMA 4EGLA 3G9CA 2AZ3A 3QGHA 2DHSA 1YITS 2Y1IA 4I2PA 3RB3A 2DNRA 2RVJA 2WONA 3CCJS 1URAA 4NWBA 2B4PA 4IRDA 2Y1LB 1VOMA 1HHQA 1FJEB 2H5IB 3POTA 4OX8A 1AXQA 1YJRA 2FGOA 1RTJB 1Y5NB 3TZXA 3EGZA 3F0NA 2MY8A 3LPEA 5HMXA 2P5VA 3GV7B 3M8QB 5J1NA 2Z2ZA 4YDXA 4XAKA 4DU7A 2VONA 2CQCA 1QSYA 3NBPB 1ROFA 1FKPB 1K73T 2GV1A 2C22A 2VICA 3WHIA 4ECUA 1U2CA 4Q44A 1APSA 5A0YB 3FQKA 3C6TA 5CYQB 1SJ3P 2RHQB 1GEHA 1S6UA 1FKAF 4QZVB 4CO2A 1C0UA 3C16A 3AB2B 4NYOA 4Q8FA 5HQ8A 3OV7A 1SV5A 2C3OA 2BJ1A 4ZCKA 4IOAQ 2CZ4A 4NYPA 3W5YA 3OVBA 3KLGB 3EJMA 5CA5A 5CCMA 3AXKA 2HVZA 3MAQA 4CYUA 1EW2A 2OAUA 1WTBA 2Z30B 1T95A 2MKSA 3MM9B 4DV2J 1CQMA 5ETVA 1TU0B 3EMTA 3OW2R 4QYRA 1RTIB 1J5OB 2RRBA 3QAUA 2ZDOA 3HX9A 1LW0A 4O44B 3AA9A 4OYIA 4BLGA 5E3QA 1KOHA 3NRBA 4ZK7M 2DNNA 2AV5A 4OJHA 2RILA 5K5MA 4DR1J 4OIXA 5J2NB 3I31A 3SSRA 4DPOA 5KFYA 4PCQA 3JAMU 1OIAA 3EZUA 3W8GA 4OMFG 2MJNA 4F0MA 4RNOA 2HVHA 1CC7A 2FJEB 2NYIA 2QL5B 3R3TA 1ZEDA 1NHUA 1MMNA 1X4AA 2XB2D 1H74A 5ETLA 5CD4H 4FZVA 5D4NA 2AYBA 1XMQJ 1LXNA 3D2WA 4EO6A 1N5YB 1RT1B 4DV7F 1SKWA 5KXAA 1DBDA 1MU2B 2BA9A 4M5MA 3QT5A 4BBYA 4A8SA 3JXOA 3DLGB 2VBYA 4RW7A 3C66A 3WIUA 2C3UA 3DNCA 1VRQC 2XY6A 1RTZA 2E7WA 5IT9Y 4TN0A 2E7VA 4KPYA 2OPSB 3T5LA 1TL3B 4J9RA 3HFZB 2D41A 2CJXB 4I6WA 4RW4A 2KXFA 1S9EA 4ZHRA 2DRAA 3TAQA 4MK7A 2IVMA 2ZVIA 1XWLA 1CJKA 3R5JB 1P1TA 3T9ZA 4DUYF 4PQAA 2MZRA 3R5GA 2IMWP 4PZVA 4UUXA 2D7SA 4OZLA 2WHOA 3TRGA 2HQFA 4NI2B 1MROA 4R5PA 2RUGA 1PAUB 5B0EA 3SV4A 3A4TA 2DNYA 3HSZA 1TVRB 3LP1A 2BR0A 3GFXA 3QNWB 2AYEA 2GVDB 4YHHF 2JVRA 3UDVA 3KHRA 4XDDA 1XJWB 4DV1F 4FF1A 3NKYA 2VPZB 1K47A 1S97A 4NEZA 3HSJA 2AX1A 2Q43A 4KB7A 1UJ5A 1BY9A 3EPIA 2CFXA 3VQSA 4ZCMA 2HLUA 2M0GB 3CCVS 5C66A 4IFVB 5K20B 3EPGA 2CJ9A 1RHUB 2CRLA 2JX2A 4C48A 3CCMS 5C25B 4L73A 1S9FA 1NBEB 2J7KA 1U1RA 3O3LA 2LXFA 2QA1A 3MPDA 4MH8A 4M1KA 3AH6A 1BQXA 1SJ1A 4K50A 4PG6A 5A2QY 2JWNA 4NCGB 4ED2A 4ZMMA 2ZD1B 2ZJQQ 3J80Y 2UUCJ 3IWLA 4FXWA 1HFEL 2F5GA 2QA2A 1JMTA 5IJSA 1WEYA 3MR5A 4ECXA 5HP1B 4CDIA 4XK8C 1Y6VA 3KJVA 3LF0A 4PYDA 2BX6A 2AZ1A 2RKIB 3SQGB 1VI7A 4TKTA 5DGAA 4CXKA 4EBEA 2ROPA 3WAWA 4CLWA 3F73A 2LU1A 4KJDA 3K8WA 2CJAA 3IG1A 1JXEA 3DMJB 1L3UA 3TAMB 1RE1B 2WVBA 4X4OA 1QUPA 4LRAA 1VBYA 4CLTA 1RDRA 3CMES 3W8PA 1YJ9S 2E9ZA 3O44A 4C11A 3QFHA 1EB0A 3R27A 3NGRA 1ANJA 2DBBA 3R9LA 2DXEA 3MM5B 3S6EA 3CC7S 1XNQJ 2RT3A 1EKRA 4DMZA 3P45B 4R0JA 5LSOA 3HFKA 3G2XA 5ADZA 3MPUB 3QJJA 5DLTA 1N5QA 5LIAA 1S57A 3R6GB 1TELA 3W66A 4ZVFA 2XSFA 3I6PA 4HLBA 3AODA 4ANCA 4DUZJ 2KT3A 2HNDB 3MFIA 3TNVA 2CPXA 5DDOC 3IMQJ 1IN0A 4P7TA 4H4OB 4YN3B 4URSA 1ZA1B 1UFKA 1NK5A 2DXDA 2YKNB 4KHMA 2B56A 1HKAA 4OX9F 1HMVA 4A8FA 1GXTA 4ED6A 1EJJA 3J80U 2WSCC 4K4UA 1IM6A 1WWHA 5HQLA 2DNMA 5HANA 1VBKA 4K4TA 2Q6CA 5KG1A 5HMYA 2DHXA 3FJ2A 4F4AA 5D3GB 4PUOA 4DR7F 2VG5B 5HRTA 2E5LF 3AXMA 1VQ4S 3PR5B 1XN9A 5KFBA 4NZ7A 3QWPA 1YBTA 1KTQA 1FNXH 1S1VA 5LXRA 2LQ9A 3AD9C 3CB4A 1Q86T 1U1OA 3O1LA 1SKSA 1IR2A 3VQTA 2CNOB 2DVIA 1RAIB 1N54B 3MEKA 3OTOF 4JI0J 4V1Ak 2E1PA 2XMWA 4ELTA 5J2MB 1BHNA 5DLGA 1TKTA 2FLNA 2KZZA 1TL1B 1WDDA 1ICEB 2CDQA 3DN9A 2ROEA 4FF3A 4JYAJ 3DOMB 3M8QA 4PPDA 1HI1A 3VAIA 4ES2A 4DSIA 2IIHA 4J9QA 4QCLA 3VF0B 2UZAA 3CCRS 4W4MA 1V5VA 4MIBA 2CA9A 1YJNS 2PA3A 1HNXJ 4WFYA 2OD4A 4PKDB 5CYQA 3M2VB 4ERDA 4DL0C 2HKEA 1FJ7A 3RR7A 3FSXA 3W2WB 2J6SA 4X4UA 1D8ZA 1JLBB 3U1NA 2KM8C 3R6LB 2AQ4A 3NNCA 2DH9A 7FD1A 2YNFB 1WOOA 4GMKA 3DXSX 3T1YF 4OZ5A 3KLGA 3Q8YA 1KQGB 4NLQA 3GTYX 2XEXA 4TN2A 4C3KA 1Z1ZA 2QZUA 1IWGA 1DFDA 3CJ5A 3D5MA 4DPYA 2QGFB 1UW9A 1J5OA 1X5PA 2JEIA 3TVKA 5FIIA 2JNJA 4LUBA 2DRBA 5B0GA 1UA0A 3LA0A 4ECRA 1VQ7S 2A3JA 3JQJA 3W61A 2LLZA 2XS7A 1YGYA 1MWZA 4CWBA 2GIRA 3DCAA 4ZJLA 2V2ZA 1QUVA 4AFFA 2BACA 1UL3A 2WVDA 1GMUA 3T01A 4C8NA 3QAEA 2R8KA 1J5EJ 5J2NA 1VDHA 3ILJA 2CJYB 4DV4J 1JLGA 2MLYA 3I4HX 2W9AA 5G4DA 1R8HA 4C3LA 1TFWA 4J91A 2ZHOA 3TEHB 2QYCA 4RUCA 4USKA 5KFEA 3O2IA 5K8PA 3N28A 4CNZA 4MKYA 3BB5A 3MEDB 1LWEB 1N5YA 4ECWA 1RT1A 3CCQS 1ALHA 1K1SA 3HHEA 4NLUA 3CCZA 2DT9A 1EQMA 1MU2A 2HNYA 1Q5YA 3DLGA 4K5SA 3C8YA 2EBGA 1W26A 1PYOB 1PG5B 1TV6B 2FC9A 5KFGA 2EC2A 2AD9A 1E6VA 2HRYA 5KFMA 4YY3F 3IRXB 1VC6A 2OPSA 1TL3A 3ZZRA 3UW1A 2QFJA 4NLDA 1REGX 5KT4A 4F4ZA 2HFOA 4ZP8A 2Z0GA 4DFPA 2QO3A 1S4EA 3PZPA 3GILA 3JB9k 1HWIA 4DDFA 1F2HA 2DO0A 3KG4A 2YNHA 1IBLF 1IKXB 2Y8WA 4PG8A 3J7AN 4KGXB 5GMKa 4NI2A 1GK8A 4PWUA 2CNKB 2CPJA 1BLUA 2N7YA 3E2DA 2V8GA 2CG8A 1VK3A 1M1HA 1FNMA 2PSZA 1R0BG 2GVDA 5IQQA 3DDNA 1RT3B 4DR4J 2A2CA 4DX6A 3L3CA 2JEFA 3ZTOA 1WEZA 2V94A 5DLFA 3QO9B 2W8SA 3LQVA 3S8SA 1N34F 1HNWJ 3HJVA 1WUUA 4W92B 3UWTA 4LVNP 1UEKA 3HXMA 4QWCA 4LFAF 2QFIA 2DIVA 2EEYA 4X84A 4IFVA 4AT1B 3ZNUA 2B5JA 2BQUA 2ZJPQ 5C25A 3PW5A 3PYDA 1JXVA 2BBEA 4LRCA 2W7OA 2XG8A 1I94J 3HULA 4ZITA 4ZPCA 3U1LA 1S1WB 1WD6A 4DUYJ 3HHLA 3TAPA 1X5OA 2C1EB 4NCGA 3HSGA 3HHLD 3TA0A 2W4DA 1T05B 2FZGB 1VQMS 2R8GA 1U1LA 4C0HA 1Q5VA 2ZH4A 2NQPA 2VKRA 1FVQA 2XCAA 3MEEA 1IXKA 4P2SA 3M1VB 3G6ES 4LJMA 2O3DA 2UXCF 4TYAA 1NSAA 2XLKA 1NB7A 3SIPB 5H9FK 2DR8A 1E6YB 3CO9A 1OYEA 5DM7Q 3A8JA 2LMIA 4OZ2A 1HW8A 2CQ0A 2RKIA 3SQGA 2X98A 1X4GA 5GAEI 2LA6A 5C24B 1UW4A 2AMCB 1DURA 2W2PP 4EMDA 3SZ2A 3FEYB 4TLQA 1JJ2R 1AUKA 1NXIA 1FVSA 1B3TA 3TAMA 1XNRF 4JI8J 5KFUA 3OXGA 4ZGAA 2X51A 2DISA 2MKIA 5HAOA 2E5HA 4F2SA 2MQMA 2BOPA 4TY9A 3V6DB 3PRDA 5HLFB 4LVOP 2QZ8A 4L75A 3MM5A 1UVNA 1SC3B 1RA6A 1QAYA 3MCSA 4JI4J 4CLUA 1RWWB 2JVOA 3CE8A 2NS1B 3N9UC 3NG8A 3Q2SC 1UJ6A 1WHVA 4ICLB 2GQ2A 1FRMA 4DWIA 2MKCA 1T03B 4BS2A 3MCOA 4WP3A 1YLXA 1HHTP 3CJ2A 2HNDA 1N2LA 2K8GA 2JLFA 2KJWA 2VBWA 3I0SB 3PW0A 2PFFB 2YKQA 3P4UB 3FCHA 4F4WA 4H4OA 1T02A 1Q95G 1NK9A 2GHVC 1C1BA 2W1BA 2YKNA 3DOKA 2RNEA 2W2QP 1DAXA 3OTBA 5CYMB 1V3RA 3A8EA 2V34A 4USVA 5F8GA 1BE4A 1Q8KA 2AJ4A 5D3GA 4X65F 2VG5A 5GAEU 4E8UA 1S6OA 5DJBA 5HSPA 1JX4A 3M2RB 3HK2A 2VZ9A 2ZBPA 4WFBQ 3H4BA 2J7UA 3BH6B 4KV8B 1N33F 2R2TA 3H7HB 3GONA 4GVLA 1KHLA 3W9IA 3FVYA 5J2MA 1SH3A 1RJJA 1YX2A 3VGTA 1C1CB 3PW4A 2DGQA 2VBXA 1TL1A 4RBUA 3R1HA 1IBMJ 2WZ1A 3DOMA 1EARA 3D28A 3EZOA 2A2DA 2JRSA 2KZMA 4DXLA 3G87A 1ZTTA 3D6FB 1WDTA 2OTLS 4QIVA 4LF6F 2RD5C 4IO1A 4E0DA 2DIUA 2V6AA 3D4JA 2C42A 4OX9J 1FO1A 3VR1A 2HBYB 3EGWB 4IH6A 1G7CB 1OQ6A 3W2WA 2ZOFA 3DRYA 5DO2A 5THWA 4TU7A 3R2DJ 4LSZB 4DR7J 3GYGA 2DCLA 2YNFA 3QJPA 3NKPA 4DUTA 3RGIA 2DTJA 2RUSA 4WYLA 2JJ4D 3TJAA 3GB0A 1NDPA 1U02A 5EWGA 1ZETA 3I5AA 1JQGA 2G13A 1M0SA 3IS9A 2HQDA 4MTPA 1SKRA 4OHYA 3Q89A 3H2VE 1UA1A 3UCUP 1BMQB 1RTHB 3VTIA 3GE9A 1YQHA 2GGPB 1T9VA 2H54B 1Z4UA 2E5JA 4KH1B 2UXBJ 4OX7A 2VPXB 5H9EJ 3M6XA 3CGIA 2ZOMA 4WU3A 2DEIA 2G2ZA 1JKHB 5DDRC 4URGA 2B4OA 4IG3A 2ZH7A 3I9ZA 4WXOA 1NSQA 1B7YB 2MDAA 3LWLA 2LQ8A 3MK0A 1JIHA 3I0RB 3HZEA 4ZG7A 1T9XA 4UOFA 1H2UX 3LUYA 3PX6A 2XO6A 4MYTA 1TK5A 2FLLA 5DGBA 2QLFB 1S1XB 4FYYB 2N3LA 2RH3A 2ZDPA 1VQ8S 3GFYA 4HHUA 5C7PA 2CUYA 4C3MA 3HHKA 4U8YA 4I7FB 1HBMB 2VH7A 2IM1A 1Y4ZB 3ZZ0A 3ELHA 3QMQA 1LQ9A 4DBQA 4QIFA 3LAKA 2JC1A 1HQUB 3UD4P 1LWEA 5C2GA 1FFSB 3QPIA 4QW9A 1GX5A 4PQUA 1SPBP 1U45A 4FDJA 4P2MA 4OLOA 2JZ5A 3RB0A 1EW8A 4U7UK 3A8KA 2PMZD 1D9FA 2ASJA 3OL8A 2J9CA 1TV6A 3W64A 1RLDA 4WFAQ 4ELVA 1D1UA 3IAS9 4ZPAA 4ED3A 2IBKA 5L0BA 3Q3QA 4EO8A 3CJ0A 3IRXA 2PI5A 3QIPA 3LPYA 4JI3J 2BM0A 4UF4A 3CCWA 3EVWA 4NLPA 4ZP9A 2BKOA 3JSMB 4A8QA 3K89A 2KKHA 4J9MA 2KYZA 3EUNA 5HL7Q 3I87A 4CNYA 3D6MB 2YQ0A 2DB1A 2WOMB 2HBZB 1X4FA 2YWEA 2B3TB 4F50A 1IKXA 3CDUA 2XSJB 2RU3A 5MAOA 4DQQA 3UD3P 4P72A 1RAOA 1S6PB 2XI3A 1MSWD 5IFMA 1N6QB 2W5TA 1N36F 3NMRA 4ZPBA 2ZUAA 2PO4A 2QE5A 4ZS6A 3CWJA 3IA0A 4QR2A 4DSEA 5LSRA 4MKVA 1RK8A 2DNOA 4XPEA 3H42A 3SV3A 2XMMA 1RU2A 2FHMA 1NJXA 5KT7A 3J81U 1HWLA 2GA3A 1BC6A 2ZBRA 3HP6A 3M6WA 1XR6A 4YY3J 3IGYB 5E3CA 4ZDNA 1KC8T 4LT6A 1KHVA 2B9YA 1QAXA 1FTRA 4Y2KA 4X4PA 3JTNA 5DRKA 3MR6A 2HZCA 2HHSA 4RWWA 4YUDA 1A0OB 4NLOA 3M8SA 4UZBA 4LSLB 5HATA 4C8LA 1XBWA 4ZP7A 4G1IA 1TMJA 2I5JB 3W2VB 4LR9A 4ALZA 4P74A 1IBLJ 1JJ4A 3OLBA 5LM7E 1T05A 3HZGA 3HVAA 3G82A 3HD1A 1JB0C 4X66F 2C3PA 2PMHA 1RWNB 4FVCA 2HHHJ 2G4BA 3TG0A 3M1VA 4YR2A 2WRMA 4FYVB 5D0RA 3S01A 4DQSA 2W8LA 1E6YA 1E3CP 2GSUA 5L1IA 3UPFA 3TZWA 4K8RA 4ER8A 1TK0A 3J7YI 4PABA 2YX1A 1VBXA 2E66A 2ZE2B 3T1HJ 3FGVA 2AKWB 3MD1A 1Y5LB 3QBCA 4QPXA 2F4VJ 2F7VA 3OJSA 2Q6BA 1RT4A 2VIHA 1HPZB 3GSIA 1ULRA 4OHZA 4CH0S 5GAGI 3BEGB 4DU8A 3MCNA 4Q2LA 4FPIA 5BR8J 3V6DA 5HLFA 1ZH5A 4K4ZA 3B5QA 5KFHA 3A3NB 2XULA 4C6AA 2VFVA 1Y10A 3S1TA 1WELA 1YIJS 2GJFA 1RT5B 3KK3B 1QVGR 2ZVSA 3H5XA 3NS6A 2DH8A 1F0XA 4DSKA 4WWSA 4ICLA 1VQOS 1VISA 2ZKTA 2I9SA 3R1LA 5KFRA 4A8MP 3GIKA 4Y00A 2VDIA 2DHGA 1VLYA 1TFYA 4U67Q 4K4YA 4DL6A 4A8XA 3SXLA 1GT8A 1YJTA 1GMVA 1VQKS 4FKYA 2KDOA 2YWGA 1V3ZA 4EYHB 2LU2A 4QJVA 4NXNF 3OUYA 5B0CA 2W7AA 3UDLA 4KJIA 3JSRA 2ZNZA 5J1PA 1H2VZ 4ELUA 4UORA 4WFZA 3MURP 2MZSA 3UDEA 3W9HA 3UI3A 1S1TB 2LEAA 3BREA 1JLFB 2WTFA 2KFZA 1F2GA 1TP7A 5LT5A 5KT6A 3OXFA 3M2RA 1P1LA 2CPZA 4DR3J 4WFXA 2HQGA 1IBKJ 1DY3A 3FFIB 4IOBA 4LRFA 5GAGU 4KV8A 5LRNA 4NXMF 1JXLA 1AYEA 1C1CA 4O3OA 3W5ZA 4UY85 1T0TV 4RL1A 4UW2A 1X4BA 4IFYB 4DS4A 5EDWA 5IOLA 1RTDB 3KHLA 1PAEX 2M5YA 2WSFC 4J9NA 5F3TA 4AL6A 5DG9A 2CXEA 3HI9A 1VR6A 2DGVA 1RWUA 3UO0A 2RQMA 2V68A 1EP4B 2R2SA 4RNHA 1XMBA 5SUHA 2XHCA 3NGKA 1R8AA 1TKXB 1OS5A 1CS4B 3FBBA 3HKZD 2ADBA 4CM0A 4R8UB 2QYGA 2AGPA 3KDNA 4UOGA 4Z7YA 2EI5A 2IHR1 3MCMA 5E2QA 4Y0FA 3LP2B 3KUHA 1RT2B 2AU0A 2UUTA 5HVFA 2MY7A 2OLWA 5KT5A 2GGPA 2E29A 4KGKA 2OPRB 4OYXA 1NJIT 4B17A 1JKHA 3FEZA 3KJQB 2LVWA 4J37A 2IPOB 4HTIA 1FWLA 2WSEC 3I0RA 8ATCB 3B6BA 4MY4A 5CYJA 3ZXWA 1S1XA 1LKZA 4LF7J 4FYWB 5BYSA 2KT2A 1DTQA 4KHRA 1O6XA 1S9GB 8RUCA 1B70B 4I7FA 1HBMA 5H1SV 5KTQA 5KFVA 4OHWA 3F44A 2YNIB 3BGOP 1FF2A 1OSDA 4IQXA 1HQUA 3RJMB 5KG0A 3F41A 4UOHA 5F3ZA 1KS2A 4OYOA 2DR9A 2ERRA 2V0NA 1CJTB 4FS1A 1ZS6A 3QWUA 4GTYA 1NDCA 3IBFB 2CG4A 1EHWA 1NAQA 3U7JA 2C2MB 4O3NA 2UUWA 2A1BA 1I1GA 3LOUA 2BQRA 1NK6A 4MHXA 3UFCX 2CQIA 1AA1B 1W25A 1FDBA 1KOOA 2VQFJ 1YTYA 4BWMA 1Q8BA 3CDWA 1IJFB 5E5NA 5CZVA 1OO0B 3A3PB 3GPAA 1U49A 1ELYA 3L4BC 2JEGA 5E33A 2AYMA 2R8HA 2GS8A 3JSMA 3ISZA 2CQ1A 2MQNA 4RR5A 2CZVC 2D69A 3M6UA 3G4SS 2NXNA 2AJFE 2C2RA 4DHVA 3OVAA 2XSJA 3T19A 3RW6A 1S6PA 1NPPA 2YH0A 3HM9A 1N6QA 1AROP 1RQ0A 1EQJA 1ELZA 4LBIA 4CZCA 1NJYA 2I2YA 1C4CA 1LWXA 4DR5J 3ILLA 2F9DA 2G9YA 2YKAA 3A8IA 3IXQA 1MNEA 3CJTA 2HAFA 1QAJA 2MLXA 3BQ0A 2DJWA 3KHHA 4CI0B 3CMAS 1W2IA 4I56A 2R7SA 1U1QA 5I3UA 2EBEA 1L5UA 2VD3A 3UN3A 3MPWA 1VS3A 5F8LA 4RW6B 3RB6A 5ETOA 2J9EA 3FZBA 2V4RA 1PBAA 2FLPA 4ECSA 2RQKA 1FKOB 1FJGF 4Z37A 4I6AA 4Q45A 1SIWB 1VQ5S 3DRPB 1VHFA 2I5JA 4UOCA 4OYAA 3W2VA 1TAUA 3C6UB 2ANHA 1CJUB 1R8BA 1FDNA 2ZOGA 4WYWA 4LRBA 4BCAA 4QIWD 1Q78A 3EYZA 3N0VA 5EGEA 2IY5B 2GAHC 4H4MB 2Z58B 4WP8A 1HQAA 4LF9J 4A47A 1HBUB 3BGFA 5I4MA 3OTDA 3BBCA 4MAKA 3V2UC 1MN9A 4KAIA 5ETKA 3OD2A 5GOVA 5F8IA 2DNKA 1LEOA 1RWVB 2OSQA 3NGSA 3V5RA 1HPZA 2XZTB 4GKJF 3DYCA 4O3RA 4G1PA 5JXSA 2CAJA 3SI8A 3NCRA 4CIOA 2EKNA 4IRKA 3FKBA 3KK3A 1AJAA 2W5SA 3QT8A 1OPIA 5HJXA 4KGMA 1AZSA 3BS9A 1N48A 5CZXA 1RYSA 4RUBA 3TVZA 3T02A 3V6HA 3ILIA 2HHTA 3JS9A 4OJGA 3G71S 4X64J 3M7VA 1U1PA 4M95A 1GTEA 4X66J 1PJ6A 5CXTA 2MZQA 4ZKAA 4HDGA 2HK2A 3RRGA 3OR2B 4NRTA 2HHQA 3Q8RB 2BOAA 2WB1D 2GMJA 3T5JA 1S5ZA 1T94A 2MSTA 3WBHA 2LCWA 2CWXA 2UVWA 2N4DA 3NCPA 3DGPB 4B3TJ 4YMEA 4P2XA 1UVLA 5AE3A 2V8VA 1S1TA 1JLFA 4DJBA 5G0RA 2ZM6J 4YB7A 1VGYA 1JLEA 2EWHA 4LSNB 4LQ9A 2M8DB 2RQCA 1UPPA 5GRRA 2MEWA 2YX4A 4RJVA 5BYRA 2F65A 3FFIA 5B7WA 2J8AA 3HD2A 2V4JB 1NHKL 2CKWA 4F3MA 4FS2A 2FD2A 1FHTA 1HBNB 3PYEA 1PIEA 4QBUA 2B4UA 3P5TL 4OZJA 4WK1A 4KO0B 1N5SA 4WK3A 5L1KA 5H9FJ 4EU0A 1RTDA 2MQQA 5LJ5Y 1VIOA 4M5IA 3CJ3A 2L48A 3H90A 2HG4A 1AUDA 1TL7A 1WJ9A 3QSYB 2VJUA 2B4VA 3MHYA 1YI2S 1UTAA 3K17A 2ZKUA 1EP4A 5D6GA 5DQIA 5MLCV 3BN4A 5RUBA 1KH9A 3MM7B 4KPCA 2KXHA 1TKXA 1R0CB 3S7RA 1IM4A 1CS4A 1NKCA 4QAXA 2FJDB 5E41A 2R9LA 2FJXA 4DV3F 3TQ1A 5A6PA 1RABB 2ZZNA 3W60A 4R8UA 2XRGA 1PYSB 2IVYA 3IWNC 1TKZB 2OFGX 3LP2A 4KHPF 2GIFA 4IG0B 1RT2A 3BN7A 1FDAA 4NXMJ 3H5SA 2ACMA 1O51A 1UCNA 4IDKB 4OYZA 5D4OA 3DLEA 1R8PA 1M5VC 3IFEA 4B3SF 3H0PA 3QT6A 2HPUA 4PAAA 3BPDA 3KOAA 1AB8A 1ZAXA 2B7BB 2OPRA 2G0JA 4HDHA 5EGHA 2BRLA 2GO9A 1KH5A 4TU9A 2CQ2A 3B4DA 1NLKL 4C9DA 1ED9A 1N88A 4YDDB 4K2JA 3ZTSA 3T5KA 2HQ3A 4P7VA 1RLCL 3CF5Q 2KM8B 4W90B 4O3PA 3OR1B 5KOXA 4N77A 5DETA 4PWWA 3HHDA 4RW9B 2W9BB 3TOQA 3DM2A 1KLMB 5KFQA 2VHGA 5HJYA 3KLFB 4X2BA 1K8AT 3FQLA 3CEDA 5E0OA 1LOUA 2ROGA 4DSFA 4EZ6A 4MIVA 1FCAA 5KFCA 3MECB 2BKNA 3HHLC 3US5A 2ZH2A 3PKMA 1CJTA 4E98A 3ZNJ1 1XMOJ 4C8OA 5KFLA 4LR7A 5B0DA 5ETRA 1K9MT 1WG5A 2OPQB 3ETMA 2B8QA 1Q81T 2CPFA 4KC5A 2LDIA 1Z2ZA 4R25A 1FEHA 1U1NA 1PO6A 2XCPA 2EXUA 3DOLB 4X4VA 4L74A 2KT5A 2UUAF 1PC4A 3VWSA 1CG2A 1RXOB 2CWKA 2CPEA 2N4CA 2IJRA 3BDGA 3MGJA 4N8NA 3TJ8A 4B3MF 3ENAA 4EZ9A 4QR0A 2KVQE 2CIMA 2ZBQA 3EDQB 5D4LA 3G8TA 3JQMA 5IWAJ 4LQ3A 1F9FA 3UN2A 2OKQA 1TZ0A 5AJ3J 4PRFA 2EFPA 3D0IE 3SDEB 1KD1T 2E9RX 3L9ZA 1E2SP 4DQPA 4J90A 3CMRA 2CQBA 4RNNA 3EDRB 4H4KA 2N82B 2G9OA 2KB2A 4MYUA 5A6WA 1RHJB 2OUGA 1WKJA 2OD6A 2RQ4A 1NKBA 4PG4A 5IV4A 1ACMB 1NK4A 2FJAB 2HZAA 3BGRB 5K14B 4CLSA 3CCES 2FVPA 2MJUA 4NOHA 1KFDA 2Q3PA 3TW0A 2EVZA 3Q8SB 2R8JA 5DDPC 2Z57B 1R0AB 3J7Z5 3PX4A 1MWQA 3C6UA 1DRZA 1CJUA 3RR8A 4DR6F 3M9OB 5B0AA 4WFNQ 3MK1A 3CCTA 2XYPB 3IM8A 2BRKA 2FDNA 4HT7A 2L9DA 4H4MA 3PO5A 4X4NA 2KG1A 1HBOB 3NGDA 2QEXS 2C3MA 4OHVA 1RT6B 3A12A 3BPSP 4XIUA 2V5HG 4MJKA 3VAFA 2VU5A 1HBUA 3BR9A 1K0TA 1X5TA 2QSWA 3UDCA 3EGNA 3JQKA 4CLFA 5F8HA 2F40A 4A46A 1Y9OA 2XNRA 5A8WA 5I42B 1BD6A 4U95A 2CNNB 3TUJC 2YNGA 3BO4A 2GW8A 1FXLA 1VBZA 4B9NA 1FJGJ 1W7WA 3UD5A 4QWAA 1JNZB 3ICLA 2HRTA 2DNPA 2XGPA 2OELA 2R7QA 3LWMA 1KHJA 5FLXU 4J9UE 4WIQA 2ATLA 4LF4F 2BDPA 2O66A 4NLTA 3OTCA 2JFKA 3FCWA 1MMDA 4JI1J 3NWGA 1LWCA 4FKXA 3Q22A 1C0TA 2XYGB 3OR2A 4ECZA 4MKAA 3M6VA 3LH2S 3EICA 2XS2A 3IP0A 2PD1A 5KG2A 2HQIA 5EHHA 1BQMB 4KQZA 2DNZA 1IKYB 4WIIA 1AFJA 4DR2F 1REVB 2VC0A 1GFWB 3PFOA 4Y34A 2OHDA 1JLCB 2VDHA 1RAFB 2LEPA 3WX4A 1E1ZP 4QIEA 2M52A 3JTPA 3A13A 4O4GB 3PJ9A 2V8HA 2MQLA 5GAHI 3D9BA 4TLRA 2B6AA 3H5YA 1NK0A 2GQQA 4LF8F 1ZAVA 4RX6A 2V4JA 2XMUA 4M5JA 3U27A 3FRYA 1HBNA 3MAHA 4F8RA 3H20A 1M1GA 1FERA 2QLWA 4ZVGA 1WC6A 4KO0A 5DG8A 4HYKA 1M5SA 2ZWOA 1IKVB 5K8NA 4CH7A 3NKMA 3MMAB 1NB2A 1SI9A 4HI1A 2K1RB 3FNNA 3RBXA 1F1BB 5HROA 2J0WA 4DL4A 2V67A 7FDRA 3BJYA 2E1RA 4NEYA 4QOTA 4O3SA 1X4DA 3NEKA 2R3VA 3TR5A 3EZ5A 2VL1A 5EX3A 2UU9F 5D78A 2NXUA 3MM7A 3BH7B 1UWBB 3VAMA 2W9CA 4TY8A 3PVXA 2MHNA 4ED0A 3C19A 2E5IA 2X1GA 1VQLS 5BYQA 3RBZA 2WK4A 2KN4A 2RJZA 1KSPA 2J6UA 1TKZA 2Z56B 4YB1P 1M1KT 4NL5A 4IG0A 1RBAA 2V8DA 1EZZB 5LQQA 4IDKA 1VQNS 2EG2A 3DLHA 1Y00A 1EIYB 3GJTB 5DLWA 1FDDA 1HQEB 1U26A 1ED8A 1SIZA 1HR0F 5GMDA 2H5EA 4CH1A 4IYQA 1UJ4A 4HACB 4AD6A 3WAYA 1YJUA 2WB4A 2NSBA 1R8CA 1VQ9S 4WP9A 3A52A 2HS4A 2Z4PA 5DDQC 4WBFA 4M8LA 3OR1A 2DHHA 3NGTA 4MMOA 3ZZYA 2EFQA 4K7QA 1P9YA 4QYZJ 4I2QB 1HNIB 4DCPB 4ENOA 1SC1B 4RW9A 5HK4A 4J5OA 1MN7A 4JI2J 3KK2B 1Z2LA 3M32B 2UXDF 3SEOA 4GTXA 4Y2IA 1WORA 3VHQA 4F25A 3G96A 4JI5J 3M2UA 2H65B 3K7RA 1YRXA 5A8RB 1GAOA 3OXLA 1XEZA 3QYYA 3MECA 3OFHA 1LK5A 2L9WA 2C2OB 3ITHB 4RNMA 4KHPJ 3LW5C 1RHRB 1XR7A 4ZVEA 4Q8EA 3E8OA 5B0FA 3OFGA 4LF5F 5F0WA 2R42A 3PO4A 1FI4A 2RH6A 2BJ8A 2OPQA 5KFZA 4LFBJ 4U8VA 3SCJE 4F7VA 2HK3A 1WG4A 3MTKA 3DOLA 4HVZA 3K5LA 2OEJA 4ZLJA 5IXUA 1VYAA 5B08A 4DV0F 4OI3A 4L3NA 2J5AA 3G6YA 3VAKA 4FDIA 3CW2C 1VK8A 5J2PA 1S76D 2ASLA 2DGOA 2YQ3A 2K3KA 2LQJA 5LRMA 2G1HA 4L72B 2H3EB 1X31C 4DL7A 3RAXA 4C7QA 4WKYA 3IGVA 2H51B 1OY9A 2U1AA 3MK2A 2BJ7A 2RHSB 1NUEA 5ETMA 3UQSA 1GXUA 4GRSA 4A8WA 1QTNB 2IAJB 3SDEA 1RKIA 3MUTP 6AT1B 3OL6A 3ZZZA 4LREA 5INHA 2W7PA 1DLOB 3Q8VA 2E9TA 2RRNA 2JHEA 1JLQB 5IT9U 5LMUF 2MYFA 1SBRA 1OY8A 3GFHA 1TQLA 1LFWA 3VAJA 4OYWA 2HS0A 3OFEA 5L0KA 2CJQA 2HHVA 2VQRA 1HIYA 2U2FA 3L7PA 5L8RC 3UCGA 1H73A 5E3AA 1N0UA 2UUAJ 3BGRA 5K14A 4N76A 2J9DE 4O23A 5DS7A 2H48B 1O5JA 4B3MJ 3P3DA 4USIA 2W4CA 1R0AA 2KHCA 3DLLQ 2XNQA 4JI7F 1BWEA 2O5DA 4YB5A 4G1QB 4OI1A 3DC2A 4OJ1A 4DPUA 4DFMA 4ZVPB 3GV5B 2CPYA 4P6QA 3LP0B 3R5CA 2X1BA 4UT4A 3H2LA 4N41A 4ZVUB 3DFEA 5KT2A 4KGZB 1TK8A 1WKKA 5J2QB 2OFHX 3T3FA 3ZTQA 5EN1A 5D77A 1HBOA 3FSYA 1RBOB 2RAQA 1S4FA 1RT6A 2YX7A 4YEAA 5CCLA 3GU0A 2I1RA 3KXDA 2FY8A 4RKUC 3CD0A 5FDLB 2HIYA 4LQYA 1N8RT 4KE5A 4LBHA 1IVZA 1MWYA 4X4RA 4USTA 3MTJA 1WI6A 3KDOA 5I42A 2GLQA 4P73A 4GTWA 4OJ3A 4USHA 4OHXA 5A2QU 2QA4S 1Y5IB 1CEZA 1S49A 3LGNA 3V81A 2EK1A 3DHWC 3HLUA 2HBRB 3KTQA 2YKOA 3I4PA 2WONB 1NK7A 4WJBA 2D9OA 4DR6J 3OL9A 1UEUA 1H7WA 4A8OA 2Y1RI 3WIVA 3AOAA 3T6BA 4Z7CA 1X0PA 3HPOA 4I69A 2P6SA 3HDSA 2H4WB 3GLJA 4ED7A 4GKKJ 2FB0A 2IYGA 3W3SA 3N6LA 4M5KA 1HNZJ 1BQMA 3IR5B 2QMXA 2HMIB 1IKYA 4DR1F 4U7CA 3C6TB 4C2MA 5F9LA 1RTJA 1REVA 4F4XA 4LFCJ 5HMWA 3C16B 4CO3A 1U1KA 1JLCA 5CABA 4F3OA 2P9EA 2EC0A 2QC3A 2ALZA 4IKAA 5L0EA 3CDBA 3SZZA 3FCVA 1RB0A 1SV5B 2UVUA 3MWBA 4O4GA 1KWMA 1UMJA 3ONQA 3NBPA 1HWUA 2FUG9 1FKPA 2MHEA 3TA1A 2DRDA 3CJRA 2RS2A 5A0YA 2ZUGA 4OX6A 2HURA 1T3OA 1XMQF 3DRSB 4M5HA 3AY0A 1ZYQA 2E5GA 3I56S 1TKDA 5IV3A 2F9JA 3NKRA 4YR0A 4DEZA 4A4JA 2Q79A 5KFKA 1IKVA 3I5CA 2DNLA 4QIGA 3DXBA 5SZTA 2XO7A 1KVIA 2VB6A 5ETQA 4HTJA 3PHEA 1LW0B 3VGUA 2H4YB 3NNAA 2H5JB 1JNRB 4ZVTB 4DV5J 4U9RA 6FD1A 1Q79A 1T11A 5DZ7A 1N52B 4KAYA 3MM9A 4ZIWA 1V6HA 1VQPS 1XR5A 5F0UA 2VV5A 4QWEA 1RTIA 2OEKA 3TJ9A 1UWBA 3VCDA 3EX7B 4O44A 2C2KB 3D1HA 1H2TZ 4C97A 3K57A 1FA0A 2VOOA 4M5DB 1RCXB 5C5JA 1KKHA 3Q83A 3C15B 4FF4A 2F8MA 3ET6B 2PA8D 4NMLA 3DLKB 1F3FA 4LF8J 4TU8A 1JJCB 4UPIA 2GCFA 5J1EB 3CCSS 1G2EA 1S6QB 1SH0A 4X4SA 4Z2XA 3M8PB 2Y0BB 3I9V9 5IS2A 1FRLA 1FRIA 5CD4A 1HQEA 1ANIA 4F67A 1Q16B 3TO8A 4CLYA 2FZKB 3B82A 1NPKA 1X9MA 4IUFA 3DLJA 4LRDA 3IBCB 1ZPWX 1S10A 2AHOB 4RW4B 2RU9A 5JVHQ 1B0VA 2V2KA 4ETZA 2JSXA 4ZVQB 3WDOA 3NKNA 1N5TA 2UU9J 1RU1A 2VC1A 2HFSA 3PY8A 3Q8PB 4I2QA 3GIIA 2V4QA 1HNIA 4ANEA 2F3JA 4JBCA 1I5OB 1RHQB 3KK2A 1SJ4P 1KLNA 4DLEA 4NLWA 2V9KA 5A8RA 2UUCF 4RO0A 5D0GA 4R5PB 3D1OA 2DNQA 2RDJA 3VZIA 4B56A 2BZ2A 1V9OA 3MM6B 2JOQA 2NZ4A 3CJ8A 3ITHA 2C2EA 1D8YA 3AOCA 3LP1B 5KOWA 1IR0A 2G0CA 2CQDA 1S0VA 3N5BA 2G2OA 3JSYA 3KG0A 1FTCA 3LO3A 1R31A 5DQGA 3MD3A 4WTYA 3TEGA 1VMBA 3BKFA 5I3QA 1NSPA 3MMBB 4I0WA 4CP5A 5JUMA 4OL8A 2VFSA 4PXDA 4IR9A 1D3WA 4F02A 1TVRA 1T8EA 3K58A 4YP3A 4DV7J 2FHKA 1XNQF 1XIQA 5B09A 2KXNB 1RGVA 2VASA 4F2RA 1QM9A 4RW8B 2QL9B 2IBOA 1ZOTA 4AXIA 1H72C 2UXDJ 3ZC4A 2IAJA 3UR0A 1SJRA 4DUZF 4EEYA 4ZVSB 1MLAA 1AW0A 3BM7A 1DLOA 3FK4A 3VGVA 3VV2B 3H2UB 4MK8A 4HL9A 1DQAA 1NKEA 3IAM9 4UPLA 2PN6A 1O0PA 3MDFA 3I5BA 4FF2A 3KJVB 2XZDB 4ZCLA 2HQCA 2HHUA 2RRAA 3C14B 5GADI 2PMWA 4RBVA 2BJ9A 3CSKA 2ZD1A 4NYZA 4X4QA 2IDEA 2FHJA 4PEOA 4Q0BB 3ENQA 4NCBA 1S72S 1U1MA 1TL5A 4P9SA 5HP1A 1JLAB 2JEJA 2KJVA 4YHHJ 2HWIA 3EVOA 2RIJA 4NZ6A 5FD1A 2AJ1A 3W5XA 4ZLPA 2XBPA 4C8KA 4DV1J 2CPIA 3OPKA 4ECYA 4G1QA 2HRUA 1HI0P 2UV8A 2VQEF 2AGQA 3LP0A 3DMJA 2IDLA 2E1AA 3D7SB 2XM3A 3BSCA 4OI6A 3QZ8A 5J2QA 3UVJB 3KK1B 2VFTA 1L3SA 1B4SA 3CIZA 4U96A 4WCEQ 2FGCA 3HCXA 2RE1A 4KY3A 4M5LA 5I3PA 3QZ7A 1KEKA 4RU9A 5C2CA 1SHQA 3ILOA 3PFEA 1SH2A 1KN6A 2EK6A 2PEBA 4AQYF 3R5BA 3C2PA 2XWYA 1NZAA 2FVSA 3GFZA 3BBFA 3TP2A 4QPTA 3D54A 2GAGC 4PG7A 1OPZA 4AE5A 2EFNA 5GADU 3GCXP 3NAIA 1Q1KA 2B9EA 2ZBCA 3MUVP 3W9JA 1S7IA 3FMWA 3I96A 3PKYA 4MFBB 5GMEA 1LV5A 3H5UA 4O0IA 2QV6A 3T6JA 2XLIA 1SQFA 4OV6A 1RT7B 2NPFA 3WC0A 4JI7J 4JV5F 3B54A 2KRRA 3EWGA 4ED8A 1Q7LB 2GO8A 1WC4A 1D9AA 3GIMA 1TKTB 3BDHA 1T3NA 3TI0A 4CT9A 2KU7A 3PRVA 2XMAA 2NUUG 3SBMA 2YQ1A 2ZH9A 4NLSA 3SSSA 2ZZMA 1RWOB 3RAMA 3JAMY 1N0VC 2QMUB 2D1GA 3V4IB 1FE4A 2OMLA 3W7BA 3PW2A 2HMIA 2HAIA 2IRYA 1X0FA 1J5EF 2ZFHA 1HDHA 2V50A 1D09B 1R27B 3K5PA 4DV4F 1A7GE 4GVBB 1KNZA 2NXCA 4USWA 5LL6d 3BV8A 2MKKA 4JI6F 5L46A 3GWCA 4BC7A 4DV6F 3CULA 3PV8A 2FYXA 4ANDA 1HYSB 2HGNA 1KDNA 1QY7A 3GCWP 2R7OA 2YWKA 2PI4A 2YKPA 4KIAA 3DRSA 4ID8A 1NRKA 4FNHA 3W1YC 1UEVA 3M2VA 5M2RA 1YBAA 1HJKA 4YB6A 1IUJA 1Y3KA 3FBCA 1JLBA 1V5IB 2HYIB 4OYMA 2P6TA 3N01A 2E5LJ 3DDIA 4KR0B 2KFNA 1S7HA 3Q86A 4B9SA 5AJ9A 1QSSA 4L6V3 5ETTA 4I67A 5E7OB 5HBMB 2COLA 1KH4A 2LP4A 3MMJA 2P2CB 1D0EA 5EGYA 5HI7A 1RSCA 1QVFR 3D66A 3OTOJ 2BUNA 1U25A 2CQ4A 3CC4S 1A9NB 5KFIA 1HD0A 1FK9B 3L95X 1G4CA 1S48A 2ZEJA 3MR3A 1JLGB 2QRRA 1FT8A 3KLHB 2EW9A 4M5DA 4KFBB 4ZN3A 2AJ0A 3G6XA 4EK2A 4J9SA 3C15A 1PBUA 3ET6A 4JP8A 4ED4A 3DLKA 5D15A 1WF2A 5CQGA 1UFWA 4JOUA 2VG6B 2YTCA 1M5HA 1IBCB 2NZCA 5J1EA 4CCHA 2K06A 2HVDA 1MG7A 1S6QA 2XZWA 2AWZA 3FZ2A 3PHTA 2HNYB 3M8PA 4YQWA 3CT9A 4DR4F 1FRXA 3QQCD 3FRZA 3PEHA 5IM0B 1RYRA 3CDEA 1ZM9A 1H98A 4EWTA 1SJFA 1JJHA 4H4KC 1HI8A 1E6VB 1HNWF 4JUZA 3T1YJ 3MEDA 1PCAA 3DGVA 4HHHA 3IGNA 2HHXA 2XC9A 2Y8YA 5K9FA 4TNOA 3DU6A 1PJ5A 4NPOA 2IRUA 1O8BA 2IMOA 4OZ3A 3VGSA 1I94F 2VKZG 1QLNA 1ALJA 3QFWA 1S0MA 4AYBD 4F0KA 4M94A 1YRTA 3J81j 2YNHB 2D3OR 3H25A 2M4MA 1OY6A 1KONA 2VUGA 4LMZA 1SL2A 5D4PA 3MM6A 2I8EA 3HVTB 3MOJB 4M5GA 4KH0B 4FVMA 3ISND 1LFPA 1MMLA 4C98A 4B3OB 4GO5X 3R5DA 4K2XA 2PEHA 3Q2TC 2Q1LA 2J0QD 3RAQA 2ZHAA 2BW2A 3MMBA 5DLVA 3ETOA 3G86A 2K3IA 4P10A 2MSSA 4JI8F 4KSEB 1WC1A 1QE1B 1DJ0A 2W4PA 1ITPA 4DG1B 1P6TA 4DFKA 5L1JA 1RT3A 2B5JB 1QAIA 3GJSB 2MKHA 2IJNA 4JI4F 2IM2A 1NPRA 3KD8A 2NLWA 2I0XA 3QO9A 3M8YA 2MKJA 4CLLA 4C8YA 4RW8A 4ED1A 2POKA 4QQBA 3HHLB 4B3RF 3MI7X 1HWJA 1PKUA 2CZ9A 4E2FB 3H40A 4C8ZA 2LA4A 2DR5A 1WNEA 2DNHA 3N4WA 4LF2A 3EXCX 3MEEB 1VC5A 1BGXT 2BM1A 3RRKA 3D67A 1S1WA 2DXFA 1HA1A 4P2FA 1NZ8A 3HFVA 3C14A 4CLKA 4UUWA 3BSOA 4JV0A 3D6HB 2R7TA 2YWHA 1WOSA 3ZTRA 2QLXA 9ATCB 2Y0SD 4Q0BA 4ZLLA 2BJ3A 5KFWA 5A8KB 5EWEA 3RYLA 4NLVA 3HHNB 2V8PA 3Q24A 1JLAA 1OSCA 2FTRA 2EFVA 2X1AA 2VPWB 1RAEB 5C24A 1P49A 1NMEB 2VBZA 1S77D 2XR9A 4B9MA 2GVZB 2HS3A 1Q7YT 3SMZA 4IH7A 1N34J 4GC7A 3Q0AA 1AUSL 2WBMA 3KLEB 1IBMF 3UVJA 3KK1A 4OI4A 3KUEA 4LFAJ 1X5SA 2ZH3A 2A0FB 3FC9A 2KVIA 1VLOA 3GYXB 2QL7B 3RTVA 5L9NA 3TQEA 3PM9A 1C1BB 4OZNA 3DOKB 3LAMA 3GJQB 3QGGA 1T03A 1B64A 4ZPVR 3QSIA 2X3GA 4CM2A 1E33P 4KM4A 3K5NA 3TANA 3BDPA 4GC6A 1ELOA 3BO3A 4OZ1A 3EGVA 4ED5A 1LXJA 1MW7A 3I0SA 2R2UA 4UQTA 2OP5A 4MFBA 2UXCJ 1HNVB 4HEA9 3OSNA 2O01C 4DS5A 2LYVA 4YR1A 1RT7A 5DM6Q 3FDSA 3WZ0A 4CXUA 2ILZA 5CYMA 3RRHA 1UAWA 3GR0A 4TQRA 4K4VA 3CXCR 3ZO7A 4I4BA 2VQEJ 3J7YU 3BKUA 4DF4A 1SL0A 4FYXB 2QIFA 3TUZC 1XNRJ 2IFYA 5L38A 2UXBF 2W2NP 4I64A 1KRPA 4OQJA 2ASYA 2D3UA 2KRBA 4DL3A 1QDUB 2XS5A 2AEJA 3D6TB 1GMWA 3EXYA 3V4IA 3SCKE 1GMWD 4KJGA 3KMSA 1IQTA 3EM1A 3P96A 3R5AA 2LDYA 4AQYJ 2DK2A 2OTJS 3KWMA 4QWBA 1S79A 2VFRA 1UVMA 3AOBA 1NDKA 4B9TA 2W5WA 4GVBA 4B02A 2DD8S 2ZWPA 2RSQA 2EG1A 1NEEA 2BW7A 3TYTA 5CHCB 3CVKA 1PC5A 1HYSA 1CPZA 3DHXA 4M5NA 2Y1JA 1T9YA 2ACYA 4NA1A 2GC8A 2MPUA 2Z2MA 5KAKA 2DGSA 1R7IA 2YY3A 1CC8A 3PIOQ 3IS9B 4ILRA 5HVGA 3D0GE 2V9WA 3WQPA 3W63A 4NWJA 4JV5J 5KFPA 3H4DA 2L3MA 1WKLA 3TVYA 2CNLB 3VAHA 2AJ2A 4X65J 2GNKA 2AJQA 1UVJA 3THVA 1ZA2B 2IYIA 2W8KA 1SC6A 2B8PA 4RLEA 5HBMA 3J7A1 1UVIA 1VRTB 2A6OA 2A18A 1WHWA 2KH9A 4JI3F 3OJUA 4NA3A 3V6JA 1N33J 4FBTA 4IG3B 2FC8A 5KFFA 4K0KF 3VVTA 2QJ3A 2OO4A 1RTHA 1QTMA 1N5VA 1FK9A 1OMSA 5KT3A 1YK9A 3GP9A 2D74B 2V2VA 3BBBA 1FE0A 4Q7AA 1KVJA 1WG1A 8AT1B 2DEJA 5HO4A 1KHNA 1GTHA 3KLHA 4JI6J 4KFBA 4A8YA 3MAAB 2DYAA 4DV6J 4ZJOA 5ITHA 4LF6J 3QIDA 2AT1B 3BF4A 1DHMA 3A1YG 5CAAA 4BC9A 2VG6A 4XDCA 1WSRA 2NYHA 2P9GA 2YWFA 1ELXA 1RBLA 2GIQA 4PXCA 1CBKA 4PQUB 2CQHA 2ADCA 3PIPQ 5IM0A 2L9NA 5T7LB 4WPAA 1S1UB 2DY1A 3PDNA 1O98A 1U6FA 1OJ4A 3AAWB 2N3OA 3QIPB 4FPRA 2IM0A 3M30B 4KYZA 1B0TA 3QRQA 2LECA 3SYZA 1BXNA 1K0VA 5D8HB 4L3KA 4NCAA 3QGPA 4MKBA 2OH2A 2GMHA 1N2KA 2DNGA 4ETXA 1EJ7L 4RPFA 1ZEFA 1N32F 1UKUA 3GR1A 2HHHF 4CRJA 1SC4B 2X3DA 1FWKA 3THTA 3HVTA 5KFAA 2ZJRQ 3T5HA 1ZZNA 2XMTA 2OPPB 4ATNA 4B3OA 1IJEB 1M5OC 2WOMA 2UV8G 2XGQA 4ZG6A 4DX8H 1DQ8A 4ECTA 2J0SD 2FVQA 3T1HF 4O4RA 1K7HA 4J9OA 3FBEA 5LOQA 4U7UD 2BE7D 1EETB 2DPIA 2IM3A 2NPIA 2P8IA 2F4VF 3I32A 2DGWA 2BE9B 4UOPA 3BYPA 3T41A 3MPVA 2QLBB 1F9EB 1QE1A 2HVEA 2MMYA 3SFGA 3VVUA 5BR8F 4DG1A 3KLIB 1HWKA 2HSEB 4IOCQ 4BWJA 3NGUA 1U0HB 1OWXA 2CDRB 3L7UA 2M70A 3CJKB 2XY7A 1B99A 3MXHP 2LQBA 2A10A 4A8KA 2QLJB 3NCQA 4KRWA 2CADA 1FRJA 3IR6B 2BEFA 4EBCA 3G82B 5KFSA 4DLGA 3CC2S 2AX0A 5K8MA 3HMJG 5GVQA 2GX8A 4LSLA 1QD1A 2ZHBA 2NUHA 2BE2B 3NNHA 1EAYC 2DGTA 3FMBA 2UUBF 2CQ3A 2DKOB 1U48A 1RAGB 5LXYA 2JDJA 1H0HB 1EW9A 1U24A 1KTVA 2XHWA 4ZPDA 1O99A 5E3PA 2ZH8A 5BXIA 2PIIA 4HH1A 2CVEA 1U6ZA 3VAGA 3OSPA 1RT4B 4DSLA 1N36J 1M5KC 5A8KA 2XYHB 1BUXA 2Z8QA 3JSBA 2AIRB 2BANB 3NLCA 4DR3F 3UN5A 3C3LA 3QGIA 1IBKF 3V4MA 4AL5A 5HN0A 1BWVA 2ZE2A 1NH8A 4USJC 1XK8A 3BSNA 3AQOA 4H54A 2GVZA 2F4FA 4MIWA 3SZYA 4ZG9A 1KVKA 3TARA 2RDIA 3KLEA 4B3RJ 5KG7A 1FEEA 2XMKA 4KTQA 2LEBA 1R6VA 1NSKL 2RB7A 3BKTA 2HHPA 3OBIA 3T1AA 5LMNF 3CJQA 1RT5A 2F1FA 3I55S 4ES3A 1YJ7A 2B7CB 1X4HA 3FEXB 7AT1B 3N6NA 3NS5A 1I51B 1HQ2A 1KR4A 3KYLA 4HHJA 2J7WA 3OUYB 3G6VA 2J76E 4K4XA 2AGOA 2M88A 4OI0A 2JH3A 2FZCB 2B43A 1NDLA 1HNVA 4UOOA 3TZYA 1KBRA 4P75A 3MEGB 3AA8A 3PYFA 4KBIA 3U02A 3CUNA 1HHSA 1RADB 3QJLA 2C2DA 2DGUA 4NLRA 4J7CA 1FD8A 4V19X 1YBUA 3PW7A 2G1DA 2ASDA 3CTRA 2M3DA 3I82A 3NOGA 1IKWB 1U2FA 2EPIA 1AJBA 4QR1A 1FWPA 4WZMA 4DQRA 2FPHX 3NOCA 2QTWA 2KFYA 2VG7B 2IC3B 2HNZB 1UP1A 2W25A 2W5QA 4LF7F 3PACA 4IFYA 4DL5A 4F04B 1J2VA 3ED4A 2DO4A 2YXLA 2FIUA 2CPDA 4OLPA 3HT3A 2OMOA 2R7VA 2APOA 4RBTA 3M9MB 4AXJA 1ALKA 2LXIA 3PXGa 2WVEA 2H9ZA 4NXNJ 3TX8A 2PE8A 1RWPB 1VQ6S 1WHYA 1P9QC 3NKOA 1F9HA 3OFFA 2ILYA 5AXLA 2FQQB 1X9SA 3G8SA 3AJDA 4F0HA 1SJQA 2L08A 3LANA 4PPZA 1ZTWA 1VRTA 2VQFF 1YZ7A 2W5VA 3JTOA 2GZOA 4K4SA 2J9DA 2O67A 1JWWA 2KL8A 3CDAA 2FJVA 1UZHA 3CNQP 1F5AA 4B9LA 1T9TA 4UTGA 1Y7AA 1ZM3A 5F9NA 4ZVHA 1B7FA 4DCOB 1DTQB 4FDFA 3ZTPA 3LXQA 1M90T 4ID5B 3MAAA 4HI2A 2FY1A 4EBDA 3GV8B 4ECQA 3GYNA 3J81Y 3CD6S 1D9DA 2R2RA 4V19J 3BQ2A 3IC1A 4DF8A 5D0HA 4DR5F 3TWZA 3GG1A 4N7TA 1UETA 3R2CJ 1S9GA 2C3YA 4CTAB 5T7LA 1L3VA 1S1UA 2J6TA 1VQSA 2YNIA 3AHPA 3EE3A 4ZN1A 1RWKB 4NX9A 3E51A 3H8YA 1IQZA 5HQMA 2NREA 3HJFA 3CJ4A 1I3OB 1U4BA 3M30A 2ZBIA 1SUQB 3R7SB 3P5BP 1P8GA 4K0KJ 3UCZP 3KJNB 5F8JA 4C4WA 1J27A 1FXDA 1DTTB 2R7XA 3MF5A 2MQOA 2P9CA 2X7IA 1FRHA 1VFJA 3DLBA 3ZFVA 1U8WA 1X9WA 4RUHA 1F3VA 3RUBL 2IA6A 3K59A 4TYBA 2DR7A 3ENWA 3Q8UA 1VHIA 3D3BJ 2MGZB 4F4YA 4OYPA 5E3RA 4CYRA 3AFGA 2GA7A 2BKPA 3BR8A 3M05A 3IO1A 3OQ2A 4NLYA 2HFNA 1NM2A 2OPPA 5K8OA 4O0NA 4LF9F 4K59A 5ETSA 2ZH5A 1PGZA 1VRUB 1RP5A 1GNKA 5L39A 2EFGA 3QATA 3CCUS 1YSJA 1EETA 3ZZTA 3TA2A 3UR3C 5F8MA 3DPCA 1URRA 5DZ6A 1OYDA 3G8QA 3MZIA 4TVAB 2HFVA 5I3UB 1RAJA 3R7NB 5M2UA 4IH5A 3L09A 3IM9A 2RF2B 3NL0A 4ILMA 1Y7PA 4WE1B 3KLIA 3X1LB 1BQNB 2W01A 1WC3A 3ADAC 2NSCA 2KYXA 5L1LA 1U0HA 4N56A 3QRRA 4I1TA 4MK9A 2BJEA 4UY8T 4QU7A 3CJKA 3ZZUA 1NCLA 2HW3A 3PNIA 3E3XA 1TR0A 4RW6A 4X64F 1QJHA 2BVZA 2DITA 2R8IA 1PJ7A 4NASA 2YH1A 1FJCA 1N32J 4OYBA 1FKOA 1WHXA 1KQKA 4L76A 1XC9A 4LIRA 2O1PA 3MMCB 4CLPA 2BE2A 4XPCA 2ZZTA 3DRPA 1CSJA 3UNYA 4D3HA 4LBPA 1RZMA 1M5PC 1LWFB 5TJ3A 2YKMB 2YVSA 4B3TF 3PCOB 5AE1A 3BDEA 3HVRA 4YFUA 3O6QA 3QLHB 5A76A 4BDPA 4ZA1A 3IRWP 5DQHA 2ZM6F 3DKDA 1FNOA 2B51A 3DI6B 2CQPA 4CO5A 2ZH1A 4AUKA 3CIMA 3ZZOA 1AJCA 2BANA 5KG6A 1H6KX 5M2PA 4QU6A 4DZDA 1NHVA 2WCXA 1S99A 4USMA 3AJ2A 2EFOA 1ZZFA 4DX7A 1AZSB 1SVDA 3IR7B 1Q4RA 3HO1A 4Y6IA 2V2QA 1RKJA 4KAVA 5ETNA 4URQU 4F36A 4UZCA 2BV3A 2VA2A 1ZM2A 1TUVA 5JVGQ 2QX0A 3KNAA 3PYGA 4A48A 4LR2A 2G0IA 3KFWX 5KG5A 3W65A 4C8MA 1URNA 2NR0A 3SCIE 3DRRB 3AD7C 5KFDA 6FDRA 2UUBJ 3PJWA 3QRPA 1UZDA 4IRCA 3U1MA 3H59A 2L41A 3DYAB 4EUVA 2OGUA 2PC6A 4NMXA 3CD5A 1CULB 2RS8A 5F8NA 1FFWB 2IUCB 1KQSR 5G0RB 2VJVA 1JLEB 2HWHA 3MEGA 4DN0A 2QG9B 4DQIA 1DARA 4QYZK 3GSDA 4NWXA 2K7JA 4JV1A 3NVLA 1U0SA 3D1QA 5DG7A 1U2RA 2OEMA 3ZZPA 5CH7B 2OIHA 2NXJA 3DGPA 1WF0A 3TUPA 3L7OA 1PYTA 1FX4A 1YVFA 3M8WA 4LSNA 4GKJJ 3N6MA 1H3DA 2YWWA 4Y3CA 1IKWA 4PR6A 2JFDA 5D0EA 2R7UA 2R7WA 1TMMA 3X3UA 1EI6A 1U7LA 5LMNJ 2E44A 3SFUA 2E1CA 3MFHA 2ZC4A 2W5RA 1TL7B 2JLGA 2VG7A 2IC3A 2XMVA 1Q8IA 2HNZA 4NA2A 1R43A 4OFZA 3K8VA 4FBUA 2KTQA 1AT1B 1YKWA 2IVFB 2KI2A 5IJQA 3NS7B 2WW8A 1H38A 4I68A 4WXWA 4NE9C 5C42B 3MOZA 2GHPA 2ATCB 4HH0A 4TQSA 4RZRA 1YG0A 1VQYA 3GJRB 1WEXA 2W5XA 3RG6A 3AJ1A 3WAVA 1X4CA 4XTTA 4Y2AA 1UPMB 5KG4A 4RU2A 1B8JA 4P71A 4DPTA 1ZEBA 1C4AA 1XMOF 4B9UA 1CVJA 4Y28C 3IDDA 3LGMA 3DLEB 5L9XA 3MM8B 2E7XA 3LGHA 1WC5A 3ISNC 1HARA 4IR1A 2XQCA 2YPZA 1FESA 5EUHA 1K44A 1K1QA 4R0EA 5AE2A 1TL4A 1JK9B 1HD1A 2XMJA 5GAHU 3JYTB 2R7RA 1F60B 1YJWS 3KKFA 1Q82T 2GSNA 2RMLA 3DRXA 2H1YA 1EX8A 1U8SA 2FVCA 3N5FA 1SCJB 1AFIA 5IWAF 4ES1A 3IGZB 2K2PA 1KH7A 2DY9A 5KFJA 3D68A 4ID5A 2I6WA 4AL7A 4UQGA 5AJ3F 4CO4A 3DM2B 2C2ZB 3NY0A 4Y2CA 4ZPWR 2MB0B 2KO1A 2C28A 3BGLA 2EKYA 2HLTA 2MKYA 1HL6A 1L3KA 2FJWA 4FXVA 4NLGA 4CTAA 5IQ6A 2W9BA 2BJDA 3V6KA 2Z2LA 4W98A 1KLMA 1YJVA 2M9KA 4FNIA 3KLFA 3GIRA 4XO0A 1NO8A 4DV3J 4LIWA 2M8HA 3PJXA 2ZC3A 3E01B 2M2BA 1SUQA 3BDGB 2ALYB 2NXEA 4KT0C 2GSOA 1VJQA 1RAAB 4DI6A 4B08A 1URBA 2PT0A 2WVCA 1DTTA 2QT7A 4B3SJ 1LNQA 3B78A 5HVHA 3PEJA 4NZ0A 5BJRA 4WU2A 3M9NB 2D9PA 3M8RA 1SQEA 1X8DA 2MGZA 1S0OA 3R8YA 1WF1A 2G2YA 4X62F 3CCLS 1WSVA 4LR8A 5K4PA 4HT5A 1AJDA 1WC0A 4ZVRB 3R97A 4RNFA 4WF9Q 4BHQA 5U47A 2GJ2A 1W2BR 1VRUA 1WOPA 4X4TA 3UE2A 3OTEA 1LK7A 2GQCA 1N4LA 2BXJA 2UP1A 3AB4B 4RUAA 1OQ3A 3IWXA 9RUBA 5AXNA 2HEKA 3SSQA 2WW4A 2MZJA 1UFLA 2ZH6A 2RF2A 1GH8A 4WE1A 2DH7A 2MLZA 1SB6A 1BQNA 2B9WA 4P52A 3T9NA 4DFJA 2WBRA 1YHQS 1TTHB 4GTZA 1KHKA 3P8BB 3WC2A 3AD8C 1CQNA 2ZNYA 4ZCIA 3CPWR 3NP5A 2AEFA 5T41A 2OJ3A 2V63A 1QSLA 2UVVA 2MQPA 4JI1F 1WTFA 3D3CJ 5T14A 5LSLA 3MMCA 1T9WA 3MUMP 3M8ZA 4KKOB 2J8SA 1Y0HA 2A6MA 1LWFA 2MZ1A 1S59A 2YKMA 1CJVB 2CJBA 1NU4A 4O3QA 2AF6A 1LW2B 3K5MA 2HGMA 3QLHA 3O5TB 3VZHA 3KG1A 4PWDB 2RDDA 5AXKA 3N79A 5A8WB 3DI6A 4S0MA 1RAHB 2LKZA 2PGCA 2JL9A 3K5OA 5KFXA 2SXLA 2B9XA 2YNGB 2MTLA 3B8HA 4CQ1A 3PRBA 4DOZA 4CYSA 2AP6A 3LTOA 2CYYA 3KUGA 2VOPA 3HSDA 5HMZA 4WTOB 2HIQA 1SXLA 1YZ6A 5AXMA 4G65A 3BDFA 1S0NA 2FLOA 1YDLA 2QN6B 4EYIB 4UPKA 4Q43A 3M4XA 2OI2A 2XWXA 1LWCB 1R6YA 2GHWA 4K4WA 3HF5A 2CPHA 1C0TB 2FHOB 4FXDA 1HW9A 1HLWA 3DRRA 4I2PB 4IO9Q 1NH7A 4G6VB 3OLAA 2ABYA 4DV2F 4C0OC 4MIAA 1G3OA 3DYAA 2VF3A 4M63A 3POTB 1Q0NA 3AT1B 4WKRA 3UNGC 2QSFA 4UPHA 1VJWA 4N5SA 4ECVA 3K0JA 1CULA 2IJFA 2IUCA 3D0HE 2D3O1 2KG0A 4J9KA 3PX0A 4EFAC 1WACA 2HGLA 2B6AB 4ZPTR 4F4KA 3NAHA 2DPJA 1FFGB 1UWAA 2LXUA 3PR4A 4JV2A 1XQIA 1Q53A 5KFNA 1C0UB 4DZ6A 3Q23A 2ZITA 3SCLE 2XY5A 4N47A 1P27B 3FUYA 4B9VA 3RB4A 2N7CA 3BO2A 1FX2A 3WBZA 2DHAA 3RZAA 5HROB 4LF1A 4CYUB 1SQGA 2DGXA 4D3GA 2CVIA 4GO7X 4Y65A 2YBVA 4MT1A 3AQPA 4DPXA 4LF4J 5JMNA 3GQCA 3MMAA 4DPWA 3CJSA 2K1RA 4HKQA 2HWTA 2AEMA 4U6PA 1T9UA 2W9CB 2BABA 4QW8A 5C42A 3NWRA 4TY8B 4JI2F 1KFSA 4DX5A 1VCTA 1U09A 2F8EX 1IWAA 4JI5F 4EI2A 5KFTA 4J9PA 1TAQA 4NLXA 4ZOSA 3BZQA 1T7PA 2IFXA 3PTWA 1F5CA 1EQ0A 1IR1A 2W8DA 1WI8A 2PDAA 4CLZA 1RWMB 1R3NA 2HVIA 1U47A 1KHWA 4CT8A 1GXLA 4DR2J 3OHBA 2CJKA 1PSDA 3OVSA 4YR3A 4J9LA 1ZAWA 2W24A 2XI2A 3RW7A 2W2OP 1Y11A 2F8HA 3RBEA 3MM8A 4LFBF 3CMQA 3FBFA 3IN5A 1Y3JA 1ALIA 3OHAA 5EX0A 3KMQA 4ITSA 4J9VA 3OL7A 3GZ7A 4WZQA 4DN9A 1Q8LA 2OSRA 2BYCA 3FSIA 4YOEA 3K2YA 3TZZA 3JYTA 1RISA 3QT7A 4F26A 2J0XA 2DR6A 3WX8A 2D3ZA 3J7ZT 4RW7B 3GG0A 3DDKA 3H98A 1N56A 1NK8A 3GIJA 4JB8B 2VA3A 2V69A 1SHNA 1FRKA 4RWXA 1GQEA 1NJZA 3HKWA 4ZLNA 2Q66A 4HACA 4OZ0A 1V3SA 2IA0A 2Y3YA 2X1FA 3THPA 3NMAA 3M2UB 2Y9HA 3A3OB 1SL1A 1S9EB 1XTZA 4NRUA 4ZHRB 3TUIC 1SKUB 4ZVOB 1B0PA 3CO0P 3BYRA 4ZJQA 1DQ9A 1CJKB 1PILA 4K5RA 3BSAA 3F56A 3ENVA 3PG9A 3M32A 2HBQB 2IRXA 1KP6A 4QWDA 1G6BA 1MROB 4Q2MA 1VC0A 3VALA 2MQ8A 5IZHA 3CD7A 1RHKB 3E01A 5KG3A 4USUA 2M7SA 5J2PB 2MXYA 2D1CA 1RWXB 2XTJP 1RUSA 1XERA 3OT9A 5FJ4A 4FN5A 2HFZA 2VPYB 2BQ3A 4Q5VA 3NXZA 4ZP6A 3W62A 1HR0J 1F5BA 4G3IA 1G1XA 2WVFA 3P49B 3LALA 2AYGA 5LJ3Y 1U6BA 4HR2A 1CLFA 1NNDA 2QMWA 3E2EA 2BMBA 1NJWA 4PYAA 1X60A 4C0BA 2I38A 1RCOB 1FSUA 2JC0A 4FP9A 5IT4A 1RHMB 4N8OA 3KLVA 4ILLA 3Q8QB 5AT1B 2KHDA 3P6YC 2LQ5A 5FLXY 4I6YA 2B0GA 2HFUA 3HT0A 4DCJB 1JLQA 2HHWA 2DCUB 5ETPA 2NCKL 4KGVB 2VODA 3NKQA 2GFFA 1A6LA
chains in the Genus database with same CATH topology
3UN2A 1KH4A 4LR9A 2GLQA 3T00A 1ED8A 3WAVA 3MK1A 5DLTA 4MHXA 3NVLA 4QAXA 5LIAA 4GTWA 4FDIA 1B8JA 3DYCA 3UN3A 4YR1A 1ELXA 3OT9A 2D1GA 1E2SP 1AUKA 1ZEBA 1SHQA 2W8SA 3WAYA 4B56A 4UPLA 5GRRA 4UPIA 3NKPA 4NWJA 4CXUA 3CMRA 4MIVA 3WAXA 1P49A 1Y7AA 1ELYA 3A52A 4ZG6A 4ZGAA 3TG0A 2W5TA 4UPHA 1SHNA 3IDDA 2XRGA 1EW9A 2W5QA 3M8WA 3TX0A 1ZEDA 2XR9A 3KD8A 1K7HA 3NKRA 5LRMA 4KAVA 1HDHA 1O99A 2IUCA 3LXQA 1ALJA 5IJSA 3M8YA 1E3CP 2GSUA 1AJAA 3ED4A 2W5SA 4MY4A 4LR7A 2IFYA 4CXSA 1Y6VA 3UO0A 1KHLA 1O98A 4FDJA 3T01A 3MK2A 5KXAA 4UOPA 1EW8A 1EW2A 4LRCA 2ANHA 4UOOA 3T02A 1ANIA 4LR2A 4LRBA 2W8DA 4CYRA 1EI6A 3BDGB 4UORA 1ALKA 2GSOA 1EJJA 1URAA 4GTXA 2GA3A 3M7VA 1E1ZP 2W5RA 4CXKA 2GSNA 3UN5A 4LREA 3WAWA 4LRDA 3UNYA 4KJGA 1URBA 5INHA 4GTZA 5EGHA 1FSUA 5L0BA 3IGYB 3Q3QA 4CYSA 1KHKA 1KH5A 4KJDA 5EGEA 3TWZA 4TN0A 4N7TA 1N2LA 3BDGA 4KAYA 1EQJA 5HRTA 1ED9A 3NKOA 1HJKA 5TJ3A 3IGZB 1ELZA 4LRAA 1KH7A 3SZYA 3BDFA 5IJQA 4ZG9A 3B5QA 3NKNA 1HQAA 1ALIA 3E2DA 4LRFA 1E33P 2W5WA 4KM4A 3DPCA 1KHJA 1KHNA 5LQQA 2IUCB 3MK0A 1ALHA 4UPKA 4LQYA 5C66A 2G9YA 5LRNA 5L0KA 1N2KA 4GTYA 1ANJA 2RH6A 3WBHA 4ZG7A 3BDHA 2QZUA 5DLVA 2VQRA 5AJ9A 2W5VA 2W5XA 1ZEFA 1KH9A 5GOVA 1AJBA 3NKMA 4LR8A 2X98A 5K4PA 4NWXA 5L0EA 3NKQA 5DLWA 1AJDA 1AJCA 3SZZA 3M8ZA 2ZKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UN2 A;  1KH4 A;  4LR9 A;  2GLQ A;  3T00 A;  1ED8 A;  3WAV A;  3MK1 A;  5DLT A;  4MHX A;  3NVL A;  4QAX A;  5LIA A;  4GTW A;  4FDI A;  1B8J A;  3DYC A;  3UN3 A;  4YR1 A;  1ELX A;  3OT9 A;  2D1G A;  1E2S P;  1AUK A;  1ZEB A;  1SHQ A;  2W8S A;  3WAY A;  4B56 A;  4UPL A;  5GRR A;  4UPI A;  3NKP A;  4NWJ A;  4CXU A;  3CMR A;  4MIV A;  3WAX A;  1P49 A;  1Y7A A;  1ELY A;  3A52 A;  4ZG6 A;  4ZGA A;  3TG0 A;  2W5T A;  4UPH A;  1SHN A;  3IDD A;  2XRG A;  1EW9 A;  2W5Q A;  3M8W A;  3TX0 A;  1ZED A;  2XR9 A;  3KD8 A;  1K7H A;  3NKR A;  5LRM A;  4KAV A;  1HDH A;  1O99 A;  2IUC A;  3LXQ A;  1ALJ A;  5IJS A;  3M8Y A;  1E3C P;  2GSU A;  1AJA A;  3ED4 A;  2W5S A;  4MY4 A;  4LR7 A;  2IFY A;  4CXS A;  1Y6V A;  3UO0 A;  1KHL A;  1O98 A;  4FDJ A;  3T01 A;  3MK2 A;  5KXA A;  4UOP A;  1EW8 A;  1EW2 A;  4LRC A;  2ANH A;  4UOO A;  3T02 A;  1ANI A;  4LR2 A;  4LRB A;  2W8D A;  4CYR A;  1EI6 A;  3BDG B;  4UOR A;  1ALK A;  2GSO A;  1EJJ A;  1URA A;  4GTX A;  2GA3 A;  3M7V A;  1E1Z P;  2W5R A;  4CXK A;  2GSN A;  3UN5 A;  4LRE A;  3WAW A;  4LRD A;  3UNY A;  4KJG A;  1URB A;  5INH A;  4GTZ A;  5EGH A;  1FSU A;  5L0B A;  3IGY B;  3Q3Q A;  4CYS A;  1KHK A;  1KH5 A;  4KJD A;  5EGE A;  3TWZ A;  4TN0 A;  4N7T A;  1N2L A;  3BDG A;  4KAY A;  1EQJ A;  5HRT A;  1ED9 A;  3NKO A;  1HJK A;  5TJ3 A;  3IGZ B;  1ELZ A;  4LRA A;  1KH7 A;  3SZY A;  3BDF A;  5IJQ A;  4ZG9 A;  3B5Q A;  3NKN A;  1HQA A;  1ALI A;  3E2D A;  4LRF A;  1E33 P;  2W5W A;  4KM4 A;  3DPC A;  1KHJ A;  1KHN A;  5LQQ A;  2IUC B;  3MK0 A;  1ALH A;  4UPK A;  4LQY A;  5C66 A;  2G9Y A;  5LRN A;  5L0K A;  1N2K A;  4GTY A;  1ANJ A;  2RH6 A;  3WBH A;  4ZG7 A;  3BDH A;  2QZU A;  5DLV A;  2VQR A;  5AJ9 A;  2W5V A;  2W5X A;  1ZEF A;  1KH9 A;  5GOV A;  1AJB A;  3NKM A;  4LR8 A;  2X98 A;  5K4P A;  4NWX A;  5L0E A;  3NKQ A;  5DLW A;  1AJD A;  1AJC A;  3SZZ A;  3M8Z A;  2ZKT A; 
#chains in the Genus database with same CATH topology
 1EKS A;  1KQF B;  4LF5 J;  1RAC B;  2WAQ D;  2YPY A;  3R7B B;  3GMG A;  3DU5 A;  3KHG A;  1VIX A;  3KJF B;  3MR2 A;  2FHJ D;  3MR7 A;  3IG1 B;  4DV0 J;  4FYD A;  2R4F A;  3ULH A;  2UVR A;  4PXB A;  5B0B A;  5F41 A;  1L3T A;  4CO0 A;  1C2P A;  4C11 B;  2Z2Y B;  2W2M P;  4X62 J;  4CXS A;  1R89 A;  2F63 A;  2FJB B;  4YS2 A;  1X4E A;  4ZIV A;  2MZT A;  4KKO A;  4GKK F;  4TXS A;  4JI0 F;  5IT0 A;  4DSJ A;  1RA7 A;  3RU0 A;  1HNZ F;  5IC6 B;  4OV1 A;  2XLJ A;  1H7X A;  3SQO P;  1CJV A;  1UVK A;  1ZBT A;  3BQ1 A;  4LFC F;  1LW2 A;  1ZM4 A;  4PXE A;  1I6J A;  3B4M A;  4JYA F;  4Y2M A;  4CO1 A;  4PWD A;  3KNG A;  1ZPV A;  1TUG B;  1F6T A;  2QA4 G;  5JJB A;  5IC4 B;  2GJI A;  3O8W A;  2LFV A;  2HZV A;  4F3Q A;  1YWX A;  5LMU J;  3HVW A;  3IBW A;  5H9E K;  1DZ5 A;  1HNX F;  1RI7 A;  2K7K A;  2JLE A;  5FDL A;  3T00 A;  4PG5 A;  3V81 B;  1HMV B;  3EVM A;  1S12 A;  1FD2 A;  2CQG A;  1X7V A;  1GX6 A;  2FVR A;  5KFO A;  2AW0 A;  1TUW A;  1YRU A;  3C46 A;  4OI2 A;  3WAX A;  2C2N A;  4PUO B;  3BGU A;  1FXR A;  2VFU A;  3MPY A;  3TX0 A;  2PFD A;  2GML A;  4DL2 A;  2E1M C;  3RBD A;  1S1V B;  5EWF A;  4DV5 F;  4IQM A;  4EGL A;  3G9C A;  2AZ3 A;  3QGH A;  2DHS A;  1YIT S;  2Y1I A;  4I2P A;  3RB3 A;  2DNR A;  2RVJ A;  2WON A;  3CCJ S;  1URA A;  4NWB A;  2B4P A;  4IRD A;  2Y1L B;  1VOM A;  1HHQ A;  1FJE B;  2H5I B;  3POT A;  4OX8 A;  1AXQ A;  1YJR A;  2FGO A;  1RTJ B;  1Y5N B;  3TZX A;  3EGZ A;  3F0N A;  2MY8 A;  3LPE A;  5HMX A;  2P5V A;  3GV7 B;  3M8Q B;  5J1N A;  2Z2Z A;  4YDX A;  4XAK A;  4DU7 A;  2VON A;  2CQC A;  1QSY A;  3NBP B;  1ROF A;  1FKP B;  1K73 T;  2GV1 A;  2C22 A;  2VIC A;  3WHI A;  4ECU A;  1U2C A;  4Q44 A;  1APS A;  5A0Y B;  3FQK A;  3C6T A;  5CYQ B;  1SJ3 P;  2RHQ B;  1GEH A;  1S6U A;  1FKA F;  4QZV B;  4CO2 A;  1C0U A;  3C16 A;  3AB2 B;  4NYO A;  4Q8F A;  5HQ8 A;  3OV7 A;  1SV5 A;  2C3O A;  2BJ1 A;  4ZCK A;  4IOA Q;  2CZ4 A;  4NYP A;  3W5Y A;  3OVB A;  3KLG B;  3EJM A;  5CA5 A;  5CCM A;  3AXK A;  2HVZ A;  3MAQ A;  4CYU A;  1EW2 A;  2OAU A;  1WTB A;  2Z30 B;  1T95 A;  2MKS A;  3MM9 B;  4DV2 J;  1CQM A;  5ETV A;  1TU0 B;  3EMT A;  3OW2 R;  4QYR A;  1RTI B;  1J5O B;  2RRB A;  3QAU A;  2ZDO A;  3HX9 A;  1LW0 A;  4O44 B;  3AA9 A;  4OYI A;  4BLG A;  5E3Q A;  1KOH A;  3NRB A;  4ZK7 M;  2DNN A;  2AV5 A;  4OJH A;  2RIL A;  5K5M A;  4DR1 J;  4OIX A;  5J2N B;  3I31 A;  3SSR A;  4DPO A;  5KFY A;  4PCQ A;  3JAM U;  1OIA A;  3EZU A;  3W8G A;  4OMF G;  2MJN A;  4F0M A;  4RNO A;  2HVH A;  1CC7 A;  2FJE B;  2NYI A;  2QL5 B;  3R3T A;  1ZED A;  1NHU A;  1MMN A;  1X4A A;  2XB2 D;  1H74 A;  5ETL A;  5CD4 H;  4FZV A;  5D4N A;  2AYB A;  1XMQ J;  1LXN A;  3D2W A;  4EO6 A;  1N5Y B;  1RT1 B;  4DV7 F;  1SKW A;  5KXA A;  1DBD A;  1MU2 B;  2BA9 A;  4M5M A;  3QT5 A;  4BBY A;  4A8S A;  3JXO A;  3DLG B;  2VBY A;  4RW7 A;  3C66 A;  3WIU A;  2C3U A;  3DNC A;  1VRQ C;  2XY6 A;  1RTZ A;  2E7W A;  5IT9 Y;  4TN0 A;  2E7V A;  4KPY A;  2OPS B;  3T5L A;  1TL3 B;  4J9R A;  3HFZ B;  2D41 A;  2CJX B;  4I6W A;  4RW4 A;  2KXF A;  1S9E A;  4ZHR A;  2DRA A;  3TAQ A;  4MK7 A;  2IVM A;  2ZVI A;  1XWL A;  1CJK A;  3R5J B;  1P1T A;  3T9Z A;  4DUY F;  4PQA A;  2MZR A;  3R5G A;  2IMW P;  4PZV A;  4UUX A;  2D7S A;  4OZL A;  2WHO A;  3TRG A;  2HQF A;  4NI2 B;  1MRO A;  4R5P A;  2RUG A;  1PAU B;  5B0E A;  3SV4 A;  3A4T A;  2DNY A;  3HSZ A;  1TVR B;  3LP1 A;  2BR0 A;  3GFX A;  3QNW B;  2AYE A;  2GVD B;  4YHH F;  2JVR A;  3UDV A;  3KHR A;  4XDD A;  1XJW B;  4DV1 F;  4FF1 A;  3NKY A;  2VPZ B;  1K47 A;  1S97 A;  4NEZ A;  3HSJ A;  2AX1 A;  2Q43 A;  4KB7 A;  1UJ5 A;  1BY9 A;  3EPI A;  2CFX A;  3VQS A;  4ZCM A;  2HLU A;  2M0G B;  3CCV S;  5C66 A;  4IFV B;  5K20 B;  3EPG A;  2CJ9 A;  1RHU B;  2CRL A;  2JX2 A;  4C48 A;  3CCM S;  5C25 B;  4L73 A;  1S9F A;  1NBE B;  2J7K A;  1U1R A;  3O3L A;  2LXF A;  2QA1 A;  3MPD A;  4MH8 A;  4M1K A;  3AH6 A;  1BQX A;  1SJ1 A;  4K50 A;  4PG6 A;  5A2Q Y;  2JWN A;  4NCG B;  4ED2 A;  4ZMM A;  2ZD1 B;  2ZJQ Q;  3J80 Y;  2UUC J;  3IWL A;  4FXW A;  1HFE L;  2F5G A;  2QA2 A;  1JMT A;  5IJS A;  1WEY A;  3MR5 A;  4ECX A;  5HP1 B;  4CDI A;  4XK8 C;  1Y6V A;  3KJV A;  3LF0 A;  4PYD A;  2BX6 A;  2AZ1 A;  2RKI B;  3SQG B;  1VI7 A;  4TKT A;  5DGA A;  4CXK A;  4EBE A;  2ROP A;  3WAW A;  4CLW A;  3F73 A;  2LU1 A;  4KJD A;  3K8W A;  2CJA A;  3IG1 A;  1JXE A;  3DMJ B;  1L3U A;  3TAM B;  1RE1 B;  2WVB A;  4X4O A;  1QUP A;  4LRA A;  1VBY A;  4CLT A;  1RDR A;  3CME S;  3W8P A;  1YJ9 S;  2E9Z A;  3O44 A;  4C11 A;  3QFH A;  1EB0 A;  3R27 A;  3NGR A;  1ANJ A;  2DBB A;  3R9L A;  2DXE A;  3MM5 B;  3S6E A;  3CC7 S;  1XNQ J;  2RT3 A;  1EKR A;  4DMZ A;  3P45 B;  4R0J A;  5LSO A;  3HFK A;  3G2X A;  5ADZ A;  3MPU B;  3QJJ A;  5DLT A;  1N5Q A;  5LIA A;  1S57 A;  3R6G B;  1TEL A;  3W66 A;  4ZVF A;  2XSF A;  3I6P A;  4HLB A;  3AOD A;  4ANC A;  4DUZ J;  2KT3 A;  2HND B;  3MFI A;  3TNV A;  2CPX A;  5DDO C;  3IMQ J;  1IN0 A;  4P7T A;  4H4O B;  4YN3 B;  4URS A;  1ZA1 B;  1UFK A;  1NK5 A;  2DXD A;  2YKN B;  4KHM A;  2B56 A;  1HKA A;  4OX9 F;  1HMV A;  4A8F A;  1GXT A;  4ED6 A;  1EJJ A;  3J80 U;  2WSC C;  4K4U A;  1IM6 A;  1WWH A;  5HQL A;  2DNM A;  5HAN A;  1VBK A;  4K4T A;  2Q6C A;  5KG1 A;  5HMY A;  2DHX A;  3FJ2 A;  4F4A A;  5D3G B;  4PUO A;  4DR7 F;  2VG5 B;  5HRT A;  2E5L F;  3AXM A;  1VQ4 S;  3PR5 B;  1XN9 A;  5KFB A;  4NZ7 A;  3QWP A;  1YBT A;  1KTQ A;  1FNX H;  1S1V A;  5LXR A;  2LQ9 A;  3AD9 C;  3CB4 A;  1Q86 T;  1U1O A;  3O1L A;  1SKS A;  1IR2 A;  3VQT A;  2CNO B;  2DVI A;  1RAI B;  1N54 B;  3MEK A;  3OTO F;  4JI0 J;  4V1A k;  2E1P A;  2XMW A;  4ELT A;  5J2M B;  1BHN A;  5DLG A;  1TKT A;  2FLN A;  2KZZ A;  1TL1 B;  1WDD A;  1ICE B;  2CDQ A;  3DN9 A;  2ROE A;  4FF3 A;  4JYA J;  3DOM B;  3M8Q A;  4PPD A;  1HI1 A;  3VAI A;  4ES2 A;  4DSI A;  2IIH A;  4J9Q A;  4QCL A;  3VF0 B;  2UZA A;  3CCR S;  4W4M A;  1V5V A;  4MIB A;  2CA9 A;  1YJN S;  2PA3 A;  1HNX J;  4WFY A;  2OD4 A;  4PKD B;  5CYQ A;  3M2V B;  4ERD A;  4DL0 C;  2HKE A;  1FJ7 A;  3RR7 A;  3FSX A;  3W2W B;  2J6S A;  4X4U A;  1D8Z A;  1JLB B;  3U1N A;  2KM8 C;  3R6L B;  2AQ4 A;  3NNC A;  2DH9 A;  7FD1 A;  2YNF B;  1WOO A;  4GMK A;  3DXS X;  3T1Y F;  4OZ5 A;  3KLG A;  3Q8Y A;  1KQG B;  4NLQ A;  3GTY X;  2XEX A;  4TN2 A;  4C3K A;  1Z1Z A;  2QZU A;  1IWG A;  1DFD A;  3CJ5 A;  3D5M A;  4DPY A;  2QGF B;  1UW9 A;  1J5O A;  1X5P A;  2JEI A;  3TVK A;  5FII A;  2JNJ A;  4LUB A;  2DRB A;  5B0G A;  1UA0 A;  3LA0 A;  4ECR A;  1VQ7 S;  2A3J A;  3JQJ A;  3W61 A;  2LLZ A;  2XS7 A;  1YGY A;  1MWZ A;  4CWB A;  2GIR A;  3DCA A;  4ZJL A;  2V2Z A;  1QUV A;  4AFF A;  2BAC A;  1UL3 A;  2WVD A;  1GMU A;  3T01 A;  4C8N A;  3QAE A;  2R8K A;  1J5E J;  5J2N A;  1VDH A;  3ILJ A;  2CJY B;  4DV4 J;  1JLG A;  2MLY A;  3I4H X;  2W9A A;  5G4D A;  1R8H A;  4C3L A;  1TFW A;  4J91 A;  2ZHO A;  3TEH B;  2QYC A;  4RUC A;  4USK A;  5KFE A;  3O2I A;  5K8P A;  3N28 A;  4CNZ A;  4MKY A;  3BB5 A;  3MED B;  1LWE B;  1N5Y A;  4ECW A;  1RT1 A;  3CCQ S;  1ALH A;  1K1S A;  3HHE A;  4NLU A;  3CCZ A;  2DT9 A;  1EQM A;  1MU2 A;  2HNY A;  1Q5Y A;  3DLG A;  4K5S A;  3C8Y A;  2EBG A;  1W26 A;  1PYO B;  1PG5 B;  1TV6 B;  2FC9 A;  5KFG A;  2EC2 A;  2AD9 A;  1E6V A;  2HRY A;  5KFM A;  4YY3 F;  3IRX B;  1VC6 A;  2OPS A;  1TL3 A;  3ZZR A;  3UW1 A;  2QFJ A;  4NLD A;  1REG X;  5KT4 A;  4F4Z A;  2HFO A;  4ZP8 A;  2Z0G A;  4DFP A;  2QO3 A;  1S4E A;  3PZP A;  3GIL A;  3JB9 k;  1HWI A;  4DDF A;  1F2H A;  2DO0 A;  3KG4 A;  2YNH A;  1IBL F;  1IKX B;  2Y8W A;  4PG8 A;  3J7A N;  4KGX B;  5GMK a;  4NI2 A;  1GK8 A;  4PWU A;  2CNK B;  2CPJ A;  1BLU A;  2N7Y A;  3E2D A;  2V8G A;  2CG8 A;  1VK3 A;  1M1H A;  1FNM A;  2PSZ A;  1R0B G;  2GVD A;  5IQQ A;  3DDN A;  1RT3 B;  4DR4 J;  2A2C A;  4DX6 A;  3L3C A;  2JEF A;  3ZTO A;  1WEZ A;  2V94 A;  5DLF A;  3QO9 B;  2W8S A;  3LQV A;  3S8S A;  1N34 F;  1HNW J;  3HJV A;  1WUU A;  4W92 B;  3UWT A;  4LVN P;  1UEK A;  3HXM A;  4QWC A;  4LFA F;  2QFI A;  2DIV A;  2EEY A;  4X84 A;  4IFV A;  4AT1 B;  3ZNU A;  2B5J A;  2BQU A;  2ZJP Q;  5C25 A;  3PW5 A;  3PYD A;  1JXV A;  2BBE A;  4LRC A;  2W7O A;  2XG8 A;  1I94 J;  3HUL A;  4ZIT A;  4ZPC A;  3U1L A;  1S1W B;  1WD6 A;  4DUY J;  3HHL A;  3TAP A;  1X5O A;  2C1E B;  4NCG A;  3HSG A;  3HHL D;  3TA0 A;  2W4D A;  1T05 B;  2FZG B;  1VQM S;  2R8G A;  1U1L A;  4C0H A;  1Q5V A;  2ZH4 A;  2NQP A;  2VKR A;  1FVQ A;  2XCA A;  3MEE A;  1IXK A;  4P2S A;  3M1V B;  3G6E S;  4LJM A;  2O3D A;  2UXC F;  4TYA A;  1NSA A;  2XLK A;  1NB7 A;  3SIP B;  5H9F K;  2DR8 A;  1E6Y B;  3CO9 A;  1OYE A;  5DM7 Q;  3A8J A;  2LMI A;  4OZ2 A;  1HW8 A;  2CQ0 A;  2RKI A;  3SQG A;  2X98 A;  1X4G A;  5GAE I;  2LA6 A;  5C24 B;  1UW4 A;  2AMC B;  1DUR A;  2W2P P;  4EMD A;  3SZ2 A;  3FEY B;  4TLQ A;  1JJ2 R;  1AUK A;  1NXI A;  1FVS A;  1B3T A;  3TAM A;  1XNR F;  4JI8 J;  5KFU A;  3OXG A;  4ZGA A;  2X51 A;  2DIS A;  2MKI A;  5HAO A;  2E5H A;  4F2S A;  2MQM A;  2BOP A;  4TY9 A;  3V6D B;  3PRD A;  5HLF B;  4LVO P;  2QZ8 A;  4L75 A;  3MM5 A;  1UVN A;  1SC3 B;  1RA6 A;  1QAY A;  3MCS A;  4JI4 J;  4CLU A;  1RWW B;  2JVO A;  3CE8 A;  2NS1 B;  3N9U C;  3NG8 A;  3Q2S C;  1UJ6 A;  1WHV A;  4ICL B;  2GQ2 A;  1FRM A;  4DWI A;  2MKC A;  1T03 B;  4BS2 A;  3MCO A;  4WP3 A;  1YLX A;  1HHT P;  3CJ2 A;  2HND A;  1N2L A;  2K8G A;  2JLF A;  2KJW A;  2VBW A;  3I0S B;  3PW0 A;  2PFF B;  2YKQ A;  3P4U B;  3FCH A;  4F4W A;  4H4O A;  1T02 A;  1Q95 G;  1NK9 A;  2GHV C;  1C1B A;  2W1B A;  2YKN A;  3DOK A;  2RNE A;  2W2Q P;  1DAX A;  3OTB A;  5CYM B;  1V3R A;  3A8E A;  2V34 A;  4USV A;  5F8G A;  1BE4 A;  1Q8K A;  2AJ4 A;  5D3G A;  4X65 F;  2VG5 A;  5GAE U;  4E8U A;  1S6O A;  5DJB A;  5HSP A;  1JX4 A;  3M2R B;  3HK2 A;  2VZ9 A;  2ZBP A;  4WFB Q;  3H4B A;  2J7U A;  3BH6 B;  4KV8 B;  1N33 F;  2R2T A;  3H7H B;  3GON A;  4GVL A;  1KHL A;  3W9I A;  3FVY A;  5J2M A;  1SH3 A;  1RJJ A;  1YX2 A;  3VGT A;  1C1C B;  3PW4 A;  2DGQ A;  2VBX A;  1TL1 A;  4RBU A;  3R1H A;  1IBM J;  2WZ1 A;  3DOM A;  1EAR A;  3D28 A;  3EZO A;  2A2D A;  2JRS A;  2KZM A;  4DXL A;  3G87 A;  1ZTT A;  3D6F B;  1WDT A;  2OTL S;  4QIV A;  4LF6 F;  2RD5 C;  4IO1 A;  4E0D A;  2DIU A;  2V6A A;  3D4J A;  2C42 A;  4OX9 J;  1FO1 A;  3VR1 A;  2HBY B;  3EGW B;  4IH6 A;  1G7C B;  1OQ6 A;  3W2W A;  2ZOF A;  3DRY A;  5DO2 A;  5THW A;  4TU7 A;  3R2D J;  4LSZ B;  4DR7 J;  3GYG A;  2DCL A;  2YNF A;  3QJP A;  3NKP A;  4DUT A;  3RGI A;  2DTJ A;  2RUS A;  4WYL A;  2JJ4 D;  3TJA A;  3GB0 A;  1NDP A;  1U02 A;  5EWG A;  1ZET A;  3I5A A;  1JQG A;  2G13 A;  1M0S A;  3IS9 A;  2HQD A;  4MTP A;  1SKR A;  4OHY A;  3Q89 A;  3H2V E;  1UA1 A;  3UCU P;  1BMQ B;  1RTH B;  3VTI A;  3GE9 A;  1YQH A;  2GGP B;  1T9V A;  2H54 B;  1Z4U A;  2E5J A;  4KH1 B;  2UXB J;  4OX7 A;  2VPX B;  5H9E J;  3M6X A;  3CGI A;  2ZOM A;  4WU3 A;  2DEI A;  2G2Z A;  1JKH B;  5DDR C;  4URG A;  2B4O A;  4IG3 A;  2ZH7 A;  3I9Z A;  4WXO A;  1NSQ A;  1B7Y B;  2MDA A;  3LWL A;  2LQ8 A;  3MK0 A;  1JIH A;  3I0R B;  3HZE A;  4ZG7 A;  1T9X A;  4UOF A;  1H2U X;  3LUY A;  3PX6 A;  2XO6 A;  4MYT A;  1TK5 A;  2FLL A;  5DGB A;  2QLF B;  1S1X B;  4FYY B;  2N3L A;  2RH3 A;  2ZDP A;  1VQ8 S;  3GFY A;  4HHU A;  5C7P A;  2CUY A;  4C3M A;  3HHK A;  4U8Y A;  4I7F B;  1HBM B;  2VH7 A;  2IM1 A;  1Y4Z B;  3ZZ0 A;  3ELH A;  3QMQ A;  1LQ9 A;  4DBQ A;  4QIF A;  3LAK A;  2JC1 A;  1HQU B;  3UD4 P;  1LWE A;  5C2G A;  1FFS B;  3QPI A;  4QW9 A;  1GX5 A;  4PQU A;  1SPB P;  1U45 A;  4FDJ A;  4P2M A;  4OLO A;  2JZ5 A;  3RB0 A;  1EW8 A;  4U7U K;  3A8K A;  2PMZ D;  1D9F A;  2ASJ A;  3OL8 A;  2J9C A;  1TV6 A;  3W64 A;  1RLD A;  4WFA Q;  4ELV A;  1D1U A;  3IAS 9;  4ZPA A;  4ED3 A;  2IBK A;  5L0B A;  3Q3Q A;  4EO8 A;  3CJ0 A;  3IRX A;  2PI5 A;  3QIP A;  3LPY A;  4JI3 J;  2BM0 A;  4UF4 A;  3CCW A;  3EVW A;  4NLP A;  4ZP9 A;  2BKO A;  3JSM B;  4A8Q A;  3K89 A;  2KKH A;  4J9M A;  2KYZ A;  3EUN A;  5HL7 Q;  3I87 A;  4CNY A;  3D6M B;  2YQ0 A;  2DB1 A;  2WOM B;  2HBZ B;  1X4F A;  2YWE A;  2B3T B;  4F50 A;  1IKX A;  3CDU A;  2XSJ B;  2RU3 A;  5MAO A;  4DQQ A;  3UD3 P;  4P72 A;  1RAO A;  1S6P B;  2XI3 A;  1MSW D;  5IFM A;  1N6Q B;  2W5T A;  1N36 F;  3NMR A;  4ZPB A;  2ZUA A;  2PO4 A;  2QE5 A;  4ZS6 A;  3CWJ A;  3IA0 A;  4QR2 A;  4DSE A;  5LSR A;  4MKV A;  1RK8 A;  2DNO A;  4XPE A;  3H42 A;  3SV3 A;  2XMM A;  1RU2 A;  2FHM A;  1NJX A;  5KT7 A;  3J81 U;  1HWL A;  2GA3 A;  1BC6 A;  2ZBR A;  3HP6 A;  3M6W A;  1XR6 A;  4YY3 J;  3IGY B;  5E3C A;  4ZDN A;  1KC8 T;  4LT6 A;  1KHV A;  2B9Y A;  1QAX A;  1FTR A;  4Y2K A;  4X4P A;  3JTN A;  5DRK A;  3MR6 A;  2HZC A;  2HHS A;  4RWW A;  4YUD A;  1A0O B;  4NLO A;  3M8S A;  4UZB A;  4LSL B;  5HAT A;  4C8L A;  1XBW A;  4ZP7 A;  4G1I A;  1TMJ A;  2I5J B;  3W2V B;  4LR9 A;  4ALZ A;  4P74 A;  1IBL J;  1JJ4 A;  3OLB A;  5LM7 E;  1T05 A;  3HZG A;  3HVA A;  3G82 A;  3HD1 A;  1JB0 C;  4X66 F;  2C3P A;  2PMH A;  1RWN B;  4FVC A;  2HHH J;  2G4B A;  3TG0 A;  3M1V A;  4YR2 A;  2WRM A;  4FYV B;  5D0R A;  3S01 A;  4DQS A;  2W8L A;  1E6Y A;  1E3C P;  2GSU A;  5L1I A;  3UPF A;  3TZW A;  4K8R A;  4ER8 A;  1TK0 A;  3J7Y I;  4PAB A;  2YX1 A;  1VBX A;  2E66 A;  2ZE2 B;  3T1H J;  3FGV A;  2AKW B;  3MD1 A;  1Y5L B;  3QBC A;  4QPX A;  2F4V J;  2F7V A;  3OJS A;  2Q6B A;  1RT4 A;  2VIH A;  1HPZ B;  3GSI A;  1ULR A;  4OHZ A;  4CH0 S;  5GAG I;  3BEG B;  4DU8 A;  3MCN A;  4Q2L A;  4FPI A;  5BR8 J;  3V6D A;  5HLF A;  1ZH5 A;  4K4Z A;  3B5Q A;  5KFH A;  3A3N B;  2XUL A;  4C6A A;  2VFV A;  1Y10 A;  3S1T A;  1WEL A;  1YIJ S;  2GJF A;  1RT5 B;  3KK3 B;  1QVG R;  2ZVS A;  3H5X A;  3NS6 A;  2DH8 A;  1F0X A;  4DSK A;  4WWS A;  4ICL A;  1VQO S;  1VIS A;  2ZKT A;  2I9S A;  3R1L A;  5KFR A;  4A8M P;  3GIK A;  4Y00 A;  2VDI A;  2DHG A;  1VLY A;  1TFY A;  4U67 Q;  4K4Y A;  4DL6 A;  4A8X A;  3SXL A;  1GT8 A;  1YJT A;  1GMV A;  1VQK S;  4FKY A;  2KDO A;  2YWG A;  1V3Z A;  4EYH B;  2LU2 A;  4QJV A;  4NXN F;  3OUY A;  5B0C A;  2W7A A;  3UDL A;  4KJI A;  3JSR A;  2ZNZ A;  5J1P A;  1H2V Z;  4ELU A;  4UOR A;  4WFZ A;  3MUR P;  2MZS A;  3UDE A;  3W9H A;  3UI3 A;  1S1T B;  2LEA A;  3BRE A;  1JLF B;  2WTF A;  2KFZ A;  1F2G A;  1TP7 A;  5LT5 A;  5KT6 A;  3OXF A;  3M2R A;  1P1L A;  2CPZ A;  4DR3 J;  4WFX A;  2HQG A;  1IBK J;  1DY3 A;  3FFI B;  4IOB A;  4LRF A;  5GAG U;  4KV8 A;  5LRN A;  4NXM F;  1JXL A;  1AYE A;  1C1C A;  4O3O A;  3W5Z A;  4UY8 5;  1T0T V;  4RL1 A;  4UW2 A;  1X4B A;  4IFY B;  4DS4 A;  5EDW A;  5IOL A;  1RTD B;  3KHL A;  1PAE X;  2M5Y A;  2WSF C;  4J9N A;  5F3T A;  4AL6 A;  5DG9 A;  2CXE A;  3HI9 A;  1VR6 A;  2DGV A;  1RWU A;  3UO0 A;  2RQM A;  2V68 A;  1EP4 B;  2R2S A;  4RNH A;  1XMB A;  5SUH A;  2XHC A;  3NGK A;  1R8A A;  1TKX B;  1OS5 A;  1CS4 B;  3FBB A;  3HKZ D;  2ADB A;  4CM0 A;  4R8U B;  2QYG A;  2AGP A;  3KDN A;  4UOG A;  4Z7Y A;  2EI5 A;  2IHR 1;  3MCM A;  5E2Q A;  4Y0F A;  3LP2 B;  3KUH A;  1RT2 B;  2AU0 A;  2UUT A;  5HVF A;  2MY7 A;  2OLW A;  5KT5 A;  2GGP A;  2E29 A;  4KGK A;  2OPR B;  4OYX A;  1NJI T;  4B17 A;  1JKH A;  3FEZ A;  3KJQ B;  2LVW A;  4J37 A;  2IPO B;  4HTI A;  1FWL A;  2WSE C;  3I0R A;  8ATC B;  3B6B A;  4MY4 A;  5CYJ A;  3ZXW A;  1S1X A;  1LKZ A;  4LF7 J;  4FYW B;  5BYS A;  2KT2 A;  1DTQ A;  4KHR A;  1O6X A;  1S9G B;  8RUC A;  1B70 B;  4I7F A;  1HBM A;  5H1S V;  5KTQ A;  5KFV A;  4OHW A;  3F44 A;  2YNI B;  3BGO P;  1FF2 A;  1OSD A;  4IQX A;  1HQU A;  3RJM B;  5KG0 A;  3F41 A;  4UOH A;  5F3Z A;  1KS2 A;  4OYO A;  2DR9 A;  2ERR A;  2V0N A;  1CJT B;  4FS1 A;  1ZS6 A;  3QWU A;  4GTY A;  1NDC A;  3IBF B;  2CG4 A;  1EHW A;  1NAQ A;  3U7J A;  2C2M B;  4O3N A;  2UUW A;  2A1B A;  1I1G A;  3LOU A;  2BQR A;  1NK6 A;  4MHX A;  3UFC X;  2CQI A;  1AA1 B;  1W25 A;  1FDB A;  1KOO A;  2VQF J;  1YTY A;  4BWM A;  1Q8B A;  3CDW A;  1IJF B;  5E5N A;  5CZV A;  1OO0 B;  3A3P B;  3GPA A;  1U49 A;  1ELY A;  3L4B C;  2JEG A;  5E33 A;  2AYM A;  2R8H A;  2GS8 A;  3JSM A;  3ISZ A;  2CQ1 A;  2MQN A;  4RR5 A;  2CZV C;  2D69 A;  3M6U A;  3G4S S;  2NXN A;  2AJF E;  2C2R A;  4DHV A;  3OVA A;  2XSJ A;  3T19 A;  3RW6 A;  1S6P A;  1NPP A;  2YH0 A;  3HM9 A;  1N6Q A;  1ARO P;  1RQ0 A;  1EQJ A;  1ELZ A;  4LBI A;  4CZC A;  1NJY A;  2I2Y A;  1C4C A;  1LWX A;  4DR5 J;  3ILL A;  2F9D A;  2G9Y A;  2YKA A;  3A8I A;  3IXQ A;  1MNE A;  3CJT A;  2HAF A;  1QAJ A;  2MLX A;  3BQ0 A;  2DJW A;  3KHH A;  4CI0 B;  3CMA S;  1W2I A;  4I56 A;  2R7S A;  1U1Q A;  5I3U A;  2EBE A;  1L5U A;  2VD3 A;  3UN3 A;  3MPW A;  1VS3 A;  5F8L A;  4RW6 B;  3RB6 A;  5ETO A;  2J9E A;  3FZB A;  2V4R A;  1PBA A;  2FLP A;  4ECS A;  2RQK A;  1FKO B;  1FJG F;  4Z37 A;  4I6A A;  4Q45 A;  1SIW B;  1VQ5 S;  3DRP B;  1VHF A;  2I5J A;  4UOC A;  4OYA A;  3W2V A;  1TAU A;  3C6U B;  2ANH A;  1CJU B;  1R8B A;  1FDN A;  2ZOG A;  4WYW A;  4LRB A;  4BCA A;  4QIW D;  1Q78 A;  3EYZ A;  3N0V A;  5EGE A;  2IY5 B;  2GAH C;  4H4M B;  2Z58 B;  4WP8 A;  1HQA A;  4LF9 J;  4A47 A;  1HBU B;  3BGF A;  5I4M A;  3OTD A;  3BBC A;  4MAK A;  3V2U C;  1MN9 A;  4KAI A;  5ETK A;  3OD2 A;  5GOV A;  5F8I A;  2DNK A;  1LEO A;  1RWV B;  2OSQ A;  3NGS A;  3V5R A;  1HPZ A;  2XZT B;  4GKJ F;  3DYC A;  4O3R A;  4G1P A;  5JXS A;  2CAJ A;  3SI8 A;  3NCR A;  4CIO A;  2EKN A;  4IRK A;  3FKB A;  3KK3 A;  1AJA A;  2W5S A;  3QT8 A;  1OPI A;  5HJX A;  4KGM A;  1AZS A;  3BS9 A;  1N48 A;  5CZX A;  1RYS A;  4RUB A;  3TVZ A;  3T02 A;  3V6H A;  3ILI A;  2HHT A;  3JS9 A;  4OJG A;  3G71 S;  4X64 J;  3M7V A;  1U1P A;  4M95 A;  1GTE A;  4X66 J;  1PJ6 A;  5CXT A;  2MZQ A;  4ZKA A;  4HDG A;  2HK2 A;  3RRG A;  3OR2 B;  4NRT A;  2HHQ A;  3Q8R B;  2BOA A;  2WB1 D;  2GMJ A;  3T5J A;  1S5Z A;  1T94 A;  2MST A;  3WBH A;  2LCW A;  2CWX A;  2UVW A;  2N4D A;  3NCP A;  3DGP B;  4B3T J;  4YME A;  4P2X A;  1UVL A;  5AE3 A;  2V8V A;  1S1T A;  1JLF A;  4DJB A;  5G0R A;  2ZM6 J;  4YB7 A;  1VGY A;  1JLE A;  2EWH A;  4LSN B;  4LQ9 A;  2M8D B;  2RQC A;  1UPP A;  5GRR A;  2MEW A;  2YX4 A;  4RJV A;  5BYR A;  2F65 A;  3FFI A;  5B7W A;  2J8A A;  3HD2 A;  2V4J B;  1NHK L;  2CKW A;  4F3M A;  4FS2 A;  2FD2 A;  1FHT A;  1HBN B;  3PYE A;  1PIE A;  4QBU A;  2B4U A;  3P5T L;  4OZJ A;  4WK1 A;  4KO0 B;  1N5S A;  4WK3 A;  5L1K A;  5H9F J;  4EU0 A;  1RTD A;  2MQQ A;  5LJ5 Y;  1VIO A;  4M5I A;  3CJ3 A;  2L48 A;  3H90 A;  2HG4 A;  1AUD A;  1TL7 A;  1WJ9 A;  3QSY B;  2VJU A;  2B4V A;  3MHY A;  1YI2 S;  1UTA A;  3K17 A;  2ZKU A;  1EP4 A;  5D6G A;  5DQI A;  5MLC V;  3BN4 A;  5RUB A;  1KH9 A;  3MM7 B;  4KPC A;  2KXH A;  1TKX A;  1R0C B;  3S7R A;  1IM4 A;  1CS4 A;  1NKC A;  4QAX A;  2FJD B;  5E41 A;  2R9L A;  2FJX A;  4DV3 F;  3TQ1 A;  5A6P A;  1RAB B;  2ZZN A;  3W60 A;  4R8U A;  2XRG A;  1PYS B;  2IVY A;  3IWN C;  1TKZ B;  2OFG X;  3LP2 A;  4KHP F;  2GIF A;  4IG0 B;  1RT2 A;  3BN7 A;  1FDA A;  4NXM J;  3H5S A;  2ACM A;  1O51 A;  1UCN A;  4IDK B;  4OYZ A;  5D4O A;  3DLE A;  1R8P A;  1M5V C;  3IFE A;  4B3S F;  3H0P A;  3QT6 A;  2HPU A;  4PAA A;  3BPD A;  3KOA A;  1AB8 A;  1ZAX A;  2B7B B;  2OPR A;  2G0J A;  4HDH A;  5EGH A;  2BRL A;  2GO9 A;  1KH5 A;  4TU9 A;  2CQ2 A;  3B4D A;  1NLK L;  4C9D A;  1ED9 A;  1N88 A;  4YDD B;  4K2J A;  3ZTS A;  3T5K A;  2HQ3 A;  4P7V A;  1RLC L;  3CF5 Q;  2KM8 B;  4W90 B;  4O3P A;  3OR1 B;  5KOX A;  4N77 A;  5DET A;  4PWW A;  3HHD A;  4RW9 B;  2W9B B;  3TOQ A;  3DM2 A;  1KLM B;  5KFQ A;  2VHG A;  5HJY A;  3KLF B;  4X2B A;  1K8A T;  3FQL A;  3CED A;  5E0O A;  1LOU A;  2ROG A;  4DSF A;  4EZ6 A;  4MIV A;  1FCA A;  5KFC A;  3MEC B;  2BKN A;  3HHL C;  3US5 A;  2ZH2 A;  3PKM A;  1CJT A;  4E98 A;  3ZNJ 1;  1XMO J;  4C8O A;  5KFL A;  4LR7 A;  5B0D A;  5ETR A;  1K9M T;  1WG5 A;  2OPQ B;  3ETM A;  2B8Q A;  1Q81 T;  2CPF A;  4KC5 A;  2LDI A;  1Z2Z A;  4R25 A;  1FEH A;  1U1N A;  1PO6 A;  2XCP A;  2EXU A;  3DOL B;  4X4V A;  4L74 A;  2KT5 A;  2UUA F;  1PC4 A;  3VWS A;  1CG2 A;  1RXO B;  2CWK A;  2CPE A;  2N4C A;  2IJR A;  3BDG A;  3MGJ A;  4N8N A;  3TJ8 A;  4B3M F;  3ENA A;  4EZ9 A;  4QR0 A;  2KVQ E;  2CIM A;  2ZBQ A;  3EDQ B;  5D4L A;  3G8T A;  3JQM A;  5IWA J;  4LQ3 A;  1F9F A;  3UN2 A;  2OKQ A;  1TZ0 A;  5AJ3 J;  4PRF A;  2EFP A;  3D0I E;  3SDE B;  1KD1 T;  2E9R X;  3L9Z A;  1E2S P;  4DQP A;  4J90 A;  3CMR A;  2CQB A;  4RNN A;  3EDR B;  4H4K A;  2N82 B;  2G9O A;  2KB2 A;  4MYU A;  5A6W A;  1RHJ B;  2OUG A;  1WKJ A;  2OD6 A;  2RQ4 A;  1NKB A;  4PG4 A;  5IV4 A;  1ACM B;  1NK4 A;  2FJA B;  2HZA A;  3BGR B;  5K14 B;  4CLS A;  3CCE S;  2FVP A;  2MJU A;  4NOH A;  1KFD A;  2Q3P A;  3TW0 A;  2EVZ A;  3Q8S B;  2R8J A;  5DDP C;  2Z57 B;  1R0A B;  3J7Z 5;  3PX4 A;  1MWQ A;  3C6U A;  1DRZ A;  1CJU A;  3RR8 A;  4DR6 F;  3M9O B;  5B0A A;  4WFN Q;  3MK1 A;  3CCT A;  2XYP B;  3IM8 A;  2BRK A;  2FDN A;  4HT7 A;  2L9D A;  4H4M A;  3PO5 A;  4X4N A;  2KG1 A;  1HBO B;  3NGD A;  2QEX S;  2C3M A;  4OHV A;  1RT6 B;  3A12 A;  3BPS P;  4XIU A;  2V5H G;  4MJK A;  3VAF A;  2VU5 A;  1HBU A;  3BR9 A;  1K0T A;  1X5T A;  2QSW A;  3UDC A;  3EGN A;  3JQK A;  4CLF A;  5F8H A;  2F40 A;  4A46 A;  1Y9O A;  2XNR A;  5A8W A;  5I42 B;  1BD6 A;  4U95 A;  2CNN B;  3TUJ C;  2YNG A;  3BO4 A;  2GW8 A;  1FXL A;  1VBZ A;  4B9N A;  1FJG J;  1W7W A;  3UD5 A;  4QWA A;  1JNZ B;  3ICL A;  2HRT A;  2DNP A;  2XGP A;  2OEL A;  2R7Q A;  3LWM A;  1KHJ A;  5FLX U;  4J9U E;  4WIQ A;  2ATL A;  4LF4 F;  2BDP A;  2O66 A;  4NLT A;  3OTC A;  2JFK A;  3FCW A;  1MMD A;  4JI1 J;  3NWG A;  1LWC A;  4FKX A;  3Q22 A;  1C0T A;  2XYG B;  3OR2 A;  4ECZ A;  4MKA A;  3M6V A;  3LH2 S;  3EIC A;  2XS2 A;  3IP0 A;  2PD1 A;  5KG2 A;  2HQI A;  5EHH A;  1BQM B;  4KQZ A;  2DNZ A;  1IKY B;  4WII A;  1AFJ A;  4DR2 F;  1REV B;  2VC0 A;  1GFW B;  3PFO A;  4Y34 A;  2OHD A;  1JLC B;  2VDH A;  1RAF B;  2LEP A;  3WX4 A;  1E1Z P;  4QIE A;  2M52 A;  3JTP A;  3A13 A;  4O4G B;  3PJ9 A;  2V8H A;  2MQL A;  5GAH I;  3D9B A;  4TLR A;  2B6A A;  3H5Y A;  1NK0 A;  2GQQ A;  4LF8 F;  1ZAV A;  4RX6 A;  2V4J A;  2XMU A;  4M5J A;  3U27 A;  3FRY A;  1HBN A;  3MAH A;  4F8R A;  3H20 A;  1M1G A;  1FER A;  2QLW A;  4ZVG A;  1WC6 A;  4KO0 A;  5DG8 A;  4HYK A;  1M5S A;  2ZWO A;  1IKV B;  5K8N A;  4CH7 A;  3NKM A;  3MMA B;  1NB2 A;  1SI9 A;  4HI1 A;  2K1R B;  3FNN A;  3RBX A;  1F1B B;  5HRO A;  2J0W A;  4DL4 A;  2V67 A;  7FDR A;  3BJY A;  2E1R A;  4NEY A;  4QOT A;  4O3S A;  1X4D A;  3NEK A;  2R3V A;  3TR5 A;  3EZ5 A;  2VL1 A;  5EX3 A;  2UU9 F;  5D78 A;  2NXU A;  3MM7 A;  3BH7 B;  1UWB B;  3VAM A;  2W9C A;  4TY8 A;  3PVX A;  2MHN A;  4ED0 A;  3C19 A;  2E5I A;  2X1G A;  1VQL S;  5BYQ A;  3RBZ A;  2WK4 A;  2KN4 A;  2RJZ A;  1KSP A;  2J6U A;  1TKZ A;  2Z56 B;  4YB1 P;  1M1K T;  4NL5 A;  4IG0 A;  1RBA A;  2V8D A;  1EZZ B;  5LQQ A;  4IDK A;  1VQN S;  2EG2 A;  3DLH A;  1Y00 A;  1EIY B;  3GJT B;  5DLW A;  1FDD A;  1HQE B;  1U26 A;  1ED8 A;  1SIZ A;  1HR0 F;  5GMD A;  2H5E A;  4CH1 A;  4IYQ A;  1UJ4 A;  4HAC B;  4AD6 A;  3WAY A;  1YJU A;  2WB4 A;  2NSB A;  1R8C A;  1VQ9 S;  4WP9 A;  3A52 A;  2HS4 A;  2Z4P A;  5DDQ C;  4WBF A;  4M8L A;  3OR1 A;  2DHH A;  3NGT A;  4MMO A;  3ZZY A;  2EFQ A;  4K7Q A;  1P9Y A;  4QYZ J;  4I2Q B;  1HNI B;  4DCP B;  4ENO A;  1SC1 B;  4RW9 A;  5HK4 A;  4J5O A;  1MN7 A;  4JI2 J;  3KK2 B;  1Z2L A;  3M32 B;  2UXD F;  3SEO A;  4GTX A;  4Y2I A;  1WOR A;  3VHQ A;  4F25 A;  3G96 A;  4JI5 J;  3M2U A;  2H65 B;  3K7R A;  1YRX A;  5A8R B;  1GAO A;  3OXL A;  1XEZ A;  3QYY A;  3MEC A;  3OFH A;  1LK5 A;  2L9W A;  2C2O B;  3ITH B;  4RNM A;  4KHP J;  3LW5 C;  1RHR B;  1XR7 A;  4ZVE A;  4Q8E A;  3E8O A;  5B0F A;  3OFG A;  4LF5 F;  5F0W A;  2R42 A;  3PO4 A;  1FI4 A;  2RH6 A;  2BJ8 A;  2OPQ A;  5KFZ A;  4LFB J;  4U8V A;  3SCJ E;  4F7V A;  2HK3 A;  1WG4 A;  3MTK A;  3DOL A;  4HVZ A;  3K5L A;  2OEJ A;  4ZLJ A;  5IXU A;  1VYA A;  5B08 A;  4DV0 F;  4OI3 A;  4L3N A;  2J5A A;  3G6Y A;  3VAK A;  4FDI A;  3CW2 C;  1VK8 A;  5J2P A;  1S76 D;  2ASL A;  2DGO A;  2YQ3 A;  2K3K A;  2LQJ A;  5LRM A;  2G1H A;  4L72 B;  2H3E B;  1X31 C;  4DL7 A;  3RAX A;  4C7Q A;  4WKY A;  3IGV A;  2H51 B;  1OY9 A;  2U1A A;  3MK2 A;  2BJ7 A;  2RHS B;  1NUE A;  5ETM A;  3UQS A;  1GXU A;  4GRS A;  4A8W A;  1QTN B;  2IAJ B;  3SDE A;  1RKI A;  3MUT P;  6AT1 B;  3OL6 A;  3ZZZ A;  4LRE A;  5INH A;  2W7P A;  1DLO B;  3Q8V A;  2E9T A;  2RRN A;  2JHE A;  1JLQ B;  5IT9 U;  5LMU F;  2MYF A;  1SBR A;  1OY8 A;  3GFH A;  1TQL A;  1LFW A;  3VAJ A;  4OYW A;  2HS0 A;  3OFE A;  5L0K A;  2CJQ A;  2HHV A;  2VQR A;  1HIY A;  2U2F A;  3L7P A;  5L8R C;  3UCG A;  1H73 A;  5E3A A;  1N0U A;  2UUA J;  3BGR A;  5K14 A;  4N76 A;  2J9D E;  4O23 A;  5DS7 A;  2H48 B;  1O5J A;  4B3M J;  3P3D A;  4USI A;  2W4C A;  1R0A A;  2KHC A;  3DLL Q;  2XNQ A;  4JI7 F;  1BWE A;  2O5D A;  4YB5 A;  4G1Q B;  4OI1 A;  3DC2 A;  4OJ1 A;  4DPU A;  4DFM A;  4ZVP B;  3GV5 B;  2CPY A;  4P6Q A;  3LP0 B;  3R5C A;  2X1B A;  4UT4 A;  3H2L A;  4N41 A;  4ZVU B;  3DFE A;  5KT2 A;  4KGZ B;  1TK8 A;  1WKK A;  5J2Q B;  2OFH X;  3T3F A;  3ZTQ A;  5EN1 A;  5D77 A;  1HBO A;  3FSY A;  1RBO B;  2RAQ A;  1S4F A;  1RT6 A;  2YX7 A;  4YEA A;  5CCL A;  3GU0 A;  2I1R A;  3KXD A;  2FY8 A;  4RKU C;  3CD0 A;  5FDL B;  2HIY A;  4LQY A;  1N8R T;  4KE5 A;  4LBH A;  1IVZ A;  1MWY A;  4X4R A;  4UST A;  3MTJ A;  1WI6 A;  3KDO A;  5I42 A;  2GLQ A;  4P73 A;  4GTW A;  4OJ3 A;  4USH A;  4OHX A;  5A2Q U;  2QA4 S;  1Y5I B;  1CEZ A;  1S49 A;  3LGN A;  3V81 A;  2EK1 A;  3DHW C;  3HLU A;  2HBR B;  3KTQ A;  2YKO A;  3I4P A;  2WON B;  1NK7 A;  4WJB A;  2D9O A;  4DR6 J;  3OL9 A;  1UEU A;  1H7W A;  4A8O A;  2Y1R I;  3WIV A;  3AOA A;  3T6B A;  4Z7C A;  1X0P A;  3HPO A;  4I69 A;  2P6S A;  3HDS A;  2H4W B;  3GLJ A;  4ED7 A;  4GKK J;  2FB0 A;  2IYG A;  3W3S A;  3N6L A;  4M5K A;  1HNZ J;  1BQM A;  3IR5 B;  2QMX A;  2HMI B;  1IKY A;  4DR1 F;  4U7C A;  3C6T B;  4C2M A;  5F9L A;  1RTJ A;  1REV A;  4F4X A;  4LFC J;  5HMW A;  3C16 B;  4CO3 A;  1U1K A;  1JLC A;  5CAB A;  4F3O A;  2P9E A;  2EC0 A;  2QC3 A;  2ALZ A;  4IKA A;  5L0E A;  3CDB A;  3SZZ A;  3FCV A;  1RB0 A;  1SV5 B;  2UVU A;  3MWB A;  4O4G A;  1KWM A;  1UMJ A;  3ONQ A;  3NBP A;  1HWU A;  2FUG 9;  1FKP A;  2MHE A;  3TA1 A;  2DRD A;  3CJR A;  2RS2 A;  5A0Y A;  2ZUG A;  4OX6 A;  2HUR A;  1T3O A;  1XMQ F;  3DRS B;  4M5H A;  3AY0 A;  1ZYQ A;  2E5G A;  3I56 S;  1TKD A;  5IV3 A;  2F9J A;  3NKR A;  4YR0 A;  4DEZ A;  4A4J A;  2Q79 A;  5KFK A;  1IKV A;  3I5C A;  2DNL A;  4QIG A;  3DXB A;  5SZT A;  2XO7 A;  1KVI A;  2VB6 A;  5ETQ A;  4HTJ A;  3PHE A;  1LW0 B;  3VGU A;  2H4Y B;  3NNA A;  2H5J B;  1JNR B;  4ZVT B;  4DV5 J;  4U9R A;  6FD1 A;  1Q79 A;  1T11 A;  5DZ7 A;  1N52 B;  4KAY A;  3MM9 A;  4ZIW A;  1V6H A;  1VQP S;  1XR5 A;  5F0U A;  2VV5 A;  4QWE A;  1RTI A;  2OEK A;  3TJ9 A;  1UWB A;  3VCD A;  3EX7 B;  4O44 A;  2C2K B;  3D1H A;  1H2T Z;  4C97 A;  3K57 A;  1FA0 A;  2VOO A;  4M5D B;  1RCX B;  5C5J A;  1KKH A;  3Q83 A;  3C15 B;  4FF4 A;  2F8M A;  3ET6 B;  2PA8 D;  4NML A;  3DLK B;  1F3F A;  4LF8 J;  4TU8 A;  1JJC B;  4UPI A;  2GCF A;  5J1E B;  3CCS S;  1G2E A;  1S6Q B;  1SH0 A;  4X4S A;  4Z2X A;  3M8P B;  2Y0B B;  3I9V 9;  5IS2 A;  1FRL A;  1FRI A;  5CD4 A;  1HQE A;  1ANI A;  4F67 A;  1Q16 B;  3TO8 A;  4CLY A;  2FZK B;  3B82 A;  1NPK A;  1X9M A;  4IUF A;  3DLJ A;  4LRD A;  3IBC B;  1ZPW X;  1S10 A;  2AHO B;  4RW4 B;  2RU9 A;  5JVH Q;  1B0V A;  2V2K A;  4ETZ A;  2JSX A;  4ZVQ B;  3WDO A;  3NKN A;  1N5T A;  2UU9 J;  1RU1 A;  2VC1 A;  2HFS A;  3PY8 A;  3Q8P B;  4I2Q A;  3GII A;  2V4Q A;  1HNI A;  4ANE A;  2F3J A;  4JBC A;  1I5O B;  1RHQ B;  3KK2 A;  1SJ4 P;  1KLN A;  4DLE A;  4NLW A;  2V9K A;  5A8R A;  2UUC F;  4RO0 A;  5D0G A;  4R5P B;  3D1O A;  2DNQ A;  2RDJ A;  3VZI A;  4B56 A;  2BZ2 A;  1V9O A;  3MM6 B;  2JOQ A;  2NZ4 A;  3CJ8 A;  3ITH A;  2C2E A;  1D8Y A;  3AOC A;  3LP1 B;  5KOW A;  1IR0 A;  2G0C A;  2CQD A;  1S0V A;  3N5B A;  2G2O A;  3JSY A;  3KG0 A;  1FTC A;  3LO3 A;  1R31 A;  5DQG A;  3MD3 A;  4WTY A;  3TEG A;  1VMB A;  3BKF A;  5I3Q A;  1NSP A;  3MMB B;  4I0W A;  4CP5 A;  5JUM A;  4OL8 A;  2VFS A;  4PXD A;  4IR9 A;  1D3W A;  4F02 A;  1TVR A;  1T8E A;  3K58 A;  4YP3 A;  4DV7 J;  2FHK A;  1XNQ F;  1XIQ A;  5B09 A;  2KXN B;  1RGV A;  2VAS A;  4F2R A;  1QM9 A;  4RW8 B;  2QL9 B;  2IBO A;  1ZOT A;  4AXI A;  1H72 C;  2UXD J;  3ZC4 A;  2IAJ A;  3UR0 A;  1SJR A;  4DUZ F;  4EEY A;  4ZVS B;  1MLA A;  1AW0 A;  3BM7 A;  1DLO A;  3FK4 A;  3VGV A;  3VV2 B;  3H2U B;  4MK8 A;  4HL9 A;  1DQA A;  1NKE A;  3IAM 9;  4UPL A;  2PN6 A;  1O0P A;  3MDF A;  3I5B A;  4FF2 A;  3KJV B;  2XZD B;  4ZCL A;  2HQC A;  2HHU A;  2RRA A;  3C14 B;  5GAD I;  2PMW A;  4RBV A;  2BJ9 A;  3CSK A;  2ZD1 A;  4NYZ A;  4X4Q A;  2IDE A;  2FHJ A;  4PEO A;  4Q0B B;  3ENQ A;  4NCB A;  1S72 S;  1U1M A;  1TL5 A;  4P9S A;  5HP1 A;  1JLA B;  2JEJ A;  2KJV A;  4YHH J;  2HWI A;  3EVO A;  2RIJ A;  4NZ6 A;  5FD1 A;  2AJ1 A;  3W5X A;  4ZLP A;  2XBP A;  4C8K A;  4DV1 J;  2CPI A;  3OPK A;  4ECY A;  4G1Q A;  2HRU A;  1HI0 P;  2UV8 A;  2VQE F;  2AGQ A;  3LP0 A;  3DMJ A;  2IDL A;  2E1A A;  3D7S B;  2XM3 A;  3BSC A;  4OI6 A;  3QZ8 A;  5J2Q A;  3UVJ B;  3KK1 B;  2VFT A;  1L3S A;  1B4S A;  3CIZ A;  4U96 A;  4WCE Q;  2FGC A;  3HCX A;  2RE1 A;  4KY3 A;  4M5L A;  5I3P A;  3QZ7 A;  1KEK A;  4RU9 A;  5C2C A;  1SHQ A;  3ILO A;  3PFE A;  1SH2 A;  1KN6 A;  2EK6 A;  2PEB A;  4AQY F;  3R5B A;  3C2P A;  2XWY A;  1NZA A;  2FVS A;  3GFZ A;  3BBF A;  3TP2 A;  4QPT A;  3D54 A;  2GAG C;  4PG7 A;  1OPZ A;  4AE5 A;  2EFN A;  5GAD U;  3GCX P;  3NAI A;  1Q1K A;  2B9E A;  2ZBC A;  3MUV P;  3W9J A;  1S7I A;  3FMW A;  3I96 A;  3PKY A;  4MFB B;  5GME A;  1LV5 A;  3H5U A;  4O0I A;  2QV6 A;  3T6J A;  2XLI A;  1SQF A;  4OV6 A;  1RT7 B;  2NPF A;  3WC0 A;  4JI7 J;  4JV5 F;  3B54 A;  2KRR A;  3EWG A;  4ED8 A;  1Q7L B;  2GO8 A;  1WC4 A;  1D9A A;  3GIM A;  1TKT B;  3BDH A;  1T3N A;  3TI0 A;  4CT9 A;  2KU7 A;  3PRV A;  2XMA A;  2NUU G;  3SBM A;  2YQ1 A;  2ZH9 A;  4NLS A;  3SSS A;  2ZZM A;  1RWO B;  3RAM A;  3JAM Y;  1N0V C;  2QMU B;  2D1G A;  3V4I B;  1FE4 A;  2OML A;  3W7B A;  3PW2 A;  2HMI A;  2HAI A;  2IRY A;  1X0F A;  1J5E F;  2ZFH A;  1HDH A;  2V50 A;  1D09 B;  1R27 B;  3K5P A;  4DV4 F;  1A7G E;  4GVB B;  1KNZ A;  2NXC A;  4USW A;  5LL6 d;  3BV8 A;  2MKK A;  4JI6 F;  5L46 A;  3GWC A;  4BC7 A;  4DV6 F;  3CUL A;  3PV8 A;  2FYX A;  4AND A;  1HYS B;  2HGN A;  1KDN A;  1QY7 A;  3GCW P;  2R7O A;  2YWK A;  2PI4 A;  2YKP A;  4KIA A;  3DRS A;  4ID8 A;  1NRK A;  4FNH A;  3W1Y C;  1UEV A;  3M2V A;  5M2R A;  1YBA A;  1HJK A;  4YB6 A;  1IUJ A;  1Y3K A;  3FBC A;  1JLB A;  1V5I B;  2HYI B;  4OYM A;  2P6T A;  3N01 A;  2E5L J;  3DDI A;  4KR0 B;  2KFN A;  1S7H A;  3Q86 A;  4B9S A;  5AJ9 A;  1QSS A;  4L6V 3;  5ETT A;  4I67 A;  5E7O B;  5HBM B;  2COL A;  1KH4 A;  2LP4 A;  3MMJ A;  2P2C B;  1D0E A;  5EGY A;  5HI7 A;  1RSC A;  1QVF R;  3D66 A;  3OTO J;  2BUN A;  1U25 A;  2CQ4 A;  3CC4 S;  1A9N B;  5KFI A;  1HD0 A;  1FK9 B;  3L95 X;  1G4C A;  1S48 A;  2ZEJ A;  3MR3 A;  1JLG B;  2QRR A;  1FT8 A;  3KLH B;  2EW9 A;  4M5D A;  4KFB B;  4ZN3 A;  2AJ0 A;  3G6X A;  4EK2 A;  4J9S A;  3C15 A;  1PBU A;  3ET6 A;  4JP8 A;  4ED4 A;  3DLK A;  5D15 A;  1WF2 A;  5CQG A;  1UFW A;  4JOU A;  2VG6 B;  2YTC A;  1M5H A;  1IBC B;  2NZC A;  5J1E A;  4CCH A;  2K06 A;  2HVD A;  1MG7 A;  1S6Q A;  2XZW A;  2AWZ A;  3FZ2 A;  3PHT A;  2HNY B;  3M8P A;  4YQW A;  3CT9 A;  4DR4 F;  1FRX A;  3QQC D;  3FRZ A;  3PEH A;  5IM0 B;  1RYR A;  3CDE A;  1ZM9 A;  1H98 A;  4EWT A;  1SJF A;  1JJH A;  4H4K C;  1HI8 A;  1E6V B;  1HNW F;  4JUZ A;  3T1Y J;  3MED A;  1PCA A;  3DGV A;  4HHH A;  3IGN A;  2HHX A;  2XC9 A;  2Y8Y A;  5K9F A;  4TNO A;  3DU6 A;  1PJ5 A;  4NPO A;  2IRU A;  1O8B A;  2IMO A;  4OZ3 A;  3VGS A;  1I94 F;  2VKZ G;  1QLN A;  1ALJ A;  3QFW A;  1S0M A;  4AYB D;  4F0K A;  4M94 A;  1YRT A;  3J81 j;  2YNH B;  2D3O R;  3H25 A;  2M4M A;  1OY6 A;  1KON A;  2VUG A;  4LMZ A;  1SL2 A;  5D4P A;  3MM6 A;  2I8E A;  3HVT B;  3MOJ B;  4M5G A;  4KH0 B;  4FVM A;  3ISN D;  1LFP A;  1MML A;  4C98 A;  4B3O B;  4GO5 X;  3R5D A;  4K2X A;  2PEH A;  3Q2T C;  2Q1L A;  2J0Q D;  3RAQ A;  2ZHA A;  2BW2 A;  3MMB A;  5DLV A;  3ETO A;  3G86 A;  2K3I A;  4P10 A;  2MSS A;  4JI8 F;  4KSE B;  1WC1 A;  1QE1 B;  1DJ0 A;  2W4P A;  1ITP A;  4DG1 B;  1P6T A;  4DFK A;  5L1J A;  1RT3 A;  2B5J B;  1QAI A;  3GJS B;  2MKH A;  2IJN A;  4JI4 F;  2IM2 A;  1NPR A;  3KD8 A;  2NLW A;  2I0X A;  3QO9 A;  3M8Y A;  2MKJ A;  4CLL A;  4C8Y A;  4RW8 A;  4ED1 A;  2POK A;  4QQB A;  3HHL B;  4B3R F;  3MI7 X;  1HWJ A;  1PKU A;  2CZ9 A;  4E2F B;  3H40 A;  4C8Z A;  2LA4 A;  2DR5 A;  1WNE A;  2DNH A;  3N4W A;  4LF2 A;  3EXC X;  3MEE B;  1VC5 A;  1BGX T;  2BM1 A;  3RRK A;  3D67 A;  1S1W A;  2DXF A;  1HA1 A;  4P2F A;  1NZ8 A;  3HFV A;  3C14 A;  4CLK A;  4UUW A;  3BSO A;  4JV0 A;  3D6H B;  2R7T A;  2YWH A;  1WOS A;  3ZTR A;  2QLX A;  9ATC B;  2Y0S D;  4Q0B A;  4ZLL A;  2BJ3 A;  5KFW A;  5A8K B;  5EWE A;  3RYL A;  4NLV A;  3HHN B;  2V8P A;  3Q24 A;  1JLA A;  1OSC A;  2FTR A;  2EFV A;  2X1A A;  2VPW B;  1RAE B;  5C24 A;  1P49 A;  1NME B;  2VBZ A;  1S77 D;  2XR9 A;  4B9M A;  2GVZ B;  2HS3 A;  1Q7Y T;  3SMZ A;  4IH7 A;  1N34 J;  4GC7 A;  3Q0A A;  1AUS L;  2WBM A;  3KLE B;  1IBM F;  3UVJ A;  3KK1 A;  4OI4 A;  3KUE A;  4LFA J;  1X5S A;  2ZH3 A;  2A0F B;  3FC9 A;  2KVI A;  1VLO A;  3GYX B;  2QL7 B;  3RTV A;  5L9N A;  3TQE A;  3PM9 A;  1C1B B;  4OZN A;  3DOK B;  3LAM A;  3GJQ B;  3QGG A;  1T03 A;  1B64 A;  4ZPV R;  3QSI A;  2X3G A;  4CM2 A;  1E33 P;  4KM4 A;  3K5N A;  3TAN A;  3BDP A;  4GC6 A;  1ELO A;  3BO3 A;  4OZ1 A;  3EGV A;  4ED5 A;  1LXJ A;  1MW7 A;  3I0S A;  2R2U A;  4UQT A;  2OP5 A;  4MFB A;  2UXC J;  1HNV B;  4HEA 9;  3OSN A;  2O01 C;  4DS5 A;  2LYV A;  4YR1 A;  1RT7 A;  5DM6 Q;  3FDS A;  3WZ0 A;  4CXU A;  2ILZ A;  5CYM A;  3RRH A;  1UAW A;  3GR0 A;  4TQR A;  4K4V A;  3CXC R;  3ZO7 A;  4I4B A;  2VQE J;  3J7Y U;  3BKU A;  4DF4 A;  1SL0 A;  4FYX B;  2QIF A;  3TUZ C;  1XNR J;  2IFY A;  5L38 A;  2UXB F;  2W2N P;  4I64 A;  1KRP A;  4OQJ A;  2ASY A;  2D3U A;  2KRB A;  4DL3 A;  1QDU B;  2XS5 A;  2AEJ A;  3D6T B;  1GMW A;  3EXY A;  3V4I A;  3SCK E;  1GMW D;  4KJG A;  3KMS A;  1IQT A;  3EM1 A;  3P96 A;  3R5A A;  2LDY A;  4AQY J;  2DK2 A;  2OTJ S;  3KWM A;  4QWB A;  1S79 A;  2VFR A;  1UVM A;  3AOB A;  1NDK A;  4B9T A;  2W5W A;  4GVB A;  4B02 A;  2DD8 S;  2ZWP A;  2RSQ A;  2EG1 A;  1NEE A;  2BW7 A;  3TYT A;  5CHC B;  3CVK A;  1PC5 A;  1HYS A;  1CPZ A;  3DHX A;  4M5N A;  2Y1J A;  1T9Y A;  2ACY A;  4NA1 A;  2GC8 A;  2MPU A;  2Z2M A;  5KAK A;  2DGS A;  1R7I A;  2YY3 A;  1CC8 A;  3PIO Q;  3IS9 B;  4ILR A;  5HVG A;  3D0G E;  2V9W A;  3WQP A;  3W63 A;  4NWJ A;  4JV5 J;  5KFP A;  3H4D A;  2L3M A;  1WKL A;  3TVY A;  2CNL B;  3VAH A;  2AJ2 A;  4X65 J;  2GNK A;  2AJQ A;  1UVJ A;  3THV A;  1ZA2 B;  2IYI A;  2W8K A;  1SC6 A;  2B8P A;  4RLE A;  5HBM A;  3J7A 1;  1UVI A;  1VRT B;  2A6O A;  2A18 A;  1WHW A;  2KH9 A;  4JI3 F;  3OJU A;  4NA3 A;  3V6J A;  1N33 J;  4FBT A;  4IG3 B;  2FC8 A;  5KFF A;  4K0K F;  3VVT A;  2QJ3 A;  2OO4 A;  1RTH A;  1QTM A;  1N5V A;  1FK9 A;  1OMS A;  5KT3 A;  1YK9 A;  3GP9 A;  2D74 B;  2V2V A;  3BBB A;  1FE0 A;  4Q7A A;  1KVJ A;  1WG1 A;  8AT1 B;  2DEJ A;  5HO4 A;  1KHN A;  1GTH A;  3KLH A;  4JI6 J;  4KFB A;  4A8Y A;  3MAA B;  2DYA A;  4DV6 J;  4ZJO A;  5ITH A;  4LF6 J;  3QID A;  2AT1 B;  3BF4 A;  1DHM A;  3A1Y G;  5CAA A;  4BC9 A;  2VG6 A;  4XDC A;  1WSR A;  2NYH A;  2P9G A;  2YWF A;  1ELX A;  1RBL A;  2GIQ A;  4PXC A;  1CBK A;  4PQU B;  2CQH A;  2ADC A;  3PIP Q;  5IM0 A;  2L9N A;  5T7L B;  4WPA A;  1S1U B;  2DY1 A;  3PDN A;  1O98 A;  1U6F A;  1OJ4 A;  3AAW B;  2N3O A;  3QIP B;  4FPR A;  2IM0 A;  3M30 B;  4KYZ A;  1B0T A;  3QRQ A;  2LEC A;  3SYZ A;  1BXN A;  1K0V A;  5D8H B;  4L3K A;  4NCA A;  3QGP A;  4MKB A;  2OH2 A;  2GMH A;  1N2K A;  2DNG A;  4ETX A;  1EJ7 L;  4RPF A;  1ZEF A;  1N32 F;  1UKU A;  3GR1 A;  2HHH F;  4CRJ A;  1SC4 B;  2X3D A;  1FWK A;  3THT A;  3HVT A;  5KFA A;  2ZJR Q;  3T5H A;  1ZZN A;  2XMT A;  2OPP B;  4ATN A;  4B3O A;  1IJE B;  1M5O C;  2WOM A;  2UV8 G;  2XGQ A;  4ZG6 A;  4DX8 H;  1DQ8 A;  4ECT A;  2J0S D;  2FVQ A;  3T1H F;  4O4R A;  1K7H A;  4J9O A;  3FBE A;  5LOQ A;  4U7U D;  2BE7 D;  1EET B;  2DPI A;  2IM3 A;  2NPI A;  2P8I A;  2F4V F;  3I32 A;  2DGW A;  2BE9 B;  4UOP A;  3BYP A;  3T41 A;  3MPV A;  2QLB B;  1F9E B;  1QE1 A;  2HVE A;  2MMY A;  3SFG A;  3VVU A;  5BR8 F;  4DG1 A;  3KLI B;  1HWK A;  2HSE B;  4IOC Q;  4BWJ A;  3NGU A;  1U0H B;  1OWX A;  2CDR B;  3L7U A;  2M70 A;  3CJK B;  2XY7 A;  1B99 A;  3MXH P;  2LQB A;  2A10 A;  4A8K A;  2QLJ B;  3NCQ A;  4KRW A;  2CAD A;  1FRJ A;  3IR6 B;  2BEF A;  4EBC A;  3G82 B;  5KFS A;  4DLG A;  3CC2 S;  2AX0 A;  5K8M A;  3HMJ G;  5GVQ A;  2GX8 A;  4LSL A;  1QD1 A;  2ZHB A;  2NUH A;  2BE2 B;  3NNH A;  1EAY C;  2DGT A;  3FMB A;  2UUB F;  2CQ3 A;  2DKO B;  1U48 A;  1RAG B;  5LXY A;  2JDJ A;  1H0H B;  1EW9 A;  1U24 A;  1KTV A;  2XHW A;  4ZPD A;  1O99 A;  5E3P A;  2ZH8 A;  5BXI A;  2PII A;  4HH1 A;  2CVE A;  1U6Z A;  3VAG A;  3OSP A;  1RT4 B;  4DSL A;  1N36 J;  1M5K C;  5A8K A;  2XYH B;  1BUX A;  2Z8Q A;  3JSB A;  2AIR B;  2BAN B;  3NLC A;  4DR3 F;  3UN5 A;  3C3L A;  3QGI A;  1IBK F;  3V4M A;  4AL5 A;  5HN0 A;  1BWV A;  2ZE2 A;  1NH8 A;  4USJ C;  1XK8 A;  3BSN A;  3AQO A;  4H54 A;  2GVZ A;  2F4F A;  4MIW A;  3SZY A;  4ZG9 A;  1KVK A;  3TAR A;  2RDI A;  3KLE A;  4B3R J;  5KG7 A;  1FEE A;  2XMK A;  4KTQ A;  2LEB A;  1R6V A;  1NSK L;  2RB7 A;  3BKT A;  2HHP A;  3OBI A;  3T1A A;  5LMN F;  3CJQ A;  1RT5 A;  2F1F A;  3I55 S;  4ES3 A;  1YJ7 A;  2B7C B;  1X4H A;  3FEX B;  7AT1 B;  3N6N A;  3NS5 A;  1I51 B;  1HQ2 A;  1KR4 A;  3KYL A;  4HHJ A;  2J7W A;  3OUY B;  3G6V A;  2J76 E;  4K4X A;  2AGO A;  2M88 A;  4OI0 A;  2JH3 A;  2FZC B;  2B43 A;  1NDL A;  1HNV A;  4UOO A;  3TZY A;  1KBR A;  4P75 A;  3MEG B;  3AA8 A;  3PYF A;  4KBI A;  3U02 A;  3CUN A;  1HHS A;  1RAD B;  3QJL A;  2C2D A;  2DGU A;  4NLR A;  4J7C A;  1FD8 A;  4V19 X;  1YBU A;  3PW7 A;  2G1D A;  2ASD A;  3CTR A;  2M3D A;  3I82 A;  3NOG A;  1IKW B;  1U2F A;  2EPI A;  1AJB A;  4QR1 A;  1FWP A;  4WZM A;  4DQR A;  2FPH X;  3NOC A;  2QTW A;  2KFY A;  2VG7 B;  2IC3 B;  2HNZ B;  1UP1 A;  2W25 A;  2W5Q A;  4LF7 F;  3PAC A;  4IFY A;  4DL5 A;  4F04 B;  1J2V A;  3ED4 A;  2DO4 A;  2YXL A;  2FIU A;  2CPD A;  4OLP A;  3HT3 A;  2OMO A;  2R7V A;  2APO A;  4RBT A;  3M9M B;  4AXJ A;  1ALK A;  2LXI A;  3PXG a;  2WVE A;  2H9Z A;  4NXN J;  3TX8 A;  2PE8 A;  1RWP B;  1VQ6 S;  1WHY A;  1P9Q C;  3NKO A;  1F9H A;  3OFF A;  2ILY A;  5AXL A;  2FQQ B;  1X9S A;  3G8S A;  3AJD A;  4F0H A;  1SJQ A;  2L08 A;  3LAN A;  4PPZ A;  1ZTW A;  1VRT A;  2VQF F;  1YZ7 A;  2W5V A;  3JTO A;  2GZO A;  4K4S A;  2J9D A;  2O67 A;  1JWW A;  2KL8 A;  3CDA A;  2FJV A;  1UZH A;  3CNQ P;  1F5A A;  4B9L A;  1T9T A;  4UTG A;  1Y7A A;  1ZM3 A;  5F9N A;  4ZVH A;  1B7F A;  4DCO B;  1DTQ B;  4FDF A;  3ZTP A;  3LXQ A;  1M90 T;  4ID5 B;  3MAA A;  4HI2 A;  2FY1 A;  4EBD A;  3GV8 B;  4ECQ A;  3GYN A;  3J81 Y;  3CD6 S;  1D9D A;  2R2R A;  4V19 J;  3BQ2 A;  3IC1 A;  4DF8 A;  5D0H A;  4DR5 F;  3TWZ A;  3GG1 A;  4N7T A;  1UET A;  3R2C J;  1S9G A;  2C3Y A;  4CTA B;  5T7L A;  1L3V A;  1S1U A;  2J6T A;  1VQS A;  2YNI A;  3AHP A;  3EE3 A;  4ZN1 A;  1RWK B;  4NX9 A;  3E51 A;  3H8Y A;  1IQZ A;  5HQM A;  2NRE A;  3HJF A;  3CJ4 A;  1I3O B;  1U4B A;  3M30 A;  2ZBI A;  1SUQ B;  3R7S B;  3P5B P;  1P8G A;  4K0K J;  3UCZ P;  3KJN B;  5F8J A;  4C4W A;  1J27 A;  1FXD A;  1DTT B;  2R7X A;  3MF5 A;  2MQO A;  2P9C A;  2X7I A;  1FRH A;  1VFJ A;  3DLB A;  3ZFV A;  1U8W A;  1X9W A;  4RUH A;  1F3V A;  3RUB L;  2IA6 A;  3K59 A;  4TYB A;  2DR7 A;  3ENW A;  3Q8U A;  1VHI A;  3D3B J;  2MGZ B;  4F4Y A;  4OYP A;  5E3R A;  4CYR A;  3AFG A;  2GA7 A;  2BKP A;  3BR8 A;  3M05 A;  3IO1 A;  3OQ2 A;  4NLY A;  2HFN A;  1NM2 A;  2OPP A;  5K8O A;  4O0N A;  4LF9 F;  4K59 A;  5ETS A;  2ZH5 A;  1PGZ A;  1VRU B;  1RP5 A;  1GNK A;  5L39 A;  2EFG A;  3QAT A;  3CCU S;  1YSJ A;  1EET A;  3ZZT A;  3TA2 A;  3UR3 C;  5F8M A;  3DPC A;  1URR A;  5DZ6 A;  1OYD A;  3G8Q A;  3MZI A;  4TVA B;  2HFV A;  5I3U B;  1RAJ A;  3R7N B;  5M2U A;  4IH5 A;  3L09 A;  3IM9 A;  2RF2 B;  3NL0 A;  4ILM A;  1Y7P A;  4WE1 B;  3KLI A;  3X1L B;  1BQN B;  2W01 A;  1WC3 A;  3ADA C;  2NSC A;  2KYX A;  5L1L A;  1U0H A;  4N56 A;  3QRR A;  4I1T A;  4MK9 A;  2BJE A;  4UY8 T;  4QU7 A;  3CJK A;  3ZZU A;  1NCL A;  2HW3 A;  3PNI A;  3E3X A;  1TR0 A;  4RW6 A;  4X64 F;  1QJH A;  2BVZ A;  2DIT A;  2R8I A;  1PJ7 A;  4NAS A;  2YH1 A;  1FJC A;  1N32 J;  4OYB A;  1FKO A;  1WHX A;  1KQK A;  4L76 A;  1XC9 A;  4LIR A;  2O1P A;  3MMC B;  4CLP A;  2BE2 A;  4XPC A;  2ZZT A;  3DRP A;  1CSJ A;  3UNY A;  4D3H A;  4LBP A;  1RZM A;  1M5P C;  1LWF B;  5TJ3 A;  2YKM B;  2YVS A;  4B3T F;  3PCO B;  5AE1 A;  3BDE A;  3HVR A;  4YFU A;  3O6Q A;  3QLH B;  5A76 A;  4BDP A;  4ZA1 A;  3IRW P;  5DQH A;  2ZM6 F;  3DKD A;  1FNO A;  2B51 A;  3DI6 B;  2CQP A;  4CO5 A;  2ZH1 A;  4AUK A;  3CIM A;  3ZZO A;  1AJC A;  2BAN A;  5KG6 A;  1H6K X;  5M2P A;  4QU6 A;  4DZD A;  1NHV A;  2WCX A;  1S99 A;  4USM A;  3AJ2 A;  2EFO A;  1ZZF A;  4DX7 A;  1AZS B;  1SVD A;  3IR7 B;  1Q4R A;  3HO1 A;  4Y6I A;  2V2Q A;  1RKJ A;  4KAV A;  5ETN A;  4URQ U;  4F36 A;  4UZC A;  2BV3 A;  2VA2 A;  1ZM2 A;  1TUV A;  5JVG Q;  2QX0 A;  3KNA A;  3PYG A;  4A48 A;  4LR2 A;  2G0I A;  3KFW X;  5KG5 A;  3W65 A;  4C8M A;  1URN A;  2NR0 A;  3SCI E;  3DRR B;  3AD7 C;  5KFD A;  6FDR A;  2UUB J;  3PJW A;  3QRP A;  1UZD A;  4IRC A;  3U1M A;  3H59 A;  2L41 A;  3DYA B;  4EUV A;  2OGU A;  2PC6 A;  4NMX A;  3CD5 A;  1CUL B;  2RS8 A;  5F8N A;  1FFW B;  2IUC B;  1KQS R;  5G0R B;  2VJV A;  1JLE B;  2HWH A;  3MEG A;  4DN0 A;  2QG9 B;  4DQI A;  1DAR A;  4QYZ K;  3GSD A;  4NWX A;  2K7J A;  4JV1 A;  3NVL A;  1U0S A;  3D1Q A;  5DG7 A;  1U2R A;  2OEM A;  3ZZP A;  5CH7 B;  2OIH A;  2NXJ A;  3DGP A;  1WF0 A;  3TUP A;  3L7O A;  1PYT A;  1FX4 A;  1YVF A;  3M8W A;  4LSN A;  4GKJ J;  3N6M A;  1H3D A;  2YWW A;  4Y3C A;  1IKW A;  4PR6 A;  2JFD A;  5D0E A;  2R7U A;  2R7W A;  1TMM A;  3X3U A;  1EI6 A;  1U7L A;  5LMN J;  2E44 A;  3SFU A;  2E1C A;  3MFH A;  2ZC4 A;  2W5R A;  1TL7 B;  2JLG A;  2VG7 A;  2IC3 A;  2XMV A;  1Q8I A;  2HNZ A;  4NA2 A;  1R43 A;  4OFZ A;  3K8V A;  4FBU A;  2KTQ A;  1AT1 B;  1YKW A;  2IVF B;  2KI2 A;  5IJQ A;  3NS7 B;  2WW8 A;  1H38 A;  4I68 A;  4WXW A;  4NE9 C;  5C42 B;  3MOZ A;  2GHP A;  2ATC B;  4HH0 A;  4TQS A;  4RZR A;  1YG0 A;  1VQY A;  3GJR B;  1WEX A;  2W5X A;  3RG6 A;  3AJ1 A;  3WAV A;  1X4C A;  4XTT A;  4Y2A A;  1UPM B;  5KG4 A;  4RU2 A;  1B8J A;  4P71 A;  4DPT A;  1ZEB A;  1C4A A;  1XMO F;  4B9U A;  1CVJ A;  4Y28 C;  3IDD A;  3LGM A;  3DLE B;  5L9X A;  3MM8 B;  2E7X A;  3LGH A;  1WC5 A;  3ISN C;  1HAR A;  4IR1 A;  2XQC A;  2YPZ A;  1FES A;  5EUH A;  1K44 A;  1K1Q A;  4R0E A;  5AE2 A;  1TL4 A;  1JK9 B;  1HD1 A;  2XMJ A;  5GAH U;  3JYT B;  2R7R A;  1F60 B;  1YJW S;  3KKF A;  1Q82 T;  2GSN A;  2RML A;  3DRX A;  2H1Y A;  1EX8 A;  1U8S A;  2FVC A;  3N5F A;  1SCJ B;  1AFI A;  5IWA F;  4ES1 A;  3IGZ B;  2K2P A;  1KH7 A;  2DY9 A;  5KFJ A;  3D68 A;  4ID5 A;  2I6W A;  4AL7 A;  4UQG A;  5AJ3 F;  4CO4 A;  3DM2 B;  2C2Z B;  3NY0 A;  4Y2C A;  4ZPW R;  2MB0 B;  2KO1 A;  2C28 A;  3BGL A;  2EKY A;  2HLT A;  2MKY A;  1HL6 A;  1L3K A;  2FJW A;  4FXV A;  4NLG A;  4CTA A;  5IQ6 A;  2W9B A;  2BJD A;  3V6K A;  2Z2L A;  4W98 A;  1KLM A;  1YJV A;  2M9K A;  4FNI A;  3KLF A;  3GIR A;  4XO0 A;  1NO8 A;  4DV3 J;  4LIW A;  2M8H A;  3PJX A;  2ZC3 A;  3E01 B;  2M2B A;  1SUQ A;  3BDG B;  2ALY B;  2NXE A;  4KT0 C;  2GSO A;  1VJQ A;  1RAA B;  4DI6 A;  4B08 A;  1URB A;  2PT0 A;  2WVC A;  1DTT A;  2QT7 A;  4B3S J;  1LNQ A;  3B78 A;  5HVH A;  3PEJ A;  4NZ0 A;  5BJR A;  4WU2 A;  3M9N B;  2D9P A;  3M8R A;  1SQE A;  1X8D A;  2MGZ A;  1S0O A;  3R8Y A;  1WF1 A;  2G2Y A;  4X62 F;  3CCL S;  1WSV A;  4LR8 A;  5K4P A;  4HT5 A;  1AJD A;  1WC0 A;  4ZVR B;  3R97 A;  4RNF A;  4WF9 Q;  4BHQ A;  5U47 A;  2GJ2 A;  1W2B R;  1VRU A;  1WOP A;  4X4T A;  3UE2 A;  3OTE A;  1LK7 A;  2GQC A;  1N4L A;  2BXJ A;  2UP1 A;  3AB4 B;  4RUA A;  1OQ3 A;  3IWX A;  9RUB A;  5AXN A;  2HEK A;  3SSQ A;  2WW4 A;  2MZJ A;  1UFL A;  2ZH6 A;  2RF2 A;  1GH8 A;  4WE1 A;  2DH7 A;  2MLZ A;  1SB6 A;  1BQN A;  2B9W A;  4P52 A;  3T9N A;  4DFJ A;  2WBR A;  1YHQ S;  1TTH B;  4GTZ A;  1KHK A;  3P8B B;  3WC2 A;  3AD8 C;  1CQN A;  2ZNY A;  4ZCI A;  3CPW R;  3NP5 A;  2AEF A;  5T41 A;  2OJ3 A;  2V63 A;  1QSL A;  2UVV A;  2MQP A;  4JI1 F;  1WTF A;  3D3C J;  5T14 A;  5LSL A;  3MMC A;  1T9W A;  3MUM P;  3M8Z A;  4KKO B;  2J8S A;  1Y0H A;  2A6M A;  1LWF A;  2MZ1 A;  1S59 A;  2YKM A;  1CJV B;  2CJB A;  1NU4 A;  4O3Q A;  2AF6 A;  1LW2 B;  3K5M A;  2HGM A;  3QLH A;  3O5T B;  3VZH A;  3KG1 A;  4PWD B;  2RDD A;  5AXK A;  3N79 A;  5A8W B;  3DI6 A;  4S0M A;  1RAH B;  2LKZ A;  2PGC A;  2JL9 A;  3K5O A;  5KFX A;  2SXL A;  2B9X A;  2YNG B;  2MTL A;  3B8H A;  4CQ1 A;  3PRB A;  4DOZ A;  4CYS A;  2AP6 A;  3LTO A;  2CYY A;  3KUG A;  2VOP A;  3HSD A;  5HMZ A;  4WTO B;  2HIQ A;  1SXL A;  1YZ6 A;  5AXM A;  4G65 A;  3BDF A;  1S0N A;  2FLO A;  1YDL A;  2QN6 B;  4EYI B;  4UPK A;  4Q43 A;  3M4X A;  2OI2 A;  2XWX A;  1LWC B;  1R6Y A;  2GHW A;  4K4W A;  3HF5 A;  2CPH A;  1C0T B;  2FHO B;  4FXD A;  1HW9 A;  1HLW A;  3DRR A;  4I2P B;  4IO9 Q;  1NH7 A;  4G6V B;  3OLA A;  2ABY A;  4DV2 F;  4C0O C;  4MIA A;  1G3O A;  3DYA A;  2VF3 A;  4M63 A;  3POT B;  1Q0N A;  3AT1 B;  4WKR A;  3UNG C;  2QSF A;  4UPH A;  1VJW A;  4N5S A;  4ECV A;  3K0J A;  1CUL A;  2IJF A;  2IUC A;  3D0H E;  2D3O 1;  2KG0 A;  4J9K A;  3PX0 A;  4EFA C;  1WAC A;  2HGL A;  2B6A B;  4ZPT R;  4F4K A;  3NAH A;  2DPJ A;  1FFG B;  1UWA A;  2LXU A;  3PR4 A;  4JV2 A;  1XQI A;  1Q53 A;  5KFN A;  1C0U B;  4DZ6 A;  3Q23 A;  2ZIT A;  3SCL E;  2XY5 A;  4N47 A;  1P27 B;  3FUY A;  4B9V A;  3RB4 A;  2N7C A;  3BO2 A;  1FX2 A;  3WBZ A;  2DHA A;  3RZA A;  5HRO B;  4LF1 A;  4CYU B;  1SQG A;  2DGX A;  4D3G A;  2CVI A;  4GO7 X;  4Y65 A;  2YBV A;  4MT1 A;  3AQP A;  4DPX A;  4LF4 J;  5JMN A;  3GQC A;  3MMA A;  4DPW A;  3CJS A;  2K1R A;  4HKQ A;  2HWT A;  2AEM A;  4U6P A;  1T9U A;  2W9C B;  2BAB A;  4QW8 A;  5C42 A;  3NWR A;  4TY8 B;  4JI2 F;  1KFS A;  4DX5 A;  1VCT A;  1U09 A;  2F8E X;  1IWA A;  4JI5 F;  4EI2 A;  5KFT A;  4J9P A;  1TAQ A;  4NLX A;  4ZOS A;  3BZQ A;  1T7P A;  2IFX A;  3PTW A;  1F5C A;  1EQ0 A;  1IR1 A;  2W8D A;  1WI8 A;  2PDA A;  4CLZ A;  1RWM B;  1R3N A;  2HVI A;  1U47 A;  1KHW A;  4CT8 A;  1GXL A;  4DR2 J;  3OHB A;  2CJK A;  1PSD A;  3OVS A;  4YR3 A;  4J9L A;  1ZAW A;  2W24 A;  2XI2 A;  3RW7 A;  2W2O P;  1Y11 A;  2F8H A;  3RBE A;  3MM8 A;  4LFB F;  3CMQ A;  3FBF A;  3IN5 A;  1Y3J A;  1ALI A;  3OHA A;  5EX0 A;  3KMQ A;  4ITS A;  4J9V A;  3OL7 A;  3GZ7 A;  4WZQ A;  4DN9 A;  1Q8L A;  2OSR A;  2BYC A;  3FSI A;  4YOE A;  3K2Y A;  3TZZ A;  3JYT A;  1RIS A;  3QT7 A;  4F26 A;  2J0X A;  2DR6 A;  3WX8 A;  2D3Z A;  3J7Z T;  4RW7 B;  3GG0 A;  3DDK A;  3H98 A;  1N56 A;  1NK8 A;  3GIJ A;  4JB8 B;  2VA3 A;  2V69 A;  1SHN A;  1FRK A;  4RWX A;  1GQE A;  1NJZ A;  3HKW A;  4ZLN A;  2Q66 A;  4HAC A;  4OZ0 A;  1V3S A;  2IA0 A;  2Y3Y A;  2X1F A;  3THP A;  3NMA A;  3M2U B;  2Y9H A;  3A3O B;  1SL1 A;  1S9E B;  1XTZ A;  4NRU A;  4ZHR B;  3TUI C;  1SKU B;  4ZVO B;  1B0P A;  3CO0 P;  3BYR A;  4ZJQ A;  1DQ9 A;  1CJK B;  1PIL A;  4K5R A;  3BSA A;  3F56 A;  3ENV A;  3PG9 A;  3M32 A;  2HBQ B;  2IRX A;  1KP6 A;  4QWD A;  1G6B A;  1MRO B;  4Q2M A;  1VC0 A;  3VAL A;  2MQ8 A;  5IZH A;  3CD7 A;  1RHK B;  3E01 A;  5KG3 A;  4USU A;  2M7S A;  5J2P B;  2MXY A;  2D1C A;  1RWX B;  2XTJ P;  1RUS A;  1XER A;  3OT9 A;  5FJ4 A;  4FN5 A;  2HFZ A;  2VPY B;  2BQ3 A;  4Q5V A;  3NXZ A;  4ZP6 A;  3W62 A;  1HR0 J;  1F5B A;  4G3I A;  1G1X A;  2WVF A;  3P49 B;  3LAL A;  2AYG A;  5LJ3 Y;  1U6B A;  4HR2 A;  1CLF A;  1NND A;  2QMW A;  3E2E A;  2BMB A;  1NJW A;  4PYA A;  1X60 A;  4C0B A;  2I38 A;  1RCO B;  1FSU A;  2JC0 A;  4FP9 A;  5IT4 A;  1RHM B;  4N8O A;  3KLV A;  4ILL A;  3Q8Q B;  5AT1 B;  2KHD A;  3P6Y C;  2LQ5 A;  5FLX Y;  4I6Y A;  2B0G A;  2HFU A;  3HT0 A;  4DCJ B;  1JLQ A;  2HHW A;  2DCU B;  5ETP A;  2NCK L;  4KGV B;  2VOD A;  3NKQ A;  2GFF A;  1A6L A; 
#chains in the Genus database with same CATH homology
 3UN2 A;  1KH4 A;  4LR9 A;  2GLQ A;  3T00 A;  1ED8 A;  3WAV A;  3MK1 A;  5DLT A;  4MHX A;  3NVL A;  4QAX A;  5LIA A;  4GTW A;  4FDI A;  1B8J A;  3DYC A;  3UN3 A;  4YR1 A;  1ELX A;  3OT9 A;  2D1G A;  1E2S P;  1AUK A;  1ZEB A;  1SHQ A;  2W8S A;  3WAY A;  4B56 A;  4UPL A;  5GRR A;  4UPI A;  3NKP A;  4NWJ A;  4CXU A;  3CMR A;  4MIV A;  3WAX A;  1P49 A;  1Y7A A;  1ELY A;  3A52 A;  4ZG6 A;  4ZGA A;  3TG0 A;  2W5T A;  4UPH A;  1SHN A;  3IDD A;  2XRG A;  1EW9 A;  2W5Q A;  3M8W A;  3TX0 A;  1ZED A;  2XR9 A;  3KD8 A;  1K7H A;  3NKR A;  5LRM A;  4KAV A;  1HDH A;  1O99 A;  2IUC A;  3LXQ A;  1ALJ A;  5IJS A;  3M8Y A;  1E3C P;  2GSU A;  1AJA A;  3ED4 A;  2W5S A;  4MY4 A;  4LR7 A;  2IFY A;  4CXS A;  1Y6V A;  3UO0 A;  1KHL A;  1O98 A;  4FDJ A;  3T01 A;  3MK2 A;  5KXA A;  4UOP A;  1EW8 A;  1EW2 A;  4LRC A;  2ANH A;  4UOO A;  3T02 A;  1ANI A;  4LR2 A;  4LRB A;  2W8D A;  4CYR A;  1EI6 A;  3BDG B;  4UOR A;  1ALK A;  2GSO A;  1EJJ A;  1URA A;  4GTX A;  2GA3 A;  3M7V A;  1E1Z P;  2W5R A;  4CXK A;  2GSN A;  3UN5 A;  4LRE A;  3WAW A;  4LRD A;  3UNY A;  4KJG A;  1URB A;  5INH A;  4GTZ A;  5EGH A;  1FSU A;  5L0B A;  3IGY B;  3Q3Q A;  4CYS A;  1KHK A;  1KH5 A;  4KJD A;  5EGE A;  3TWZ A;  4TN0 A;  4N7T A;  1N2L A;  3BDG A;  4KAY A;  1EQJ A;  5HRT A;  1ED9 A;  3NKO A;  1HJK A;  5TJ3 A;  3IGZ B;  1ELZ A;  4LRA A;  1KH7 A;  3SZY A;  3BDF A;  5IJQ A;  4ZG9 A;  3B5Q A;  3NKN A;  1HQA A;  1ALI A;  3E2D A;  4LRF A;  1E33 P;  2W5W A;  4KM4 A;  3DPC A;  1KHJ A;  1KHN A;  5LQQ A;  2IUC B;  3MK0 A;  1ALH A;  4UPK A;  4LQY A;  5C66 A;  2G9Y A;  5LRN A;  5L0K A;  1N2K A;  4GTY A;  1ANJ A;  2RH6 A;  3WBH A;  4ZG7 A;  3BDH A;  2QZU A;  5DLV A;  2VQR A;  5AJ9 A;  2W5V A;  2W5X A;  1ZEF A;  1KH9 A;  5GOV A;  1AJB A;  3NKM A;  4LR8 A;  2X98 A;  5K4P A;  4NWX A;  5L0E A;  3NKQ A;  5DLW A;  1AJD A;  1AJC A;  3SZZ A;  3M8Z A;  2ZKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...