4LRAA

Phosphopentomutase s154g variant
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTGADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 139
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lraA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lraA01
3LXQA 3BDHA 4ZG9A 2X98A 3A52A 4KAVA 1AJAA 3NKQA 4UPHA 1KH5A 4MHXA 5K4PA 3MK2A 3NKNA 3UO0A 4LRCA 1EW2A 3KD8A 4KJGA 5IJQA 2W8SA 3UN5A 1EW8A 3Q3QA 1ELXA 3IGZB 4UORA 2W5TA 3M8YA 3UNYA 4GTWA 5IJSA 5LRMA 2W5SA 1EW9A 1KHNA 2W5VA 4MIVA 3WAVA 2GA3A 2GSOA 2IUCA 4KJDA 1URBA 1N2KA 5DLVA 4LRBA 5L0BA 4GTXA 4LR9A 2RH6A 4LRFA 2GSNA 4NWJA 1ALJA 3TX0A 1KH7A 1O99A 2W8DA 3MK0A 4UOPA 3B5QA 5TJ3A 3TWZA 1ELYA 1AJBA 1E3CP 2ZKTA 1Y6VA 2W5RA 1KH4A 4NWXA 3SZYA 3BDFA 4UPKA 3DPCA 5EGHA 1HJKA 5LQQA 1Y7AA 5GOVA 4LR7A 3MK1A 1URAA 3T00A 4CXUA 4ZGAA 3M8ZA 3T02A 4LR2A 5HRTA 1HDHA 1O98A 4UOOA 1KHJA 1KHLA 1KH9A 4UPIA 1ZEDA 4LREA 1ANIA 2ANHA 4KM4A 1EQJA 2G9YA 5LRNA 1K7HA 3NVLA 1AUKA 4MY4A 5DLTA 1EJJA 4UPLA 3WAXA 1ALHA 3T01A 1FSUA 3M8WA 5L0KA 1ED9A 1HQAA 3BDGB 4LQYA 3UN2A 1E2SP 5DLWA 1N2LA 2GSUA 4ZG6A 3IDDA 3E2DA 1ALIA 4GTZA 2W5XA 3NKMA 5GRRA 3M7VA 2IUCB 1E1ZP 4TN0A 4YR1A 4LRAA 1P49A 4LRDA 1SHQA 1B8JA 3IGYB 4FDJA 3OT9A 1EI6A 4LR8A 3NKPA 3TG0A 2IFYA 4CXSA 5L0EA 5C66A 3NKRA 5EGEA 2GLQA 2W5WA 2QZUA 3WBHA 3SZZA 3UN3A 1ZEFA 4N7TA 3NKOA 2VQRA 1ELZA 5KXAA 4KAYA 1SHNA 2D1GA 3ED4A 1E33P 4CYRA 3WAWA 3BDGA 2W5QA 5INHA 2XR9A 1ED8A 1ALKA 2XRGA 4CXKA 4ZG7A 4B56A 4GTYA 4QAXA 3CMRA 3WAYA 1AJCA 1ZEBA 5AJ9A 1KHKA 4CYSA 3DYCA 5LIAA 4FDIA 1ANJA 1AJDA
chains in the Genus database with same CATH superfamily
8ATCB 1VRUB 2IVMA 1JLCB 1FD2A 3EXYA 3MM7B 1MMNA 2VBYA 2XLJA 3MEGA 2LKZA 4FNIA 1Q7LB 1N5VA 2KXFA 4R0JA 4R8UA 4ZCMA 4I0WA 1GT8A 4NCBA 1RTDA 1LKZA 3TUPA 1GMWD 2E5GA 2LQ5A 5DZ6A 2HQFA 4Y28C 2PT0A 3EDQB 3JTNA 1IQTA 2VIHA 3FC9A 4CH0S 1FNOA 2MKJA 1NK0A 2A18A 3LF0A 3O2IA 3TEHB 1H6KX 4B02A 4TLRA 4IG0A 4RPFA 4YR3A 5B0GA 4J37A 1R27B 3CC4S 1RWNB 1BXNA 2KJWA 4DSKA 5KAKA 2ZNYA 3HI9A 3BGRB 4UZCA 2F8MA 4M95A 2ZVIA 4TU7A 3HVRA 1K1QA 2DNKA 3WX8A 5KFKA 2UXBF 3IRXA 4ZCKA 1N48A 3EVOA 1NHVA 1CPZA 4DV3J 3R1HA 2XZTB 2CPFA 4X66J 3IFEA 1DFDA 5IV4A 3TAMB 4KH1B 5CYMA 3M8YA 2MYFA 5CZVA 1X9WA 2ZKUA 5K8PA 3DLGA 2ZBIA 3GYXB 2YH0A 3R5CA 1CC8A 2DRBA 1UZHA 1BE4A 2XS2A 5HANA 4OYOA 1S77D 3CTRA 5IT9Y 4ZLPA 4KAIA 4LFBJ 1UEUA 2NXCA 1WTBA 2KI2A 1PC5A 4HLBA 4DCPB 2X1AA 4DHVA 3VGUA 3TNVA 2AZ1A 5A8WB 1KQKA 3HHLB 5KG2A 4JI8F 4ZHRB 5EX3A 3MMAA 3IRWP 3I4HX 2PFDA 5E3PA 2KM8B 2UUTA 1TKZA 2LDYA 1S1WB 4DR6F 4UOHA 1N5TA 1GTHA 1FCAA 3C66A 2OTJS 2IAJA 2OLWA 1EQ0A 4WF9Q 4HI2A 2ZH3A 2IC3A 3BV8A 1QVFR 4KY3A 4MIWA 4KYZA 3KMSA 3UDCA 4FYDA 4N76A 1CJUB 3FBBA 3THPA 1U1LA 2CPEA 3NL0A 2P6TA 2ZWPA 4OI6A 3Q3QA 3VGTA 3G8QA 2IM0A 4A8QA 4DWIA 3JSYA 4O3OA 3QPIA 4MK8A 3TWZA 3VQSA 1RBLA 1FVQA 3Q2SC 7FDRA 4NYOA 3DM2A 3HXMA 3QRQA 3H7HB 2BZ2A 5T7LB 1IWGA 1U6BA 2R3VA 4UPIA 2BANB 5I42B 4KM4A 3SSSA 1GEHA 1J27A 3PX4A 3K5NA 4Z2XA 1MN9A 1SC3B 1IKXA 1LWEB 3DOMB 3P96A 2MZ1A 4LBHA 3BO4A 2DH9A 1B8JA 1ZAXA 4B3TF 3FSYA 2X1GA 5C25B 3TUIC 3G71S 2UUBJ 3LP0A 2QZUA 2MZQA 1SQEA 2YNFA 3H20A 3N5FA 2ZOFA 4CLWA 1HWKA 1AB8A 1VK3A 2FZGB 5J1NA 4B17A 2CYYA 1HWLA 1REVB 1M5OC 2ZH4A 3UE2A 2G4BA 3C16A 1HIYA 3VAJA 4ZG9A 2DBBA 3B4DA 2MQOA 3HHEA 2HGMA 3I32A 1JLGB 1FVSA 2MQPA 4GTWA 1R8HA 2VU5A 1B0PA 3OVBA 2GVZA 1ALJA 3TZZA 3P6YC 3OVSA 1X4FA 1QE1A 1KH4A 1OMSA 3WZ0A 1WG1A 3CJ5A 1HNVB 4RKUC 4USVA 3T02A 3OTCA 1AW0A 1T94A 4HH1A 3PJWA 5KG5A 4WCEQ 4EYIB 3OTDA 2ASDA 2ZHOA 2R9LA 3J7YU 3BBBA 3HULA 4IQMA 5KFAA 4J91A 5A8RB 1FDNA 1T9YA 2IUCB 1FNMA 3OSNA 1B0TA 4CYUB 3SQGA 3V4MA 3PIOQ 2HBYB 1JX4A 4RR5A 1SH2A 2D9OA 5EX0A 5LL6d 3W5XA 4ZJLA 4DCOB 5L1JA 1J5OA 1Q5VA 1Q79A 5IQQA 3EICA 1F9HA 2LYVA 4AXIA 1YJVA 4A4JA 3CDBA 4ZN3A 4IDKB 4N47A 3CCUS 2FVSA 4DR7J 4LF9J 3R5DA 1WKJA 3QFWA 2RD5C 3ENWA 2HFZA 4GRSA 2MMYA 4TVAB 4JP8A 3KJQB 1W7WA 2EKYA 2NS1B 2IVFB 4CLZA 1VRTA 4NYZA 5D0GA 3CCVS 1NH7A 3LANA 2XY6A 2P2CB 3BH6B 3JQMA 3VAFA 4PQUB 1YVFA 3SFUA 4PEOA 1PJ7A 2XMKA 2W9AA 3FEXB 4EBCA 4DR4J 2IM1A 4P2MA 3MEKA 2XZWA 3HVWA 2E5LJ 3POTA 5L0EA 3DLHA 2O67A 2CPJA 1RDRA 1NZ8A 2CZ4A 1HNWF 2ASLA 4DR5F 4Y2KA 3ZZOA 1RWPB 3AXKA 2OSQA 2MQMA 3O5TB 3DXBA 3FQKA 3VVTA 3O3LA 1Q53A 2QIFA 3OD2A 1EKSA 1IR1A 2D9PA 1VHIA 4FKXA 5T41A 1RT7B 4B9TA 2ZDOA 2XYPB 2MQLA 1TV6A 1FRIA 1U26A 2VICA 2AYEA 1VQLS 5DQIA 2XS7A 3UQSA 2WOMA 4WFNQ 2GSNA 3I5BA 3QO9B 5C2CA 3EUNA 2ILZA 1KFSA 2KB2A 3NY0A 2BE7D 2LLZA 2BE9B 2VA3A 3M8QB 3RRKA 4M5JA 3KG1A 4MY4A 4K4YA 1H0HB 3T9ZA 1TUWA 1Q5YA 1FTCA 2DNQA 4GMKA 4BLGA 1TTHB 2VC1A 3D66A 4OX9J 4YFUA 1SIWB 4B9LA 4K0KJ 4YR2A 1DURA 3OFFA 2PDAA 4LVOP 1KP6A 1IVZA 3CEDA 2BE2A 3LTOA 3GJRB 2CADA 2MY7A 3TQ1A 2X3DA 1SH3A 2FPHX 2K3KA 4KIAA 1WG5A 1RAFB 4ZP8A 5B0FA 1U1OA 2ZH9A 5DM6Q 1WHYA 2CQGA 4MMOA 2HNYB 1Q81T 1ZPWX 2AWZA 1FJGF 1ACMB 4DR2J 3NWRA 3C6TB 1X7VA 1AUDA 2YKNA 3SCIE 2FQQB 3FBCA 4QIEA 3IA0A 1H2TZ 1U6ZA 4ZMMA 5HN0A 3H5XA 4OI2A 1BY9A 1UJ6A 4LVNP 2LCWA 1IBKF 3ZTQA 4WWSA 2V8DA 4UOOA 5KFIA 4JI3J 2ROGA 3E8OA 2RHQB 1FT8A 1DLOA 3M8RA 2JVOA 2UUCJ 1JJ2R 5I4MA 1M1HA 1SB6A 1OQ6A 4R0EA 3SZ2A 1NK7A 2XCAA 3R8YA 1CS4A 2Y0SD 2YNHA 1M5SA 2Z4PA 4KSEB 4A8WA 2V8HA 3CJ3A 5J2MB 4EK2A 2NPIA 4QWBA 2BW2A 3IBWA 2I5JB 1UPPA 1U0SA 3KK3B 5KFCA 1VGYA 2M8HA 4UY8T 2RDDA 2ZNZA 3NEKA 2MZSA 1NLKL 1RAGB 2RQ4A 2GSOA 2VG7B 1HBUA 4URQU 2QA2A 4ZVFA 3NXZA 4YN3B 2R7OA 2OD6A 4B3OB 1JK9B 1HJKA 2JFKA 2DITA 2V67A 3GLJA 1G1XA 4AL7A 2AYBA 3J80U 1SL0A 4F4WA 3RW7A 2ZVSA 1VBYA 3GILA 1WTFA 4B3MF 4FXDA 3ETOA 4JV5F 2NZ4A 4NA1A 2ZUAA 2ZWOA 1KWMA 2FY1A 2IRXA 2F9JA 2DGQA 4QU7A 2VOPA 2HQIA 4ZPVR 1TELA 1HLWA 4K2XA 3PFOA 1VIXA 4OZ2A 5J2QB 3C15A 1VCTA 4ELVA 1PAUB 3CCZA 3ISZA 3ED4A 4DLEA 3VAMA 2W8LA 1WSRA 5AXMA 2IHR1 3MR2A 3H40A 4C11A 2PGCA 4YR0A 2LXIA 1RHRB 1WHWA 1NZAA 3CMES 1EARA 3UO0A 2CRLA 4DL6A 3CSKA 3IGVA 1FWKA 2H5EA 2ZH8A 1TL7B 5LMNF 4HT5A 4RUBA 4OHYA 2HHTA 2WBRA 1IBMF 1U47A 1D3WA 4PCQA 3R5BA 3PHEA 3BR8A 4HEA9 2XCPA 1W2BR 5LRNA 2HYIB 3ITHA 1FSUA 3BDGB 4KKOA 1JLEA 1IKVB 1O6XA 2IJNA 2VH7A 1X60A 1E1ZP 2DIVA 3N6MA 1VLYA 3KHRA 4J9MA 4F26A 2KTQA 4MAKA 4DV0J 4TNOA 2DGWA 4HACA 5JVGQ 4OFZA 1HD0A 3BQ0A 3O44A 4K7QA 2QO3A 1NRKA 4A8YA 4OYAA 2FGCA 2O5DA 3ZZRA 5HQ8A 1AJDA 1X31C 1HYSB 2BV3A 2E44A 3ZNJ1 4ID5B 1KKHA 3D6TB 2P6SA 3RB4A 3SSRA 3KUHA 3HVTA 2R8GA 3MEEB 3UFCX 1T95A 2VQEJ 2E1PA 4HHHA 1FXLA 3OPKA 3CJKB 4RBTA 3BSCA 2DNRA 4DUZJ 4PXEA 2LQ8A 1X5OA 4I64A 4OX6A 2I2YA 2DGUA 2WK4A 3THTA 2NUUG 3J81j 1LK7A 1VQ9S 2B0GA 1TKDA 1O51A 1FJ7A 1UVJA 3LAMA 4RO0A 3T1YF 1H2UX 3ZC4A 2F4VF 3MOZA 2EG2A 2VF3A 3I0RA 1IBLJ 1QSLA 3W2WA 4DPYA 5GMDA 4C2MA 2F65A 4Q8EA 2EEYA 3KUEA 2DHHA 1T7PA 1EP4A 3IC1A 2W5QA 4PG5A 3FCWA 1S0MA 1KQGB 4YB7A 4OJ3A 3W1YC 3TJAA 3Q8QB 5AE2A 1ITPA 1KQFB 4GC6A 1WF2A 3CDWA 1VQPS 1WNEA 4X2BA 2CPIA 2JOQA 4QR1A 1XMOF 3JSBA 5A2QY 1G3OA 3DGPB 1CJVB 1T11A 2QLWA 1SPBP 2RUGA 1IWAA 2M5YA 3HF5A 3KTQA 4OZNA 1DQ8A 4LF6F 2DIUA 3DKDA 4A8OA 5A76A 4LSZB 1RACB 4FF2A 4Y2AA 4QBUA 3KLGA 4HTJA 2A3JA 1NSPA 4H4KA 1ED9A 2CPYA 2QLJB 5AT1B 2XY7A 4PWUA 1FRHA 2E9ZA 4DPOA 2MGZA 2C22A 2MQQA 3I5CA 3HJFA 1SJ4P 1SJRA 2CG4A 3CCTA 1WC1A 4K5SA 4ECVA 1RQ0A 2VG5B 4KAYA 1N36J 1X9MA 4JI1J 4TU9A 2Z2LA 4QYRA 2ZHBA 5CYQB 4B56A 4QAXA 2DGOA 2ASJA 4M5KA 1RT6B 2CPZA 3H90A 3DOLA 3DOKA 2YPYA 2V34A 2MKHA 4X84A 3HZGA 2MSTA 3FBFA 3MUTP 2DNZA 1URRA 3DRYA 1KHNA 4WFYA 1PJ6A 4ZOSA 2OHDA 4RW4B 5HI7A 4C8OA 4FPIA 4MTPA 2XC9A 3T00A 2H9ZA 1LWFB 4U67Q 1QJHA 5JJBA 2YWWA 1S1UB 3DC2A 1WOOA 3RW6A 2GGPB 3CIZA 2WVFA 3JXOA 2Z2MA 1RTJA 4URGA 4J9KA 3BM7A 3KLFA 2HQ3A 5D4NA 2ZDPA 5F8MA 3KLHA 2HKEA 3M2VB 4P6QA 1TL3B 3UCUP 3AJ2A 4P9SA 2FJVA 3F44A 3A8IA 4W98A 4V19X 1HW9A 2FZKB 4LFAJ 3VTIA 2R7TA 1KHWA 5LIAA 2PSZA 3NGUA 2VHGA 3PKYA 1ZH5A 4NA3A 5M2RA 3SSQA 1WHXA 3OHAA 2ZHAA 1XIQA 2LXFA 2CDRB 4L75A 4ZK7M 2KFNA 2FIUA 1PBUA 3GFXA 3KHGA 1RYRA 3UNYA 2B9EA 4F2SA 3V6DB 4OI0A 2RILA 4E0DA 2BQUA 4Y34A 7AT1B 4OHWA 4I7FB 4G1PA 3J7Z5 1LW0A 1VLOA 3GV8B 1G6BA 1VHFA 2N82B 3DRPB 1DTTB 4OHVA 2G9YA 1H7XA 3TEGA 2PEHA 1XN9A 2AEFA 2OI2A 3G6VA 3RAQA 4DV5F 3UCGA 4LQ3A 1FO1A 2Z2YB 1WI8A 5K20B 2RUSA 3OT9A 3TG0A 1XR7A 4C8NA 3UVJB 5E2QA 3M2RB 3UN3A 3BYPA 1UWAA 2LQJA 3OUYA 1N54B 5HLFB 4TKTA 3GQCA 1J5EF 3C19A 4ZKAA 1EKRA 3I0SA 3JQKA 1Q78A 5DDRC 2X1FA 2KT2A 2XWXA 4CNYA 1M90T 1K73T 1TVRA 3FVYA 3M2UB 3OLAA 4KHPJ 1FRLA 1JXVA 1TKTB 1ZTWA 2X51A 2G2OA 4U9RA 5D4OA 4ZVHA 5E41A 4NWXA 4ZVPB 1TKXA 2E5LF 2EK1A 4U7UK 3FKBA 3CDEA 4W90B 2HGLA 3R7SB 1PSDA 4LR2A 4RW8B 2APOA 2PO4A 2K7JA 2F3JA 4DV1J 1HR0J 5KG6A 1S10A 1JKHB 2O3DA 1N88A 2C2MB 2W2MP 1X4DA 5IZHA 1QAIA 1RWWB 5B09A 2I9SA 2IJRA 4RZRA 1S9EA 2YVSA 1VMBA 3RRGA 3NLCA 3QJJA 3EPGA 1HPZB 2E7WA 2QJ3A 4I68A 2WVDA 4M5IA 4NLTA 2POKA 1XK8A 1NB2A 3CMRA 2C3YA 2DPIA 2QMWA 4LIRA 4I2QA 1NNDA 3K5LA 1RWKB 2V50A 5K9FA 3RBDA 5K4PA 4Y3CA 2E5IA 1TK5A 3UN5A 5EN1A 4ERDA 1TFYA 3A3OB 4WU2A 5ETQA 3J7AN 1H38A 1VBXA 4B9MA 5HMYA 5K8MA 1LFWA 3H2VE 2CIMA 4C8KA 3KOAA 3FMWA 5K14A 2CQCA 2HNZB 2CG8A 3ZZPA 5KG7A 1KH9A 4ZVRB 3BB5A 2OPSA 4EFAC 3HHNB 4P2SA 5FLXY 4P72A 1VRUA 3OR1A 1S6UA 2FVQA 3DDNA 2YKMA 5FIIA 3BQ2A 4DU8A 3V6JA 1N5QA 1RA7A 1ZPVA 4KFBB 4H4MB 1B64A 2M7SA 1HNXF 2PFFB 3TUZC 3QRPA 3KJFB 1CULB 3W65A 3R2DJ 2EFVA 2VFTA 4L6V3 1UKUA 4QR2A 4QJVA 2CVIA 3VALA 1AA1B 4RW7A 4LT6A 1UW9A 2DVIA 2Y0BB 3DLLQ 1EW8A 2J9EA 1EW9A 1LV5A 3IMQJ 2DJWA 2GQ2A 2XMWA 2N7YA 4AD6A 4DCJB 1VJWA 3B4MA 3TAPA 3VAHA 4JI0F 4YHHF 2VBZA 5IS2A 1FRKA 1YK9A 2QN6B 5D4LA 2QLXA 4FN5A 2KH9A 4RNNA 1EZZB 2O01C 2ZM6J 1ANIA 3C2PA 2FJWA 4C0HA 2Z2ZA 4X65F 2DR7A 2NYHA 1B99A 1CJKA 3J7A1 2DRDA 2WW8A 1LW2B 2DNNA 5GAEU 1C4AA 1TK0A 4B3SJ 2E9RX 3TARA 1OWXA 2W5WA 3N5BA 3NOCA 4HHJA 3RU0A 1FK9B 4NI2B 2X1BA 4ZVEA 1RAAB 2LEBA 4ZPAA 3ET6B 5DGBA 2J0XA 3KNAA 5T14A 3BDHA 2PE8A 5GADU 2NZCA 1FERA 1S4EA 5K8NA 2BJ8A 5MLCV 1N33J 4QPTA 1R6YA 3Q23A 1HI0P 2DXFA 6AT1B 4JI4F 3MAAB 4RX6A 3SDEB 2KG0A 4P75A 5L38A 1RT5B 1VDHA 3BDFA 3BJYA 2LQ9A 2R7SA 2E5HA 2CQIA 4LSNB 3IR5B 3K89A 4EO8A 2RDIA 2ASYA 2BUNA 2CA9A 2QSFA 1Q95G 1EQJA 2XYGB 3RTVA 3T1HJ 1XQIA 3QAUA 4LQYA 2XNRA 1HNZJ 4G1QB 4O3NA 3JQJA 1JLAA 4CQ1A 2W5XA 4LBPA 1NDCA 2YXLA 1M1GA 3M7VA 2V5HG 5F8IA 3DDIA 3MURP 2IFYA 2KRBA 5KFWA 4CRJA 2VFUA 2DH8A 2ZH5A 1FA0A 2PC6A 1VQOS 2IVYA 2D1GA 3J7YI 1KHVA 1I94J 1XMQF 2IJFA 3TW0A 1CVJA 4JI5F 2HHSA 3GCXP 4PWWA 3WIUA 3PACA 3MUMP 1MN7A 4JYAJ 1KH5A 1O0PA 2L08A 1RYSA 1NM2A 1U1PA 3BQ1A 1RT1A 1K9MT 4ED3A 3BKUA 3DOMA 5CD4H 1WG4A 4RBUA 2BEFA 4NA2A 2E7XA 5C25A 4CTAB 4R5PB 1VC5A 4M5LA 1AZSA 5DQGA 5D6GA 4LMZA 2BMBA 1XNRJ 3MR5A 2IPOB 5CAAA 4MK9A 3MOJB 4MIAA 1REVA 1IM6A 2V4RA 3PRVA 3FZ2A 2RQMA 3M1VA 2MPUA 1XNQJ 2HQCA 3QYYA 4U6PA 5SUHA 2W9BB 4HI1A 3DLBA 2EFOA 3N6LA 1D8ZA 3G9CA 4C98A 2B9XA 4GVBA 2JEGA 2ZD1A 5I3UA 1S1XA 2XRGA 3GB0A 1X4EA 4WXOA 2AJ0A 1AJCA 1NJYA 1GTEA 3QLHA 3W2VA 2KO1A 4X64J 2JEJA 4RWWA 2DNHA 4ZVSB 3FSIA 4RNFA 5J1EB 2FJAB 3M9NB 2W8SA 4P73A 2P9GA 4IG3A 2IUCA 3RR7A 2JHEA 4N77A 5IC6B 3JSMA 1RHUB 1GMWA 1P9QC 3LAKA 2PI4A 3MM6B 8AT1B 1J2VA 3IXQA 2EW9A 4QW8A 4K4TA 2HRYA 2ZC3A 3UN2A 4IDKA 2PN6A 1HI1A 3MPVA 2VOOA 3IP0A 1PILA 2CFXA 1TR0A 4RNHA 3D0GE 2YNIB 2DD8S 4J90A 4N7TA 2RT3A 2HHHJ 5HP1B 3F41A 2Y1JA 1U0HB 2MZRA 1UETA 5A6WA 2KHCA 1I5OB 3N9UC 3SXLA 2Q79A 4PQUA 2B8PA 2N4DA 3LGHA 1BQNB 2UVUA 3M9MB 2FHOB 2HWIA 4V1Ak 1LOUA 2YH1A 3KJNB 2JSXA 2EPIA 2WSCC 2F9DA 4TY8A 3D0IE 5HROA 2BM0A 1X0PA 2HWHA 4XTTA 2D3ZA 3DU5A 2EI5A 2RF2A 2MKIA 2ATLA 2FZCB 3FMBA 4GO5X 4KHMA 4OZ5A 3IS9A 1OY8A 3QIDA 5SZTA 4JI2F 1ZBTA 3CCWA 4J9NA 3ZTRA 3M05A 3GZ7A 4CP5A 2VFRA 4ZCIA 2H5JB 5C7PA 4JI7F 4C48A 2ZH2A 2A1BA 4C8ZA 2ZBQA 5D0RA 1IN0A 5THWA 1HBMB 2KG1A 5KG0A 4JI1F 5DLTA 3P3DA 1JXEA 4JV1A 1ALHA 2RHSB 1RT7A 2H65B 4M63A 3C6UA 2YWEA 1ZM2A 1KFDA 1NMEB 4PQAA 1IUJA 5H9FK 3KLEB 4DS4A 3QO9A 2IM2A 2ERRA 5DS7A 2CVEA 1VC6A 2P9EA 1FKOB 1UWBA 1C1CA 3OR2B 3PYFA 2CZVC 3M8QA 2GFFA 2WW4A 1MMDA 1ZOTA 3TVYA 2HFUA 1C0TB 2QL5B 1DTQA 3QJLA 1S1TA 4USMA 4LF5J 2JLFA 1N6QA 1V5IB 3FK4A 4NWJA 1T9WA 2JDJA 2JFDA 2YWHA 4KO0A 3LP1B 2OD4A 5LOQA 1SL2A 4NLDA 4MKYA 4RU9A 5KT3A 2GVDA 4Q2MA 2I0XA 2HS3A 1NB7A 3T01A 1YITS 4FF3A 2HNYA 2B6AB 5AJ3J 4FNHA 3EX7B 1OPZA 2GHVC 2P9CA 4DX8H 2UUAF 3UDEA 3C6TA 3OLBA 4DS5A 3RR8A 4QCLA 2DO4A 4PUOB 5LXRA 5KG1A 3OFGA 1YHQS 2C3UA 3QT7A 2CPHA 1R0AA 3WAWA 3DYAA 2YNGB 1BGXT 1MG7A 3DRSB 4P10A 4DL7A 4NLVA 1VISA 4OX7A 2L3MA 4IRDA 2YQ1A 5H9FJ 2H48B 3DLEB 4QIVA 1OIAA 2W9CB 2QE5A 2D74B 4I69A 3LALA 2QGFB 4H54A 4NX9A 3CD6S 1WELA 1KVIA 2VG6A 2N3LA 4NPOA 2RAQA 2WTFA 4X4UA 4Y00A 1Q8LA 3V81A 1PIEA 4HKQA 4H4KC 3ZO7A 4PABA 2B43A 1FD8A 2DK2A 2C2RA 2NYIA 1R8PA 3M8ZA 1T9UA 4NCGB 2M2BA 4KPYA 1SV5A 3DMJA 5D3GB 5IT9U 2W01A 1QAYA 2B4OA 5J2MA 3VAIA 3RG6A 5IOLA 5KFQA 4DR1J 2I5JA 4DPTA 4GKJF 2O66A 1WC0A 4IYQA 2HQDA 2CXEA 2IM3A 4CM0A 4PWDB 2CQ1A 1HMVB 3UI3A 3HKWA 2MY8A 2VG7A 1U1RA 3M8PB 5EWFA 4KHPF 3Q2TC 2F1FA 1E6VA 2FHMA 3VVUA 4UZBA 3B6BA 3CJRA 1TUVA 5HVFA 1AFJA 5D8HB 3LH2S 2FYXA 1YJTA 4A8MP 1UL3A 3M30A 1T3NA 3MK2A 3HZEA 1XC9A 2CZ9A 3K58A 2ZH6A 1FJCA 2E7VA 1SUQB 5IWAJ 1RKIA 5IC4B 4OHZA 2KVQE 2ZJQQ 1D09B 3CCES 4CLYA 3TZYA 3DLKA 1N32J 1X4BA 3BGLA 3HO1A 4B3RJ 4UOGA 4DI6A 2C28A 4CLTA 3QBCA 1JNRB 2L9WA 3IG1B 2XMTA 2VASA 5DQHA 3KJVB 2BJ9A 1WEZA 1TL5A 5E33A 2R8JA 2U2FA 4CO2A 4IFVB 2GSUA 3DHXA 4O4GB 1M0SA 3E2DA 1S12A 2V2VA 2G1DA 2NREA 5F3ZA 3G4SS 3WC0A 3M32A 1SBRA 1FFWB 5LJ3Y 2W24A 4F50A 1IR2A 4TQSA 3MEGB 4CXKA 1Y11A 1RAHB 3QNWB 2XSJA 1HD1A 4R8UB 1S0VA 2IMOA 3EZUA 1C0UB 2D41A 1RTDB 2AEJA 2Y9HA 3NCQA 1VRQC 3MECB 2JRSA 4MIVA 4I56A 2V4JB 5J2PA 5CXTA 4KE5A 2VUGA 4LR9A 3T19A 3ZTOA 4IG0B 3FDSA 3OVAA 2A6MA 1MWQA 2LP4A 1SKUB 2DH7A 1P27B 4A8KA 1Y3JA 2M70A 1V6HA 2M88A 4BC7A 4OYXA 3PM9A 4RUCA 5L8RC 1HYSA 2GS8A 1XMBA 5L1LA 4ID5A 3HM9A 2GIQA 1P9YA 2W4DA 3IRXB 4ILMA 2LFVA 3IGYB 4Q7AA 1GNKA 4JI6J 3CCJS 4UOCA 2L9NA 1IKWA 1NHKL 2H5IB 2B5JA 4CYRA 3PNIA 1EETA 1Z2LA 1UCNA 1PCAA 3MD1A 1JJHA 3DLGB 1ZZFA 4TY9A 2C2DA 4NLUA 5F9NA 1HQUA 1T03B 1YIJS 3ISND 3GFZA 1U48A 1TAUA 2XI3A 3GFYA 3CO9A 2R7WA 1YDLA 5E5NA 1FHTA 4KV8B 5ITHA 1YWXA 1FDAA 2FVRA 1O99A 4NLSA 2DTJA 3BF4A 3SV4A 3SZYA 4XIUA 4UPKA 3D6FB 5F8HA 3BREA 3EZOA 2HWTA 5F0WA 5ETTA 4Y65A 3MMAB 4K4ZA 4DV7F 2D3O1 5A8KA 2RU9A 4FS1A 1TKZB 3ONQA 1NPRA 2IAJB 1Y00A 5CZXA 3LGMA 4CO0A 3J80Y 1OSDA 5DETA 5GRRA 4U7UD 5HMWA 4ZITA 1VBKA 3EMTA 2KVIA 3IR6B 4U96A 5KFOA 4DFJA 4CH7A 1YBAA 3BGOP 3NS5A 3WDOA 1SH0A 2RB7A 3QSIA 4OV1A 2DHAA 3K7RA 4B08A 1ZM3A 3HHLD 4UY85 3A4TA 1KTVA 4DL3A 3ILIA 5JMNA 3BGUA 3TUJC 3SCJE 4WFZA 4P2FA 4NXMJ 3DM2B 3X3UA 2LEPA 1EW2A 1MW7A 2Z0GA 3NGSA 4LFCF 1KOOA 3T1HF 2G0JA 3AXMA 4X4QA 1UVNA 1OS5A 2D69A 1HNZF 4NRUA 4URSA 5EWEA 5AXKA 1EQMA 3RBXA 4NMLA 1WI6A 1IKXB 3MK1A 1S7HA 1Z2ZA 1L3TA 3J81U 4P7VA 2B9WA 2FHJD 4M5GA 3PG9A 1RT6A 3OTEA 2YNFB 5B0EA 2ATCB 2DR5A 3H5UA 1ALIA 1CSJA 3CCSS 1V3RA 3BR9A 4LBIA 4IRKA 4RNOA 4FP9A 3T6BA 1A9NB 3BBFA 2A2CA 3JAMY 3B54A 5B0CA 1RLCL 2VPYB 2XSFA 2V2ZA 3NKOA 1YSJA 3D6MB 3KDOA 3DFEA 1L5UA 1B4SA 4FF4A 2XTJP 3V4IA 1WF1A 2AJQA 1CLFA 3T6JA 1QE1B 5C5JA 1RLDA 4EMDA 4DZ6A 5ETSA 5LM7E 1LWCA 4M5MA 1IBCB 3GIIA 5JXSA 1DHMA 3HK2A 4LF1A 2W5VA 2AW0A 2XQCA 3MTJA 3MM5A 4EWTA 3C14B 3JB9k 1RCOB 3FNNA 4IFYA 4IH7A 2VD3A 3EXCX 4HL9A 2BRKA 1TL3A 2LMIA 2V0NA 3CDUA 3VGSA 2G1HA 3SQGB 3T41A 2CQDA 4ALZA 1RE1B 4LSLA 4DPUA 2NXEA 4EYHB 1UPMB 1MROA 4BC9A 5LJ5Y 5DG7A 1NJIT 4OIXA 1U02A 2QLBB 2CJQA 3SI8A 1VBZA 2Q3PA 4NLYA 2EFGA 4K50A 4LF8J 1QUVA 5H9EJ 1M5PC 4NLWA 3KG4A 2ZUGA 1KD1T 1TL1A 4QQBA 2JC1A 1RAIB 4PPZA 4Q0BA 1EHWA 1YJRA 3D9BA 4TLQA 1U4BA 1P8GA 3Q89A 2AMCB 2FJBB 2BDPA 3M4XA 4Y6IA 4QYZK 2NSBA 2LA4A 1T8EA 3HKZD 1ZETA 3BKTA 1Q4RA 4XO0A 4LF4J 4OMFG 2B8QA 4Z37A 4ECXA 1PBAA 3L9ZA 4DG1B 4HTIA 4UOPA 4WFAQ 5HMZA 2NLWA 3UVJA 4DUYF 4AXJA 1WKKA 2UVVA 1IJFB 4EUVA 3GG0A 3AOCA 1WC4A 1C1BA 2OGUA 1MU2B 3HLUA 2AHOB 1ROFA 2HS0A 5IM0B 3VZIA 1F1BB 3EGNA 2GX8A 3Q8RB 4GTZA 1UZDA 3CGIA 4DXLA 2MEWA 4DN9A 2BJ1A 1TKTA 3QT8A 3G6YA 3RJMB 4NEZA 1GXLA 4ZDNA 4IOCQ 4L74A 4FVCA 2ROPA 3TA0A 4ZVUB 3HP6A 3QMQA 3TZWA 1RZMA 4OHXA 4GTYA 2E5JA 2WOMB 4Y2CA 3WAYA 3FBEA 3O8WA 3FCHA 3PJ9A 4LF7J 2J0QD 3M6UA 1VQ4S 1YJUA 3HFZB 2GZOA 2GIFA 4CLKA 2R7VA 1Q82T 3E2EA 5D78A 4CCHA 4DOZA 2PA8D 4QYZJ 1LEOA 1AUSL 3B5QA 1HKAA 2HRUA 3GIKA 3PW4A 1RAJA 1K0VA 3KWMA 1A6LA 3CULA 1U49A 3V2UC 3P49B 5KT7A 2QX0A 3QAEA 3ENQA 2J76E 3P5TL 5BYRA 2J6TA 4YS2A 3MEDA 2DNMA 4JV0A 2M8DB 4DX7A 2E29A 2BE2B 4EGLA 4ILLA 4MKBA 3KLVA 1JLQB 3MWBA 2UU9F 4F67A 2M4MA 3D28A 1UFKA 2HZVA 4K59A 2J0WA 1CJTB 4B9UA 5HBMA 3NP5A 1R89A 4J9PA 3CIMA 3HSGA 2KYZA 2YKNB 4PXCA 2DNLA 3HX9A 4CYSA 5IT0A 4ED7A 1MNEA 5L9NA 3R3TA 3OL7A 2D7SA 4S0MA 4XAKA 4I2PB 5G0RA 4O3RA 4KGVB 2CAJA 1W26A 2OJ3A 1U2RA 1F9EB 5GADI 3WHIA 1DLOB 5KFXA 5IFMA 3GJTB 3K0JA 5ETPA 2AJFE 1CULA 2XO6A 2CWKA 4AQYF 4F3QA 3JYTA 2UXBJ 1CS4B 4YDDB 2K1RA 2YNHB 1S76D 3CCRS 5GAGU 2K8GA 1U09A 4N56A 3NNCA 1WEYA 2VZ9A 3H25A 3E01A 1WORA 2AX0A 4B9SA 1T9XA 3OTBA 4ZLNA 2AQ4A 5CHCB 1RWUA 3WQPA 2CPXA 4CM2A 4FDFA 3L09A 2VDIA 4ANDA 2EG1A 4OQJA 3CMAS 4DQQA 3IWLA 1VQSA 4TYBA 1NKBA 1LFPA 2EBEA 2IDLA 2ALZA 1PGZA 2BBEA 4DV4F 2UXDF 4KHRA 2H1YA 3DLJA 5A2QU 2VB6A 1LW2A 3OTOF 2AEMA 3CJSA 3U7JA 3Q24A 2IDEA 4DR3F 1TL4A 5ETMA 5E7OB 1KH7A 4EZ6A 3CT9A 3D68A 3G82A 2RQCA 4DR6J 4Y2MA 4CI0B 4ZS6A 2N4CA 2HBRB 4NI2A 2J8AA 4J9OA 2ZE2B 2GQQA 4Z7CA 3HFKA 2FLOA 3UD3P 2DHXA 4RU2A 2BKOA 4C11B 4PRFA 1G7CB 1LK5A 4O3QA 4X4SA 1YBTA 2J9DA 1FX4A 2FLNA 5KT5A 2RNEA 3MAAA 2R8KA 3I9ZA 1NDKA 3NS6A 3GWCA 2PMZD 1KVJA 1FKAF 2WAQD 1JLFB 2OKQA 4C3MA 1KONA 4CO1A 1PAEX 2WHOA 3T5LA 2HK3A 5C2GA 3MZIA 1UP1A 3QGIA 3BS9A 4KJGA 3RB0A 4NXNJ 1B7FA 1RTHA 3SIPB 1WKLA 2Z56B 3IAS9 4GKKF 1KLMA 2FC9A 4LRFA 2RVJA 3DGVA 4NLOA 3ITHB 3JS9A 4ED4A 4IOAQ 1AJBA 2E1MC 2J5AA 4ICLA 3BN4A 1JLEB 5HO4A 4B3TJ 2NXUA 1S6QA 1RTIA 2AYGA 2MTLA 3NAHA 5B08A 3I56S 2BW7A 1RT3B 4HACB 5LMUF 2LDIA 1UJ4A 1YLXA 4USJC 4NLPA 1SHQA 4AT1B 3ILJA 2Q6BA 3F0NA 3R5JB 1S6PB 1FTRA 2WONA 3SZZA 3R7NB 2YKOA 1Z1ZA 3LP2A 3MR7A 3PV8A 4CTAA 3AQPA 4R5PA 3RAXA 1JNZB 3HVTB 1NK9A 1D1UA 4HDHA 2U1AA 3NKQA 3E51A 3U27A 3Q8PB 1RBOB 2E1CA 3MM9A 4ECUA 2A10A 3DRXA 3LPEA 1R6VA 2OPPA 4K4UA 2V63A 1R8BA 1XEZA 4FXVA 4IOBA 2E1AA 3IBFB 3N28A 4ETZA 1K0TA 2ALYB 1Y6VA 4KGMA 2OH2A 5U47A 4ETXA 5BR8F 3I0RB 4I1TA 1H2VZ 4NE9C 2CJAA 2M52A 3KLIB 1R8CA 2QZ8A 4HR2A 2R42A 3D1OA 4PXBA 2JNJA 3Q8SB 3TA2A 5L0KA 3A3NB 1P1TA 2UXCF 3IM8A 5J1EA 2Y8WA 4ZJOA 4X62F 3UR3C 4KGKA 4WU3A 2JWNA 4IR1A 1HHSA 1RXOB 4O4RA 2HG4A 1DQAA 1Y0HA 2H4YB 5A0YA 4MFBA 5KFTA 2EWHA 3GP9A 2OELA 3QGGA 4HVZA 4ZPTR 4PG6A 1X5TA 2FDNA 3MCMA 4A8SA 3EVWA 3N79A 2QTWA 2CQ2A 3MPYA 1S59A 3EWGA 5CH7B 3DI6B 3WX4A 4O44A 4OI1A 1YZ7A 4ZCLA 1C2PA 5TJ3A 5KOXA 3PR5B 3MHYA 2RRBA 2HIQA 5ETRA 4OL8A 4ES2A 5HP1A 1F5CA 2CJ9A 2HVIA 4PG8A 1LXNA 2HAIA 1Y9OA 1HNWJ 1B7YB 1HQEA 3QJPA 3H8YA 2WB4A 3N01A 3CMQA 1HWIA 4N5SA 3I87A 4C8YA 2AJ2A 4EBDA 3T3FA 3GR0A 3DOKB 2CJYB 4IUFA 5EGEA 5EWGA 4ANEA 1XERA 2VPWB 2IA6A 3T5KA 2DR9A 2W4PA 1KQSR 4IRCA 1HBMA 4KJIA 3G87A 2C2ZB 3PEHA 3SV3A 4ZJQA 1C4CA 2Z8QA 1EIYB 1N34F 1YRTA 1M5VC 1WC5A 3AD8C 3MF5A 2CDQA 4IR9A 4F3MA 3IR7B 5E3RA 3VCDA 4CDIA 4E98A 5F41A 2R7XA 1XWLA 4F36A 3ZXWA 2DXDA 2HS4A 1RHJB 1FKOA 1S0NA 2FVCA 1YGYA 3QIPA 5KOWA 1T9VA 4Q45A 3KLFB 2ZZNA 5IV3A 2IRUA 3H5SA 3KLHB 1WC3A 3N0VA 3KYLA 4YY3F 3UPFA 3DCAA 1H7WA 3KG0A 1C0TA 5E0OA 3TOQA 3HD1A 5JUMA 1FJGJ 1YTYA 3VWSA 3O6QA 3NMRA 2V2KA 1APSA 1NK8A 1OY6A 2YTCA 3NNAA 2MHEA 1B3TA 4QPXA 4JBCA 2YWGA 3GIRA 5L9XA 4USUA 5EGYA 3LP1A 5CD4A 4DL5A 3NBPB 3FUYA 4P7TA 1IBKJ 1L3VA 4NCAA 2A0FB 1AXQA 4K4XA 2DNOA 1LW0B 2MB0B 1FFSB 4L3NA 5IJQA 2BVZA 4I6AA 3X1LB 3PW2A 5L0BA 3I55S 1HNIA 2VBXA 1RSCA 3EGWB 1URAA 3GONA 3DRSA 1HA1A 1CQNA 4DL4A 1I6JA 2C2NA 3GV7B 5BYQA 5DM7Q 2B4UA 1RTZA 2ZZMA 2RS8A 4UPLA 2JH3A 5I3QA 1HQ2A 3OUYB 4NLQA 2W9CA 3AHPA 3HFVA 3OL9A 2OAUA 3ZZYA 3I0SB 4C0BA 3BZQA 2B4PA 2VA2A 3T9NA 3W62A 1UEKA 1FDBA 1TVRB 4DEZA 2W1BA 2OPQA 3ILOA 3PX6A 2BR0A 3TQEA 4NCGA 2J6SA 1VQ7S 2BKNA 3LXQA 3W3SA 5D3GA 1TKXB 1U8WA 2JZ5A 5E3QA 2QFIA 4B3MJ 3AB2B 3H59A 4WE1A 4JV5J 4W92B 1XTZA 2LQBA 1QD1A 2W2QP 1HMVA 1WJ9A 2HVHA 2YKAA 2AX1A 2VBWA 4C6AA 3TR5A 4DV3F 2HRTA 4K5RA 4ER8A 1S9EB 4X66F 4YB1P 4WP3A 5ADZA 3ELHA 5K8OA 4KR0B 2VQFJ 3P45B 1PYTA 1YZ6A 2OEKA 1Y4ZB 4M5DA 4XDDA 1PYSB 2XGPA 1SUQA 3KFWX 3PO4A 4FYWB 1EI6A 4EBEA 1BC6A 2QV6A 2MJNA 3HSZA 3ULHA 1ZAVA 4E2FB 4LFBF 4TQRA 5LMNJ 4A48A 2K7KA 4ZG7A 4F4ZA 4MYTA 4Q5VA 9ATCB 3DYCA 1ANJA 4KAVA 5D77A 1CC7A 5HMXA 2SXLA 4IFVA 1ELOA 4OYIA 5KFEA 4WZMA 5K14B 3VAGA 3H4DA 2VJUA 2DGVA 3UNGC 3KDNA 3RZAA 2OPSB 1BQMB 3TI0A 3CB4A 1UVLA 3FRYA 4HDGA 3OR1B 2LEAA 5B0BA 1DARA 5LSRA 1CBKA 5CCLA 4QIFA 3FFIA 2QLFB 2YKMB 3AJDA 4F2RA 2H54B 3I4PA 4QW9A 2A2DA 3KK1B 2ZZTA 4WYLA 3GE9A 4WKYA 4DBQA 1RGVA 3HSJA 1C0UA 2J7UA 3MAHA 4MJKA 4HHUA 3US5A 1N5YB 4DMZA 3OL8A 4BDPA 3MECA 4LRDA 4W4MA 2V4JA 2HFVA 3GU0A 3NKYA 3OXFA 4RW7B 3I5AA 1S97A 2OMOA 3MXHP 1NBEB 1FWPA 3Q0AA 1RT2A 1QUPA 2IMWP 1NK5A 4OV6A 4F0HA 5A6PA 4EEYA 2CQ0A 2KKHA 3K5OA 3VQTA 2BX6A 1U2CA 2HNDA 1VK8A 2UUBF 3T1YJ 1RB0A 3PXGa 2F4VJ 4LRBA 3JTOA 1RU1A 3QQCD 4ES3A 4F3OA 1CJKB 4WKRA 5GMKa 3GCWP 5C42A 3VF0B 4IO1A 2YKQA 1VQYA 3PZPA 1JLBB 2KFZA 3MMJA 2GHPA 3D0HE 2R7UA 1S49A 1T03A 3KXDA 3UR0A 3RRHA 4Y0FA 4ZVOB 4RBVA 4WPAA 2BQRA 1XMOJ 2Y1LB 1VIOA 2HLUA 4KV8A 2F40A 3KNGA 5DG9A 3BPDA 3SCKE 2XO7A 4LF6J 4DV2J 4ENOA 2NXJA 1RWXB 3H42A 2Z58B 1KHKA 4OZ0A 3NGTA 1HBNA 5AE3A 4TN2A 4M5HA 4H4OB 1BQXA 1RT4A 5L1KA 1LWXA 3EVMA 4GVLA 1A0OB 4ELUA 2G0CA 2Y8YA 2W2PP 2LU2A 3HHDA 3EM1A 2W4CA 3FRZA 5IXUA 1Z4UA 3LOUA 1PJ5A 2G13A 2WBMA 3AA8A 1RABB 1DZ5A 2GJFA 2AJ1A 4F04B 1JLAB 2N3OA 1SC4B 2BJDA 3ZTPA 3W9JA 4DR7F 3OV7A 4PZVA 3UDLA 4KH0B 2ZJRQ 2FJXA 2F8HA 4LF9F 2EFPA 1NXIA 3QATA 4NMXA 4HT7A 1ZM4A 1Y3KA 4F25A 2OEJA 4GC7A 1S1VB 4G1IA 4ED5A 4CXSA 2NCKL 4MKVA 3V6HA 1OO0B 1B0VA 3IGNA 4NXNF 4CLPA 4J9VA 5KXAA 1NKCA 5KFYA 1RT1B 1FE4A 3NOGA 3K17A 3UCZP 3P4UB 3GFHA 1I51B 3CD7A 4DR4F 4BS2A 1T05B 5ETOA 2GCFA 5HQMA 2AD9A 1FXDA 3G8SA 3G2XA 4NLGA 1AZSB 5HVHA 3SCLE 4K2JA 4B9NA 2GJIA 2XLKA 2W5TA 3KK2A 2G9OA 1URBA 2YPZA 3BKFA 2NQPA 2OSRA 4ED6A 4ZIVA 3L95X 3KHLA 2DB1A 3CF5Q 2KXHA 3M1VB 4MIBA 4N8OA 3ADAC 2GJ2A 2ZBPA 4L3KA 4ZLLA 5HRTA 1TAQA 1KOHA 3Q8YA 3MR6A 4OYBA 2JEIA 4GVBB 2ZD1B 4OJHA 3AJ1A 1S1XB 5I3UB 1E6YA 4R25A 2UVWA 1LXJA 1TQLA 4FS2A 1HFEL 2XZDB 1WF0A 5H1SV 3QLHB 3PRBA 2EFNA 3W2VB 1P6TA 4DJBA 2I1RA 3V6KA 5B7WA 3AA9A 3LW5C 3C14A 4NWBA 3AOAA 5INHA 5D0HA 4OX8A 4A46A 4ID8A 4AE5A 3QT6A 4IG3B 4QU6A 2ZFHA 5L39A 2KYXA 3AAWB 4P71A 2RKIB 3JSMB 1AJAA 4ZVGA 4OX9F 2CQPA 4K0KF 4UUWA 2DEJA 4AYBD 4RW9A 2MKSA 4DV5J 2C3PA 1M5HA 1JLCA 1NDPA 1NHUA 2CKWA 2ACYA 3MM7A 1JIHA 4RL1A 2ZH1A 1VYAA 2HZCA 2HMIB 4CWBA 1GK8A 4DR2F 4ECTA 1RK8A 1J5EJ 2IYIA 3IDDA 4JV2A 4A47A 3W9IA 6FDRA 4IO9Q 2UUWA 5HK4A 1H3DA 4DG1A 5HSPA 4TY8B 5HROB 3FSXA 4JI3F 5J1PA 2IYGA 2W7AA 4NRTA 3BDPA 1R8AA 2RF2B 4KGZB 4KB7A 4WBFA 2OPRB 3MPDA 1RHMB 3IS9B 1MU2A 3CC7S 2QC3A 5KG3A 4G3IA 3VZHA 3TA1A 5IM0A 4F8RA 2PA3A 3PKMA 5GVQA 3H0PA 3W5ZA 2UUCF 3BGRA 3CUNA 5FJ4A 4YOEA 3IGZB 5F3TA 2RE1A 3I96A 4ZVTB 1WC6A 2EKNA 1R7IA 2E1RA 2CUYA 3QRRA 2MZJA 2M3DA 3ENVA 2YWKA 2GO9A 3CJTA 3C6UB 1N4LA 3TAMA 3W8GA 2AU0A 1IQZA 3PHTA 2Q1LA 1VQMS 5BYSA 4DLGA 1RISA 4AFFA 1VQ5S 1D9FA 4F4AA 2WCXA 3S7RA 2VONA 1CG2A 1UWBB 1F0XA 3J81Y 1U24A 1C1CB 4A8XA 3VV2B 3RUBL 2HZAA 2HHPA 4IH6A 2FVPA 4ED0A 3R5GA 1T3OA 1ZA1B 1YJ7A 1R0BG 4QZVB 5A8WA 1DTQB 1ED8A 1S1TB 2HVDA 3HHLA 1N6QB 2X7IA 4ZHRA 1PYOB 5GAGI 4ECZA 3GPAA 2OFHX 4OYPA 3MD3A 4WYWA 1TMMA 1GAOA 4KO0B 1S1WA 2R8HA 4V19J 3K5MA 3NKNA 4LRCA 5DO2A 2XI2A 3FCVA 1TMJA 1JLQA 1VQ6S 2GVDB 2MDAA 4C9DA 1CJUA 1CJTA 4OJGA 2ZKTA 1E3CP 1OY9A 2AZ3A 3W66A 3R7BB 1PC4A 5F0UA 4LR7A 1YJWS 1QTNB 2PEBA 1HNXJ 3QGPA 4D3HA 2FHJA 1JQGA 1D0EA 3MMBB 4USKA 1U1NA 4WK1A 4A8FA 1S5ZA 1R0AB 2DISA 3DYAB 4BBYA 2R8IA 1RHQB 4I2PA 4J5OA 4U7CA 3HPOA 2F7VA 5T7LA 3H2UB 4X4OA 2BANA 5I42A 5IQ6A 3D3CJ 1YJ9S 4P52A 1KVKA 2VG6B 1U8SA 3D1QA 2NR0A 5KFZA 1LWEA 3CJ4A 4WXWA 3SQOP 4JI0J 4YHHJ 3NNHA 2MHNA 4DQIA 3V81B 4C97A 4UPHA 1D9DA 4CLSA 2RDJA 1FF2A 2W5SA 4Q43A 4WK3A 4X65J 1SV5B 3DMJB 4DV0F 4BCAA 4X4VA 1SXLA 4I4BA 4NZ0A 4C8MA 5CQGA 2LXUA 4WP9A 3ICLA 1UJ5A 1MWZA 1A7GE 2K06A 4QIGA 1DBDA 1JLGA 4TXSA 2MKYA 3R27A 1HI8A 4Y2IA 3TP2A 1KHJA 1KHLA 2W25A 4QR0A 1IKYB 3CNQP 2ANHA 4OZ3A 3PW7A 1AUKA 2FD2A 4USHA 1FXRA 5KFGA 1E6VB 2L48A 2GHWA 4J7CA 3MUVP 1N2LA 2VQEF 5GAHU 2J9CA 3NCRA 1HNVA 1DY3A 1X4AA 1HBOB 3DU6A 5DDOC 4DUZF 1X8DA 1G2EA 1WUUA 3M30B 4JI4J 2QFJA 1YX2A 2R4FA 3QGHA 3F56A 2XR9A 2V9WA 1ALKA 5A8RA 1U45A 3F73A 1FEHA 3CVKA 3OSPA 3DLKB 2DY9A 2MLYA 2ZE2A 4CYUA 4QWEA 1IBLF 4U8VA 3M6VA 3CC2S 1KBRA 1FEEA 4UTGA 3MDFA 2PIIA 1F3FA 2H3EB 3TJ8A 2VQFF 2V69A 4C3LA 3MM8B 4Q2LA 2QEXS 5DRKA 3TAQA 2IY5B 1SC1B 2DNGA 3MCNA 2V4QA 2FUG9 1ELYA 4FZVA 4RNMA 5EUHA 4RLEA 2MKKA 2HHVA 4ANCA 1SL1A 4ATNA 1JLFA 3M32B 2EK6A 3VHQA 2IIHA 3MMCB 1ULRA 2PMWA 3BH7B 1FKPB 3LO3A 3BO2A 1XMQJ 4JI5J 2COLA 3RBZA 2XBPA 4ES1A 4QWCA 1E2SP 1NUEA 2ILYA 1GMVA 4O23A 2XSJB 4ZP6A 1HWUA 4FDJA 5RUBA 2A6OA 2B9YA 2W2OP 3JAMU 4PR6A 2J6UA 5HVGA 1NJZA 4OZLA 2RRAA 4X4TA 2DGXA 1N0VC 2I8EA 3ETMA 3Q8UA 2GAGC 1VQ8S 2HFSA 1RCXB 1O5JA 2IA0A 1UEVA 1U1QA 5J2PB 3CJQA 2XMUA 2XG8A 4PXDA 5DG8A 4CLFA 1YG0A 2DCUB 1RT3A 1DRZA 1SJFA 4F4YA 4USIA 1SQFA 4CIOA 3GG1A 3BSNA 5DLFA 2FJDB 1N36F 2X3GA 5J2NB 2GMHA 3CCMS 1BD6A 3S01A 1WACA 2C1EB 1S6PA 3Q8VA 2BACA 2HVZA 1NAQA 1RWMB 4F0MA 5AE1A 2KDOA 1F9FA 1OSCA 2XWYA 4DL2A 1RBAA 3HSDA 1X4HA 3TYTA 1RUSA 1IKWB 1K47A 2CJXB 3R5AA 2B5JB 1EB0A 2XNQA 1EETB 4XK8C 2JC0A 2MQNA 2QL9B 4LUBA 3D1HA 5KFJA 4UF4A 2DNPA 1HQUB 3LPYA 3AT1B 5F9LA 3GIJA 4USWA 4K4SA 3RB3A 1SVDA 1ZEFA 2DEIA 1GXTA 2B4VA 4DV6J 4AL5A 3PY8A 2ZBCA 1RJJA 4OYWA 3U1NA 1RWVB 3KLIA 1FFGB 3DRRB 3TZXA 3K2YA 1F6TA 1FNXH 3BSAA 2Y1RI 3WIVA 3KD8A 1X5PA 4GO7X 3PVXA 3ZZUA 1UA1A 1X9SA 5A8KB 2AGOA 3BSOA 4DFKA 1FX2A 1NSQA 1UTAA 4GTXA 1MLAA 3BO3A 1T0TV 2V94A 1PG5B 4CT9A 4LFAF 2FC8A 4ZA1A 2B51A 4YB5A 3DPCA 4CXUA 1GH8A 3IN5A 2GA7A 1S6OA 4CO5A 4X4PA 4LREA 1Y5LB 3M8SA 2AGPA 1S7IA 4CNZA 4DV2F 3WAXA 2V8PA 3K8WA 2C2OB 3FGVA 4NLXA 3H5YA 3CJ2A 1IM4A 5CABA 2CNNB 4XPEA 1S9GB 4ZP9A 1RP5A 2AF6A 3QWPA 4X4NA 3DI6A 3CD0A 9RUBA 4DFMA 1ELZA 5KT6A 1YRXA 4K8RA 4UW2A 4JI2J 2C2EA 5HAOA 4TYAA 4K4VA 2D3UA 4FVMA 2R7RA 4JI7J 5FDLB 2Q43A 3RYLA 2KJVA 4ECQA 2BQ3A 4Q8FA 5GMEA 2JLGA 3NGKA 2H51B 1PO6A 4RW6B 4EU0A 1D9AA 3RBEA 4OI4A 5EGHA 5GOVA 3KK3A 4FBTA 4KPCA 3U1MA 3PR4A 2JX2A 4N8NA 2JLEA 5ETLA 1ZAWA 2JL9A 5ETNA 1ICEB 2Q6CA 2NPFA 5F8NA 3MPUB 4DU7A 1FWLA 4NZ6A 4B3OA 3V4IB 4J9SA 1SCJB 3H2LA 3FZBA 3L7PA 5KFRA 5KFLA 2BJ7A 3G8TA 4WZQA 1QTMA 2J7KA 1SJ3P 3NS7B 1SIZA 4ECWA 4KC5A 3CJ0A 2KRRA 1LWCB 4FYVB 4JUZA 2Z57B 2QYCA 3NGRA 3FQLA 4DV1F 1HR0F 2RU3A 2DY1A 3PYGA 2XLIA 3MM5B 1BUXA 3ZZZA 1ZS6A 5J2QA 5C24B 1JB0C 1XR6A 5LT5A 5DDPC 4IFYB 3JSRA 2GW8A 2OMLA 2OIHA 5L1IA 5AXNA 3CXCR 1GMUA 1JMTA 4RJVA 1FRMA 3SEOA 3W9HA 2UUAJ 4LSLB 4OLPA 1WEXA 1FESA 1RI7A 3W63A 3AD7C 2GAHC 4EZ9A 1QM9A 1MROB 4ED2A 2OEMA 1O98A 3IWNC 5DDQC 3L4BC 3NBPA 3CDAA 1TL7A 2CJKA 4HH0A 5KFDA 1M1KT 3P8BB 1S9FA 2AGQA 3K59A 1KEKA 1TL1B 1S99A 4N41A 3GTYX 5G4DA 4Q0BB 2V8VA 4F0KA 2IFXA 2MQ8A 4FYXB 2W8KA 2K3IA 2ZJPQ 3NKPA 3PX0A 1WD6A 1RA6A 4L72B 1SHNA 3NGDA 1KR4A 3BDGA 4PKDB 1IKVA 1R31A 3MTKA 2G2ZA 3R6LB 3H98A 1T9TA 2NSCA 2PI5A 3D54A 1PKUA 2GC8A 4DDFA 1C1BB 2QRRA 2XB2D 3NWGA 2V9KA 4GKJJ 2CJBA 3W64A 2OTLS 5EHHA 3PW0A 2J0SD 2I6WA 1JXLA 1Y10A 4OZ1A 3W61A 5LXYA 2IBOA 1M5KC 2E66A 1BLUA 5KFSA 3MEEA 3MI7X 2MLZA 4ILRA 3CJKA 5DLWA 5CYMB 4C4WA 1WWHA 5KFMA 2HHUA 3UD4P 1QSYA 1OPIA 3HCXA 2EC2A 1TP7A 1KS2A 2ZM6F 5LSLA 1FRXA 1FE0A 4ZN1A 4J9QA 4XDCA 4UUXA 4DQPA 2XHWA 5AJ9A 4DF8A 2DGSA 2XHCA 2XS5A 2HEKA 1HHQA 5M2UA 1Q1KA 4KT0C 2DXEA 1VC0A 4B3SF 4CLLA 3AQOA 4FYYB 2QYGA 2BABA 2C3OA 3MEDB 4G6VB 3AOBA 1FJEB 5KT4A 3AFGA 1URNA 3NCPA 3DGPA 1CJVA 4WFBQ 2IC3B 3PCOB 2HVEA 3SYZA 2P5VA 1N52B 1N33F 4M94A 1V3SA 2Y3YA 2PD1A 3T5HA 4D3GA 2XMMA 3D7SB 5HBMB 4I6YA 3PDNA 1W2IA 4RWXA 3M6WA 3OHBA 1L3UA 2UP1A 1Q86T 2ZOGA 3HD2A 1S0OA 4UQGA 4B9VA 1V3ZA 1D8YA 4DSJA 4ELTA 1BQMA 3A8EA 2CQHA 2R2UA 3C46A 2R7QA 2AT1B 5G0RB 3MPWA 2BM1A 3W5YA 1MMLA 1ZEBA 3KK1A 4WJBA 4MHXA 4DUTA 2HFNA 2VG5A 8RUCA 3AODA 4PAAA 3CJ8A 1SJ1A 5CYQA 3PO5A 2KFYA 5CA5A 1LQ9A 3JYTB 1V5VA 1N5YA 3QZ7A 5DLVA 3HVAA 3LP0B 2V6AA 3OW2R 4I67A 2W8DA 3G96A 1I94F 5HJXA 1X0FA 1V9OA 2K1RB 4O3SA 2WRMA 1UFLA 5BJRA 3V5RA 4JYAF 2YX1A 3C16B 3E01B 1MWYA 4RW4A 3M9OB 3TVKA 3D2WA 4ZG6A 1F5BA 3P5BP 3THVA 2HAFA 4ECYA 4JB8B 2ZOMA 1LWFA 4LRAA 1RU2A 3A8KA 4EI2A 2RSQA 4U8YA 2GVZB 5BXIA 3ISNC 3LQVA 1OQ3A 5D0EA 1S1UA 1QVGR 3R97A 1XNRF 1UAWA 3S8SA 1B70B 1NCLA 3D5MA 4OZJA 2PMHA 4DQRA 4OYZA 2GGPA 1GX6A 1VJQA 1XNQF 3TANA 1GX5A 4NYPA 1FRJA 3HT3A 3CWJA 4DV7J 5E3AA 1JLBA 3KUGA 3G82B 2NUHA 1DAXA 2F63A 4ZLJA 3L7UA 1JJ4A 4O0NA 3KMQA 1N5SA 3M2VA 4DSEA 5AXLA 2QSWA 3C8YA 4KJDA 3GSIA 2RH6A 2OP5A 2RMLA 3DN9A 4QIWD 3MK0A 1JJCB 1AROP 2RIJA 2RQKA 3OBIA 1J5OB 4DQSA 4ED8A 3EPIA 1RKJA 4CO3A 4X64F 3MR3A 3H4BA 2GNKA 3V6DA 4H4OA 4WFXA 2WSFC 4I7FA 4M8LA 4L73A 4BWMA 4EO6A 2DHGA 3HHLC 2MJUA 1OJ4A 2BYCA 4J9UE 3PIPQ 2Z30B 1VRTB 3DRPA 4LFCJ 2KM8C 1DTTA 3R2CJ 1WSVA 4DZDA 1RAEB 1WDTA 2MKCA 2ADBA 1R0CB 1NPKA 4OYMA 5L46A 1RTHB 3D3BJ 3NAIA 3PFEA 1Q8KA 1UVMA 4AUKA 5DJBA 1OYDA 2CWXA 2HBQB 4F4XA 1KLMB 2QT7A 5B0AA 1K8AT 1Q0NA 2RH3A 4FPRA 4I6WA 1T02A 2X98A 3RGIA 4USTA 4ICLB 1KTQA 3M2RA 1VI7A 4NOHA 5HLFA 2GV1A 3MCSA 4C7QA 3BEGB 2WZ1A 1S6QB 3POTB 4WP8A 1RTIB 3RAMA 4KQZA 2HHHF 3RB6A 3N4WA 1KRPA 1S1VA 4J9RA 3GSDA 3U1LA 2F4FA 2DYAA 3M2UA 2B56A 4DFPA 2DHSA 2CQ4A 3DDKA 4DX5A 1NDLA 3TRGA 2MSSA 2WONB 4DF4A 4DN0A 1T05A 1K7HA 2GO8A 2VKRA 2VKZG 1TV6B 2OUGA 3LP2B 5KFNA 1TZ0A 4ECRA 4DX6A 4ZPBA 4NEYA 1KLNA 2HBZB 4QWDA 2P8IA 4RW8A 5ETVA 2J7WA 3GYNA 1UMJA 5F8LA 3DXSX 3OL6A 3ILLA 3MM9B 4ED1A 4XPCA 5B0DA 1HWJA 2WB1D 1JKHA 2OPPB 3Q86A 2I38A 2JJ4D 3D67A 3K8VA 2MLXA 3S1TA 3SBMA 2JEFA 4WIIA 1W25A 3A52A 2WVBA 3EYZA 1KC8T 1HPZA 4UOFA 2LU1A 1BWEA 2MZTA 4M5NA 3IO1A 3CO0P 2DR8A 2LECA 3A12A 1XR5A 2AIRB 1OYEA 1L3KA 3PW5A 4WTOB 3LUYA 1AYEA 2GQCA 2HGNA 2DKOB 3UW1A 1SQGA 2CNOB 3GYGA 1HDHA 3W8PA 2VL1A 4DV6F 4F4KA 4DSLA 2ZBRA 4LF5F 2RKIA 4TU8A 4PYDA 3ZFVA 2VPXB 3OQ2A 1WDDA 1YBUA 2HFOA 5A0YB 4MFBB 2DGTA 2HNZA 5GAEI 4LR8A 3EJMA 3R9LA 2GLQA 3FEYB 2KU7A 3I82A 4LJMA 4OJ1A 3T1AA 3LWMA 2HPUA 3HJVA 2XY5A 4DUYJ 3A13A 4O44B 1S4FA 4E8UA 1MSWD 2VFSA 2HMIA 5HL7Q 1H73A 5AJ3F 3GV5B 1XBWA 4KFBA 4H4MA 2YX7A 2WVCA 4CZCA 3TVZA 5MAOA 4AL6A 2BKPA 1U6FA 1QLNA 3GMGA 1HQEB 2KL8A 5KFUA 2ABYA 2KHDA 3O1LA 2WSEC 3A3PB 4ZGAA 5KFHA 1WOSA 3B82A 2B3TB 2OPRA 2FB0A 4UT4A 1ZEDA 4P74A 2CNLB 2YY3A 4MKAA 3G6XA 1HQAA 3AY0A 3QZ8A 2DR6A 1P49A 1HBUB 1NO8A 1ZTTA 1Q7YT 2Y1IA 4PG4A 2EXUA 1HARA 1Y5IB 3IAM9 2V68A 1YRUA 3OJSA 3CE8A 2HK2A 1NSKL 2D1CA 3Q83A 4KBIA 2C2KB 3HDSA 4FDIA 4DR1F 3L7OA 2CNKB 4JI8J 3K57A 1KDNA 2DCLA 4K4WA 3GR1A 5CYJA 4CLUA 1YQHA 3QIPB 1FK9A 1Q8IA 2RS2A 4NZ7A 3AB4B 3ET6A 1SJQA 3C15B 2UU9J 1GFWB 1WOPA 2UZAA 1RWOB 2UVRA 3OFEA 1BHNA 3PTWA 1AFIA 2XEXA 2MXYA 2QMXA 2DT9A 4LF2A 2RRNA 4G65A 3CCLS 3PYDA 3SDEA 5IWAF 5KFBA 2VODA 4WIQA 2XM3A 2FHKA 1RT5A 1RAOA 1RHKB 4MH8A 4O3PA 1GXUA 1N32F 1NEEA 1NJWA 4LSNA 4B3RF 3D4JA 2BOPA 2R2SA 1F2GA 3TO8A 1QAXA 1E33P 1GQEA 1F3VA 2ZEJA 4G1QA 4ZPWR 4CO4A 2J9DE 1N0UA 2ROEA 5GAHI 4ZPCA 1XJWB 2HSEB 1CQMA 2Q66A 1HNIB 1NSAA 3SMZA 3MMBA 5KG4A 3B78A 4AQYJ 4KKOB 3OFHA 2G0IA 3BN7A 3SFGA 4NASA 1ELXA 1Q16B 2FGOA 1FI4A 1ZA2B 4JOUA 5ETKA 3I31A 2BA9A 2W5RA 2QA4G 5M2PA 1QY7A 4FKYA 2YWFA 3FJ2A 4O0IA 1F2HA 3Q22A 3NRBA 4M1KA 1YJNS 2D3OR 4WTYA 4CH1A 3J7ZT 1TK8A 1KSPA 3QWUA 1WHVA 4NLRA 4FBUA 3M8WA 2OPQB 1S57A 2GMLA 4Z7YA 3CW2C 3AD9C 3EDRB 2C3MA 2QG9B 2EC0A 4TN0A 4DV4J 2UXDJ 1VQKS 2ZH7A 3ZZTA 2HLTA 3UD5A 3ENAA 3QFHA 3OTOJ 3ZNUA 2DRAA 3HHKA 4DR3J 3EGVA 4DPXA 4WE1B 4L76A 2W9BA 2V2QA 3NG8A 2YQ0A 2CQ3A 5KFVA 1RADB 5K5MA 1IKYA 2EFQA 5KTQA 3HT0A 4YUDA 2E9TA 1P1LA 3BYRA 2FJEB 4YB6A 3W2WB 4JI6F 4UORA 4FF1A 1HBOA 3OJUA 5JVHQ 1CEZA 2KT3A 5F8JA 4NL5A 1NU4A 3TX0A 2QA4S 1EP4B 2CPDA 4M5DB 3WBZA 5KFFA 1HHTP 4IKAA 4F7VA 2EVZA 4CT8A 5CCMA 1DJ0A 2FTRA 2F8EX 3U02A 2AJ4A 4DL0C 1H98A 1FDDA 2YQ3A 3TJ9A 1QSSA 5EDWA 2ACMA 2AYMA 3MM6A 1ZZNA 4OI3A 3K5PA 2XYHB 2LVWA 3ZTSA 3MM8A 1Q8BA 2R2RA 5D15A 4GKKJ 2VQRA 5DLGA 1K44A 4PG7A 2VJVA 4ZPDA 2BJ3A 3KLGB 3A1YG 3A8JA 4DPWA 2VDHA 2W2NP 3MMCA 1NPPA 2YNIA 5I3PA 1TFWA 1UVIA 3PRDA 1FKPA 1TU0B 3MGJA 1S48A 3M6XA 1HW8A 4YDXA 3FEZA 3FFIB 1NK4A 4YP3A 2ZC4A 2GIRA 3ZZ0A 1IR0A 4LIWA 5LRMA 5E3CA 1U0HA 2AP6A 5LMUJ 2MGZB 2BXJA 2GA3A 1UVKA 1X5SA 4DR5J 3MFHA 1BQNA 4MK7A 1U1KA 1DQ9A 2UV8A 4QWAA 2DO0A 3BPSP 3DOLB 3GIMA 3G86A 1Y7PA 4NXMF 1UA0A 3NVLA 2G2YA 5KT2A 2DPJA 1RT2B 2YBVA 1EAYC 2H4WB 3L3CA 4YR1A 2KN4A 4X4RA 5J2NA 2VV5A 1EX8A 5IT4A 2HNDB 1QDUB 5F8GA 4FXWA 1UFWA 1U2FA 2HURA 3UDVA 2OFGX 4C3KA 3W60A 1ZM9A 2KXNB 5BR8J 3S6EA 3TX8A 2QMUB 2UV8G 1VS3A 3KLEA 2ADCA 1LNQA 3I9V9 2NXNA 3E3XA 1KNZA 4C0OC 5C42B 2YKPA 2B7BB 1RTJB 2R2TA 3OR2A 1N2KA 4IQXA 2UXCJ 1VFJA 5KFPA 1BMQB 4PYAA 4RUHA 3QT5A 4OLOA 1H72C 4X62J 4Q44A 5FLXU 2HHWA 3LWLA 2L9DA 3VGVA 1NK6A 3I6PA 2BOAA 1EJJA 1AT1B 3DRRA 2IBKA 3HMJG 2YX4A 1ZYQA 1YKWA 1BWVA 2BRLA 4BWJA 2M9KA 3D6HB 1HBNB 5HATA 2V8GA 1RT4B 3OXGA 3KHHA 2XULA 4P2XA 2F5GA 7FD1A 3T5JA 3WBHA 1SKSA 2QA1A 4ZIWA 4J9LA 4KGXB 2FLLA 1HL6A 2B6AA 4ITSA 2W7OA 2DNYA 1F5AA 1YI2S 2KT5A 2EBGA 3GJSB 5D4PA 3CCQS 2OO4A 4PUOA 3NMAA 2VC0A 3R6GB 2XMAA 3N6NA 2K2PA 1S72S 2WVEA 4QOTA 3MAQA 2YNGA 1TUGB 2FLPA 4KTQA 5IJSA 4C8LA 1X4CA 3MCOA 3IBCB 4LF8F 3WAVA 2CQBA 1S9GA 4PPDA 3W7BA 2VPZB 3DLEA 1I3OB 3OXLA 1VOMA 2HHQA 2BJEA 5FD1A 1X4GA 3PEJA 5HQLA 5DGAA 1Y7AA 1EJ7L 1VQNS 2KZMA 1U7LA 2FY8A 4YEAA 2KZZA 4YMEA 1R43A 1U1MA 1O8BA 1IXKA 5FDLA 4LF4F 4UQTA 1UW4A 3EZ5A 3G6ES 4BHQA 2M0GB 3JTPA 3VR1A 5C66A 1N56A 1NH8A 1SKRA 1N8RT 3QSYB 4RW6A 1R3NA 2HHXA 3BBCA 1N34J 2J8SA 3MFIA 3GJQB 2LA6A 4KRWA 1JWWA 5H9EK 3KK2B 2L41A 4ECSA 4PWDA 4DSIA 3WC2A 1KN6A 4U95A 1SI9A 1H74A 3M8PA 2XMVA 2C42A 2QL7B 2XMJA 4ZP7A 2JVRA 3IM9A 6FD1A 4RUAA 3EE3A 3PJXA 1SC6A 4HYKA 1REGX 4YY3J 2AKWB 1SKWA 1L3SA 1E6YB 2VFVA 5LQQA 2B7CB 2N7CA 1G4CA 4YQWA 3CPWR 3IWXA 4LF7F 1NJXA 1IJEB 1U25A 4I2QB 3CD5A 4DSFA 1VR6A 5C24A 2W7PA 1K1SA 1QAJA 4MT1A 3LA0A 3UWTA 3KKFA 2GMJA 2HW3A 1NKEA 3IG1A 3LGNA 3NKMA 4F02A 4ZVQB 3KJVA 1IBMJ 4LQ9A 4IH5A 2IRYA 2ZITA 1S79A 5HJYA 4MYUA 3NKRA 3VAKA 3EGZA 3C3LA 5DZ7A 2AV5A 3AH6A 5LSOA 2HQGA 1I1GA 2XGQA 2HIYA 4O4GA 1F60B 3PYEA 3DHWC 3BGFA 3BDEA 3R1LA 2O1PA 1Y5NB 3DNCA 2RJZA 4RW9B 3B8HA
chains in the Genus database with same CATH topology
3LXQA 3BDHA 4ZG9A 2X98A 3A52A 4KAVA 1AJAA 3NKQA 4UPHA 1KH5A 4MHXA 5K4PA 3MK2A 3NKNA 3UO0A 4LRCA 1EW2A 3KD8A 4KJGA 5IJQA 2W8SA 3UN5A 1EW8A 3Q3QA 1ELXA 3IGZB 4UORA 2W5TA 3M8YA 3UNYA 4GTWA 5IJSA 5LRMA 2W5SA 1EW9A 1KHNA 2W5VA 4MIVA 3WAVA 2GA3A 2GSOA 2IUCA 4KJDA 1URBA 1N2KA 5DLVA 4LRBA 5L0BA 4GTXA 4LR9A 2RH6A 4LRFA 2GSNA 4NWJA 1ALJA 3TX0A 1KH7A 1O99A 2W8DA 3MK0A 4UOPA 3B5QA 5TJ3A 3TWZA 1ELYA 1AJBA 1E3CP 2ZKTA 1Y6VA 2W5RA 1KH4A 4NWXA 3SZYA 3BDFA 4UPKA 3DPCA 5EGHA 1HJKA 5LQQA 1Y7AA 5GOVA 4LR7A 3MK1A 1URAA 3T00A 4CXUA 4ZGAA 3M8ZA 3T02A 4LR2A 5HRTA 1HDHA 1O98A 4UOOA 1KHJA 1KHLA 1KH9A 4UPIA 1ZEDA 4LREA 1ANIA 2ANHA 4KM4A 1EQJA 2G9YA 5LRNA 1K7HA 3NVLA 1AUKA 4MY4A 5DLTA 1EJJA 4UPLA 3WAXA 1ALHA 3T01A 1FSUA 3M8WA 5L0KA 1ED9A 1HQAA 3BDGB 4LQYA 3UN2A 1E2SP 5DLWA 1N2LA 2GSUA 4ZG6A 3IDDA 3E2DA 1ALIA 4GTZA 2W5XA 3NKMA 5GRRA 3M7VA 2IUCB 1E1ZP 4TN0A 4YR1A 4LRAA 1P49A 4LRDA 1SHQA 1B8JA 3IGYB 4FDJA 3OT9A 1EI6A 4LR8A 3NKPA 3TG0A 2IFYA 4CXSA 5L0EA 5C66A 3NKRA 5EGEA 2GLQA 2W5WA 2QZUA 3WBHA 3SZZA 3UN3A 1ZEFA 4N7TA 3NKOA 2VQRA 1ELZA 5KXAA 4KAYA 1SHNA 2D1GA 3ED4A 1E33P 4CYRA 3WAWA 3BDGA 2W5QA 5INHA 2XR9A 1ED8A 1ALKA 2XRGA 4CXKA 4ZG7A 4B56A 4GTYA 4QAXA 3CMRA 3WAYA 1AJCA 1ZEBA 5AJ9A 1KHKA 4CYSA 3DYCA 5LIAA 4FDIA 1ANJA 1AJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LXQ A;  3BDH A;  4ZG9 A;  2X98 A;  3A52 A;  4KAV A;  1AJA A;  3NKQ A;  4UPH A;  1KH5 A;  4MHX A;  5K4P A;  3MK2 A;  3NKN A;  3UO0 A;  4LRC A;  1EW2 A;  3KD8 A;  4KJG A;  5IJQ A;  2W8S A;  3UN5 A;  1EW8 A;  3Q3Q A;  1ELX A;  3IGZ B;  4UOR A;  2W5T A;  3M8Y A;  3UNY A;  4GTW A;  5IJS A;  5LRM A;  2W5S A;  1EW9 A;  1KHN A;  2W5V A;  4MIV A;  3WAV A;  2GA3 A;  2GSO A;  2IUC A;  4KJD A;  1URB A;  1N2K A;  5DLV A;  4LRB A;  5L0B A;  4GTX A;  4LR9 A;  2RH6 A;  4LRF A;  2GSN A;  4NWJ A;  1ALJ A;  3TX0 A;  1KH7 A;  1O99 A;  2W8D A;  3MK0 A;  4UOP A;  3B5Q A;  5TJ3 A;  3TWZ A;  1ELY A;  1AJB A;  1E3C P;  2ZKT A;  1Y6V A;  2W5R A;  1KH4 A;  4NWX A;  3SZY A;  3BDF A;  4UPK A;  3DPC A;  5EGH A;  1HJK A;  5LQQ A;  1Y7A A;  5GOV A;  4LR7 A;  3MK1 A;  1URA A;  3T00 A;  4CXU A;  4ZGA A;  3M8Z A;  3T02 A;  4LR2 A;  5HRT A;  1HDH A;  1O98 A;  4UOO A;  1KHJ A;  1KHL A;  1KH9 A;  4UPI A;  1ZED A;  4LRE A;  1ANI A;  2ANH A;  4KM4 A;  1EQJ A;  2G9Y A;  5LRN A;  1K7H A;  3NVL A;  1AUK A;  4MY4 A;  5DLT A;  1EJJ A;  4UPL A;  3WAX A;  1ALH A;  3T01 A;  1FSU A;  3M8W A;  5L0K A;  1ED9 A;  1HQA A;  3BDG B;  4LQY A;  3UN2 A;  1E2S P;  5DLW A;  1N2L A;  2GSU A;  4ZG6 A;  3IDD A;  3E2D A;  1ALI A;  4GTZ A;  2W5X A;  3NKM A;  5GRR A;  3M7V A;  2IUC B;  1E1Z P;  4TN0 A;  4YR1 A;  4LRA A;  1P49 A;  4LRD A;  1SHQ A;  1B8J A;  3IGY B;  4FDJ A;  3OT9 A;  1EI6 A;  4LR8 A;  3NKP A;  3TG0 A;  2IFY A;  4CXS A;  5L0E A;  5C66 A;  3NKR A;  5EGE A;  2GLQ A;  2W5W A;  2QZU A;  3WBH A;  3SZZ A;  3UN3 A;  1ZEF A;  4N7T A;  3NKO A;  2VQR A;  1ELZ A;  5KXA A;  4KAY A;  1SHN A;  2D1G A;  3ED4 A;  1E33 P;  4CYR A;  3WAW A;  3BDG A;  2W5Q A;  5INH A;  2XR9 A;  1ED8 A;  1ALK A;  2XRG A;  4CXK A;  4ZG7 A;  4B56 A;  4GTY A;  4QAX A;  3CMR A;  3WAY A;  1AJC A;  1ZEB A;  5AJ9 A;  1KHK A;  4CYS A;  3DYC A;  5LIA A;  4FDI A;  1ANJ A;  1AJD A; 
#chains in the Genus database with same CATH topology
 8ATC B;  1VRU B;  2IVM A;  1JLC B;  1FD2 A;  3EXY A;  3MM7 B;  1MMN A;  2VBY A;  2XLJ A;  3MEG A;  2LKZ A;  4FNI A;  1Q7L B;  1N5V A;  2KXF A;  4R0J A;  4R8U A;  4ZCM A;  4I0W A;  1GT8 A;  4NCB A;  1RTD A;  1LKZ A;  3TUP A;  1GMW D;  2E5G A;  2LQ5 A;  5DZ6 A;  2HQF A;  4Y28 C;  2PT0 A;  3EDQ B;  3JTN A;  1IQT A;  2VIH A;  3FC9 A;  4CH0 S;  1FNO A;  2MKJ A;  1NK0 A;  2A18 A;  3LF0 A;  3O2I A;  3TEH B;  1H6K X;  4B02 A;  4TLR A;  4IG0 A;  4RPF A;  4YR3 A;  5B0G A;  4J37 A;  1R27 B;  3CC4 S;  1RWN B;  1BXN A;  2KJW A;  4DSK A;  5KAK A;  2ZNY A;  3HI9 A;  3BGR B;  4UZC A;  2F8M A;  4M95 A;  2ZVI A;  4TU7 A;  3HVR A;  1K1Q A;  2DNK A;  3WX8 A;  5KFK A;  2UXB F;  3IRX A;  4ZCK A;  1N48 A;  3EVO A;  1NHV A;  1CPZ A;  4DV3 J;  3R1H A;  2XZT B;  2CPF A;  4X66 J;  3IFE A;  1DFD A;  5IV4 A;  3TAM B;  4KH1 B;  5CYM A;  3M8Y A;  2MYF A;  5CZV A;  1X9W A;  2ZKU A;  5K8P A;  3DLG A;  2ZBI A;  3GYX B;  2YH0 A;  3R5C A;  1CC8 A;  2DRB A;  1UZH A;  1BE4 A;  2XS2 A;  5HAN A;  4OYO A;  1S77 D;  3CTR A;  5IT9 Y;  4ZLP A;  4KAI A;  4LFB J;  1UEU A;  2NXC A;  1WTB A;  2KI2 A;  1PC5 A;  4HLB A;  4DCP B;  2X1A A;  4DHV A;  3VGU A;  3TNV A;  2AZ1 A;  5A8W B;  1KQK A;  3HHL B;  5KG2 A;  4JI8 F;  4ZHR B;  5EX3 A;  3MMA A;  3IRW P;  3I4H X;  2PFD A;  5E3P A;  2KM8 B;  2UUT A;  1TKZ A;  2LDY A;  1S1W B;  4DR6 F;  4UOH A;  1N5T A;  1GTH A;  1FCA A;  3C66 A;  2OTJ S;  2IAJ A;  2OLW A;  1EQ0 A;  4WF9 Q;  4HI2 A;  2ZH3 A;  2IC3 A;  3BV8 A;  1QVF R;  4KY3 A;  4MIW A;  4KYZ A;  3KMS A;  3UDC A;  4FYD A;  4N76 A;  1CJU B;  3FBB A;  3THP A;  1U1L A;  2CPE A;  3NL0 A;  2P6T A;  2ZWP A;  4OI6 A;  3Q3Q A;  3VGT A;  3G8Q A;  2IM0 A;  4A8Q A;  4DWI A;  3JSY A;  4O3O A;  3QPI A;  4MK8 A;  3TWZ A;  3VQS A;  1RBL A;  1FVQ A;  3Q2S C;  7FDR A;  4NYO A;  3DM2 A;  3HXM A;  3QRQ A;  3H7H B;  2BZ2 A;  5T7L B;  1IWG A;  1U6B A;  2R3V A;  4UPI A;  2BAN B;  5I42 B;  4KM4 A;  3SSS A;  1GEH A;  1J27 A;  3PX4 A;  3K5N A;  4Z2X A;  1MN9 A;  1SC3 B;  1IKX A;  1LWE B;  3DOM B;  3P96 A;  2MZ1 A;  4LBH A;  3BO4 A;  2DH9 A;  1B8J A;  1ZAX A;  4B3T F;  3FSY A;  2X1G A;  5C25 B;  3TUI C;  3G71 S;  2UUB J;  3LP0 A;  2QZU A;  2MZQ A;  1SQE A;  2YNF A;  3H20 A;  3N5F A;  2ZOF A;  4CLW A;  1HWK A;  1AB8 A;  1VK3 A;  2FZG B;  5J1N A;  4B17 A;  2CYY A;  1HWL A;  1REV B;  1M5O C;  2ZH4 A;  3UE2 A;  2G4B A;  3C16 A;  1HIY A;  3VAJ A;  4ZG9 A;  2DBB A;  3B4D A;  2MQO A;  3HHE A;  2HGM A;  3I32 A;  1JLG B;  1FVS A;  2MQP A;  4GTW A;  1R8H A;  2VU5 A;  1B0P A;  3OVB A;  2GVZ A;  1ALJ A;  3TZZ A;  3P6Y C;  3OVS A;  1X4F A;  1QE1 A;  1KH4 A;  1OMS A;  3WZ0 A;  1WG1 A;  3CJ5 A;  1HNV B;  4RKU C;  4USV A;  3T02 A;  3OTC A;  1AW0 A;  1T94 A;  4HH1 A;  3PJW A;  5KG5 A;  4WCE Q;  4EYI B;  3OTD A;  2ASD A;  2ZHO A;  2R9L A;  3J7Y U;  3BBB A;  3HUL A;  4IQM A;  5KFA A;  4J91 A;  5A8R B;  1FDN A;  1T9Y A;  2IUC B;  1FNM A;  3OSN A;  1B0T A;  4CYU B;  3SQG A;  3V4M A;  3PIO Q;  2HBY B;  1JX4 A;  4RR5 A;  1SH2 A;  2D9O A;  5EX0 A;  5LL6 d;  3W5X A;  4ZJL A;  4DCO B;  5L1J A;  1J5O A;  1Q5V A;  1Q79 A;  5IQQ A;  3EIC A;  1F9H A;  2LYV A;  4AXI A;  1YJV A;  4A4J A;  3CDB A;  4ZN3 A;  4IDK B;  4N47 A;  3CCU S;  2FVS A;  4DR7 J;  4LF9 J;  3R5D A;  1WKJ A;  3QFW A;  2RD5 C;  3ENW A;  2HFZ A;  4GRS A;  2MMY A;  4TVA B;  4JP8 A;  3KJQ B;  1W7W A;  2EKY A;  2NS1 B;  2IVF B;  4CLZ A;  1VRT A;  4NYZ A;  5D0G A;  3CCV S;  1NH7 A;  3LAN A;  2XY6 A;  2P2C B;  3BH6 B;  3JQM A;  3VAF A;  4PQU B;  1YVF A;  3SFU A;  4PEO A;  1PJ7 A;  2XMK A;  2W9A A;  3FEX B;  4EBC A;  4DR4 J;  2IM1 A;  4P2M A;  3MEK A;  2XZW A;  3HVW A;  2E5L J;  3POT A;  5L0E A;  3DLH A;  2O67 A;  2CPJ A;  1RDR A;  1NZ8 A;  2CZ4 A;  1HNW F;  2ASL A;  4DR5 F;  4Y2K A;  3ZZO A;  1RWP B;  3AXK A;  2OSQ A;  2MQM A;  3O5T B;  3DXB A;  3FQK A;  3VVT A;  3O3L A;  1Q53 A;  2QIF A;  3OD2 A;  1EKS A;  1IR1 A;  2D9P A;  1VHI A;  4FKX A;  5T41 A;  1RT7 B;  4B9T A;  2ZDO A;  2XYP B;  2MQL A;  1TV6 A;  1FRI A;  1U26 A;  2VIC A;  2AYE A;  1VQL S;  5DQI A;  2XS7 A;  3UQS A;  2WOM A;  4WFN Q;  2GSN A;  3I5B A;  3QO9 B;  5C2C A;  3EUN A;  2ILZ A;  1KFS A;  2KB2 A;  3NY0 A;  2BE7 D;  2LLZ A;  2BE9 B;  2VA3 A;  3M8Q B;  3RRK A;  4M5J A;  3KG1 A;  4MY4 A;  4K4Y A;  1H0H B;  3T9Z A;  1TUW A;  1Q5Y A;  1FTC A;  2DNQ A;  4GMK A;  4BLG A;  1TTH B;  2VC1 A;  3D66 A;  4OX9 J;  4YFU A;  1SIW B;  4B9L A;  4K0K J;  4YR2 A;  1DUR A;  3OFF A;  2PDA A;  4LVO P;  1KP6 A;  1IVZ A;  3CED A;  2BE2 A;  3LTO A;  3GJR B;  2CAD A;  2MY7 A;  3TQ1 A;  2X3D A;  1SH3 A;  2FPH X;  2K3K A;  4KIA A;  1WG5 A;  1RAF B;  4ZP8 A;  5B0F A;  1U1O A;  2ZH9 A;  5DM6 Q;  1WHY A;  2CQG A;  4MMO A;  2HNY B;  1Q81 T;  1ZPW X;  2AWZ A;  1FJG F;  1ACM B;  4DR2 J;  3NWR A;  3C6T B;  1X7V A;  1AUD A;  2YKN A;  3SCI E;  2FQQ B;  3FBC A;  4QIE A;  3IA0 A;  1H2T Z;  1U6Z A;  4ZMM A;  5HN0 A;  3H5X A;  4OI2 A;  1BY9 A;  1UJ6 A;  4LVN P;  2LCW A;  1IBK F;  3ZTQ A;  4WWS A;  2V8D A;  4UOO A;  5KFI A;  4JI3 J;  2ROG A;  3E8O A;  2RHQ B;  1FT8 A;  1DLO A;  3M8R A;  2JVO A;  2UUC J;  1JJ2 R;  5I4M A;  1M1H A;  1SB6 A;  1OQ6 A;  4R0E A;  3SZ2 A;  1NK7 A;  2XCA A;  3R8Y A;  1CS4 A;  2Y0S D;  2YNH A;  1M5S A;  2Z4P A;  4KSE B;  4A8W A;  2V8H A;  3CJ3 A;  5J2M B;  4EK2 A;  2NPI A;  4QWB A;  2BW2 A;  3IBW A;  2I5J B;  1UPP A;  1U0S A;  3KK3 B;  5KFC A;  1VGY A;  2M8H A;  4UY8 T;  2RDD A;  2ZNZ A;  3NEK A;  2MZS A;  1NLK L;  1RAG B;  2RQ4 A;  2GSO A;  2VG7 B;  1HBU A;  4URQ U;  2QA2 A;  4ZVF A;  3NXZ A;  4YN3 B;  2R7O A;  2OD6 A;  4B3O B;  1JK9 B;  1HJK A;  2JFK A;  2DIT A;  2V67 A;  3GLJ A;  1G1X A;  4AL7 A;  2AYB A;  3J80 U;  1SL0 A;  4F4W A;  3RW7 A;  2ZVS A;  1VBY A;  3GIL A;  1WTF A;  4B3M F;  4FXD A;  3ETO A;  4JV5 F;  2NZ4 A;  4NA1 A;  2ZUA A;  2ZWO A;  1KWM A;  2FY1 A;  2IRX A;  2F9J A;  2DGQ A;  4QU7 A;  2VOP A;  2HQI A;  4ZPV R;  1TEL A;  1HLW A;  4K2X A;  3PFO A;  1VIX A;  4OZ2 A;  5J2Q B;  3C15 A;  1VCT A;  4ELV A;  1PAU B;  3CCZ A;  3ISZ A;  3ED4 A;  4DLE A;  3VAM A;  2W8L A;  1WSR A;  5AXM A;  2IHR 1;  3MR2 A;  3H40 A;  4C11 A;  2PGC A;  4YR0 A;  2LXI A;  1RHR B;  1WHW A;  1NZA A;  3CME S;  1EAR A;  3UO0 A;  2CRL A;  4DL6 A;  3CSK A;  3IGV A;  1FWK A;  2H5E A;  2ZH8 A;  1TL7 B;  5LMN F;  4HT5 A;  4RUB A;  4OHY A;  2HHT A;  2WBR A;  1IBM F;  1U47 A;  1D3W A;  4PCQ A;  3R5B A;  3PHE A;  3BR8 A;  4HEA 9;  2XCP A;  1W2B R;  5LRN A;  2HYI B;  3ITH A;  1FSU A;  3BDG B;  4KKO A;  1JLE A;  1IKV B;  1O6X A;  2IJN A;  2VH7 A;  1X60 A;  1E1Z P;  2DIV A;  3N6M A;  1VLY A;  3KHR A;  4J9M A;  4F26 A;  2KTQ A;  4MAK A;  4DV0 J;  4TNO A;  2DGW A;  4HAC A;  5JVG Q;  4OFZ A;  1HD0 A;  3BQ0 A;  3O44 A;  4K7Q A;  2QO3 A;  1NRK A;  4A8Y A;  4OYA A;  2FGC A;  2O5D A;  3ZZR A;  5HQ8 A;  1AJD A;  1X31 C;  1HYS B;  2BV3 A;  2E44 A;  3ZNJ 1;  4ID5 B;  1KKH A;  3D6T B;  2P6S A;  3RB4 A;  3SSR A;  3KUH A;  3HVT A;  2R8G A;  3MEE B;  3UFC X;  1T95 A;  2VQE J;  2E1P A;  4HHH A;  1FXL A;  3OPK A;  3CJK B;  4RBT A;  3BSC A;  2DNR A;  4DUZ J;  4PXE A;  2LQ8 A;  1X5O A;  4I64 A;  4OX6 A;  2I2Y A;  2DGU A;  2WK4 A;  3THT A;  2NUU G;  3J81 j;  1LK7 A;  1VQ9 S;  2B0G A;  1TKD A;  1O51 A;  1FJ7 A;  1UVJ A;  3LAM A;  4RO0 A;  3T1Y F;  1H2U X;  3ZC4 A;  2F4V F;  3MOZ A;  2EG2 A;  2VF3 A;  3I0R A;  1IBL J;  1QSL A;  3W2W A;  4DPY A;  5GMD A;  4C2M A;  2F65 A;  4Q8E A;  2EEY A;  3KUE A;  2DHH A;  1T7P A;  1EP4 A;  3IC1 A;  2W5Q A;  4PG5 A;  3FCW A;  1S0M A;  1KQG B;  4YB7 A;  4OJ3 A;  3W1Y C;  3TJA A;  3Q8Q B;  5AE2 A;  1ITP A;  1KQF B;  4GC6 A;  1WF2 A;  3CDW A;  1VQP S;  1WNE A;  4X2B A;  2CPI A;  2JOQ A;  4QR1 A;  1XMO F;  3JSB A;  5A2Q Y;  1G3O A;  3DGP B;  1CJV B;  1T11 A;  2QLW A;  1SPB P;  2RUG A;  1IWA A;  2M5Y A;  3HF5 A;  3KTQ A;  4OZN A;  1DQ8 A;  4LF6 F;  2DIU A;  3DKD A;  4A8O A;  5A76 A;  4LSZ B;  1RAC B;  4FF2 A;  4Y2A A;  4QBU A;  3KLG A;  4HTJ A;  2A3J A;  1NSP A;  4H4K A;  1ED9 A;  2CPY A;  2QLJ B;  5AT1 B;  2XY7 A;  4PWU A;  1FRH A;  2E9Z A;  4DPO A;  2MGZ A;  2C22 A;  2MQQ A;  3I5C A;  3HJF A;  1SJ4 P;  1SJR A;  2CG4 A;  3CCT A;  1WC1 A;  4K5S A;  4ECV A;  1RQ0 A;  2VG5 B;  4KAY A;  1N36 J;  1X9M A;  4JI1 J;  4TU9 A;  2Z2L A;  4QYR A;  2ZHB A;  5CYQ B;  4B56 A;  4QAX A;  2DGO A;  2ASJ A;  4M5K A;  1RT6 B;  2CPZ A;  3H90 A;  3DOL A;  3DOK A;  2YPY A;  2V34 A;  2MKH A;  4X84 A;  3HZG A;  2MST A;  3FBF A;  3MUT P;  2DNZ A;  1URR A;  3DRY A;  1KHN A;  4WFY A;  1PJ6 A;  4ZOS A;  2OHD A;  4RW4 B;  5HI7 A;  4C8O A;  4FPI A;  4MTP A;  2XC9 A;  3T00 A;  2H9Z A;  1LWF B;  4U67 Q;  1QJH A;  5JJB A;  2YWW A;  1S1U B;  3DC2 A;  1WOO A;  3RW6 A;  2GGP B;  3CIZ A;  2WVF A;  3JXO A;  2Z2M A;  1RTJ A;  4URG A;  4J9K A;  3BM7 A;  3KLF A;  2HQ3 A;  5D4N A;  2ZDP A;  5F8M A;  3KLH A;  2HKE A;  3M2V B;  4P6Q A;  1TL3 B;  3UCU P;  3AJ2 A;  4P9S A;  2FJV A;  3F44 A;  3A8I A;  4W98 A;  4V19 X;  1HW9 A;  2FZK B;  4LFA J;  3VTI A;  2R7T A;  1KHW A;  5LIA A;  2PSZ A;  3NGU A;  2VHG A;  3PKY A;  1ZH5 A;  4NA3 A;  5M2R A;  3SSQ A;  1WHX A;  3OHA A;  2ZHA A;  1XIQ A;  2LXF A;  2CDR B;  4L75 A;  4ZK7 M;  2KFN A;  2FIU A;  1PBU A;  3GFX A;  3KHG A;  1RYR A;  3UNY A;  2B9E A;  4F2S A;  3V6D B;  4OI0 A;  2RIL A;  4E0D A;  2BQU A;  4Y34 A;  7AT1 B;  4OHW A;  4I7F B;  4G1P A;  3J7Z 5;  1LW0 A;  1VLO A;  3GV8 B;  1G6B A;  1VHF A;  2N82 B;  3DRP B;  1DTT B;  4OHV A;  2G9Y A;  1H7X A;  3TEG A;  2PEH A;  1XN9 A;  2AEF A;  2OI2 A;  3G6V A;  3RAQ A;  4DV5 F;  3UCG A;  4LQ3 A;  1FO1 A;  2Z2Y B;  1WI8 A;  5K20 B;  2RUS A;  3OT9 A;  3TG0 A;  1XR7 A;  4C8N A;  3UVJ B;  5E2Q A;  3M2R B;  3UN3 A;  3BYP A;  1UWA A;  2LQJ A;  3OUY A;  1N54 B;  5HLF B;  4TKT A;  3GQC A;  1J5E F;  3C19 A;  4ZKA A;  1EKR A;  3I0S A;  3JQK A;  1Q78 A;  5DDR C;  2X1F A;  2KT2 A;  2XWX A;  4CNY A;  1M90 T;  1K73 T;  1TVR A;  3FVY A;  3M2U B;  3OLA A;  4KHP J;  1FRL A;  1JXV A;  1TKT B;  1ZTW A;  2X51 A;  2G2O A;  4U9R A;  5D4O A;  4ZVH A;  5E41 A;  4NWX A;  4ZVP B;  1TKX A;  2E5L F;  2EK1 A;  4U7U K;  3FKB A;  3CDE A;  4W90 B;  2HGL A;  3R7S B;  1PSD A;  4LR2 A;  4RW8 B;  2APO A;  2PO4 A;  2K7J A;  2F3J A;  4DV1 J;  1HR0 J;  5KG6 A;  1S10 A;  1JKH B;  2O3D A;  1N88 A;  2C2M B;  2W2M P;  1X4D A;  5IZH A;  1QAI A;  1RWW B;  5B09 A;  2I9S A;  2IJR A;  4RZR A;  1S9E A;  2YVS A;  1VMB A;  3RRG A;  3NLC A;  3QJJ A;  3EPG A;  1HPZ B;  2E7W A;  2QJ3 A;  4I68 A;  2WVD A;  4M5I A;  4NLT A;  2POK A;  1XK8 A;  1NB2 A;  3CMR A;  2C3Y A;  2DPI A;  2QMW A;  4LIR A;  4I2Q A;  1NND A;  3K5L A;  1RWK B;  2V50 A;  5K9F A;  3RBD A;  5K4P A;  4Y3C A;  2E5I A;  1TK5 A;  3UN5 A;  5EN1 A;  4ERD A;  1TFY A;  3A3O B;  4WU2 A;  5ETQ A;  3J7A N;  1H38 A;  1VBX A;  4B9M A;  5HMY A;  5K8M A;  1LFW A;  3H2V E;  2CIM A;  4C8K A;  3KOA A;  3FMW A;  5K14 A;  2CQC A;  2HNZ B;  2CG8 A;  3ZZP A;  5KG7 A;  1KH9 A;  4ZVR B;  3BB5 A;  2OPS A;  4EFA C;  3HHN B;  4P2S A;  5FLX Y;  4P72 A;  1VRU A;  3OR1 A;  1S6U A;  2FVQ A;  3DDN A;  2YKM A;  5FII A;  3BQ2 A;  4DU8 A;  3V6J A;  1N5Q A;  1RA7 A;  1ZPV A;  4KFB B;  4H4M B;  1B64 A;  2M7S A;  1HNX F;  2PFF B;  3TUZ C;  3QRP A;  3KJF B;  1CUL B;  3W65 A;  3R2D J;  2EFV A;  2VFT A;  4L6V 3;  1UKU A;  4QR2 A;  4QJV A;  2CVI A;  3VAL A;  1AA1 B;  4RW7 A;  4LT6 A;  1UW9 A;  2DVI A;  2Y0B B;  3DLL Q;  1EW8 A;  2J9E A;  1EW9 A;  1LV5 A;  3IMQ J;  2DJW A;  2GQ2 A;  2XMW A;  2N7Y A;  4AD6 A;  4DCJ B;  1VJW A;  3B4M A;  3TAP A;  3VAH A;  4JI0 F;  4YHH F;  2VBZ A;  5IS2 A;  1FRK A;  1YK9 A;  2QN6 B;  5D4L A;  2QLX A;  4FN5 A;  2KH9 A;  4RNN A;  1EZZ B;  2O01 C;  2ZM6 J;  1ANI A;  3C2P A;  2FJW A;  4C0H A;  2Z2Z A;  4X65 F;  2DR7 A;  2NYH A;  1B99 A;  1CJK A;  3J7A 1;  2DRD A;  2WW8 A;  1LW2 B;  2DNN A;  5GAE U;  1C4A A;  1TK0 A;  4B3S J;  2E9R X;  3TAR A;  1OWX A;  2W5W A;  3N5B A;  3NOC A;  4HHJ A;  3RU0 A;  1FK9 B;  4NI2 B;  2X1B A;  4ZVE A;  1RAA B;  2LEB A;  4ZPA A;  3ET6 B;  5DGB A;  2J0X A;  3KNA A;  5T14 A;  3BDH A;  2PE8 A;  5GAD U;  2NZC A;  1FER A;  1S4E A;  5K8N A;  2BJ8 A;  5MLC V;  1N33 J;  4QPT A;  1R6Y A;  3Q23 A;  1HI0 P;  2DXF A;  6AT1 B;  4JI4 F;  3MAA B;  4RX6 A;  3SDE B;  2KG0 A;  4P75 A;  5L38 A;  1RT5 B;  1VDH A;  3BDF A;  3BJY A;  2LQ9 A;  2R7S A;  2E5H A;  2CQI A;  4LSN B;  3IR5 B;  3K89 A;  4EO8 A;  2RDI A;  2ASY A;  2BUN A;  2CA9 A;  2QSF A;  1Q95 G;  1EQJ A;  2XYG B;  3RTV A;  3T1H J;  1XQI A;  3QAU A;  4LQY A;  2XNR A;  1HNZ J;  4G1Q B;  4O3N A;  3JQJ A;  1JLA A;  4CQ1 A;  2W5X A;  4LBP A;  1NDC A;  2YXL A;  1M1G A;  3M7V A;  2V5H G;  5F8I A;  3DDI A;  3MUR P;  2IFY A;  2KRB A;  5KFW A;  4CRJ A;  2VFU A;  2DH8 A;  2ZH5 A;  1FA0 A;  2PC6 A;  1VQO S;  2IVY A;  2D1G A;  3J7Y I;  1KHV A;  1I94 J;  1XMQ F;  2IJF A;  3TW0 A;  1CVJ A;  4JI5 F;  2HHS A;  3GCX P;  4PWW A;  3WIU A;  3PAC A;  3MUM P;  1MN7 A;  4JYA J;  1KH5 A;  1O0P A;  2L08 A;  1RYS A;  1NM2 A;  1U1P A;  3BQ1 A;  1RT1 A;  1K9M T;  4ED3 A;  3BKU A;  3DOM A;  5CD4 H;  1WG4 A;  4RBU A;  2BEF A;  4NA2 A;  2E7X A;  5C25 A;  4CTA B;  4R5P B;  1VC5 A;  4M5L A;  1AZS A;  5DQG A;  5D6G A;  4LMZ A;  2BMB A;  1XNR J;  3MR5 A;  2IPO B;  5CAA A;  4MK9 A;  3MOJ B;  4MIA A;  1REV A;  1IM6 A;  2V4R A;  3PRV A;  3FZ2 A;  2RQM A;  3M1V A;  2MPU A;  1XNQ J;  2HQC A;  3QYY A;  4U6P A;  5SUH A;  2W9B B;  4HI1 A;  3DLB A;  2EFO A;  3N6L A;  1D8Z A;  3G9C A;  4C98 A;  2B9X A;  4GVB A;  2JEG A;  2ZD1 A;  5I3U A;  1S1X A;  2XRG A;  3GB0 A;  1X4E A;  4WXO A;  2AJ0 A;  1AJC A;  1NJY A;  1GTE A;  3QLH A;  3W2V A;  2KO1 A;  4X64 J;  2JEJ A;  4RWW A;  2DNH A;  4ZVS B;  3FSI A;  4RNF A;  5J1E B;  2FJA B;  3M9N B;  2W8S A;  4P73 A;  2P9G A;  4IG3 A;  2IUC A;  3RR7 A;  2JHE A;  4N77 A;  5IC6 B;  3JSM A;  1RHU B;  1GMW A;  1P9Q C;  3LAK A;  2PI4 A;  3MM6 B;  8AT1 B;  1J2V A;  3IXQ A;  2EW9 A;  4QW8 A;  4K4T A;  2HRY A;  2ZC3 A;  3UN2 A;  4IDK A;  2PN6 A;  1HI1 A;  3MPV A;  2VOO A;  3IP0 A;  1PIL A;  2CFX A;  1TR0 A;  4RNH A;  3D0G E;  2YNI B;  2DD8 S;  4J90 A;  4N7T A;  2RT3 A;  2HHH J;  5HP1 B;  3F41 A;  2Y1J A;  1U0H B;  2MZR A;  1UET A;  5A6W A;  2KHC A;  1I5O B;  3N9U C;  3SXL A;  2Q79 A;  4PQU A;  2B8P A;  2N4D A;  3LGH A;  1BQN B;  2UVU A;  3M9M B;  2FHO B;  2HWI A;  4V1A k;  1LOU A;  2YH1 A;  3KJN B;  2JSX A;  2EPI A;  2WSC C;  2F9D A;  4TY8 A;  3D0I E;  5HRO A;  2BM0 A;  1X0P A;  2HWH A;  4XTT A;  2D3Z A;  3DU5 A;  2EI5 A;  2RF2 A;  2MKI A;  2ATL A;  2FZC B;  3FMB A;  4GO5 X;  4KHM A;  4OZ5 A;  3IS9 A;  1OY8 A;  3QID A;  5SZT A;  4JI2 F;  1ZBT A;  3CCW A;  4J9N A;  3ZTR A;  3M05 A;  3GZ7 A;  4CP5 A;  2VFR A;  4ZCI A;  2H5J B;  5C7P A;  4JI7 F;  4C48 A;  2ZH2 A;  2A1B A;  4C8Z A;  2ZBQ A;  5D0R A;  1IN0 A;  5THW A;  1HBM B;  2KG1 A;  5KG0 A;  4JI1 F;  5DLT A;  3P3D A;  1JXE A;  4JV1 A;  1ALH A;  2RHS B;  1RT7 A;  2H65 B;  4M63 A;  3C6U A;  2YWE A;  1ZM2 A;  1KFD A;  1NME B;  4PQA A;  1IUJ A;  5H9F K;  3KLE B;  4DS4 A;  3QO9 A;  2IM2 A;  2ERR A;  5DS7 A;  2CVE A;  1VC6 A;  2P9E A;  1FKO B;  1UWB A;  1C1C A;  3OR2 B;  3PYF A;  2CZV C;  3M8Q A;  2GFF A;  2WW4 A;  1MMD A;  1ZOT A;  3TVY A;  2HFU A;  1C0T B;  2QL5 B;  1DTQ A;  3QJL A;  1S1T A;  4USM A;  4LF5 J;  2JLF A;  1N6Q A;  1V5I B;  3FK4 A;  4NWJ A;  1T9W A;  2JDJ A;  2JFD A;  2YWH A;  4KO0 A;  3LP1 B;  2OD4 A;  5LOQ A;  1SL2 A;  4NLD A;  4MKY A;  4RU9 A;  5KT3 A;  2GVD A;  4Q2M A;  2I0X A;  2HS3 A;  1NB7 A;  3T01 A;  1YIT S;  4FF3 A;  2HNY A;  2B6A B;  5AJ3 J;  4FNH A;  3EX7 B;  1OPZ A;  2GHV C;  2P9C A;  4DX8 H;  2UUA F;  3UDE A;  3C6T A;  3OLB A;  4DS5 A;  3RR8 A;  4QCL A;  2DO4 A;  4PUO B;  5LXR A;  5KG1 A;  3OFG A;  1YHQ S;  2C3U A;  3QT7 A;  2CPH A;  1R0A A;  3WAW A;  3DYA A;  2YNG B;  1BGX T;  1MG7 A;  3DRS B;  4P10 A;  4DL7 A;  4NLV A;  1VIS A;  4OX7 A;  2L3M A;  4IRD A;  2YQ1 A;  5H9F J;  2H48 B;  3DLE B;  4QIV A;  1OIA A;  2W9C B;  2QE5 A;  2D74 B;  4I69 A;  3LAL A;  2QGF B;  4H54 A;  4NX9 A;  3CD6 S;  1WEL A;  1KVI A;  2VG6 A;  2N3L A;  4NPO A;  2RAQ A;  2WTF A;  4X4U A;  4Y00 A;  1Q8L A;  3V81 A;  1PIE A;  4HKQ A;  4H4K C;  3ZO7 A;  4PAB A;  2B43 A;  1FD8 A;  2DK2 A;  2C2R A;  2NYI A;  1R8P A;  3M8Z A;  1T9U A;  4NCG B;  2M2B A;  4KPY A;  1SV5 A;  3DMJ A;  5D3G B;  5IT9 U;  2W01 A;  1QAY A;  2B4O A;  5J2M A;  3VAI A;  3RG6 A;  5IOL A;  5KFQ A;  4DR1 J;  2I5J A;  4DPT A;  4GKJ F;  2O66 A;  1WC0 A;  4IYQ A;  2HQD A;  2CXE A;  2IM3 A;  4CM0 A;  4PWD B;  2CQ1 A;  1HMV B;  3UI3 A;  3HKW A;  2MY8 A;  2VG7 A;  1U1R A;  3M8P B;  5EWF A;  4KHP F;  3Q2T C;  2F1F A;  1E6V A;  2FHM A;  3VVU A;  4UZB A;  3B6B A;  3CJR A;  1TUV A;  5HVF A;  1AFJ A;  5D8H B;  3LH2 S;  2FYX A;  1YJT A;  4A8M P;  1UL3 A;  3M30 A;  1T3N A;  3MK2 A;  3HZE A;  1XC9 A;  2CZ9 A;  3K58 A;  2ZH6 A;  1FJC A;  2E7V A;  1SUQ B;  5IWA J;  1RKI A;  5IC4 B;  4OHZ A;  2KVQ E;  2ZJQ Q;  1D09 B;  3CCE S;  4CLY A;  3TZY A;  3DLK A;  1N32 J;  1X4B A;  3BGL A;  3HO1 A;  4B3R J;  4UOG A;  4DI6 A;  2C28 A;  4CLT A;  3QBC A;  1JNR B;  2L9W A;  3IG1 B;  2XMT A;  2VAS A;  5DQH A;  3KJV B;  2BJ9 A;  1WEZ A;  1TL5 A;  5E33 A;  2R8J A;  2U2F A;  4CO2 A;  4IFV B;  2GSU A;  3DHX A;  4O4G B;  1M0S A;  3E2D A;  1S12 A;  2V2V A;  2G1D A;  2NRE A;  5F3Z A;  3G4S S;  3WC0 A;  3M32 A;  1SBR A;  1FFW B;  5LJ3 Y;  2W24 A;  4F50 A;  1IR2 A;  4TQS A;  3MEG B;  4CXK A;  1Y11 A;  1RAH B;  3QNW B;  2XSJ A;  1HD1 A;  4R8U B;  1S0V A;  2IMO A;  3EZU A;  1C0U B;  2D41 A;  1RTD B;  2AEJ A;  2Y9H A;  3NCQ A;  1VRQ C;  3MEC B;  2JRS A;  4MIV A;  4I56 A;  2V4J B;  5J2P A;  5CXT A;  4KE5 A;  2VUG A;  4LR9 A;  3T19 A;  3ZTO A;  4IG0 B;  3FDS A;  3OVA A;  2A6M A;  1MWQ A;  2LP4 A;  1SKU B;  2DH7 A;  1P27 B;  4A8K A;  1Y3J A;  2M70 A;  1V6H A;  2M88 A;  4BC7 A;  4OYX A;  3PM9 A;  4RUC A;  5L8R C;  1HYS A;  2GS8 A;  1XMB A;  5L1L A;  4ID5 A;  3HM9 A;  2GIQ A;  1P9Y A;  2W4D A;  3IRX B;  4ILM A;  2LFV A;  3IGY B;  4Q7A A;  1GNK A;  4JI6 J;  3CCJ S;  4UOC A;  2L9N A;  1IKW A;  1NHK L;  2H5I B;  2B5J A;  4CYR A;  3PNI A;  1EET A;  1Z2L A;  1UCN A;  1PCA A;  3MD1 A;  1JJH A;  3DLG B;  1ZZF A;  4TY9 A;  2C2D A;  4NLU A;  5F9N A;  1HQU A;  1T03 B;  1YIJ S;  3ISN D;  3GFZ A;  1U48 A;  1TAU A;  2XI3 A;  3GFY A;  3CO9 A;  2R7W A;  1YDL A;  5E5N A;  1FHT A;  4KV8 B;  5ITH A;  1YWX A;  1FDA A;  2FVR A;  1O99 A;  4NLS A;  2DTJ A;  3BF4 A;  3SV4 A;  3SZY A;  4XIU A;  4UPK A;  3D6F B;  5F8H A;  3BRE A;  3EZO A;  2HWT A;  5F0W A;  5ETT A;  4Y65 A;  3MMA B;  4K4Z A;  4DV7 F;  2D3O 1;  5A8K A;  2RU9 A;  4FS1 A;  1TKZ B;  3ONQ A;  1NPR A;  2IAJ B;  1Y00 A;  5CZX A;  3LGM A;  4CO0 A;  3J80 Y;  1OSD A;  5DET A;  5GRR A;  4U7U D;  5HMW A;  4ZIT A;  1VBK A;  3EMT A;  2KVI A;  3IR6 B;  4U96 A;  5KFO A;  4DFJ A;  4CH7 A;  1YBA A;  3BGO P;  3NS5 A;  3WDO A;  1SH0 A;  2RB7 A;  3QSI A;  4OV1 A;  2DHA A;  3K7R A;  4B08 A;  1ZM3 A;  3HHL D;  4UY8 5;  3A4T A;  1KTV A;  4DL3 A;  3ILI A;  5JMN A;  3BGU A;  3TUJ C;  3SCJ E;  4WFZ A;  4P2F A;  4NXM J;  3DM2 B;  3X3U A;  2LEP A;  1EW2 A;  1MW7 A;  2Z0G A;  3NGS A;  4LFC F;  1KOO A;  3T1H F;  2G0J A;  3AXM A;  4X4Q A;  1UVN A;  1OS5 A;  2D69 A;  1HNZ F;  4NRU A;  4URS A;  5EWE A;  5AXK A;  1EQM A;  3RBX A;  4NML A;  1WI6 A;  1IKX B;  3MK1 A;  1S7H A;  1Z2Z A;  1L3T A;  3J81 U;  4P7V A;  2B9W A;  2FHJ D;  4M5G A;  3PG9 A;  1RT6 A;  3OTE A;  2YNF B;  5B0E A;  2ATC B;  2DR5 A;  3H5U A;  1ALI A;  1CSJ A;  3CCS S;  1V3R A;  3BR9 A;  4LBI A;  4IRK A;  4RNO A;  4FP9 A;  3T6B A;  1A9N B;  3BBF A;  2A2C A;  3JAM Y;  3B54 A;  5B0C A;  1RLC L;  2VPY B;  2XSF A;  2V2Z A;  3NKO A;  1YSJ A;  3D6M B;  3KDO A;  3DFE A;  1L5U A;  1B4S A;  4FF4 A;  2XTJ P;  3V4I A;  1WF1 A;  2AJQ A;  1CLF A;  3T6J A;  1QE1 B;  5C5J A;  1RLD A;  4EMD A;  4DZ6 A;  5ETS A;  5LM7 E;  1LWC A;  4M5M A;  1IBC B;  3GII A;  5JXS A;  1DHM A;  3HK2 A;  4LF1 A;  2W5V A;  2AW0 A;  2XQC A;  3MTJ A;  3MM5 A;  4EWT A;  3C14 B;  3JB9 k;  1RCO B;  3FNN A;  4IFY A;  4IH7 A;  2VD3 A;  3EXC X;  4HL9 A;  2BRK A;  1TL3 A;  2LMI A;  2V0N A;  3CDU A;  3VGS A;  2G1H A;  3SQG B;  3T41 A;  2CQD A;  4ALZ A;  1RE1 B;  4LSL A;  4DPU A;  2NXE A;  4EYH B;  1UPM B;  1MRO A;  4BC9 A;  5LJ5 Y;  5DG7 A;  1NJI T;  4OIX A;  1U02 A;  2QLB B;  2CJQ A;  3SI8 A;  1VBZ A;  2Q3P A;  4NLY A;  2EFG A;  4K50 A;  4LF8 J;  1QUV A;  5H9E J;  1M5P C;  4NLW A;  3KG4 A;  2ZUG A;  1KD1 T;  1TL1 A;  4QQB A;  2JC1 A;  1RAI B;  4PPZ A;  4Q0B A;  1EHW A;  1YJR A;  3D9B A;  4TLQ A;  1U4B A;  1P8G A;  3Q89 A;  2AMC B;  2FJB B;  2BDP A;  3M4X A;  4Y6I A;  4QYZ K;  2NSB A;  2LA4 A;  1T8E A;  3HKZ D;  1ZET A;  3BKT A;  1Q4R A;  4XO0 A;  4LF4 J;  4OMF G;  2B8Q A;  4Z37 A;  4ECX A;  1PBA A;  3L9Z A;  4DG1 B;  4HTI A;  4UOP A;  4WFA Q;  5HMZ A;  2NLW A;  3UVJ A;  4DUY F;  4AXJ A;  1WKK A;  2UVV A;  1IJF B;  4EUV A;  3GG0 A;  3AOC A;  1WC4 A;  1C1B A;  2OGU A;  1MU2 B;  3HLU A;  2AHO B;  1ROF A;  2HS0 A;  5IM0 B;  3VZI A;  1F1B B;  3EGN A;  2GX8 A;  3Q8R B;  4GTZ A;  1UZD A;  3CGI A;  4DXL A;  2MEW A;  4DN9 A;  2BJ1 A;  1TKT A;  3QT8 A;  3G6Y A;  3RJM B;  4NEZ A;  1GXL A;  4ZDN A;  4IOC Q;  4L74 A;  4FVC A;  2ROP A;  3TA0 A;  4ZVU B;  3HP6 A;  3QMQ A;  3TZW A;  1RZM A;  4OHX A;  4GTY A;  2E5J A;  2WOM B;  4Y2C A;  3WAY A;  3FBE A;  3O8W A;  3FCH A;  3PJ9 A;  4LF7 J;  2J0Q D;  3M6U A;  1VQ4 S;  1YJU A;  3HFZ B;  2GZO A;  2GIF A;  4CLK A;  2R7V A;  1Q82 T;  3E2E A;  5D78 A;  4CCH A;  4DOZ A;  2PA8 D;  4QYZ J;  1LEO A;  1AUS L;  3B5Q A;  1HKA A;  2HRU A;  3GIK A;  3PW4 A;  1RAJ A;  1K0V A;  3KWM A;  1A6L A;  3CUL A;  1U49 A;  3V2U C;  3P49 B;  5KT7 A;  2QX0 A;  3QAE A;  3ENQ A;  2J76 E;  3P5T L;  5BYR A;  2J6T A;  4YS2 A;  3MED A;  2DNM A;  4JV0 A;  2M8D B;  4DX7 A;  2E29 A;  2BE2 B;  4EGL A;  4ILL A;  4MKB A;  3KLV A;  1JLQ B;  3MWB A;  2UU9 F;  4F67 A;  2M4M A;  3D28 A;  1UFK A;  2HZV A;  4K59 A;  2J0W A;  1CJT B;  4B9U A;  5HBM A;  3NP5 A;  1R89 A;  4J9P A;  3CIM A;  3HSG A;  2KYZ A;  2YKN B;  4PXC A;  2DNL A;  3HX9 A;  4CYS A;  5IT0 A;  4ED7 A;  1MNE A;  5L9N A;  3R3T A;  3OL7 A;  2D7S A;  4S0M A;  4XAK A;  4I2P B;  5G0R A;  4O3R A;  4KGV B;  2CAJ A;  1W26 A;  2OJ3 A;  1U2R A;  1F9E B;  5GAD I;  3WHI A;  1DLO B;  5KFX A;  5IFM A;  3GJT B;  3K0J A;  5ETP A;  2AJF E;  1CUL A;  2XO6 A;  2CWK A;  4AQY F;  4F3Q A;  3JYT A;  2UXB J;  1CS4 B;  4YDD B;  2K1R A;  2YNH B;  1S76 D;  3CCR S;  5GAG U;  2K8G A;  1U09 A;  4N56 A;  3NNC A;  1WEY A;  2VZ9 A;  3H25 A;  3E01 A;  1WOR A;  2AX0 A;  4B9S A;  1T9X A;  3OTB A;  4ZLN A;  2AQ4 A;  5CHC B;  1RWU A;  3WQP A;  2CPX A;  4CM2 A;  4FDF A;  3L09 A;  2VDI A;  4AND A;  2EG1 A;  4OQJ A;  3CMA S;  4DQQ A;  3IWL A;  1VQS A;  4TYB A;  1NKB A;  1LFP A;  2EBE A;  2IDL A;  2ALZ A;  1PGZ A;  2BBE A;  4DV4 F;  2UXD F;  4KHR A;  2H1Y A;  3DLJ A;  5A2Q U;  2VB6 A;  1LW2 A;  3OTO F;  2AEM A;  3CJS A;  3U7J A;  3Q24 A;  2IDE A;  4DR3 F;  1TL4 A;  5ETM A;  5E7O B;  1KH7 A;  4EZ6 A;  3CT9 A;  3D68 A;  3G82 A;  2RQC A;  4DR6 J;  4Y2M A;  4CI0 B;  4ZS6 A;  2N4C A;  2HBR B;  4NI2 A;  2J8A A;  4J9O A;  2ZE2 B;  2GQQ A;  4Z7C A;  3HFK A;  2FLO A;  3UD3 P;  2DHX A;  4RU2 A;  2BKO A;  4C11 B;  4PRF A;  1G7C B;  1LK5 A;  4O3Q A;  4X4S A;  1YBT A;  2J9D A;  1FX4 A;  2FLN A;  5KT5 A;  2RNE A;  3MAA A;  2R8K A;  3I9Z A;  1NDK A;  3NS6 A;  3GWC A;  2PMZ D;  1KVJ A;  1FKA F;  2WAQ D;  1JLF B;  2OKQ A;  4C3M A;  1KON A;  4CO1 A;  1PAE X;  2WHO A;  3T5L A;  2HK3 A;  5C2G A;  3MZI A;  1UP1 A;  3QGI A;  3BS9 A;  4KJG A;  3RB0 A;  4NXN J;  1B7F A;  1RTH A;  3SIP B;  1WKL A;  2Z56 B;  3IAS 9;  4GKK F;  1KLM A;  2FC9 A;  4LRF A;  2RVJ A;  3DGV A;  4NLO A;  3ITH B;  3JS9 A;  4ED4 A;  4IOA Q;  1AJB A;  2E1M C;  2J5A A;  4ICL A;  3BN4 A;  1JLE B;  5HO4 A;  4B3T J;  2NXU A;  1S6Q A;  1RTI A;  2AYG A;  2MTL A;  3NAH A;  5B08 A;  3I56 S;  2BW7 A;  1RT3 B;  4HAC B;  5LMU F;  2LDI A;  1UJ4 A;  1YLX A;  4USJ C;  4NLP A;  1SHQ A;  4AT1 B;  3ILJ A;  2Q6B A;  3F0N A;  3R5J B;  1S6P B;  1FTR A;  2WON A;  3SZZ A;  3R7N B;  2YKO A;  1Z1Z A;  3LP2 A;  3MR7 A;  3PV8 A;  4CTA A;  3AQP A;  4R5P A;  3RAX A;  1JNZ B;  3HVT B;  1NK9 A;  1D1U A;  4HDH A;  2U1A A;  3NKQ A;  3E51 A;  3U27 A;  3Q8P B;  1RBO B;  2E1C A;  3MM9 A;  4ECU A;  2A10 A;  3DRX A;  3LPE A;  1R6V A;  2OPP A;  4K4U A;  2V63 A;  1R8B A;  1XEZ A;  4FXV A;  4IOB A;  2E1A A;  3IBF B;  3N28 A;  4ETZ A;  1K0T A;  2ALY B;  1Y6V A;  4KGM A;  2OH2 A;  5U47 A;  4ETX A;  5BR8 F;  3I0R B;  4I1T A;  1H2V Z;  4NE9 C;  2CJA A;  2M52 A;  3KLI B;  1R8C A;  2QZ8 A;  4HR2 A;  2R42 A;  3D1O A;  4PXB A;  2JNJ A;  3Q8S B;  3TA2 A;  5L0K A;  3A3N B;  1P1T A;  2UXC F;  3IM8 A;  5J1E A;  2Y8W A;  4ZJO A;  4X62 F;  3UR3 C;  4KGK A;  4WU3 A;  2JWN A;  4IR1 A;  1HHS A;  1RXO B;  4O4R A;  2HG4 A;  1DQA A;  1Y0H A;  2H4Y B;  5A0Y A;  4MFB A;  5KFT A;  2EWH A;  3GP9 A;  2OEL A;  3QGG A;  4HVZ A;  4ZPT R;  4PG6 A;  1X5T A;  2FDN A;  3MCM A;  4A8S A;  3EVW A;  3N79 A;  2QTW A;  2CQ2 A;  3MPY A;  1S59 A;  3EWG A;  5CH7 B;  3DI6 B;  3WX4 A;  4O44 A;  4OI1 A;  1YZ7 A;  4ZCL A;  1C2P A;  5TJ3 A;  5KOX A;  3PR5 B;  3MHY A;  2RRB A;  2HIQ A;  5ETR A;  4OL8 A;  4ES2 A;  5HP1 A;  1F5C A;  2CJ9 A;  2HVI A;  4PG8 A;  1LXN A;  2HAI A;  1Y9O A;  1HNW J;  1B7Y B;  1HQE A;  3QJP A;  3H8Y A;  2WB4 A;  3N01 A;  3CMQ A;  1HWI A;  4N5S A;  3I87 A;  4C8Y A;  2AJ2 A;  4EBD A;  3T3F A;  3GR0 A;  3DOK B;  2CJY B;  4IUF A;  5EGE A;  5EWG A;  4ANE A;  1XER A;  2VPW B;  2IA6 A;  3T5K A;  2DR9 A;  2W4P A;  1KQS R;  4IRC A;  1HBM A;  4KJI A;  3G87 A;  2C2Z B;  3PEH A;  3SV3 A;  4ZJQ A;  1C4C A;  2Z8Q A;  1EIY B;  1N34 F;  1YRT A;  1M5V C;  1WC5 A;  3AD8 C;  3MF5 A;  2CDQ A;  4IR9 A;  4F3M A;  3IR7 B;  5E3R A;  3VCD A;  4CDI A;  4E98 A;  5F41 A;  2R7X A;  1XWL A;  4F36 A;  3ZXW A;  2DXD A;  2HS4 A;  1RHJ B;  1FKO A;  1S0N A;  2FVC A;  1YGY A;  3QIP A;  5KOW A;  1T9V A;  4Q45 A;  3KLF B;  2ZZN A;  5IV3 A;  2IRU A;  3H5S A;  3KLH B;  1WC3 A;  3N0V A;  3KYL A;  4YY3 F;  3UPF A;  3DCA A;  1H7W A;  3KG0 A;  1C0T A;  5E0O A;  3TOQ A;  3HD1 A;  5JUM A;  1FJG J;  1YTY A;  3VWS A;  3O6Q A;  3NMR A;  2V2K A;  1APS A;  1NK8 A;  1OY6 A;  2YTC A;  3NNA A;  2MHE A;  1B3T A;  4QPX A;  4JBC A;  2YWG A;  3GIR A;  5L9X A;  4USU A;  5EGY A;  3LP1 A;  5CD4 A;  4DL5 A;  3NBP B;  3FUY A;  4P7T A;  1IBK J;  1L3V A;  4NCA A;  2A0F B;  1AXQ A;  4K4X A;  2DNO A;  1LW0 B;  2MB0 B;  1FFS B;  4L3N A;  5IJQ A;  2BVZ A;  4I6A A;  3X1L B;  3PW2 A;  5L0B A;  3I55 S;  1HNI A;  2VBX A;  1RSC A;  3EGW B;  1URA A;  3GON A;  3DRS A;  1HA1 A;  1CQN A;  4DL4 A;  1I6J A;  2C2N A;  3GV7 B;  5BYQ A;  5DM7 Q;  2B4U A;  1RTZ A;  2ZZM A;  2RS8 A;  4UPL A;  2JH3 A;  5I3Q A;  1HQ2 A;  3OUY B;  4NLQ A;  2W9C A;  3AHP A;  3HFV A;  3OL9 A;  2OAU A;  3ZZY A;  3I0S B;  4C0B A;  3BZQ A;  2B4P A;  2VA2 A;  3T9N A;  3W62 A;  1UEK A;  1FDB A;  1TVR B;  4DEZ A;  2W1B A;  2OPQ A;  3ILO A;  3PX6 A;  2BR0 A;  3TQE A;  4NCG A;  2J6S A;  1VQ7 S;  2BKN A;  3LXQ A;  3W3S A;  5D3G A;  1TKX B;  1U8W A;  2JZ5 A;  5E3Q A;  2QFI A;  4B3M J;  3AB2 B;  3H59 A;  4WE1 A;  4JV5 J;  4W92 B;  1XTZ A;  2LQB A;  1QD1 A;  2W2Q P;  1HMV A;  1WJ9 A;  2HVH A;  2YKA A;  2AX1 A;  2VBW A;  4C6A A;  3TR5 A;  4DV3 F;  2HRT A;  4K5R A;  4ER8 A;  1S9E B;  4X66 F;  4YB1 P;  4WP3 A;  5ADZ A;  3ELH A;  5K8O A;  4KR0 B;  2VQF J;  3P45 B;  1PYT A;  1YZ6 A;  2OEK A;  1Y4Z B;  4M5D A;  4XDD A;  1PYS B;  2XGP A;  1SUQ A;  3KFW X;  3PO4 A;  4FYW B;  1EI6 A;  4EBE A;  1BC6 A;  2QV6 A;  2MJN A;  3HSZ A;  3ULH A;  1ZAV A;  4E2F B;  4LFB F;  4TQR A;  5LMN J;  4A48 A;  2K7K A;  4ZG7 A;  4F4Z A;  4MYT A;  4Q5V A;  9ATC B;  3DYC A;  1ANJ A;  4KAV A;  5D77 A;  1CC7 A;  5HMX A;  2SXL A;  4IFV A;  1ELO A;  4OYI A;  5KFE A;  4WZM A;  5K14 B;  3VAG A;  3H4D A;  2VJU A;  2DGV A;  3UNG C;  3KDN A;  3RZA A;  2OPS B;  1BQM B;  3TI0 A;  3CB4 A;  1UVL A;  3FRY A;  4HDG A;  3OR1 B;  2LEA A;  5B0B A;  1DAR A;  5LSR A;  1CBK A;  5CCL A;  4QIF A;  3FFI A;  2QLF B;  2YKM B;  3AJD A;  4F2R A;  2H54 B;  3I4P A;  4QW9 A;  2A2D A;  3KK1 B;  2ZZT A;  4WYL A;  3GE9 A;  4WKY A;  4DBQ A;  1RGV A;  3HSJ A;  1C0U A;  2J7U A;  3MAH A;  4MJK A;  4HHU A;  3US5 A;  1N5Y B;  4DMZ A;  3OL8 A;  4BDP A;  3MEC A;  4LRD A;  4W4M A;  2V4J A;  2HFV A;  3GU0 A;  3NKY A;  3OXF A;  4RW7 B;  3I5A A;  1S97 A;  2OMO A;  3MXH P;  1NBE B;  1FWP A;  3Q0A A;  1RT2 A;  1QUP A;  2IMW P;  1NK5 A;  4OV6 A;  4F0H A;  5A6P A;  4EEY A;  2CQ0 A;  2KKH A;  3K5O A;  3VQT A;  2BX6 A;  1U2C A;  2HND A;  1VK8 A;  2UUB F;  3T1Y J;  1RB0 A;  3PXG a;  2F4V J;  4LRB A;  3JTO A;  1RU1 A;  3QQC D;  4ES3 A;  4F3O A;  1CJK B;  4WKR A;  5GMK a;  3GCW P;  5C42 A;  3VF0 B;  4IO1 A;  2YKQ A;  1VQY A;  3PZP A;  1JLB B;  2KFZ A;  3MMJ A;  2GHP A;  3D0H E;  2R7U A;  1S49 A;  1T03 A;  3KXD A;  3UR0 A;  3RRH A;  4Y0F A;  4ZVO B;  4RBV A;  4WPA A;  2BQR A;  1XMO J;  2Y1L B;  1VIO A;  2HLU A;  4KV8 A;  2F40 A;  3KNG A;  5DG9 A;  3BPD A;  3SCK E;  2XO7 A;  4LF6 J;  4DV2 J;  4ENO A;  2NXJ A;  1RWX B;  3H42 A;  2Z58 B;  1KHK A;  4OZ0 A;  3NGT A;  1HBN A;  5AE3 A;  4TN2 A;  4M5H A;  4H4O B;  1BQX A;  1RT4 A;  5L1K A;  1LWX A;  3EVM A;  4GVL A;  1A0O B;  4ELU A;  2G0C A;  2Y8Y A;  2W2P P;  2LU2 A;  3HHD A;  3EM1 A;  2W4C A;  3FRZ A;  5IXU A;  1Z4U A;  3LOU A;  1PJ5 A;  2G13 A;  2WBM A;  3AA8 A;  1RAB B;  1DZ5 A;  2GJF A;  2AJ1 A;  4F04 B;  1JLA B;  2N3O A;  1SC4 B;  2BJD A;  3ZTP A;  3W9J A;  4DR7 F;  3OV7 A;  4PZV A;  3UDL A;  4KH0 B;  2ZJR Q;  2FJX A;  2F8H A;  4LF9 F;  2EFP A;  1NXI A;  3QAT A;  4NMX A;  4HT7 A;  1ZM4 A;  1Y3K A;  4F25 A;  2OEJ A;  4GC7 A;  1S1V B;  4G1I A;  4ED5 A;  4CXS A;  2NCK L;  4MKV A;  3V6H A;  1OO0 B;  1B0V A;  3IGN A;  4NXN F;  4CLP A;  4J9V A;  5KXA A;  1NKC A;  5KFY A;  1RT1 B;  1FE4 A;  3NOG A;  3K17 A;  3UCZ P;  3P4U B;  3GFH A;  1I51 B;  3CD7 A;  4DR4 F;  4BS2 A;  1T05 B;  5ETO A;  2GCF A;  5HQM A;  2AD9 A;  1FXD A;  3G8S A;  3G2X A;  4NLG A;  1AZS B;  5HVH A;  3SCL E;  4K2J A;  4B9N A;  2GJI A;  2XLK A;  2W5T A;  3KK2 A;  2G9O A;  1URB A;  2YPZ A;  3BKF A;  2NQP A;  2OSR A;  4ED6 A;  4ZIV A;  3L95 X;  3KHL A;  2DB1 A;  3CF5 Q;  2KXH A;  3M1V B;  4MIB A;  4N8O A;  3ADA C;  2GJ2 A;  2ZBP A;  4L3K A;  4ZLL A;  5HRT A;  1TAQ A;  1KOH A;  3Q8Y A;  3MR6 A;  4OYB A;  2JEI A;  4GVB B;  2ZD1 B;  4OJH A;  3AJ1 A;  1S1X B;  5I3U B;  1E6Y A;  4R25 A;  2UVW A;  1LXJ A;  1TQL A;  4FS2 A;  1HFE L;  2XZD B;  1WF0 A;  5H1S V;  3QLH B;  3PRB A;  2EFN A;  3W2V B;  1P6T A;  4DJB A;  2I1R A;  3V6K A;  5B7W A;  3AA9 A;  3LW5 C;  3C14 A;  4NWB A;  3AOA A;  5INH A;  5D0H A;  4OX8 A;  4A46 A;  4ID8 A;  4AE5 A;  3QT6 A;  4IG3 B;  4QU6 A;  2ZFH A;  5L39 A;  2KYX A;  3AAW B;  4P71 A;  2RKI B;  3JSM B;  1AJA A;  4ZVG A;  4OX9 F;  2CQP A;  4K0K F;  4UUW A;  2DEJ A;  4AYB D;  4RW9 A;  2MKS A;  4DV5 J;  2C3P A;  1M5H A;  1JLC A;  1NDP A;  1NHU A;  2CKW A;  2ACY A;  3MM7 A;  1JIH A;  4RL1 A;  2ZH1 A;  1VYA A;  2HZC A;  2HMI B;  4CWB A;  1GK8 A;  4DR2 F;  4ECT A;  1RK8 A;  1J5E J;  2IYI A;  3IDD A;  4JV2 A;  4A47 A;  3W9I A;  6FDR A;  4IO9 Q;  2UUW A;  5HK4 A;  1H3D A;  4DG1 A;  5HSP A;  4TY8 B;  5HRO B;  3FSX A;  4JI3 F;  5J1P A;  2IYG A;  2W7A A;  4NRT A;  3BDP A;  1R8A A;  2RF2 B;  4KGZ B;  4KB7 A;  4WBF A;  2OPR B;  3MPD A;  1RHM B;  3IS9 B;  1MU2 A;  3CC7 S;  2QC3 A;  5KG3 A;  4G3I A;  3VZH A;  3TA1 A;  5IM0 A;  4F8R A;  2PA3 A;  3PKM A;  5GVQ A;  3H0P A;  3W5Z A;  2UUC F;  3BGR A;  3CUN A;  5FJ4 A;  4YOE A;  3IGZ B;  5F3T A;  2RE1 A;  3I96 A;  4ZVT B;  1WC6 A;  2EKN A;  1R7I A;  2E1R A;  2CUY A;  3QRR A;  2MZJ A;  2M3D A;  3ENV A;  2YWK A;  2GO9 A;  3CJT A;  3C6U B;  1N4L A;  3TAM A;  3W8G A;  2AU0 A;  1IQZ A;  3PHT A;  2Q1L A;  1VQM S;  5BYS A;  4DLG A;  1RIS A;  4AFF A;  1VQ5 S;  1D9F A;  4F4A A;  2WCX A;  3S7R A;  2VON A;  1CG2 A;  1UWB B;  1F0X A;  3J81 Y;  1U24 A;  1C1C B;  4A8X A;  3VV2 B;  3RUB L;  2HZA A;  2HHP A;  4IH6 A;  2FVP A;  4ED0 A;  3R5G A;  1T3O A;  1ZA1 B;  1YJ7 A;  1R0B G;  4QZV B;  5A8W A;  1DTQ B;  1ED8 A;  1S1T B;  2HVD A;  3HHL A;  1N6Q B;  2X7I A;  4ZHR A;  1PYO B;  5GAG I;  4ECZ A;  3GPA A;  2OFH X;  4OYP A;  3MD3 A;  4WYW A;  1TMM A;  1GAO A;  4KO0 B;  1S1W A;  2R8H A;  4V19 J;  3K5M A;  3NKN A;  4LRC A;  5DO2 A;  2XI2 A;  3FCV A;  1TMJ A;  1JLQ A;  1VQ6 S;  2GVD B;  2MDA A;  4C9D A;  1CJU A;  1CJT A;  4OJG A;  2ZKT A;  1E3C P;  1OY9 A;  2AZ3 A;  3W66 A;  3R7B B;  1PC4 A;  5F0U A;  4LR7 A;  1YJW S;  1QTN B;  2PEB A;  1HNX J;  3QGP A;  4D3H A;  2FHJ A;  1JQG A;  1D0E A;  3MMB B;  4USK A;  1U1N A;  4WK1 A;  4A8F A;  1S5Z A;  1R0A B;  2DIS A;  3DYA B;  4BBY A;  2R8I A;  1RHQ B;  4I2P A;  4J5O A;  4U7C A;  3HPO A;  2F7V A;  5T7L A;  3H2U B;  4X4O A;  2BAN A;  5I42 A;  5IQ6 A;  3D3C J;  1YJ9 S;  4P52 A;  1KVK A;  2VG6 B;  1U8S A;  3D1Q A;  2NR0 A;  5KFZ A;  1LWE A;  3CJ4 A;  4WXW A;  3SQO P;  4JI0 J;  4YHH J;  3NNH A;  2MHN A;  4DQI A;  3V81 B;  4C97 A;  4UPH A;  1D9D A;  4CLS A;  2RDJ A;  1FF2 A;  2W5S A;  4Q43 A;  4WK3 A;  4X65 J;  1SV5 B;  3DMJ B;  4DV0 F;  4BCA A;  4X4V A;  1SXL A;  4I4B A;  4NZ0 A;  4C8M A;  5CQG A;  2LXU A;  4WP9 A;  3ICL A;  1UJ5 A;  1MWZ A;  1A7G E;  2K06 A;  4QIG A;  1DBD A;  1JLG A;  4TXS A;  2MKY A;  3R27 A;  1HI8 A;  4Y2I A;  3TP2 A;  1KHJ A;  1KHL A;  2W25 A;  4QR0 A;  1IKY B;  3CNQ P;  2ANH A;  4OZ3 A;  3PW7 A;  1AUK A;  2FD2 A;  4USH A;  1FXR A;  5KFG A;  1E6V B;  2L48 A;  2GHW A;  4J7C A;  3MUV P;  1N2L A;  2VQE F;  5GAH U;  2J9C A;  3NCR A;  1HNV A;  1DY3 A;  1X4A A;  1HBO B;  3DU6 A;  5DDO C;  4DUZ F;  1X8D A;  1G2E A;  1WUU A;  3M30 B;  4JI4 J;  2QFJ A;  1YX2 A;  2R4F A;  3QGH A;  3F56 A;  2XR9 A;  2V9W A;  1ALK A;  5A8R A;  1U45 A;  3F73 A;  1FEH A;  3CVK A;  3OSP A;  3DLK B;  2DY9 A;  2MLY A;  2ZE2 A;  4CYU A;  4QWE A;  1IBL F;  4U8V A;  3M6V A;  3CC2 S;  1KBR A;  1FEE A;  4UTG A;  3MDF A;  2PII A;  1F3F A;  2H3E B;  3TJ8 A;  2VQF F;  2V69 A;  4C3L A;  3MM8 B;  4Q2L A;  2QEX S;  5DRK A;  3TAQ A;  2IY5 B;  1SC1 B;  2DNG A;  3MCN A;  2V4Q A;  2FUG 9;  1ELY A;  4FZV A;  4RNM A;  5EUH A;  4RLE A;  2MKK A;  2HHV A;  4ANC A;  1SL1 A;  4ATN A;  1JLF A;  3M32 B;  2EK6 A;  3VHQ A;  2IIH A;  3MMC B;  1ULR A;  2PMW A;  3BH7 B;  1FKP B;  3LO3 A;  3BO2 A;  1XMQ J;  4JI5 J;  2COL A;  3RBZ A;  2XBP A;  4ES1 A;  4QWC A;  1E2S P;  1NUE A;  2ILY A;  1GMV A;  4O23 A;  2XSJ B;  4ZP6 A;  1HWU A;  4FDJ A;  5RUB A;  2A6O A;  2B9Y A;  2W2O P;  3JAM U;  4PR6 A;  2J6U A;  5HVG A;  1NJZ A;  4OZL A;  2RRA A;  4X4T A;  2DGX A;  1N0V C;  2I8E A;  3ETM A;  3Q8U A;  2GAG C;  1VQ8 S;  2HFS A;  1RCX B;  1O5J A;  2IA0 A;  1UEV A;  1U1Q A;  5J2P B;  3CJQ A;  2XMU A;  2XG8 A;  4PXD A;  5DG8 A;  4CLF A;  1YG0 A;  2DCU B;  1RT3 A;  1DRZ A;  1SJF A;  4F4Y A;  4USI A;  1SQF A;  4CIO A;  3GG1 A;  3BSN A;  5DLF A;  2FJD B;  1N36 F;  2X3G A;  5J2N B;  2GMH A;  3CCM S;  1BD6 A;  3S01 A;  1WAC A;  2C1E B;  1S6P A;  3Q8V A;  2BAC A;  2HVZ A;  1NAQ A;  1RWM B;  4F0M A;  5AE1 A;  2KDO A;  1F9F A;  1OSC A;  2XWY A;  4DL2 A;  1RBA A;  3HSD A;  1X4H A;  3TYT A;  1RUS A;  1IKW B;  1K47 A;  2CJX B;  3R5A A;  2B5J B;  1EB0 A;  2XNQ A;  1EET B;  4XK8 C;  2JC0 A;  2MQN A;  2QL9 B;  4LUB A;  3D1H A;  5KFJ A;  4UF4 A;  2DNP A;  1HQU B;  3LPY A;  3AT1 B;  5F9L A;  3GIJ A;  4USW A;  4K4S A;  3RB3 A;  1SVD A;  1ZEF A;  2DEI A;  1GXT A;  2B4V A;  4DV6 J;  4AL5 A;  3PY8 A;  2ZBC A;  1RJJ A;  4OYW A;  3U1N A;  1RWV B;  3KLI A;  1FFG B;  3DRR B;  3TZX A;  3K2Y A;  1F6T A;  1FNX H;  3BSA A;  2Y1R I;  3WIV A;  3KD8 A;  1X5P A;  4GO7 X;  3PVX A;  3ZZU A;  1UA1 A;  1X9S A;  5A8K B;  2AGO A;  3BSO A;  4DFK A;  1FX2 A;  1NSQ A;  1UTA A;  4GTX A;  1MLA A;  3BO3 A;  1T0T V;  2V94 A;  1PG5 B;  4CT9 A;  4LFA F;  2FC8 A;  4ZA1 A;  2B51 A;  4YB5 A;  3DPC A;  4CXU A;  1GH8 A;  3IN5 A;  2GA7 A;  1S6O A;  4CO5 A;  4X4P A;  4LRE A;  1Y5L B;  3M8S A;  2AGP A;  1S7I A;  4CNZ A;  4DV2 F;  3WAX A;  2V8P A;  3K8W A;  2C2O B;  3FGV A;  4NLX A;  3H5Y A;  3CJ2 A;  1IM4 A;  5CAB A;  2CNN B;  4XPE A;  1S9G B;  4ZP9 A;  1RP5 A;  2AF6 A;  3QWP A;  4X4N A;  3DI6 A;  3CD0 A;  9RUB A;  4DFM A;  1ELZ A;  5KT6 A;  1YRX A;  4K8R A;  4UW2 A;  4JI2 J;  2C2E A;  5HAO A;  4TYA A;  4K4V A;  2D3U A;  4FVM A;  2R7R A;  4JI7 J;  5FDL B;  2Q43 A;  3RYL A;  2KJV A;  4ECQ A;  2BQ3 A;  4Q8F A;  5GME A;  2JLG A;  3NGK A;  2H51 B;  1PO6 A;  4RW6 B;  4EU0 A;  1D9A A;  3RBE A;  4OI4 A;  5EGH A;  5GOV A;  3KK3 A;  4FBT A;  4KPC A;  3U1M A;  3PR4 A;  2JX2 A;  4N8N A;  2JLE A;  5ETL A;  1ZAW A;  2JL9 A;  5ETN A;  1ICE B;  2Q6C A;  2NPF A;  5F8N A;  3MPU B;  4DU7 A;  1FWL A;  4NZ6 A;  4B3O A;  3V4I B;  4J9S A;  1SCJ B;  3H2L A;  3FZB A;  3L7P A;  5KFR A;  5KFL A;  2BJ7 A;  3G8T A;  4WZQ A;  1QTM A;  2J7K A;  1SJ3 P;  3NS7 B;  1SIZ A;  4ECW A;  4KC5 A;  3CJ0 A;  2KRR A;  1LWC B;  4FYV B;  4JUZ A;  2Z57 B;  2QYC A;  3NGR A;  3FQL A;  4DV1 F;  1HR0 F;  2RU3 A;  2DY1 A;  3PYG A;  2XLI A;  3MM5 B;  1BUX A;  3ZZZ A;  1ZS6 A;  5J2Q A;  5C24 B;  1JB0 C;  1XR6 A;  5LT5 A;  5DDP C;  4IFY B;  3JSR A;  2GW8 A;  2OML A;  2OIH A;  5L1I A;  5AXN A;  3CXC R;  1GMU A;  1JMT A;  4RJV A;  1FRM A;  3SEO A;  3W9H A;  2UUA J;  4LSL B;  4OLP A;  1WEX A;  1FES A;  1RI7 A;  3W63 A;  3AD7 C;  2GAH C;  4EZ9 A;  1QM9 A;  1MRO B;  4ED2 A;  2OEM A;  1O98 A;  3IWN C;  5DDQ C;  3L4B C;  3NBP A;  3CDA A;  1TL7 A;  2CJK A;  4HH0 A;  5KFD A;  1M1K T;  3P8B B;  1S9F A;  2AGQ A;  3K59 A;  1KEK A;  1TL1 B;  1S99 A;  4N41 A;  3GTY X;  5G4D A;  4Q0B B;  2V8V A;  4F0K A;  2IFX A;  2MQ8 A;  4FYX B;  2W8K A;  2K3I A;  2ZJP Q;  3NKP A;  3PX0 A;  1WD6 A;  1RA6 A;  4L72 B;  1SHN A;  3NGD A;  1KR4 A;  3BDG A;  4PKD B;  1IKV A;  1R31 A;  3MTK A;  2G2Z A;  3R6L B;  3H98 A;  1T9T A;  2NSC A;  2PI5 A;  3D54 A;  1PKU A;  2GC8 A;  4DDF A;  1C1B B;  2QRR A;  2XB2 D;  3NWG A;  2V9K A;  4GKJ J;  2CJB A;  3W64 A;  2OTL S;  5EHH A;  3PW0 A;  2J0S D;  2I6W A;  1JXL A;  1Y10 A;  4OZ1 A;  3W61 A;  5LXY A;  2IBO A;  1M5K C;  2E66 A;  1BLU A;  5KFS A;  3MEE A;  3MI7 X;  2MLZ A;  4ILR A;  3CJK A;  5DLW A;  5CYM B;  4C4W A;  1WWH A;  5KFM A;  2HHU A;  3UD4 P;  1QSY A;  1OPI A;  3HCX A;  2EC2 A;  1TP7 A;  1KS2 A;  2ZM6 F;  5LSL A;  1FRX A;  1FE0 A;  4ZN1 A;  4J9Q A;  4XDC A;  4UUX A;  4DQP A;  2XHW A;  5AJ9 A;  4DF8 A;  2DGS A;  2XHC A;  2XS5 A;  2HEK A;  1HHQ A;  5M2U A;  1Q1K A;  4KT0 C;  2DXE A;  1VC0 A;  4B3S F;  4CLL A;  3AQO A;  4FYY B;  2QYG A;  2BAB A;  2C3O A;  3MED B;  4G6V B;  3AOB A;  1FJE B;  5KT4 A;  3AFG A;  1URN A;  3NCP A;  3DGP A;  1CJV A;  4WFB Q;  2IC3 B;  3PCO B;  2HVE A;  3SYZ A;  2P5V A;  1N52 B;  1N33 F;  4M94 A;  1V3S A;  2Y3Y A;  2PD1 A;  3T5H A;  4D3G A;  2XMM A;  3D7S B;  5HBM B;  4I6Y A;  3PDN A;  1W2I A;  4RWX A;  3M6W A;  3OHB A;  1L3U A;  2UP1 A;  1Q86 T;  2ZOG A;  3HD2 A;  1S0O A;  4UQG A;  4B9V A;  1V3Z A;  1D8Y A;  4DSJ A;  4ELT A;  1BQM A;  3A8E A;  2CQH A;  2R2U A;  3C46 A;  2R7Q A;  2AT1 B;  5G0R B;  3MPW A;  2BM1 A;  3W5Y A;  1MML A;  1ZEB A;  3KK1 A;  4WJB A;  4MHX A;  4DUT A;  2HFN A;  2VG5 A;  8RUC A;  3AOD A;  4PAA A;  3CJ8 A;  1SJ1 A;  5CYQ A;  3PO5 A;  2KFY A;  5CA5 A;  1LQ9 A;  3JYT B;  1V5V A;  1N5Y A;  3QZ7 A;  5DLV A;  3HVA A;  3LP0 B;  2V6A A;  3OW2 R;  4I67 A;  2W8D A;  3G96 A;  1I94 F;  5HJX A;  1X0F A;  1V9O A;  2K1R B;  4O3S A;  2WRM A;  1UFL A;  5BJR A;  3V5R A;  4JYA F;  2YX1 A;  3C16 B;  3E01 B;  1MWY A;  4RW4 A;  3M9O B;  3TVK A;  3D2W A;  4ZG6 A;  1F5B A;  3P5B P;  3THV A;  2HAF A;  4ECY A;  4JB8 B;  2ZOM A;  1LWF A;  4LRA A;  1RU2 A;  3A8K A;  4EI2 A;  2RSQ A;  4U8Y A;  2GVZ B;  5BXI A;  3ISN C;  3LQV A;  1OQ3 A;  5D0E A;  1S1U A;  1QVG R;  3R97 A;  1XNR F;  1UAW A;  3S8S A;  1B70 B;  1NCL A;  3D5M A;  4OZJ A;  2PMH A;  4DQR A;  4OYZ A;  2GGP A;  1GX6 A;  1VJQ A;  1XNQ F;  3TAN A;  1GX5 A;  4NYP A;  1FRJ A;  3HT3 A;  3CWJ A;  4DV7 J;  5E3A A;  1JLB A;  3KUG A;  3G82 B;  2NUH A;  1DAX A;  2F63 A;  4ZLJ A;  3L7U A;  1JJ4 A;  4O0N A;  3KMQ A;  1N5S A;  3M2V A;  4DSE A;  5AXL A;  2QSW A;  3C8Y A;  4KJD A;  3GSI A;  2RH6 A;  2OP5 A;  2RML A;  3DN9 A;  4QIW D;  3MK0 A;  1JJC B;  1ARO P;  2RIJ A;  2RQK A;  3OBI A;  1J5O B;  4DQS A;  4ED8 A;  3EPI A;  1RKJ A;  4CO3 A;  4X64 F;  3MR3 A;  3H4B A;  2GNK A;  3V6D A;  4H4O A;  4WFX A;  2WSF C;  4I7F A;  4M8L A;  4L73 A;  4BWM A;  4EO6 A;  2DHG A;  3HHL C;  2MJU A;  1OJ4 A;  2BYC A;  4J9U E;  3PIP Q;  2Z30 B;  1VRT B;  3DRP A;  4LFC J;  2KM8 C;  1DTT A;  3R2C J;  1WSV A;  4DZD A;  1RAE B;  1WDT A;  2MKC A;  2ADB A;  1R0C B;  1NPK A;  4OYM A;  5L46 A;  1RTH B;  3D3B J;  3NAI A;  3PFE A;  1Q8K A;  1UVM A;  4AUK A;  5DJB A;  1OYD A;  2CWX A;  2HBQ B;  4F4X A;  1KLM B;  2QT7 A;  5B0A A;  1K8A T;  1Q0N A;  2RH3 A;  4FPR A;  4I6W A;  1T02 A;  2X98 A;  3RGI A;  4UST A;  4ICL B;  1KTQ A;  3M2R A;  1VI7 A;  4NOH A;  5HLF A;  2GV1 A;  3MCS A;  4C7Q A;  3BEG B;  2WZ1 A;  1S6Q B;  3POT B;  4WP8 A;  1RTI B;  3RAM A;  4KQZ A;  2HHH F;  3RB6 A;  3N4W A;  1KRP A;  1S1V A;  4J9R A;  3GSD A;  3U1L A;  2F4F A;  2DYA A;  3M2U A;  2B56 A;  4DFP A;  2DHS A;  2CQ4 A;  3DDK A;  4DX5 A;  1NDL A;  3TRG A;  2MSS A;  2WON B;  4DF4 A;  4DN0 A;  1T05 A;  1K7H A;  2GO8 A;  2VKR A;  2VKZ G;  1TV6 B;  2OUG A;  3LP2 B;  5KFN A;  1TZ0 A;  4ECR A;  4DX6 A;  4ZPB A;  4NEY A;  1KLN A;  2HBZ B;  4QWD A;  2P8I A;  4RW8 A;  5ETV A;  2J7W A;  3GYN A;  1UMJ A;  5F8L A;  3DXS X;  3OL6 A;  3ILL A;  3MM9 B;  4ED1 A;  4XPC A;  5B0D A;  1HWJ A;  2WB1 D;  1JKH A;  2OPP B;  3Q86 A;  2I38 A;  2JJ4 D;  3D67 A;  3K8V A;  2MLX A;  3S1T A;  3SBM A;  2JEF A;  4WII A;  1W25 A;  3A52 A;  2WVB A;  3EYZ A;  1KC8 T;  1HPZ A;  4UOF A;  2LU1 A;  1BWE A;  2MZT A;  4M5N A;  3IO1 A;  3CO0 P;  2DR8 A;  2LEC A;  3A12 A;  1XR5 A;  2AIR B;  1OYE A;  1L3K A;  3PW5 A;  4WTO B;  3LUY A;  1AYE A;  2GQC A;  2HGN A;  2DKO B;  3UW1 A;  1SQG A;  2CNO B;  3GYG A;  1HDH A;  3W8P A;  2VL1 A;  4DV6 F;  4F4K A;  4DSL A;  2ZBR A;  4LF5 F;  2RKI A;  4TU8 A;  4PYD A;  3ZFV A;  2VPX B;  3OQ2 A;  1WDD A;  1YBU A;  2HFO A;  5A0Y B;  4MFB B;  2DGT A;  2HNZ A;  5GAE I;  4LR8 A;  3EJM A;  3R9L A;  2GLQ A;  3FEY B;  2KU7 A;  3I82 A;  4LJM A;  4OJ1 A;  3T1A A;  3LWM A;  2HPU A;  3HJV A;  2XY5 A;  4DUY J;  3A13 A;  4O44 B;  1S4F A;  4E8U A;  1MSW D;  2VFS A;  2HMI A;  5HL7 Q;  1H73 A;  5AJ3 F;  3GV5 B;  1XBW A;  4KFB A;  4H4M A;  2YX7 A;  2WVC A;  4CZC A;  3TVZ A;  5MAO A;  4AL6 A;  2BKP A;  1U6F A;  1QLN A;  3GMG A;  1HQE B;  2KL8 A;  5KFU A;  2ABY A;  2KHD A;  3O1L A;  2WSE C;  3A3P B;  4ZGA A;  5KFH A;  1WOS A;  3B82 A;  2B3T B;  2OPR A;  2FB0 A;  4UT4 A;  1ZED A;  4P74 A;  2CNL B;  2YY3 A;  4MKA A;  3G6X A;  1HQA A;  3AY0 A;  3QZ8 A;  2DR6 A;  1P49 A;  1HBU B;  1NO8 A;  1ZTT A;  1Q7Y T;  2Y1I A;  4PG4 A;  2EXU A;  1HAR A;  1Y5I B;  3IAM 9;  2V68 A;  1YRU A;  3OJS A;  3CE8 A;  2HK2 A;  1NSK L;  2D1C A;  3Q83 A;  4KBI A;  2C2K B;  3HDS A;  4FDI A;  4DR1 F;  3L7O A;  2CNK B;  4JI8 J;  3K57 A;  1KDN A;  2DCL A;  4K4W A;  3GR1 A;  5CYJ A;  4CLU A;  1YQH A;  3QIP B;  1FK9 A;  1Q8I A;  2RS2 A;  4NZ7 A;  3AB4 B;  3ET6 A;  1SJQ A;  3C15 B;  2UU9 J;  1GFW B;  1WOP A;  2UZA A;  1RWO B;  2UVR A;  3OFE A;  1BHN A;  3PTW A;  1AFI A;  2XEX A;  2MXY A;  2QMX A;  2DT9 A;  4LF2 A;  2RRN A;  4G65 A;  3CCL S;  3PYD A;  3SDE A;  5IWA F;  5KFB A;  2VOD A;  4WIQ A;  2XM3 A;  2FHK A;  1RT5 A;  1RAO A;  1RHK B;  4MH8 A;  4O3P A;  1GXU A;  1N32 F;  1NEE A;  1NJW A;  4LSN A;  4B3R F;  3D4J A;  2BOP A;  2R2S A;  1F2G A;  3TO8 A;  1QAX A;  1E33 P;  1GQE A;  1F3V A;  2ZEJ A;  4G1Q A;  4ZPW R;  4CO4 A;  2J9D E;  1N0U A;  2ROE A;  5GAH I;  4ZPC A;  1XJW B;  2HSE B;  1CQM A;  2Q66 A;  1HNI B;  1NSA A;  3SMZ A;  3MMB A;  5KG4 A;  3B78 A;  4AQY J;  4KKO B;  3OFH A;  2G0I A;  3BN7 A;  3SFG A;  4NAS A;  1ELX A;  1Q16 B;  2FGO A;  1FI4 A;  1ZA2 B;  4JOU A;  5ETK A;  3I31 A;  2BA9 A;  2W5R A;  2QA4 G;  5M2P A;  1QY7 A;  4FKY A;  2YWF A;  3FJ2 A;  4O0I A;  1F2H A;  3Q22 A;  3NRB A;  4M1K A;  1YJN S;  2D3O R;  4WTY A;  4CH1 A;  3J7Z T;  1TK8 A;  1KSP A;  3QWU A;  1WHV A;  4NLR A;  4FBU A;  3M8W A;  2OPQ B;  1S57 A;  2GML A;  4Z7Y A;  3CW2 C;  3AD9 C;  3EDR B;  2C3M A;  2QG9 B;  2EC0 A;  4TN0 A;  4DV4 J;  2UXD J;  1VQK S;  2ZH7 A;  3ZZT A;  2HLT A;  3UD5 A;  3ENA A;  3QFH A;  3OTO J;  3ZNU A;  2DRA A;  3HHK A;  4DR3 J;  3EGV A;  4DPX A;  4WE1 B;  4L76 A;  2W9B A;  2V2Q A;  3NG8 A;  2YQ0 A;  2CQ3 A;  5KFV A;  1RAD B;  5K5M A;  1IKY A;  2EFQ A;  5KTQ A;  3HT0 A;  4YUD A;  2E9T A;  1P1L A;  3BYR A;  2FJE B;  4YB6 A;  3W2W B;  4JI6 F;  4UOR A;  4FF1 A;  1HBO A;  3OJU A;  5JVH Q;  1CEZ A;  2KT3 A;  5F8J A;  4NL5 A;  1NU4 A;  3TX0 A;  2QA4 S;  1EP4 B;  2CPD A;  4M5D B;  3WBZ A;  5KFF A;  1HHT P;  4IKA A;  4F7V A;  2EVZ A;  4CT8 A;  5CCM A;  1DJ0 A;  2FTR A;  2F8E X;  3U02 A;  2AJ4 A;  4DL0 C;  1H98 A;  1FDD A;  2YQ3 A;  3TJ9 A;  1QSS A;  5EDW A;  2ACM A;  2AYM A;  3MM6 A;  1ZZN A;  4OI3 A;  3K5P A;  2XYH B;  2LVW A;  3ZTS A;  3MM8 A;  1Q8B A;  2R2R A;  5D15 A;  4GKK J;  2VQR A;  5DLG A;  1K44 A;  4PG7 A;  2VJV A;  4ZPD A;  2BJ3 A;  3KLG B;  3A1Y G;  3A8J A;  4DPW A;  2VDH A;  2W2N P;  3MMC A;  1NPP A;  2YNI A;  5I3P A;  1TFW A;  1UVI A;  3PRD A;  1FKP A;  1TU0 B;  3MGJ A;  1S48 A;  3M6X A;  1HW8 A;  4YDX A;  3FEZ A;  3FFI B;  1NK4 A;  4YP3 A;  2ZC4 A;  2GIR A;  3ZZ0 A;  1IR0 A;  4LIW A;  5LRM A;  5E3C A;  1U0H A;  2AP6 A;  5LMU J;  2MGZ B;  2BXJ A;  2GA3 A;  1UVK A;  1X5S A;  4DR5 J;  3MFH A;  1BQN A;  4MK7 A;  1U1K A;  1DQ9 A;  2UV8 A;  4QWA A;  2DO0 A;  3BPS P;  3DOL B;  3GIM A;  3G86 A;  1Y7P A;  4NXM F;  1UA0 A;  3NVL A;  2G2Y A;  5KT2 A;  2DPJ A;  1RT2 B;  2YBV A;  1EAY C;  2H4W B;  3L3C A;  4YR1 A;  2KN4 A;  4X4R A;  5J2N A;  2VV5 A;  1EX8 A;  5IT4 A;  2HND B;  1QDU B;  5F8G A;  4FXW A;  1UFW A;  1U2F A;  2HUR A;  3UDV A;  2OFG X;  4C3K A;  3W60 A;  1ZM9 A;  2KXN B;  5BR8 J;  3S6E A;  3TX8 A;  2QMU B;  2UV8 G;  1VS3 A;  3KLE A;  2ADC A;  1LNQ A;  3I9V 9;  2NXN A;  3E3X A;  1KNZ A;  4C0O C;  5C42 B;  2YKP A;  2B7B B;  1RTJ B;  2R2T A;  3OR2 A;  1N2K A;  4IQX A;  2UXC J;  1VFJ A;  5KFP A;  1BMQ B;  4PYA A;  4RUH A;  3QT5 A;  4OLO A;  1H72 C;  4X62 J;  4Q44 A;  5FLX U;  2HHW A;  3LWL A;  2L9D A;  3VGV A;  1NK6 A;  3I6P A;  2BOA A;  1EJJ A;  1AT1 B;  3DRR A;  2IBK A;  3HMJ G;  2YX4 A;  1ZYQ A;  1YKW A;  1BWV A;  2BRL A;  4BWJ A;  2M9K A;  3D6H B;  1HBN B;  5HAT A;  2V8G A;  1RT4 B;  3OXG A;  3KHH A;  2XUL A;  4P2X A;  2F5G A;  7FD1 A;  3T5J A;  3WBH A;  1SKS A;  2QA1 A;  4ZIW A;  4J9L A;  4KGX B;  2FLL A;  1HL6 A;  2B6A A;  4ITS A;  2W7O A;  2DNY A;  1F5A A;  1YI2 S;  2KT5 A;  2EBG A;  3GJS B;  5D4P A;  3CCQ S;  2OO4 A;  4PUO A;  3NMA A;  2VC0 A;  3R6G B;  2XMA A;  3N6N A;  2K2P A;  1S72 S;  2WVE A;  4QOT A;  3MAQ A;  2YNG A;  1TUG B;  2FLP A;  4KTQ A;  5IJS A;  4C8L A;  1X4C A;  3MCO A;  3IBC B;  4LF8 F;  3WAV A;  2CQB A;  1S9G A;  4PPD A;  3W7B A;  2VPZ B;  3DLE A;  1I3O B;  3OXL A;  1VOM A;  2HHQ A;  2BJE A;  5FD1 A;  1X4G A;  3PEJ A;  5HQL A;  5DGA A;  1Y7A A;  1EJ7 L;  1VQN S;  2KZM A;  1U7L A;  2FY8 A;  4YEA A;  2KZZ A;  4YME A;  1R43 A;  1U1M A;  1O8B A;  1IXK A;  5FDL A;  4LF4 F;  4UQT A;  1UW4 A;  3EZ5 A;  3G6E S;  4BHQ A;  2M0G B;  3JTP A;  3VR1 A;  5C66 A;  1N56 A;  1NH8 A;  1SKR A;  1N8R T;  3QSY B;  4RW6 A;  1R3N A;  2HHX A;  3BBC A;  1N34 J;  2J8S A;  3MFI A;  3GJQ B;  2LA6 A;  4KRW A;  1JWW A;  5H9E K;  3KK2 B;  2L41 A;  4ECS A;  4PWD A;  4DSI A;  3WC2 A;  1KN6 A;  4U95 A;  1SI9 A;  1H74 A;  3M8P A;  2XMV A;  2C42 A;  2QL7 B;  2XMJ A;  4ZP7 A;  2JVR A;  3IM9 A;  6FD1 A;  4RUA A;  3EE3 A;  3PJX A;  1SC6 A;  4HYK A;  1REG X;  4YY3 J;  2AKW B;  1SKW A;  1L3S A;  1E6Y B;  2VFV A;  5LQQ A;  2B7C B;  2N7C A;  1G4C A;  4YQW A;  3CPW R;  3IWX A;  4LF7 F;  1NJX A;  1IJE B;  1U25 A;  4I2Q B;  3CD5 A;  4DSF A;  1VR6 A;  5C24 A;  2W7P A;  1K1S A;  1QAJ A;  4MT1 A;  3LA0 A;  3UWT A;  3KKF A;  2GMJ A;  2HW3 A;  1NKE A;  3IG1 A;  3LGN A;  3NKM A;  4F02 A;  4ZVQ B;  3KJV A;  1IBM J;  4LQ9 A;  4IH5 A;  2IRY A;  2ZIT A;  1S79 A;  5HJY A;  4MYU A;  3NKR A;  3VAK A;  3EGZ A;  3C3L A;  5DZ7 A;  2AV5 A;  3AH6 A;  5LSO A;  2HQG A;  1I1G A;  2XGQ A;  2HIY A;  4O4G A;  1F60 B;  3PYE A;  3DHW C;  3BGF A;  3BDE A;  3R1L A;  2O1P A;  1Y5N B;  3DNC A;  2RJZ A;  4RW9 B;  3B8H A; 
#chains in the Genus database with same CATH homology
 3LXQ A;  3BDH A;  4ZG9 A;  2X98 A;  3A52 A;  4KAV A;  1AJA A;  3NKQ A;  4UPH A;  1KH5 A;  4MHX A;  5K4P A;  3MK2 A;  3NKN A;  3UO0 A;  4LRC A;  1EW2 A;  3KD8 A;  4KJG A;  5IJQ A;  2W8S A;  3UN5 A;  1EW8 A;  3Q3Q A;  1ELX A;  3IGZ B;  4UOR A;  2W5T A;  3M8Y A;  3UNY A;  4GTW A;  5IJS A;  5LRM A;  2W5S A;  1EW9 A;  1KHN A;  2W5V A;  4MIV A;  3WAV A;  2GA3 A;  2GSO A;  2IUC A;  4KJD A;  1URB A;  1N2K A;  5DLV A;  4LRB A;  5L0B A;  4GTX A;  4LR9 A;  2RH6 A;  4LRF A;  2GSN A;  4NWJ A;  1ALJ A;  3TX0 A;  1KH7 A;  1O99 A;  2W8D A;  3MK0 A;  4UOP A;  3B5Q A;  5TJ3 A;  3TWZ A;  1ELY A;  1AJB A;  1E3C P;  2ZKT A;  1Y6V A;  2W5R A;  1KH4 A;  4NWX A;  3SZY A;  3BDF A;  4UPK A;  3DPC A;  5EGH A;  1HJK A;  5LQQ A;  1Y7A A;  5GOV A;  4LR7 A;  3MK1 A;  1URA A;  3T00 A;  4CXU A;  4ZGA A;  3M8Z A;  3T02 A;  4LR2 A;  5HRT A;  1HDH A;  1O98 A;  4UOO A;  1KHJ A;  1KHL A;  1KH9 A;  4UPI A;  1ZED A;  4LRE A;  1ANI A;  2ANH A;  4KM4 A;  1EQJ A;  2G9Y A;  5LRN A;  1K7H A;  3NVL A;  1AUK A;  4MY4 A;  5DLT A;  1EJJ A;  4UPL A;  3WAX A;  1ALH A;  3T01 A;  1FSU A;  3M8W A;  5L0K A;  1ED9 A;  1HQA A;  3BDG B;  4LQY A;  3UN2 A;  1E2S P;  5DLW A;  1N2L A;  2GSU A;  4ZG6 A;  3IDD A;  3E2D A;  1ALI A;  4GTZ A;  2W5X A;  3NKM A;  5GRR A;  3M7V A;  2IUC B;  1E1Z P;  4TN0 A;  4YR1 A;  4LRA A;  1P49 A;  4LRD A;  1SHQ A;  1B8J A;  3IGY B;  4FDJ A;  3OT9 A;  1EI6 A;  4LR8 A;  3NKP A;  3TG0 A;  2IFY A;  4CXS A;  5L0E A;  5C66 A;  3NKR A;  5EGE A;  2GLQ A;  2W5W A;  2QZU A;  3WBH A;  3SZZ A;  3UN3 A;  1ZEF A;  4N7T A;  3NKO A;  2VQR A;  1ELZ A;  5KXA A;  4KAY A;  1SHN A;  2D1G A;  3ED4 A;  1E33 P;  4CYR A;  3WAW A;  3BDG A;  2W5Q A;  5INH A;  2XR9 A;  1ED8 A;  1ALK A;  2XRG A;  4CXK A;  4ZG7 A;  4B56 A;  4GTY A;  4QAX A;  3CMR A;  3WAY A;  1AJC A;  1ZEB A;  5AJ9 A;  1KHK A;  4CYS A;  3DYC A;  5LIA A;  4FDI A;  1ANJ A;  1AJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...