4LRAA

Phosphopentomutase s154g variant
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTGADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 139
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lraA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lraA01
3T02A 3M8WA 4CYRA 4UOPA 5LQQA 4KAVA 3B5QA 4CXSA 1KH7A 3OT9A 2IFYA 5L0BA 4UPLA 3IDDA 3Q3QA 4QAXA 1EW8A 1E1ZP 3BDGA 3NKPA 4KM4A 1P49A 5IJQA 1ALHA 4MY4A 3NKMA 4UORA 4LR8A 1ZEDA 1EW2A 4LRFA 1SHQA 2W5RA 3M8ZA 3NVLA 3T01A 1KHLA 4ZGAA 3KD8A 1ZEFA 4LRBA 3UN5A 4LRAA 2GLQA 1N2LA 4YR1A 2GA3A 2G9YA 2QZUA 2IUCB 1AJAA 1AJBA 1ZEBA 1HDHA 3CMRA 3IGZB 1B8JA 4B56A 4UOOA 1ANJA 5DLTA 3WBHA 3ED4A 2GSUA 2W5XA 1E3CP 3UO0A 2XR9A 3BDGB 4UPHA 5C66A 4ZG6A 1ELZA 3A52A 2IUCA 3UNYA 4LREA 5TJ3A 2GSOA 4GTWA 4LRDA 1KHJA 3M7VA 5INHA 5DLVA 5GRRA 1ELXA 4N7TA 2X98A 3UN3A 3NKRA 4CXKA 1ALJA 4GTXA 4KJDA 5LIAA 2ANHA 3BDFA 3MK0A 3WAVA 3WAWA 1ALIA 4UPIA 4GTYA 2W5WA 1AUKA 3NKOA 2GSNA 1ELYA 3UN2A 3M8YA 1KHNA 1O98A 5EGEA 5L0KA 2D1GA 4NWXA 4GTZA 5IJSA 4LR9A 1SHNA 1AJDA 1N2KA 4ZG7A 5EGHA 3MK1A 2W8DA 5DLWA 3TWZA 1HQAA 4FDJA 3TG0A 4LQYA 1EI6A 1KH9A 1EW9A 1URAA 4FDIA 4LRCA 3DPCA 3WAYA 3E2DA 1EJJA 1KH4A 1E33P 4MIVA 1Y7AA 3WAXA 1URBA 1E2SP 3NKNA 5HRTA 1ANIA 2XRGA 5L0EA 1KHKA 5GOVA 4KAYA 2VQRA 3LXQA 3SZZA 1O99A 1FSUA 4KJGA 4LR2A 2ZKTA 1Y6VA 3NKQA 3DYCA 5K4PA 1HJKA 3MK2A 4MHXA 4UPKA 2W5QA 1AJCA 5KXAA 2W8SA 1ED9A 2RH6A 5LRNA 4LR7A 3T00A 5LRMA 2W5VA 1KH5A 4CYSA 4TN0A 3IGYB 2W5SA 4NWJA 1ALKA 2W5TA 3TX0A 1ED8A 5AJ9A 3SZYA 1EQJA 4CXUA 4ZG9A 1K7HA 3BDHA
chains in the Genus database with same CATH superfamily
4F7VA 5K14B 3M8WA 4ITSA 5GMKa 3I55S 2VIHA 5HVGA 1ZTWA 3R6LB 4YR0A 1WG1A 2L41A 4A8WA 5A2QU 5HP1B 5KFAA 5C2GA 3H5SA 1SKWA 2PI5A 5I42B 1R31A 3OXLA 3FEZA 2KU7A 4DQRA 1WF1A 3PW7A 5B0DA 3IS9B 2J0XA 3UDCA 3M32A 1WC5A 1RT5B 1Q8IA 1WOOA 1RGVA 2EK1A 4X64F 2BJ1A 2BMBA 3CT9A 3MD3A 4MH8A 2D74B 1PYTA 5KFPA 4QWCA 3KMSA 1HWIA 4LF1A 5SZTA 1R0AA 4UY85 4R0EA 2N7YA 1FKPB 1AA1B 1SJ1A 3TQEA 2AYEA 2HWIA 3D1HA 2OHDA 3UVJA 4LIWA 2HVDA 4RW9B 4WYLA 3HD2A 1JLCA 2B7CB 4R5PA 3MTJA 1RAIB 3CJ5A 4WE1B 4JV5F 1YBUA 2MQ8A 2E7VA 2DRDA 4ZP7A 3V81B 3AOCA 1FKOA 4M8LA 1S4EA 1L3VA 4PRFA 1RUSA 4UUXA 4YR1A 1KVKA 3I31A 1AJBA 4NYZA 4YY3F 1V3ZA 3C19A 4A8KA 4YHHF 1NDPA 2A2DA 2EBEA 2W5XA 2HQDA 3UVJB 1R6YA 3KJQB 3UCGA 4GC6A 1SL0A 2XS7A 1SI9A 1S99A 4X4PA 5B0EA 1H2UX 1FRMA 2HQ3A 4F4YA 2Y1LB 1NK7A 1IKYA 4EFAC 3CJSA 1IKXA 3FBFA 2IUCA 1UVMA 3BKFA 2P9EA 2GSOA 4LFAJ 2YQ0A 5J2PB 4DSLA 4QPTA 4FF1A 4CLYA 3POTA 5H9FJ 4EBCA 1MNEA 1F5BA 2FJDB 3OR2B 4RW6B 2ASYA 3KJVA 5LMUJ 4RO0A 3MUVP 3KJNB 3PW5A 2R3VA 1HHTP 1KTVA 3CC2S 1HQUA 2XY6A 4A8YA 1WEYA 4F67A 5J1EB 4WU3A 2VBZA 4X4VA 3D67A 2VJVA 1X60A 3OFEA 4YR3A 4NLTA 4C0OC 3M30A 2MQNA 4OV1A 1VCTA 2R8GA 2WOMA 4IG0A 3OFGA 4HI1A 5KG0A 3TOQA 1FWKA 4DF4A 1FDNA 1P1LA 5LJ5Y 1H74A 2DTJA 1SV5B 4FBUA 3EGWB 3ZZUA 3EX7B 3I32A 3OJSA 4HEA9 3OVSA 1N2KA 4PXCA 2WBRA 2W9BB 1RWOB 1RT3B 3KUHA 4WU2A 4DPYA 2BOPA 3PCOB 4IQXA 3TWZA 4KQZA 1RQ0A 4WK3A 1D3WA 5J2QB 4ELTA 1AZSB 2VG5B 1TKTA 4IH5A 4XDCA 3TVYA 4CO5A 2RF2B 4FDIA 5LOQA 3CE8A 3FCWA 5CHCB 2DGQA 4PYDA 3D4JA 4MIVA 2CPJA 4K8RA 3DRSB 4ZPBA 4DV0J 2QA1A 4YDXA 3ZO7A 2FJAB 2HRTA 3MM9A 1NDCA 2CNKB 4ENOA 2AJQA 3G2XA 3B8HA 4HACB 4KHPJ 2BRKA 2BJ8A 1N5VA 2V94A 5J1NA 5F41A 2HHWA 5T41A 3QFHA 2MZ1A 2KG1A 2VHGA 2AYBA 3NLCA 2OO4A 1P49A 1RWXB 2EFNA 2HRUA 4URSA 2Z56B 2AQ4A 2AEJA 4J9RA 1IKWB 5KFUA 3VAFA 3JXOA 3HSZA 1N6QA 1S1XB 1Y6VA 1R8AA 2P8IA 3N6MA 3NWGA 4QBUA 4HDGA 1EZZB 4JI0J 2DR9A 3JSMB 4WXOA 3VTIA 4J9OA 4P2SA 3BO3A 3M6WA 1VQ7S 1JJHA 3FUYA 1SCJB 1ZZFA 3K5OA 5E3RA 5L38A 5CXTA 2MY8A 4C8NA 2W5VA 3IWLA 3IAM9 1IBLJ 1NUEA 5A8WA 3TYTA 4LF8F 2AKWB 4DS5A 2W5SA 1BHNA 3FSXA 3A8KA 2XS5A 1E6YA 2FJEB 2QIFA 2FC9A 2DR8A 3FCVA 3OTEA 4ZGAA 1C0UB 4WP9A 3K8VA 2EKNA 1VQYA 3WZ0A 4AQYF 2GJFA 3G8QA 4ZS6A 3DHWC 4NPOA 3MMAA 2UXDJ 3CCWA 2GIFA 1GEHA 1C4CA 3BZQA 1XNQJ 2Y1RI 3MM6B 2C3PA 2DVIA 3IGNA 1MWQA 3ULHA 5DG8A 4WFNQ 3BS9A 3I6PA 4JI8F 1RT2B 3R3TA 2OAUA 4ZVOB 1T02A 3UFCX 4GVBA 3K58A 5BYQA 3KLFA 2UXCF 2YXLA 2YKOA 2RHSB 4YUDA 4ZITA 3JS9A 2H4YB 2CQBA 2HEKA 2XZWA 5A8RA 2KYZA 1K9MT 1SKSA 3LP2A 3MOJB 3SQGB 2UV8A 1QVGR 4IFVA 1MWZA 2Z30B 1NDLA 3DC2A 3C15A 3QJJA 3DOMB 3MEEB 2XO6A 4HH1A 1RTHA 3MD1A 5D3GB 3BSOA 3IGZB 2VV5A 4HH0A 4LSNB 2AU0A 2DD8S 2MZJA 3PFOA 1TKTB 2H1YA 2IJNA 4DLEA 2BM1A 1J5OB 1N33F 1G4CA 1ELZA 2V8HA 1FXLA 4LSZB 1G6BA 3UNYA 3JAMY 5F9NA 5CYJA 3U27A 2F8HA 1U7LA 1U48A 3P5BP 3TUZC 3EICA 4WTYA 3ENAA 1CS4B 4QYZK 1Q0NA 4RWWA 1U6ZA 2DNKA 4J90A 2Y8YA 1SVDA 4I2QA 1VS3A 4LVOP 2DH9A 3NNAA 2GVZA 4C98A 4M5DB 2W7PA 1R0BG 3EZUA 3NP5A 4DSEA 1U49A 5DQGA 4JV5J 4P73A 1VIXA 4ZVGA 1HHQA 4DV2J 1CS4A 4CWBA 2MHEA 2UUWA 2V2KA 4USIA 4KR0B 1JXLA 4B3TJ 4B9VA 1GMVA 2RQKA 2V50A 4CLSA 1PO6A 2VG6A 1ZPVA 2EKYA 3I82A 4EYHB 4BS2A 5KFTA 3HPOA 1JWWA 3BSCA 2XWXA 2ZOGA 3MM8B 2MQQA 3GONA 3V5RA 2CAJA 4P52A 1TL4A 1S72S 2H5IB 3JQJA 2HMIB 2IRYA 3BGFA 2H5EA 1KN6A 2KVQE 2W1BA 1LK7A 2ACMA 2VC0A 3ZNUA 4ZP6A 4TXSA 1T03B 1H73A 1L3TA 2VFUA 2GMLA 3H2LA 1YTYA 3CDUA 2ADBA 4KPYA 4ANEA 1GXLA 2EG1A 1FE4A 1LW0B 2NXEA 2CDQA 2E1RA 5KFHA 1XERA 2HVZA 5F0UA 1URBA 2CNLB 3KG0A 2HG4A 4J9UE 4ZN1A 1WKKA 2DGWA 5D4NA 2QJ3A 3HZGA 3MMBA 4XAKA 5K8PA 1M90T 2AEMA 3UD3P 3C2PA 4LMZA 5L0EA 1UL3A 3V4IA 1IBCB 4CH0S 3QGIA 1B0PA 1CQMA 2JJ4D 2KYXA 3U02A 4JP8A 4AFFA 1JLQB 1F2GA 1VC5A 5GMEA 1N52B 1C1BB 1EKRA 3PDNA 4MIAA 2AWZA 2E66A 2JRSA 3V2UC 4IG3A 5IQ6A 3PR5B 3KK3A 4UPKA 2CZVC 2GJIA 4G1PA 4DZDA 1KD1T 4PPDA 1N0UA 1BGXT 4DUTA 2IAJA 1YJ7A 3G8SA 1TL7A 2V8GA 4JI6F 3GFXA 3MHYA 1UKUA 5KFJA 3FDSA 3H90A 3I0SA 3B54A 1N8RT 1S6QA 5AJ9A 2KB2A 1HFEL 4CXUA 2WVFA 5DRKA 4TY8A 4OZ5A 4A8XA 2RE1A 2MGZA 1DQAA 4I6WA 3T19A 5DGBA 2HHVA 2BUNA 1V6HA 3CW2C 2E7XA 5DO2A 4L3NA 5E3QA 1Y3JA 1VJQA 5ETPA 5HL7Q 2M8DB 4YB1P 4DQIA 1KVJA 2EEYA 2BE9B 1S1WB 3VAHA 3WAXA 2IM2A 1IR0A 3CJ8A 1U6FA 4PG8A 4DR1J 1VOMA 1T7PA 4ECVA 1HLWA 5K8NA 4DR5F 3AHPA 4O44B 1E1ZP 2JDJA 3C6UA 3H8YA 1WF0A 2V34A 4OLOA 1NU4A 3DRPB 2ZE2A 3QWPA 4DFPA 3NKMA 1BD6A 1S1TB 4K2JA 3OL9A 4DR6J 3NRBA 1MN9A 4X2BA 1H6KX 2LEAA 4WFZA 3TUIC 1YHQS 5DQIA 5G4DA 3KD8A 1WI6A 2AYMA 4FYXB 3FK4A 3A3OB 2B8QA 4JI7F 1MROA 2DPIA 4UQGA 1REGX 5D0HA 2UUCJ 2MQMA 1TL1B 2GA3A 3M8RA 4ES2A 4DL5A 1S1TA 1S5ZA 2X1GA 1N32J 2MZSA 5KFWA 2MLXA 5J2NA 1TAQA 3GJSB 3I56S 1ZM9A 2E44A 3GMGA 2PMZD 1FNOA 1K73T 1P9QC 5CABA 2UUBJ 3MGJA 1BLUA 4Z2XA 1BXNA 4QW8A 3CPWR 1S1UB 4M5IA 4ILRA 2NSCA 2MHNA 3AQOA 3KHRA 1JJCB 3IBFB 4NLXA 2PI4A 3G71S 1DTQB 3B6BA 3G96A 4DL6A 1VRTA 2HHHF 5TJ3A 3R5BA 4LRDA 4CLFA 5JUMA 3PY8A 5HJYA 2GCFA 2XMMA 3TJ9A 2DJWA 4FPIA 2HNZA 2CQ3A 4NWBA 3Q24A 3EGZA 4CXKA 2BANB 1NM2A 4DZ6A 3KNGA 2CADA 2KRRA 3Q8YA 4OL8A 1YZ7A 2FQQB 3RB3A 3THTA 4WF9Q 5FJ4A 1S48A 1YWXA 3A1YG 1YLXA 1IN0A 3UCUP 4UZCA 2IYGA 2ZH4A 1NO8A 4ECQA 1ELYA 2QA2A 3ZZOA 1QE1B 2HWTA 4QOTA 3QBCA 2RUSA 1MW7A 2CG8A 5K14A 2CWXA 1FTRA 4XPCA 1JLCB 1KHNA 3FNNA 4I2PB 1HARA 4ZPWR 1IJFB 2B6AA 3SCKE 1N33J 4FVMA 2B51A 2RILA 1Q16B 3OXGA 4JYAJ 5GAEU 3T6JA 3EYZA 3PYGA 1R43A 2D3OR 4LQYA 3CD7A 3M32B 2HK3A 2CPDA 1URAA 4CXSA 2XY5A 3D5MA 4DLGA 1R6VA 3ITHA 1CC7A 1WC6A 2HFOA 1QY7A 2R7VA 3QATA 3BDFA 1SJRA 2NXJA 1ZBTA 3SQOP 1P27B 2XI3A 5LJ3Y 3WX4A 3X1LB 1VIOA 4CM2A 3TZZA 3PRBA 4O3PA 5KT7A 5IT0A 4Y3CA 3GILA 5D0RA 5IC6B 2YH0A 1YRUA 1IWAA 1CJUA 2OI2A 1TL5A 2C3YA 4N77A 5HSPA 1H38A 7AT1B 2V4JA 4Z7YA 3OTCA 3CIZA 3PO5A 3AODA 4KFBA 3RR8A 2HIYA 2FVCA 4ZVEA 5I3QA 1TUGB 2QFJA 1E6VA 5EGHA 1HHSA 5ETKA 2H54B 2XMVA 3EE3A 2HAFA 2M3DA 1FX4A 1Q4RA 2WOMB 3MMCB 3NOCA 4IG0B 3UD4P 4LF9F 1N36J 1SC6A 2LYVA 4CYSA 1RT2A 3G6XA 1UVKA 1VBXA 1S1VB 1Y5IB 1SB6A 2IC3B 5D15A 1TL3B 1TQLA 2BQRA 4KB7A 1Y5LB 4LF6F 3GV8B 1QUVA 2FB0A 1WG5A 1NKCA 3A8IA 3M30B 3BGOP 4ZJOA 4HKQA 2GC8A 1U4BA 3BF4A 1T11A 4DSIA 2W24A 3EJMA 4AXIA 3UQSA 1FJGF 2ZC4A 4U6PA 3D28A 4RU9A 4I67A 4AL6A 1B0VA 2ZBPA 2IA0A 1WHYA 4O4GB 4TVAB 4ANDA 4DOZA 5E41A 2XCAA 2LEPA 3A13A 4DR7F 2UUTA 1H72C 2IC3A 4WTOB 1UJ4A 3NCPA 2EBGA 3TAQA 1EETA 2YWGA 4KAIA 3GJQB 2J9DE 2R2TA 2YX1A 9ATCB 2F4FA 3KLGA 2YNGB 4OYPA 4LSNA 2KXNB 5DLFA 1Y10A 1JLBA 1DY3A 2D9OA 3AJ1A 3HULA 4GVLA 4HT5A 1RADB 2VL1A 3QGPA 2W9CB 2KFZA 2XEXA 1CJKA 3N9UC 3NCRA 5GADU 4UORA 1WOSA 1Q81T 2J0SD 3CSKA 5KXAA 1CBKA 1HQ2A 3DNCA 4J5OA 1RYRA 3M2VA 1PAEX 2Z4PA 2QLFB 4B3MF 5ETVA 2R7OA 3VZIA 3U1LA 1NNDA 1VLOA 2OGUA 5B0GA 5F8IA 4WCEQ 2KFYA 4MAKA 2VONA 1CJKB 1X4AA 2Z58B 4CNYA 4OX7A 3MR5A 3FQKA 5SUHA 4N5SA 2LA6A 2QMWA 4IKAA 4NLWA 5CYMB 4CLPA 1AFJA 1S1XA 4RKUC 2MKYA 3L7OA 4ZP9A 1UEUA 1D8ZA 4WBFA 1E3CP 3BDGB 4UPHA 4KV8A 1BQNA 3DLJA 2FUG9 2AGQA 3VAKA 3W3SA 1KHWA 3M05A 5C42A 1U1RA 4Z37A 3LF0A 2BR0A 3G9CA 2DNPA 3WC0A 4UOFA 2UU9F 1WC3A 1FRHA 2FVSA 1UVJA 3BSNA 2OPPB 1KHJA 2IA6A 1P1TA 3TVZA 1NH8A 4QWBA 4U7UD 4RW8A 5DLVA 3RGIA 1ELXA 4B9SA 5AXNA 3GR1A 4ANCA 4ECYA 2AF6A 3G6ES 2W2OP 1U8WA 2CNOB 2Q1LA 1EQ0A 3Q86A 3R7SB 3EM1A 3OTOJ 4IRDA 2DNRA 4GTYA 4FS1A 2AJ0A 1RCOB 2WSEC 4KGZB 3GFZA 2BX6A 2GSNA 3MR7A 5A8RB 1AROP 2VA3A 1C0TA 5L0KA 2VDIA 3SCJE 4ICLA 4RPFA 2H51B 4BCAA 5DG9A 2VBYA 2OIHA 2RHQB 1RT6A 1W2BR 2PFFB 3DDNA 2X7IA 3K5PA 3PX6A 2OEKA 2QRRA 2CJ9A 2IYIA 1YITS 4MFBA 2K7KA 4M95A 1SKRA 3NGSA 5DLWA 2J0WA 4ZPDA 4N41A 2LMIA 3K2YA 3NGTA 4K5RA 4N8NA 1HBNB 2CXEA 2E5GA 5FIIA 5JJBA 1EP4A 4IYQA 2M9KA 5KFIA 5IV3A 2R8JA 4JBCA 3U7JA 4ZKAA 4ED7A 3KTQA 2J8AA 3RB0A 1LWEB 2H48B 2H5JB 3MCMA 1VK8A 4KO0A 8RUCA 2ASJA 4JOUA 4PWWA 2E9TA 4MFBB 2D3O1 5LXRA 2CJKA 4MKAA 4PWDB 1IWGA 5FLXU 4KAYA 1V3SA 1BQMA 2JWNA 3R7NB 4RR5A 2ZJPQ 2YBVA 1M5HA 3I0RA 2JFKA 4NZ0A 5HQMA 1FDBA 1Y00A 2MGZB 3BBCA 2JLGA 4DFMA 5D3GA 2HFVA 5HQLA 2ZKTA 3DHXA 2HVEA 5FLXY 3W64A 3PRDA 1NHKL 1RHJB 2ACYA 2KN4A 4O0IA 3DYCA 3GYXB 2EW9A 3FFIA 3OPKA 3S01A 2YWHA 4DV3J 4TYAA 3H40A 4CO4A 5KFBA 4HLBA 5IV4A 2W9AA 1VQ4S 2AGOA 1CC8A 1U1PA 5HMZA 1RHKB 3J81Y 2ATLA 1TKXB 1FHTA 2J7WA 1GT8A 4EEYA 1KNZA 1OYDA 3DFEA 2DT9A 2V6AA 3CIMA 3E3XA 2E5LJ 2W5TA 4DUYF 4JI2J 3W62A 2YNIB 4RX6A 2QMUB 1GTEA 2HZAA 2LFVA 2GGPB 4OIXA 5C25B 2I8EA 2CJAA 3QNWB 2W7AA 4NLSA 1X31C 3KHLA 2YKMA 4BBYA 3NGUA 4F4AA 3TO8A 4NLOA 3CD5A 1W7WA 2IDEA 3AAWB 2HPUA 4ETZA 4X4SA 3HXMA 1K8AT 3T02A 3CF5Q 1OY6A 2CPIA 4A8SA 1SXLA 4C48A 1TK5A 3MMBB 3NKPA 2XLIA 2EWHA 4KPCA 4L6V3 2OPSA 2R42A 1S97A 3PW0A 2GFFA 3CMQA 4KGXB 2CKWA 4MK9A 2HMIA 4KHPF 3PV8A 4TQSA 4BWJA 4C11B 1ZAXA 2DHXA 3CDBA 4ZDNA 4ZPVR 2POKA 4CIOA 1K0VA 1CULA 1AYEA 2PA3A 4B9NA 1WOPA 3QZ7A 1FK9B 1FXDA 1URRA 4B56A 3FMBA 1LW0A 1REVB 2QSWA 4DR2F 4AXJA 4FF3A 3WBZA 1B8JA 3RZAA 2CQGA 1RHMB 3VALA 2YTCA 1ZM4A 3MZIA 4RNOA 1VI7A 2Z2YB 2OSRA 3CJRA 5KFGA 1IQTA 3IXQA 3KLFB 2PA8D 2FHOB 2WONB 1RTHB 3F44A 5G0RA 4FBTA 4D3GA 4QR1A 3BM7A 1BMQB 2RRBA 4F4XA 3PVXA 1X0FA 4Y2AA 1NHVA 3G8TA 5INHA 2VICA 3KLVA 1D09B 4RNMA 2DCLA 1D8YA 2FVQA 1FDAA 3VCDA 4P74A 1QSYA 3Q23A 4Z7CA 3JQKA 3HSGA 4HVZA 3MAAB 1KLNA 2ZJRQ 1K7HA 3OLBA 1HWKA 3M8PA 1FD2A 1YDLA 4MKYA 4LFCF 2CQ1A 1VGYA 1FKAF 2HBZB 3NKOA 1ZS6A 5F3ZA 1JIHA 1NPKA 1RTJB 1WJ9A 3ILIA 1AW0A 2JEFA 4YEAA 3K89A 5KFEA 1H7WA 1HR0F 2N7CA 5T7LA 4FF2A 3IRXB 1TR0A 3QQCD 2D1GA 2HBYB 2FD2A 4CT8A 3CCSS 2PEBA 9RUBA 1CJUB 3TUJC 4RWXA 1S6PA 2ZH8A 3EWGA 4NA3A 2ZVSA 1Q8BA 2B4PA 1X0PA 4FF4A 3AOBA 1FRIA 3ENQA 2BJEA 3MM7A 4P6QA 4PYAA 3ZTPA 2MQOA 1HNZJ 4Q0BA 3PJWA 5C25A 1HNWF 1HWJA 2I1RA 3BKTA 3HZEA 3KK1B 3PX4A 2CJQA 2B4OA 3MDFA 4NEYA 2HZCA 2XSFA 2YKMB 1XMOF 1KH4A 3UD5A 3D6FB 1KDNA 3ONQA 2DO4A 2MLZA 2ZOMA 2QT7A 3D66A 3TZXA 1N34F 2QSFA 5A8KB 4C4WA 3BBFA 3J7YU 5HROB 3B4MA 4NEZA 4JI1F 4YOEA 2EFOA 1SIWB 4F2RA 3SZZA 3MM8A 5D4PA 4U9RA 4ZLJA 3D0IE 2QYGA 2AJ4A 2LU1A 4OYXA 2D9PA 3UPFA 1MMNA 3TX8A 5GVQA 5HMWA 2C2KB 2FJVA 3GPAA 4FZVA 5KFRA 4NLRA 1YKWA 1T9TA 4M5JA 4DDFA 3GV5B 1FJEB 5K4PA 1RBLA 2CZ4A 2ZUGA 4ID5A 1SIZA 2HHQA 2W5QA 2DK2A 5A6WA 2W8SA 5LRNA 2NUHA 1XIQA 2J9CA 2KI2A 2BEFA 3C14A 4X4TA 1JLBB 3W5YA 4IOCQ 5KOXA 4QYRA 1FCAA 4X65J 5I42A 4ED1A 1DAXA 3D0GE 4EWTA 2DHHA 2BW7A 2YKPA 3DLGB 3GSDA 1XR7A 2CYYA 4B3SF 1EB0A 1XQIA 2W4CA 5KG3A 2YNHB 4M5HA 1X4EA 2C2NA 4CLUA 2HHXA 4UOPA 4W98A 1S9GB 1RLDA 4KAVA 3DRXA 2FLNA 1AFIA 2E1AA 2R7RA 2RT3A 4UOHA 5IM0A 1QAXA 1NSPA 2X3DA 3DOLA 3BJYA 1I94J 2IFYA 5L0BA 1ZM2A 1CJVB 2XC9A 2L48A 3MWBA 2VG7A 3PYFA 4B02A 3DU5A 3V6JA 4DSFA 2I6WA 2HIQA 5HJXA 3FZBA 1PC4A 2DXFA 1JX4A 3IAS9 4QWEA 1S59A 1R89A 2C2OB 2DGTA 4LF4J 1WG4A 1QJHA 3POTB 4R25A 1KFDA 2C2EA 4EGLA 3AT1B 2R7QA 1RJJA 2ATCB 2BXJA 4RBTA 5HBMB 1TUWA 4LUBA 2EFPA 2IUCB 2BKOA 5DS7A 5KFYA 1IR1A 2PC6A 8AT1B 4O44A 5ITHA 5J2PA 2C22A 3W2VA 4P75A 2XULA 3TAMA 1RK8A 4I4BA 3HO1A 1YJNS 3L9ZA 1NB2A 4TU9A 4HHJA 4PQUB 5CCLA 3CWJA 1FRXA 3O8WA 5H9EJ 2OTLS 4DS4A 1HNIA 2O66A 1ZAWA 1PJ5A 3W2VB 1S49A 3BO4A 1C4AA 4ECZA 4B3RJ 2W01A 1HMVB 3KK2B 1FWPA 1WTBA 2A1BA 1RWPB 1RLCL 2CZ9A 1N5QA 3I5AA 5D0EA 4DV2F 1VHFA 4Y6IA 3K8WA 4PQUA 3KHHA 3SDEB 4DFKA 4HTIA 3QT5A 5A76A 4DR5J 3GIIA 2EXUA 2Q66A 5L46A 5KFKA 5I3UA 1FX2A 1P9YA 1UWBB 2LVWA 1HQEB 2XYHB 1DTQA 1ZPWX 2DHSA 1YJWS 4NXMJ 1U1KA 2XZDB 4ELVA 1SHNA 3PRVA 4ED3A 3JSYA 4IR1A 4C7QA 4QIWD 2P5VA 3LQVA 4E2FB 4CDIA 2V4RA 1X5TA 1FKPA 3DLGA 4PXBA 3ZZRA 4KGKA 1RTDA 1HL6A 4DQPA 2KFNA 1UWBA 4G1QA 2NYIA 4ZVRB 5J2MA 3KLGB 2HS3A 3IA0A 4LRCA 3SSQA 4LF5J 3TP2A 1K44A 2YKQA 4X4NA 4OHWA 3AD7C 5ETSA 3E2DA 1A7GE 3SYZA 2O67A 4JI3J 3MFIA 5DLTA 1X4HA 3L95X 4F0HA 1Q7LB 3D6MB 1E2SP 4WFXA 2W8LA 1WORA 1UA1A 3H5XA 2W7OA 3OVBA 1DFDA 4OX9F 3MEKA 3AB2B 5K8OA 2F7VA 1NK9A 1SBRA 1D9FA 1CEZA 1JXEA 5LT5A 4XPEA 1R0AB 4EZ9A 1HW8A 1VYAA 4IH7A 1VQNS 3GV7B 2HBRB 2W4PA 4LF7F 3WDOA 3C6TA 3H2UB 3K17A 2L08A 5KTQA 4ER8A 4PG5A 4EZ6A 2F8MA 4RUAA 2FC8A 2J7UA 1XMOJ 1FERA 2QMXA 4ZPCA 5KFFA 4CH1A 4C8YA 3ZTOA 3O1LA 2ZH5A 1X4FA 1T3OA 4KFBB 2DNNA 2HQIA 2RSQA 2GMHA 1OIAA 2KT5A 3SV4A 3KOAA 2R2RA 2C28A 4ZG9A 3IN5A 1YJTA 4ZCMA 2AEFA 2XNQA 3A8JA 1VQKS 2J8SA 4KH1B 2V63A 1J2VA 1HBNA 1SV5A 2V8PA 1XK8A 2I0XA 1Q5VA 3C15B 3ZZZA 4DX7A 3K59A 5LQQA 5J1EA 1E6VB 2DH7A 1G3OA 1LW2A 1U0HB 4CTAB 4CYUB 1IR2A 1RSCA 2ZBRA 4UOGA 3WC2A 1M5KC 1KKHA 2W2QP 2DR6A 3HX9A 1F9HA 2E5HA 2XTJP 4LF2A 1OPZA 4N56A 1EHWA 1HQUB 4OJHA 1GMUA 2YX7A 3N01A 4RNNA 1GX5A 2XMAA 4C8KA 3QJLA 1U2CA 1HYSA 3OFHA 3Q89A 5ETLA 3S8SA 1KQFB 3W7BA 4LRFA 3KJFB 3W9IA 1TK0A 1K0TA 3R7BB 1KQKA 5BR8F 3TI0A 3DLKB 1A6LA 3CCUS 1I5OB 2J6UA 3BBBA 4WXWA 1F2HA 2KHCA 2YNGA 5DDRC 3H98A 1Q5YA 5DDOC 4G1IA 1LQ9A 2ZH1A 3UN5A 2A6OA 4JV0A 2QEXS 1N88A 4GO7X 3ZZ0A 2AJ2A 3I0RB 1TMMA 2G9YA 1M5OC 1IBMJ 2EC0A 1M1HA 4D3HA 3R5DA 4ECXA 1FFGB 1SC1B 3N4WA 1Z2ZA 2F63A 1PILA 3IS9A 4PUOB 5FDLB 3HHLD 3K5NA 2YH1A 2BM0A 2HHHJ 4IR9A 1ED8A 2BBEA 3HDSA 1IBKJ 4DL0C 2GNKA 2LQ8A 5C66A 1RA6A 1WKJA 2FIUA 2IM3A 4URQU 5B09A 1V9OA 3EVWA 3A52A 4CZCA 1FVQA 4K5SA 3PEJA 2AP6A 5HVFA 2GJ2A 3GIKA 4LREA 2UVWA 1TKXA 3C3LA 4LF7J 2ZZMA 4ZLNA 4RLEA 3BQ2A 3D0HE 4OX6A 4R5PB 3NS5A 1M5VC 3PIPQ 3DLLQ 4B3TF 1SJ3P 4RUCA 4FXDA 3NKRA 3UN3A 1YRXA 2VPWB 1NMEB 3F0NA 2ASDA 3HSJA 4RZRA 3GYGA 2BRLA 3MCOA 1WC4A 4U96A 1J5EF 4J9VA 3H4BA 1X9MA 2FZGB 3DXBA 5KFNA 4ZIVA 2ZH9A 5IT9U 2W4DA 2A6MA 3CO9A 3KK1A 1AUKA 2W5WA 4K4UA 2PN6A 2Z2ZA 2HFZA 4N8OA 1OYEA 1O98A 5EGEA 2WW8A 4OJ3A 1EJ7L 2FPHX 1UVLA 3T41A 3RBEA 3MM5A 2C2RA 2OEJA 4OMFG 2CQ4A 3HVTB 4I6YA 2XHCA 2Y0SD 3BH6B 4MYTA 1XMBA 1NJZA 4LSLB 3US5A 3AOAA 2HW3A 4M5MA 3AD8C 4MKVA 3B78A 1D9DA 1T9VA 4FS2A 3OBIA 5B0BA 2CJBA 3X3UA 1IJEB 4HYKA 2LXIA 1EJJA 3H4DA 4K7QA 3BN4A 5CD4A 2V9KA 2E5LF 3VGUA 4JI2F 4LSLA 3NKNA 1LFPA 3QAEA 4Q44A 2R2SA 2F8EX 2ZHAA 1UMJA 2C42A 2ZM6F 2QGFB 2V2VA 2HLUA 4IFVB 1M1KT 5IOLA 2NQPA 3QLHA 3CULA 2M7SA 4GVBB 3TJ8A 2MKIA 3Q8QB 1J27A 3KUGA 2VQFF 5CAAA 4ZVQB 4YB7A 3CCES 4OYMA 3A3PB 3IBCB 1REVA 2G0CA 3UDLA 3VGVA 3CB4A 1RT4B 1DHMA 2YX4A 5ETRA 4KKOB 2LXFA 4NASA 4ZP8A 2RJZA 3ZNJ1 5AE3A 3HMJG 1DBDA 1FDDA 2BV3A 2YPYA 5EUHA 3PW4A 2XI2A 2CJXB 3DOMA 3LAMA 3MEEA 3NGRA 4NL5A 4HHHA 3GIJA 1CJVA 3EXYA 5KT4A 4JI3F 4YDDB 3N28A 5G0RB 3Q8RB 2JLFA 1S7HA 5AXKA 3LWLA 2KT2A 7FDRA 5L9XA 1U09A 2IMWP 5L39A 1S4FA 5EWGA 5DG7A 5DETA 2F4VJ 3QO9B 2PE8A 1L3KA 1X4DA 2F5GA 2IMOA 2FTRA 3FBCA 1VBYA 2UXBJ 4IUFA 3BDHA 2E29A 4CYRA 1R8BA 1HD0A 3P8BB 2FHJD 1JB0C 2MKJA 5L9NA 4H4OB 3WHIA 4PWDA 3NG8A 3KLHA 1VMBA 3KG4A 2WBMA 3F56A 3B5QA 2I5JA 2VA2A 2HVIA 3JSMA 1RB0A 3QO9A 2KJWA 2ZM6J 1DLOB 1ELOA 1W26A 2NLWA 2RIJA 2DIUA 2CIMA 3AA9A 3CJ0A 2H3EB 2A2CA 1U25A 2QA4S 1YI2S 2XQCA 5HROA 4DV0F 3QIPA 1M0SA 1GX6A 1R27B 2G0JA 1HBMB 1XR6A 1RU1A 1KLMA 3R5JB 1L3SA 2FHJA 4Q8EA 4NX9A 2VDHA 1W2IA 3PKYA 2KH9A 1SHQA 2D7SA 1RBOB 2XZTB 1CJTA 4OJGA 3NEKA 5CQGA 1NK5A 1K47A 2IRXA 2WZ1A 3LO3A 1NK4A 4ERDA 2QL9B 1FJCA 2MEWA 2W25A 3OXFA 1LWCB 1B7FA 1APSA 2GLQA 2HFNA 1UP1A 3KDOA 3MECA 3TVKA 2R7WA 2R9LA 2VPZB 3KLIA 4EO8A 1RKJA 3SDEA 4WZMA 4F3MA 4MJKA 3HVWA 4FXVA 2G9OA 2RDIA 3UO0A 4Q43A 3PM9A 1S0OA 3LGHA 2UU9J 4L75A 4YHHJ 3QRPA 3JYTB 5BJRA 3BKUA 3L7UA 3C46A 1WUUA 2DH8A 2FLLA 5KFOA 2FLPA 3CJKA 1U1QA 4CCHA 1GXUA 2AHOB 4C6AA 4QCLA 3RG6A 2JEGA 2VQEJ 4UY8T 2XGQA 4ZMMA 1NJWA 1NZAA 5THWA 3MUMP 5BR8J 1IVZA 2J9DA 2J7KA 3ZFVA 1FESA 2CPZA 4I2PA 3C14B 1KSPA 3VAIA 1JLQA 1SUQB 3RRGA 5E3CA 5J1PA 2MKSA 1ICEB 3LTOA 1L5UA 3ITHB 4JI8J 3W5ZA 1X5SA 3CVKA 4OYWA 2ZKUA 1VQ6S 2MQLA 2MJNA 3LP0B 3QGGA 3HM9A 4Q2LA 4ETXA 4A4JA 4DX6A 1G1XA 2KRBA 3R6GB 1TKZB 1VQSA 4QPXA 1LXJA 2C2DA 2WB1D 3JAMU 1QSSA 1EQMA 2XNRA 1WI8A 3DYAA 3MPUB 5EGYA 1XR5A 4PCQA 4USVA 5B0FA 4P7TA 2D3UA 4RW4A 2DO0A 3TRGA 3WIUA 5F3TA 2G13A 5H1SV 1B0TA 1N54B 3VHQA 5MLCV 1N48A 4F0MA 2X51A 1S0MA 1EW9A 3DPCA 3GE9A 3I96A 4PG7A 4CLLA 4IDKA 1XNRF 1FA0A 3LGMA 4RJVA 2ZNZA 5CCMA 2V8DA 3JB9k 1LWXA 4WPAA 4OYAA 4KSEB 1FNXH 2MDAA 5BYSA 4FKXA 1IBMF 3VGSA 4W92B 5D6GA 3P49B 4ZVPB 6FDRA 3QIPB 5K5MA 4X66F 1HBMA 3KXDA 2AJ1A 2WVDA 4C8MA 2K7JA 1N36F 3G86A 4PABA 3NS7B 3SXLA 4DV4J 1RBAA 4LR2A 1JXVA 4IFYA 4TLQA 1H98A 3Q8PB 1H2TZ 5ETQA 2GX8A 4ZG7A 5H9FK 2LQ5A 2Y1IA 1LW2B 4CTAA 1RT1A 3B4DA 3CDEA 3GIRA 4CYUA 4MHXA 1MROB 2VF3A 3VZHA 4F4KA 3S7RA 1QTMA 2CNNB 1VRTB 5A2QY 3IGYB 4I69A 2MQPA 1BY9A 3J80Y 3FMWA 3I87A 1UAWA 2GO8A 4ZVSB 4LQ3A 3QFWA 2W9BA 4MIBA 2DNLA 3A8EA 1S1UA 2HK2A 5LM7E 2ZH7A 1SQEA 2HNZB 4HL9A 2QTWA 2DIVA 2WK4A 3C8YA 3LANA 1U1OA 4MIWA 1F1BB 4C3KA 2K1RB 3HHNB 1FF2A 4QU6A 3O44A 1KQGB 3AH6A 4IO1A 1DRZA 4OV6A 1ZAVA 4OYOA 5EX0A 4AT1B 1IXKA 1DJ0A 1YBAA 3GYNA 3HFZB 3FJ2A 4KTQA 1PBAA 2VJUA 2Y8WA 2V68A 3I4HX 2AJFE 3GTYX 2UUCF 4DV4F 1T9YA 1SUQA 4Q2MA 1TK8A 1S7IA 3IG1A 3CD0A 1S9EB 8ATCB 3N6LA 4NYOA 3UCZP 4QQBA 2YNFB 3LUYA 4X4UA 2MSSA 3H2VE 3Q2SC 4H4KC 2W5RA 4ED0A 2QLBB 2YNHA 2HKEA 2PDAA 4RW7A 2VG7B 2QA4G 1AT1B 3HI9A 2Z2LA 2ZDPA 4MT1A 1RI7A 4KC5A 3UR0A 5JVGQ 2D69A 2V4JB 3GFYA 1X9SA 1GMWA 1AJAA 1WSRA 4C3LA 2MMYA 1RTIB 2CA9A 2MTLA 2IVFB 5AJ3J 2MKHA 4Y2MA 4Y34A 4PKDB 3J81U 5MAOA 3J7ZT 2OJ3A 3SIPB 4EBEA 3NWRA 4IOBA 5E5NA 1QD1A 1VR6A 5F8LA 3SV3A 2CQHA 2FJXA 2ZE2B 2LLZA 3QJPA 1XMQF 1U2RA 2OKQA 3P4UB 4NI2A 1JLGA 1QAJA 4S0MA 2ZWOA 1PBUA 1KOOA 2IRUA 2RKIA 3O2IA 5IT4A 3OW2R 4H4MA 2F9DA 3ISND 4X62J 3R5GA 5GRRA 4N7TA 3HKWA 1OSDA 1LEOA 2XSJA 1WD6A 3HHEA 4U8YA 4KJDA 3ETMA 1V5IB 1HWUA 1SJQA 5HQ8A 1KEKA 1D9AA 5EWEA 2VKZG 3BREA 3CCRS 2UUAF 4IFYB 3C16A 2K2PA 3RB6A 2W2PP 3ET6B 3CC7S 2R7SA 5EWFA 1VQ9S 1JLFA 2RNEA 4O4RA 4OQJA 4ES3A 5AE1A 2AYGA 2CVIA 2JHEA 4YQWA 1RT1B 1NK6A 3A12A 3HLUA 1ZM3A 4ZPAA 2ROGA 2DNGA 1UEKA 1EKSA 1JK9B 4K59A 3R1LA 3LPEA 4ECSA 3T6BA 1KS2A 1JKHA 1MU2A 3S1TA 2XB2D 3ET6A 4DX8H 1F3FA 1LWFB 3AA8A 5C2CA 2QX0A 3AXMA 4WFYA 3PTWA 4L74A 4Q5VA 1HMVA 3VAMA 4OYIA 4Q7AA 3D3CJ 4YR2A 3DLKA 1UPPA 2BA9A 1HNXF 2AZ3A 3C66A 4C97A 2CPFA 3TG0A 1JKHB 1MU2B 2XMKA 3I4PA 4NZ7A 3VF0B 1B70B 4FPRA 3QGHA 3BPSP 5E7OB 3FVYA 2BVZA 1S9FA 1C1CB 3B82A 4F4WA 1QE1A 1U1NA 1VQOS 1SJ4P 2BKPA 3GP9A 1WEZA 1ANIA 1HQEA 4OX8A 4RBVA 1NCLA 3QSYB 3W2WA 1LV5A 2WHOA 2F40A 3CJ2A 5J2QA 3THVA 2IJRA 1Q53A 3LPYA 2E9ZA 4F3QA 2FLOA 5F8NA 3DKDA 3FSIA 4Q45A 5KT3A 4DV6J 1RWMB 4USJC 2EK6A 2W2NP 4NRTA 2ALZA 2YQ1A 4XIUA 4ZVTB 2KM8B 3E01B 4DPWA 3TNVA 3KLHB 5HAOA 4HACA 1VC6A 2MY7A 3PO4A 5CYQA 1BQNB 1KC8T 4KHRA 4JUZA 2DNHA 3T00A 3Q8VA 4DR7J 2UVVA 2G1HA 3U1NA 1UZDA 1BC6A 4TN0A 2B9WA 2ZH6A 2ZUAA 4LBIA 3VVUA 1R0CB 3AJDA 3DMJA 2NXUA 2PD1A 2X1FA 2DNYA 5F8GA 3DOKA 2B5JA 4RNHA 4DUYJ 2HQCA 4K4VA 1ITPA 1FJ7A 3SZYA 3RRHA 5FD1A 1C0TB 5L1IA 4CO1A 4OI2A 5T14A 4O3QA 3OTDA 1W25A 5H9EK 4LFBJ 1WELA 2ALYB 2OPSB 2ZJQQ 4WP3A 5KG4A 1FK9A 1KH7A 1RAJA 3PNIA 2EC2A 3KJVB 1T9WA 2RU3A 1YIJS 4RUBA 3Q3QA 1YSJA 2BQ3A 1QTNB 3AJ2A 5HI7A 1KWMA 1FTCA 3ILJA 2IPOB 4Y65A 4CO3A 4MYUA 4DV6F 1S77D 4KM4A 3TZYA 1PG5B 3FEXB 3T1AA 3M6XA 1GH8A 1RHRB 2DNZA 2WAQD 3MEDA 4MKBA 5L1LA 1HI0P 3T01A 4EI2A 5K9FA 4ICLB 3IP0A 4L72B 1HBUB 2B4UA 2ZBQA 5EDWA 2KZMA 2NCKL 3BN7A 1J5EJ 3OHBA 1F6TA 2MPUA 4DV7F 1HBOB 2P9GA 1U0HA 2FYXA 3R1HA 1NPPA 4OI3A 1TL7B 2IIHA 1PGZA 4NXNJ 2OH2A 1JLAA 4UW2A 5LSOA 5E33A 3LP2B 2XR9A 2VASA 2XMTA 3VWSA 3CCVS 1HBUA 2LQ9A 4DU8A 2PSZA 2OPRA 4JI4F 2BABA 4OHZA 4ED5A 2X1AA 1TP7A 4DSJA 2ZHOA 3M2VB 2HGLA 3MR3A 2LXUA 2WB4A 3H42A 2WSCC 2VZ9A 2KKHA 2QL5B 2EVZA 3V6HA 1RTJA 3LH2S 4QR2A 3NNCA 4RUHA 1NJYA 3BB5A 3O6QA 3PXGa 3JSRA 1RE1B 2DGSA 2YKNB 4F26A 2D41A 5CYMA 2R7XA 4H4OA 3EMTA 1KOHA 2CQ0A 4LJMA 4P71A 4C0BA 2ZNYA 4K0KF 3LWMA 1UPMB 4ZVUB 3ADAC 3NAIA 4IDKB 3GG1A 3RYLA 3EDRB 1JJ4A 3CJ3A 4RBUA 1DLOA 4ED6A 1ZTTA 2XS2A 4WKRA 3GWCA 3M8YA 3N79A 1IBLF 1GQEA 2B9XA 2CQIA 2HNDB 1PIEA 1WACA 3H59A 3HVRA 3RU0A 2VQFJ 3KHGA 2A0FB 1IM4A 4IRCA 3D3BJ 4QIEA 2DR7A 2HNYB 1KVIA 1I1GA 2Q6CA 3DMJB 3M2RA 1FFWB 4FN5A 3OVAA 1C0UA 4I68A 1FRKA 3RB4A 4NYPA 1N34J 2JX2A 2DGUA 4ID8A 2HGMA 1AXQA 1HNVB 3H20A 5DM6Q 1FEHA 3BDEA 2DEIA 2BDPA 3WQPA 2ZOFA 1R3NA 3I9ZA 1RABB 1CULB 5D78A 2KL8A 5E3PA 4DPOA 3F73A 5LSLA 2UVRA 1E33P 2ILYA 3NBPA 1WNEA 2XBPA 3KG1A 3KLIB 4LBHA 3FBEA 3ISNC 2QFIA 3PFEA 1L3UA 1KONA 1KTQA 4OI0A 1RACB 2LU2A 2JEJA 3ZZPA 4GKJF 2VQRA 2UXCJ 4C0HA 4WP8A 4X62F 2KO1A 3MM5B 1UW9A 3OD2A 2R8HA 3PHEA 3OL6A 3HP6A 4FYWB 1Y0HA 3MR6A 2RQMA 1VRQC 2Q79A 3GU0A 3CGIA 3HJVA 1RT7A 1LXNA 3NY0A 1H0HB 1AJCA 1YJ9S 4TY8B 2GS8A 1LK5A 3TJAA 1TUVA 3IR7B 1WKLA 2QZ8A 4IO9Q 1EIYB 1RT5A 4NLVA 3TEGA 3N5BA 4ZVFA 2B6AB 5D0GA 3UE2A 4IRKA 4LF9J 2E1CA 1N5TA 1U47A 2K06A 5IWAJ 3RTVA 1KHVA 1WDDA 1KBRA 2DB1A 2MKCA 2QO3A 4DCOB 5KG5A 3K57A 1EQJA 3QT7A 4TYBA 3T1HJ 5HRTA 2C3UA 4GC7A 4WE1A 2OPQB 2BACA 1LOUA 4KKOA 2N4CA 4DXLA 2HHUA 3QAUA 1GFWB 3MCNA 3R9LA 1X4BA 2EFQA 3HHLA 1UFWA 2DKOB 4ZHRB 1VLYA 2QN6B 2HBQB 4NMLA 2HQFA 3R5AA 4UZBA 3CC4S 1K1SA 4ED2A 4F2SA 3KNAA 4IOAQ 4E98A 1EW8A 4QAXA 4FNIA 3R27A 2NZCA 2GHPA 5KFSA 3KDNA 1DARA 4Y0FA 1FWLA 2FDNA 1DQ9A 5B08A 3EPGA 2KG0A 1ALHA 2SXLA 1IKYB 5KFVA 4NMXA 1Z2LA 1TELA 1IQZA 1T05A 3UDEA 1EW2A 3HHLB 4ZHRA 4CLKA 2DGXA 1NEEA 1ZEFA 2J76E 2B56A 2JC0A 3IO1A 3IRXA 1QAIA 2VODA 5KFDA 4O3OA 4Q0BB 1RAFB 3GCXP 4R8UB 2RDJA 2APOA 2IHR1 3PW2A 1Y4ZB 4TN2A 3IR6B 1QM9A 4U8VA 4BWMA 1DTTA 4B3MJ 4KT0C 2QZUA 1TVRA 1ANJA 3WBHA 2RDDA 4A47A 1S0NA 4B3RF 1HKAA 1OMSA 2HSEB 1OQ6A 3QPIA 5K8MA 1CG2A 2Y0BB 4USUA 2MKKA 3CJ4A 3JTNA 2WTFA 4ZG6A 1IKVB 1DURA 1OJ4A 4ZVHA 1NPRA 5I3UB 4DR3J 3V4MA 3W61A 4CI0B 4L3KA 1FJGJ 1S57A 2J9EA 4CH7A 1Y5NB 1YK9A 3NAHA 5HP1A 1XN9A 2LDYA 3BPDA 4ZJQA 4NLGA 3NKYA 4NZ6A 4KJIA 2QL7B 1S6UA 4PG6A 5LXYA 4DUZF 5B7WA 4FDFA 2PO4A 2OLWA 5IS2A 4NE9C 2RH3A 2NXNA 2OMLA 2J6TA 3IFEA 3M1VA 1F9EB 2GHVC 2VFRA 3DRRB 4L73A 6FD1A 4CRJA 2NR0A 3WAVA 1SC4B 2UV8G 2XMJA 3QT8A 4KGMA 1GK8A 4WIIA 1HI1A 3NGDA 3RW6A 1RHQB 4M5NA 2XG8A 2XHWA 4EMDA 5KT6A 4J9QA 4K4YA 1RAAB 4P10A 4B9LA 2KXFA 5GMDA 3O3LA 4L76A 1G7CB 3TQ1A 2DPJA 2MB0B 4JI6J 1S0VA 1Y11A 4JB8B 2N3LA 4RW7B 5GAGU 1B4SA 1WHWA 4WIQA 3CJKB 2F3JA 4LR9A 4AL5A 2AW0A 3M8SA 1OWXA 1Q1KA 2BYCA 4DV1F 4UUWA 1S9EA 2K8GA 1S6QB 4QWAA 3MK1A 3DOLB 1RTIA 2YWFA 4DL2A 1O5JA 4DBQA 4DN9A 4F36A 2O3DA 5M2PA 4DR2J 4G3IA 2CQ2A 3FZ2A 3MEGA 4OZNA 1U1MA 2XYGB 4LQ9A 4A46A 1NHUA 1Z1ZA 1N5YB 1M1GA 1S1WA 1ZZNA 1T94A 4U7UK 2J6SA 4Q8FA 2V2QA 3KUEA 4J9MA 2OD6A 2DITA 4OYBA 1QUPA 2CQCA 3MMJA 1T0TV 4KRWA 1I51B 3SSSA 1QVFR 3OR2A 3HFKA 3LP1B 4ZN3A 3LXQA 4KE5A 3ILLA 4PXDA 2EG2A 2CPHA 3TAPA 2WCXA 2N3OA 3D1OA 3AXKA 2NYHA 4JV1A 2MXYA 4NRUA 2XMWA 5HANA 1ACMB 2BE2A 2CFXA 3S6EA 1S12A 4U67Q 3MURP 3EPIA 4F4ZA 4NLPA 3MUTP 4ECUA 3IGVA 5KG7A 2O01C 3MTKA 2YWKA 2ROPA 1F3VA 2RQCA 4B9UA 2ZZNA 1IKXB 1VC0A 3DDKA 2DXEA 4ZLPA 1KH5A 3V6DB 4NLDA 2E5IA 3TR5A 1ZYQA 2JVRA 3P6YC 2KXHA 5A8KA 1KFSA 4OZLA 5DM7Q 4YP3A 2CWKA 2DEJA 5KFMA 2O1PA 2PT0A 3FKBA 3LOUA 4NLQA 1KRPA 1MSWD 3L3CA 1OY9A 1CQNA 2CUYA 5LSRA 2W2MP 3SQGA 1WHVA 4ECWA 2M88A 3RJMB 2EFVA 3T1YJ 1YJRA 2DHGA 1HNIB 4K2XA 5L8RC 1UVIA 1IM6A 2V8VA 1SQGA 1Y7PA 3RBXA 5BXIA 1I6JA 1FRJA 2JFDA 3IDDA 2E7WA 3L7PA 1AB8A 2DY1A 3D1QA 3GZ7A 3VQSA 3W63A 2BJ7A 3AD9C 1U8SA 2PEHA 1VQMS 3PJ9A 5GAHU 2JZ5A 1MMDA 2OPRB 1FRLA 1P8GA 1WSVA 2VC1A 3JTOA 4UT4A 1ZEDA 1KH9A 1EETB 1JJ2R 1IKWA 3CCZA 3FSYA 1RHUB 2BZ2A 3CTRA 3M8ZA 4Y2CA 4J7CA 3W9JA 1RZMA 3E01A 5JMNA 5RUBA 4EYIB 3T5LA 4M5KA 2ZWPA 3RRKA 1H3DA 2R8KA 1VJWA 4W90B 2JH3A 3QRQA 2UUAJ 2KHDA 3H7HB 3ENWA 4F02A 4PXEA 4BDPA 2QLJB 1N0VC 3EVMA 4M5DA 4AQYJ 5A8WB 1PSDA 1D0EA 5GAGI 1NKEA 3ED4A 2C2MB 3DM2B 2LQBA 3Q83A 3MEGB 2DGVA 2PMWA 1GNKA 2EI5A 2FHKA 3IG1B 2YKAA 3NS6A 1VFJA 4J9NA 3R8YA 4P2XA 7FD1A 2E1PA 2HS0A 2NS1B 3M7VA 1F5CA 4KV8B 4ZIWA 3LP1A 2CVEA 5CYQB 5ETNA 2X98A 1SKUB 4DG1B 2Z8QA 3GCWP 4ZPTR 2G2OA 5D77A 2JNJA 2NPFA 1OQ3A 2KM8C 3M6UA 1NRKA 4K50A 2RS8A 4UPIA 1M5PC 1RT6B 3TAMB 2GVDB 5L1KA 4A8QA 4LF6J 5U47A 2B5JB 4FP9A 1Q78A 1PYSB 2CPEA 2JOQA 3J7Z5 2HURA 4DG1A 3OV7A 5AE2A 3J7A1 4NI2B 4ILLA 1UETA 2QG9B 4NWXA 2WVBA 4NCAA 2VOOA 2B9YA 3UWTA 4FXWA 3PYDA 4X4RA 1MMLA 5JVHQ 3IWNC 1AJDA 3KYLA 4UF4A 4P2MA 2BJ3A 1I3OB 3ZC4A 2X1BA 5F8MA 2XM3A 1XWLA 4KGVB 3GLJA 5KAKA 2R2UA 2D1CA 2BOAA 2IY5B 4WFBQ 2NUUG 5LMNF 2N82B 2ASLA 3CCJS 3SFUA 3U1MA 1R8PA 4Y2IA 3TANA 2LCWA 1FVSA 1URNA 2ZBIA 4XDDA 1LWFA 1RP5A 1R8HA 4I6AA 3RW7A 2LA4A 2LEBA 2XLJA 4ELUA 3HT0A 3JTPA 1RT4A 2H4WB 2DNOA 2VFTA 5JXSA 5HMYA 3HHLC 2DGOA 3M8QA 2XRGA 1NJIT 3M2UB 3N5FA 6AT1B 2V9WA 1TFYA 3I5CA 3J7AN 4OJ1A 2P2CB 2QLXA 2XMUA 2GVZB 3DRYA 5HMXA 4ZLLA 5DQHA 3M8PB 1UJ5A 5CD4H 2E9RX 1X5OA 3MM9B 4X4OA 1ROFA 3KLEA 4M1KA 4OZ1A 4JI0F 2FVPA 4DV1J 4CQ1A 4O3RA 3MK2A 1ULRA 3DLBA 2F4VF 3THPA 2PIIA 1VRUB 2HYIB 2YQ3A 3IBWA 3RUBL 1AUDA 1ED9A 4DN0A 5LRMA 1X9WA 2IM1A 1JQGA 3C6UB 3D2WA 2ZHBA 1SC3B 2LKZA 2C1EB 2R4FA 3DDIA 3ZZTA 3T5JA 3CD6S 1IUJA 1DZ5A 2M0GB 2HFSA 4DWIA 2B43A 3OUYA 4CP5A 4X65F 4YMEA 3M9OB 5DGAA 1GXTA 3J80U 4RL1A 2PGCA 2DISA 2AZ1A 2OP5A 1TL1A 3C6TB 2O5DA 1QDUB 1HNXJ 4YFUA 1YRTA 5A0YB 3O5TB 3NNHA 1OO0B 1YX2A 2H9ZA 4J91A 4TLRA 3BEGB 2OFGX 4H54A 5ETMA 4USMA 2PFDA 3HCXA 2FVRA 1U26A 2HFUA 2XO7A 4W4MA 4CNZA 4EUVA 4ECRA 1D1UA 2HRYA 1VQPS 1RTZA 3ZZYA 3CCLS 1Q95G 3EUNA 3NMAA 4GKJJ 1UVNA 1EX8A 3KFWX 4ES1A 1QAYA 1NH7A 1N2LA 1NLKL 1VDHA 2NXCA 4QYZJ 2D3ZA 2BANA 3P45B 3OR1B 3EGNA 3IR5B 5LL6d 2I2YA 2KTQA 3CMRA 2CQPA 4C2MA 1X8DA 1TTHB 5IC4B 1BWVA 2DBBA 4X4QA 4A8MP 3G82B 2A3JA 4YB6A 4DF8A 2GZOA 2ZEJA 2KZZA 4YY3J 2RQ4A 2GQCA 2E1MC 1LFWA 2IDLA 2ABYA 1TZ0A 2FGCA 4NOHA 5DZ7A 3R97A 1R7IA 3G6YA 2DCUB 2GW8A 3J81j 2Z2MA 1TV6B 3BR8A 2RUGA 3DYAB 1BQMB 1HI8A 3FEYB 3UR3C 2L9NA 1WDTA 4NXNF 1HBOA 1PJ6A 1B3TA 3CCMS 1FNMA 1SH2A 1FT8A 1Y9OA 2WONA 2OTJS 5K20B 4ALZA 4PEOA 3QZ8A 3P96A 4WKYA 3V6DA 1PJ7A 4XTTA 2R8IA 3ICLA 1G2EA 2QC3A 4YS2A 3AY0A 5E2QA 2BW2A 1U6BA 1ZH5A 1CLFA 2AIRB 3K0JA 3MPVA 3GJTB 1JMTA 1UJ6A 4OI6A 2GA7A 2MZRA 2JLEA 4GTZA 5IJSA 2RS2A 3HK2A 2GMJA 3HVAA 4PZVA 1NBEB 1UEVA 5HLFB 1B64A 2RRAA 3BYPA 3PACA 1F9FA 2GQQA 2W8DA 3OFFA 4P72A 3QMQA 1V5VA 3D6HB 4FDJA 5C7PA 3M9MB 1WHXA 4I0WA 5E3AA 4ZCIA 5C24A 1V3RA 1PYOB 2GIQA 2M4MA 2ZD1A 4ZCKA 5F9LA 2ILZA 3SFGA 4U95A 2V69A 5ADZA 3GJRB 3MR2A 4X64J 4B9MA 1FI4A 1TMJA 1TAUA 2WSFC 3BGRA 2JL9A 2ROEA 1RYSA 4B08A 5DJBA 5KFXA 1CJTB 2FJWA 2VG6B 2ZZTA 3HD1A 1WC0A 1HNVA 4EU0A 1NB7A 3P5TL 4A8FA 1FXRA 2HLTA 2YPZA 5EX3A 1O99A 3M2RB 2HAIA 3M1VB 3HVTA 3ELHA 3N0VA 3SZ2A 3MXHP 4DR4J 1WF2A 4J9SA 3M9NB 3HKZD 3T3FA 2AGPA 2MYFA 1HJKA 3I5BA 4QWDA 4DV5J 3BV8A 2G2YA 2Q3PA 1PKUA 4OZ3A 1OY8A 2K1RA 2R7TA 3TEHB 3DGPA 1EAYC 4OYZA 4USKA 2NZ4A 4RU2A 4DMZA 2KVIA 4I7FB 3QT6A 5KG2A 4J9PA 1AUSL 3CEDA 5IXUA 3RAQA 3KK3B 2IJFA 1YJUA 4DPTA 4DFJA 1JNZB 1A0OB 3W1YC 4M94A 5L1JA 1XBWA 2L3MA 5KOWA 3PZPA 3MI7X 3W8PA 3V4IB 3DLEB 2Q6BA 5A6PA 4LF8J 1RWKB 2VB6A 4KIAA 2BJ9A 2IFXA 4QIGA 1F5AA 5BYRA 3V81A 1C1BA 1U02A 2C3OA 1UW4A 4OFZA 2ERRA 4J9LA 3DI6A 2ZVIA 2HWHA 4K4WA 2OFHX 1YBTA 4EBDA 4DQQA 3PKMA 3HHKA 1MWYA 4TY9A 3OTOF 3SEOA 5D4LA 2CJYB 4DR3F 3SCLE 4C8LA 3BDGA 3PG9A 4DR4F 4GKKJ 3M6VA 2LQJA 4MY4A 2QLWA 4Y00A 3I0SB 3EZOA 4K4TA 2FJBB 1N4LA 4LR8A 2J5AA 2FGOA 4OZJA 1SJFA 4OX9J 3ENVA 3LP0A 1UZHA 3BQ1A 3NVLA 2GAGC 2U1AA 3MPYA 4DUZJ 4LVNP 3OTBA 4KYZA 3FBBA 3Q8UA 4H4MB 4WZQA 3V6KA 4UQTA 3AFGA 4P7VA 4E8UA 3PR4A 2VKRA 3EXCX 4LRAA 4JI7J 2FZCB 4G65A 3W8GA 4DEZA 1MLAA 4N76A 4FNHA 2BJDA 4NA2A 4ZJLA 4UOOA 4LIRA 4USHA 2IVYA 5HK4A 3ZTSA 1HNZF 2WW4A 2RKIB 3T9ZA 1JLEB 2DHAA 1JLFB 1FD8A 1Q7YT 4EK2A 1UWAA 1RAHB 5AT1B 1HPZB 3PJXA 2XCPA 2UP1A 5HBMA 4ECTA 2IBKA 2CPXA 1N32F 5ETTA 3Q22A 5KFCA 4BC9A 2OEMA 4MK7A 4O4GA 3OSNA 5EN1A 5F8JA 2UUBF 4GTWA 3ZTRA 2VBXA 1JLEA 1S79A 1RT3A 3LGNA 3CUNA 1NJXA 3BDPA 3ZXWA 5LIAA 4LFCJ 3MECB 4J9KA 1DQ8A 2MLYA 2DRAA 2VD3A 3A4TA 4QJVA 1NZ8A 1FO1A 2A18A 1KQSR 2ZC3A 4ID5B 4NCGB 4EO6A 3TA0A 3UN2A 5I4MA 2XWYA 3Q0AA 2DXDA 2ZITA 4P9SA 2QV6A 5CZXA 4DL7A 3SI8A 3M8QB 1Q8LA 3IM9A 3DGPB 4KY3A 1GAOA 2VFVA 3D54A 1KP6A 1RISA 2FY1A 4B3SJ 4KH0B 1T95A 1VISA 3AQPA 1PC5A 2G2ZA 1U1LA 3HSDA 1I94F 2UXDF 2B9EA 1RWWB 3ILOA 3W65A 3Q8SB 4PUOA 2LDIA 2AV5A 3DRRA 3W2WB 5KFZA 4DCJB 1EI6A 4AD6A 2Y3YA 2V0NA 4OI4A 3MPWA 2IM0A 3KMQA 2OSQA 4O23A 5F0WA 3SBMA 4AL7A 3CMES 4FYDA 3WAYA 4TQRA 1Y7AA 3CJTA 2AX0A 4LF4F 1T3NA 3VQTA 2G1DA 1YVFA 5KT5A 2C3MA 4RW8B 1ZA2B 1XC9A 4B3OA 3TA2A 3D68A 1SQFA 2M70A 5KFLA 1FKOB 3J7YI 3MFHA 2FZKB 4ZCLA 5D8HB 1BQXA 2M8HA 2YNFA 2L9WA 4ED8A 1CPZA 2VU5A 1K1QA 4RW9A 3UDVA 1E6YB 3MMAB 2GQ2A 3H5UA 4DSKA 3NGKA 4PPZA 5M2UA 4HTJA 3G6VA 4F50A 4QU7A 5B0CA 3DU6A 1HWLA 3T5KA 5CZVA 5HO4A 3WIVA 3T1HF 3NCQA 1MG7A 4P2FA 2HHSA 4FYVB 4I64A 1WTFA 4NWJA 3PX0A 2JSXA 3FRYA 3L09A 3RAXA 1TFWA 1S10A 3IM8A 4DL4A 4F8RA 1XEZA 3R5CA 2XSJB 4DV3F 1FEEA 4QIFA 4UOCA 2UVUA 2WVCA 1BE4A 4I56A 4DHVA 3K5LA 2XYPB 1JLGB 5E0OA 4O3NA 2XLKA 2RD5C 4YN3B 1EARA 1TL3A 4BC7A 3T9NA 4DV5F 2RAQA 4GRSA 1KR4A 1U0SA 3K7RA 3OT9A 3PYEA 4KO0B 3KK2A 4UPLA 1ZETA 1OS5A 2B0GA 5IT9Y 2H65B 4NLYA 1O6XA 4B17A 1F0XA 4NXMF 1EP4B 3C16B 4OHVA 2GO9A 3UI3A 3QLHB 4RNFA 4DV7J 3SMZA 1P6TA 2GAHC 2GIRA 3OJUA 2BE7D 2BQUA 1T8EA 1HR0J 4WJBA 4JV2A 4JI5F 3DRSA 4NCGA 3DN9A 2VPXB 2EPIA 1BUXA 2N4DA 2QE5A 4WFAQ 4DCPB 3T5HA 1KHLA 2U2FA 3KLEB 4I1TA 4LRBA 3I9V9 1AZSA 2VG5A 2DNQA 2L9DA 1JNRB 2NREA 2RF2A 3OSPA 2W9CA 3FC9A 3NXZA 1LNQA 1XMQJ 1HIYA 1SL1A 2DRBA 3QYYA 4KHMA 4PG4A 4CLTA 3MAAA 1ZEBA 4JI4J 1LWEA 4HI2A 1C1CA 2ZH3A 3UNGC 3UW1A 3GIMA 3TW0A 5DDPC 1VQLS 2GSUA 2RRNA 1RKIA 2QYCA 4V1Ak 5DZ6A 1RA7A 5B0AA 3SCIE 5HVHA 3NMRA 3LA0A 4K4ZA 2I9SA 3L4BC 4X84A 3CCQS 3HJFA 2OMOA 3M2UA 2NSBA 3GB0A 4DQSA 1PCAA 3VV2B 4WYWA 2KJVA 2HGNA 2CG4A 2GGPA 4K0KJ 4F25A 2DYAA 3PEHA 3DM2A 3KKFA 5FDLA 4QW9A 3DOKB 2JC1A 1N56A 3QWUA 5HATA 1U24A 2WRMA 3D6TB 5F8HA 2PMHA 3OLAA 3OUYB 4B3OB 4GTXA 1ALJA 1YG0A 2HNDA 3MAHA 2ANHA 5C42B 3R2CJ 2HHPA 2M52A 3VGTA 4C9DA 1N6QB 3N6NA 5KG1A 4LBPA 3MF5A 1ALIA 2M5YA 3R2DJ 2P6SA 2Z0GA 2DY9A 2FY8A 2P6TA 2HZVA 3MM6A 4DL3A 5C5JA 2W8KA 2F9JA 2YNIA 3D9BA 3FCHA 3HF5A 3JSBA 4TKTA 3W60A 4ILMA 3MAQA 1N5SA 1SPBP 4M63A 1Q86T 3E2EA 1NAQA 2OPPA 3BH7B 1PAUB 3FGVA 4DX5A 3HFVA 3OL8A 2GVDA 5GADI 3TUPA 4DJBA 1RWUA 5A0YA 3IC1A 1XNQF 1UCNA 2DNMA 4PAAA 4A48A 4DR1F 4C8OA 4ZOSA 4CLWA 1RAGB 2AMCB 2ZDOA 2V4QA 3LAKA 1RT7B 1O51A 2P9CA 1T9XA 3G82A 4URGA 3CCTA 1OSCA 3IRWP 2IAJB 4XK8C 5IQQA 2BKNA 3HHDA 4FKYA 3TA1A 4ZA1A 2R7UA 4A8OA 5AXLA 4I7FA 2MSTA 1YZ6A 3IMQJ 2G4BA 2FHMA 1KHKA 1HYSB 5GOVA 2Y9HA 4M5GA 5IFMA 1H7XA 3P3DA 4DPXA 1UFKA 1O8BA 1RAOA 1RWNB 2A10A 2GHWA 2Y1JA 3OR1A 1CVJA 4G6VB 4X66J 2OD4A 3G4SS 3EZ5A 4NA1A 1QSLA 3NKQA 4TU7A 5GAEI 1O0PA 2EFGA 2HS4A 1TV6A 5M2RA 1RCXB 5GAHI 5IM0B 2MZTA 4F0KA 3VR1A 4V19X 3QRRA 3ZTQA 3MCSA 2MZQA 1FE0A 1HA1A 2RH6A 1U45A 1NSKL 3RR7A 3BGUA 4AYBD 3OL7A 2Q43A 3QIDA 2AX1A 3MOZA 4MTPA 3CXCR 1NKBA 1Q82T 2IBOA 2VFSA 3SSRA 4XO0A 1T05B 1SH3A 4O3SA 4PR6A 3TX0A 5IWAF 3H25A 4NCBA 1J5OA 5HN0A 5AXMA 3NL0A 2VOPA 4I2QB 2ZFHA 1VRUA 3GG0A 4MK8A 3MPDA 4TNOA 1C2PA 4CM0A 5C24B 2F1FA 2XY7A 1Q8KA 1MN7A 2B7BB 1YJVA 3DRPA 4V19J 5IZHA 1QLNA 2CDRB 3FFIB 3CDAA 3H0PA 3D7SB 2E5JA 2UZAA 5LMNJ 3BGRB 3BSAA 4BHQA 4FVCA 1X5PA 2JVOA 3GSIA 1NSQA 2Z57B 3NOGA 4OZ0A 2VPYB 1Y3KA 4QR0A 3ETOA 1GMWD 4C3MA 5IJQA 3BGLA 2HNYA 5KT2A 1RDRA 4CO2A 1XNRJ 2I5JB 2OUGA 1U2FA 3BR9A 3PHTA 1DTTB 3QSIA 2RB7A 4O0NA 5LMUF 3H5YA 3GQCA 4HR2A 1VBZA 5D4OA 4LF5F 2HHTA 3K5MA 1FFSB 3CO0P 1UFLA 4GMKA 2M2BA 3CNQP 5ETOA 1NSAA 2B4VA 3W66A 4LFAF 1T03A 4TU8A 3BQ0A 2XGPA 3LW5C 3JYTA 1KLMB 1S76D 1S6OA 2VBWA 1HDHA 1IBKF 4R0JA 4FYYB 1OPIA 2OELA 2ZH2A 1NXIA 2LP4A 4IQMA 2CPYA 3M4XA 1CSJA 4C11A 3KWMA 2G0IA 2C2ZB 1BWEA 1LWCA 2CQDA 2NPIA 1WC1A 2YWEA 1XTZA 4BLGA 3F41A 2B8PA 3E8OA 1M5SA 3MEDB 4YB5A 4DI6A 4K4XA 1S9GA 2MJUA 2JEIA 5CH7B 3FRZA 2V67A 2COLA 4F04B 1NK0A 2VUGA 4M5LA 2F65A 1ZOTA 3BYRA 1SH0A 3GR0A 1B99A 4Y28C 5DLGA 4JI5J 4LFBF 3LALA 1F60B 3PIOQ 4G1QB 5J2MB 3HT3A 3VVTA 4OHXA 5EHHA 1RTDB 3MK0A 3W9HA 1JLAB 2YWWA 3WAWA 1TKDA 3DCAA 3EVOA 3OQ2A 4WWSA 4CO0A 3DI6B 4IG3B 4OZ2A 1RAEB 1XJWB 2WVEA 4LT6A 2I38A 2B3TB 4QZVB 4RW4B 3DLEA 3WX8A 3EDQB 1NK8A 3Q2TC 5DDQC 4C8ZA 4GKKF 1WEXA 4KBIA 2RMLA 2KT3A 1B7YB 4PQAA 3TARA 1GTHA 1N5YA 4AUKA 1VBKA 2HQGA 4NLUA 3RBZA 1TU0B 2UXBF 4N47A 4WK1A 3FQLA 4OI1A 3W5XA 1YQHA 1RWVB 1HQAA 3CMAS 2BE2B 2YKNA 4ATNA 3OHAA 5AJ3F 1YGYA 3DGVA 2OPQA 3GFHA 3IWXA 2J0QD 1TKZA 3TZWA 3BO2A 1HNWJ 3MMCA 2HVHA 1A9NB 1RU2A 2RU9A 5J2NB 1VQ8S 1NDKA 1R8CA 4DU7A 1WWHA 2IVMA 2K3IA 3EGVA 2DR5A 4K4SA 5T7LB 3G87A 2X3GA 3MM7B 4HDHA 4H4KA 2YY3A 3RAMA 4CLZA 3E51A 4E0DA 4Y2KA 4RW6A 1X4CA 1IKVA 1H2VZ 1X7VA 4QIVA 2AD9A 4B9TA 5HLFA 1T9UA 2GV1A 3CJQA 4HHUA 4HT7A 4GO5X 1S6PB 1Z4UA 3JQMA 4IH6A 4USTA 3DLHA 1FSUA 1VK3A 4KJGA 4ZK7M 1S1VA 2YVSA 1TVRB 2VH7A 4PWUA 2AT1B 4DR6F 3RBDA 5I3PA 4JI1J 4JYAF 5CA5A 4J37A 3CDWA 2K3KA 3AB4B 1SL2A 2ZD1B 1HPZA 1HW9A 4AE5A 3ISZA 4R8UA 1RXOB 3A3NB 1UA0A 2V5HG 4OLPA 1VQ5S 2KDOA 2ZBCA 4LR7A 4DPUA 1HD1A 3NBPB 2ADCA 4U7CA 1UTAA 3T1YF 4F3OA 2RVJA 4ED4A 2LECA 4OHYA 1X4GA 1LKZA 1ALKA 3DXSX 5KG6A 2VQEF 1Q79A 1ZA1B 4USWA 4CT9A 4MMOA 3VAJA 3VAGA 2V2ZA 2CRLA 1VHIA 5KFQA 4UTGA
chains in the Genus database with same CATH topology
3T02A 3M8WA 4CYRA 4UOPA 5LQQA 4KAVA 3B5QA 4CXSA 1KH7A 3OT9A 2IFYA 5L0BA 4UPLA 3IDDA 3Q3QA 4QAXA 1EW8A 1E1ZP 3BDGA 3NKPA 4KM4A 1P49A 5IJQA 1ALHA 4MY4A 3NKMA 4UORA 4LR8A 1ZEDA 1EW2A 4LRFA 1SHQA 2W5RA 3M8ZA 3NVLA 3T01A 1KHLA 4ZGAA 3KD8A 1ZEFA 4LRBA 3UN5A 4LRAA 2GLQA 1N2LA 4YR1A 2GA3A 2G9YA 2QZUA 2IUCB 1AJAA 1AJBA 1ZEBA 1HDHA 3CMRA 3IGZB 1B8JA 4B56A 4UOOA 1ANJA 5DLTA 3WBHA 3ED4A 2GSUA 2W5XA 1E3CP 3UO0A 2XR9A 3BDGB 4UPHA 5C66A 4ZG6A 1ELZA 3A52A 2IUCA 3UNYA 4LREA 5TJ3A 2GSOA 4GTWA 4LRDA 1KHJA 3M7VA 5INHA 5DLVA 5GRRA 1ELXA 4N7TA 2X98A 3UN3A 3NKRA 4CXKA 1ALJA 4GTXA 4KJDA 5LIAA 2ANHA 3BDFA 3MK0A 3WAVA 3WAWA 1ALIA 4UPIA 4GTYA 2W5WA 1AUKA 3NKOA 2GSNA 1ELYA 3UN2A 3M8YA 1KHNA 1O98A 5EGEA 5L0KA 2D1GA 4NWXA 4GTZA 5IJSA 4LR9A 1SHNA 1AJDA 1N2KA 4ZG7A 5EGHA 3MK1A 2W8DA 5DLWA 3TWZA 1HQAA 4FDJA 3TG0A 4LQYA 1EI6A 1KH9A 1EW9A 1URAA 4FDIA 4LRCA 3DPCA 3WAYA 3E2DA 1EJJA 1KH4A 1E33P 4MIVA 1Y7AA 3WAXA 1URBA 1E2SP 3NKNA 5HRTA 1ANIA 2XRGA 5L0EA 1KHKA 5GOVA 4KAYA 2VQRA 3LXQA 3SZZA 1O99A 1FSUA 4KJGA 4LR2A 2ZKTA 1Y6VA 3NKQA 3DYCA 5K4PA 1HJKA 3MK2A 4MHXA 4UPKA 2W5QA 1AJCA 5KXAA 2W8SA 1ED9A 2RH6A 5LRNA 4LR7A 3T00A 5LRMA 2W5VA 1KH5A 4CYSA 4TN0A 3IGYB 2W5SA 4NWJA 1ALKA 2W5TA 3TX0A 1ED8A 5AJ9A 3SZYA 1EQJA 4CXUA 4ZG9A 1K7HA 3BDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T02 A;  3M8W A;  4CYR A;  4UOP A;  5LQQ A;  4KAV A;  3B5Q A;  4CXS A;  1KH7 A;  3OT9 A;  2IFY A;  5L0B A;  4UPL A;  3IDD A;  3Q3Q A;  4QAX A;  1EW8 A;  1E1Z P;  3BDG A;  3NKP A;  4KM4 A;  1P49 A;  5IJQ A;  1ALH A;  4MY4 A;  3NKM A;  4UOR A;  4LR8 A;  1ZED A;  1EW2 A;  4LRF A;  1SHQ A;  2W5R A;  3M8Z A;  3NVL A;  3T01 A;  1KHL A;  4ZGA A;  3KD8 A;  1ZEF A;  4LRB A;  3UN5 A;  4LRA A;  2GLQ A;  1N2L A;  4YR1 A;  2GA3 A;  2G9Y A;  2QZU A;  2IUC B;  1AJA A;  1AJB A;  1ZEB A;  1HDH A;  3CMR A;  3IGZ B;  1B8J A;  4B56 A;  4UOO A;  1ANJ A;  5DLT A;  3WBH A;  3ED4 A;  2GSU A;  2W5X A;  1E3C P;  3UO0 A;  2XR9 A;  3BDG B;  4UPH A;  5C66 A;  4ZG6 A;  1ELZ A;  3A52 A;  2IUC A;  3UNY A;  4LRE A;  5TJ3 A;  2GSO A;  4GTW A;  4LRD A;  1KHJ A;  3M7V A;  5INH A;  5DLV A;  5GRR A;  1ELX A;  4N7T A;  2X98 A;  3UN3 A;  3NKR A;  4CXK A;  1ALJ A;  4GTX A;  4KJD A;  5LIA A;  2ANH A;  3BDF A;  3MK0 A;  3WAV A;  3WAW A;  1ALI A;  4UPI A;  4GTY A;  2W5W A;  1AUK A;  3NKO A;  2GSN A;  1ELY A;  3UN2 A;  3M8Y A;  1KHN A;  1O98 A;  5EGE A;  5L0K A;  2D1G A;  4NWX A;  4GTZ A;  5IJS A;  4LR9 A;  1SHN A;  1AJD A;  1N2K A;  4ZG7 A;  5EGH A;  3MK1 A;  2W8D A;  5DLW A;  3TWZ A;  1HQA A;  4FDJ A;  3TG0 A;  4LQY A;  1EI6 A;  1KH9 A;  1EW9 A;  1URA A;  4FDI A;  4LRC A;  3DPC A;  3WAY A;  3E2D A;  1EJJ A;  1KH4 A;  1E33 P;  4MIV A;  1Y7A A;  3WAX A;  1URB A;  1E2S P;  3NKN A;  5HRT A;  1ANI A;  2XRG A;  5L0E A;  1KHK A;  5GOV A;  4KAY A;  2VQR A;  3LXQ A;  3SZZ A;  1O99 A;  1FSU A;  4KJG A;  4LR2 A;  2ZKT A;  1Y6V A;  3NKQ A;  3DYC A;  5K4P A;  1HJK A;  3MK2 A;  4MHX A;  4UPK A;  2W5Q A;  1AJC A;  5KXA A;  2W8S A;  1ED9 A;  2RH6 A;  5LRN A;  4LR7 A;  3T00 A;  5LRM A;  2W5V A;  1KH5 A;  4CYS A;  4TN0 A;  3IGY B;  2W5S A;  4NWJ A;  1ALK A;  2W5T A;  3TX0 A;  1ED8 A;  5AJ9 A;  3SZY A;  1EQJ A;  4CXU A;  4ZG9 A;  1K7H A;  3BDH A; 
#chains in the Genus database with same CATH topology
 4F7V A;  5K14 B;  3M8W A;  4ITS A;  5GMK a;  3I55 S;  2VIH A;  5HVG A;  1ZTW A;  3R6L B;  4YR0 A;  1WG1 A;  2L41 A;  4A8W A;  5A2Q U;  5HP1 B;  5KFA A;  5C2G A;  3H5S A;  1SKW A;  2PI5 A;  5I42 B;  1R31 A;  3OXL A;  3FEZ A;  2KU7 A;  4DQR A;  1WF1 A;  3PW7 A;  5B0D A;  3IS9 B;  2J0X A;  3UDC A;  3M32 A;  1WC5 A;  1RT5 B;  1Q8I A;  1WOO A;  1RGV A;  2EK1 A;  4X64 F;  2BJ1 A;  2BMB A;  3CT9 A;  3MD3 A;  4MH8 A;  2D74 B;  1PYT A;  5KFP A;  4QWC A;  3KMS A;  1HWI A;  4LF1 A;  5SZT A;  1R0A A;  4UY8 5;  4R0E A;  2N7Y A;  1FKP B;  1AA1 B;  1SJ1 A;  3TQE A;  2AYE A;  2HWI A;  3D1H A;  2OHD A;  3UVJ A;  4LIW A;  2HVD A;  4RW9 B;  4WYL A;  3HD2 A;  1JLC A;  2B7C B;  4R5P A;  3MTJ A;  1RAI B;  3CJ5 A;  4WE1 B;  4JV5 F;  1YBU A;  2MQ8 A;  2E7V A;  2DRD A;  4ZP7 A;  3V81 B;  3AOC A;  1FKO A;  4M8L A;  1S4E A;  1L3V A;  4PRF A;  1RUS A;  4UUX A;  4YR1 A;  1KVK A;  3I31 A;  1AJB A;  4NYZ A;  4YY3 F;  1V3Z A;  3C19 A;  4A8K A;  4YHH F;  1NDP A;  2A2D A;  2EBE A;  2W5X A;  2HQD A;  3UVJ B;  1R6Y A;  3KJQ B;  3UCG A;  4GC6 A;  1SL0 A;  2XS7 A;  1SI9 A;  1S99 A;  4X4P A;  5B0E A;  1H2U X;  1FRM A;  2HQ3 A;  4F4Y A;  2Y1L B;  1NK7 A;  1IKY A;  4EFA C;  3CJS A;  1IKX A;  3FBF A;  2IUC A;  1UVM A;  3BKF A;  2P9E A;  2GSO A;  4LFA J;  2YQ0 A;  5J2P B;  4DSL A;  4QPT A;  4FF1 A;  4CLY A;  3POT A;  5H9F J;  4EBC A;  1MNE A;  1F5B A;  2FJD B;  3OR2 B;  4RW6 B;  2ASY A;  3KJV A;  5LMU J;  4RO0 A;  3MUV P;  3KJN B;  3PW5 A;  2R3V A;  1HHT P;  1KTV A;  3CC2 S;  1HQU A;  2XY6 A;  4A8Y A;  1WEY A;  4F67 A;  5J1E B;  4WU3 A;  2VBZ A;  4X4V A;  3D67 A;  2VJV A;  1X60 A;  3OFE A;  4YR3 A;  4NLT A;  4C0O C;  3M30 A;  2MQN A;  4OV1 A;  1VCT A;  2R8G A;  2WOM A;  4IG0 A;  3OFG A;  4HI1 A;  5KG0 A;  3TOQ A;  1FWK A;  4DF4 A;  1FDN A;  1P1L A;  5LJ5 Y;  1H74 A;  2DTJ A;  1SV5 B;  4FBU A;  3EGW B;  3ZZU A;  3EX7 B;  3I32 A;  3OJS A;  4HEA 9;  3OVS A;  1N2K A;  4PXC A;  2WBR A;  2W9B B;  1RWO B;  1RT3 B;  3KUH A;  4WU2 A;  4DPY A;  2BOP A;  3PCO B;  4IQX A;  3TWZ A;  4KQZ A;  1RQ0 A;  4WK3 A;  1D3W A;  5J2Q B;  4ELT A;  1AZS B;  2VG5 B;  1TKT A;  4IH5 A;  4XDC A;  3TVY A;  4CO5 A;  2RF2 B;  4FDI A;  5LOQ A;  3CE8 A;  3FCW A;  5CHC B;  2DGQ A;  4PYD A;  3D4J A;  4MIV A;  2CPJ A;  4K8R A;  3DRS B;  4ZPB A;  4DV0 J;  2QA1 A;  4YDX A;  3ZO7 A;  2FJA B;  2HRT A;  3MM9 A;  1NDC A;  2CNK B;  4ENO A;  2AJQ A;  3G2X A;  3B8H A;  4HAC B;  4KHP J;  2BRK A;  2BJ8 A;  1N5V A;  2V94 A;  5J1N A;  5F41 A;  2HHW A;  5T41 A;  3QFH A;  2MZ1 A;  2KG1 A;  2VHG A;  2AYB A;  3NLC A;  2OO4 A;  1P49 A;  1RWX B;  2EFN A;  2HRU A;  4URS A;  2Z56 B;  2AQ4 A;  2AEJ A;  4J9R A;  1IKW B;  5KFU A;  3VAF A;  3JXO A;  3HSZ A;  1N6Q A;  1S1X B;  1Y6V A;  1R8A A;  2P8I A;  3N6M A;  3NWG A;  4QBU A;  4HDG A;  1EZZ B;  4JI0 J;  2DR9 A;  3JSM B;  4WXO A;  3VTI A;  4J9O A;  4P2S A;  3BO3 A;  3M6W A;  1VQ7 S;  1JJH A;  3FUY A;  1SCJ B;  1ZZF A;  3K5O A;  5E3R A;  5L38 A;  5CXT A;  2MY8 A;  4C8N A;  2W5V A;  3IWL A;  3IAM 9;  1IBL J;  1NUE A;  5A8W A;  3TYT A;  4LF8 F;  2AKW B;  4DS5 A;  2W5S A;  1BHN A;  3FSX A;  3A8K A;  2XS5 A;  1E6Y A;  2FJE B;  2QIF A;  2FC9 A;  2DR8 A;  3FCV A;  3OTE A;  4ZGA A;  1C0U B;  4WP9 A;  3K8V A;  2EKN A;  1VQY A;  3WZ0 A;  4AQY F;  2GJF A;  3G8Q A;  4ZS6 A;  3DHW C;  4NPO A;  3MMA A;  2UXD J;  3CCW A;  2GIF A;  1GEH A;  1C4C A;  3BZQ A;  1XNQ J;  2Y1R I;  3MM6 B;  2C3P A;  2DVI A;  3IGN A;  1MWQ A;  3ULH A;  5DG8 A;  4WFN Q;  3BS9 A;  3I6P A;  4JI8 F;  1RT2 B;  3R3T A;  2OAU A;  4ZVO B;  1T02 A;  3UFC X;  4GVB A;  3K58 A;  5BYQ A;  3KLF A;  2UXC F;  2YXL A;  2YKO A;  2RHS B;  4YUD A;  4ZIT A;  3JS9 A;  2H4Y B;  2CQB A;  2HEK A;  2XZW A;  5A8R A;  2KYZ A;  1K9M T;  1SKS A;  3LP2 A;  3MOJ B;  3SQG B;  2UV8 A;  1QVG R;  4IFV A;  1MWZ A;  2Z30 B;  1NDL A;  3DC2 A;  3C15 A;  3QJJ A;  3DOM B;  3MEE B;  2XO6 A;  4HH1 A;  1RTH A;  3MD1 A;  5D3G B;  3BSO A;  3IGZ B;  2VV5 A;  4HH0 A;  4LSN B;  2AU0 A;  2DD8 S;  2MZJ A;  3PFO A;  1TKT B;  2H1Y A;  2IJN A;  4DLE A;  2BM1 A;  1J5O B;  1N33 F;  1G4C A;  1ELZ A;  2V8H A;  1FXL A;  4LSZ B;  1G6B A;  3UNY A;  3JAM Y;  5F9N A;  5CYJ A;  3U27 A;  2F8H A;  1U7L A;  1U48 A;  3P5B P;  3TUZ C;  3EIC A;  4WTY A;  3ENA A;  1CS4 B;  4QYZ K;  1Q0N A;  4RWW A;  1U6Z A;  2DNK A;  4J90 A;  2Y8Y A;  1SVD A;  4I2Q A;  1VS3 A;  4LVO P;  2DH9 A;  3NNA A;  2GVZ A;  4C98 A;  4M5D B;  2W7P A;  1R0B G;  3EZU A;  3NP5 A;  4DSE A;  1U49 A;  5DQG A;  4JV5 J;  4P73 A;  1VIX A;  4ZVG A;  1HHQ A;  4DV2 J;  1CS4 A;  4CWB A;  2MHE A;  2UUW A;  2V2K A;  4USI A;  4KR0 B;  1JXL A;  4B3T J;  4B9V A;  1GMV A;  2RQK A;  2V50 A;  4CLS A;  1PO6 A;  2VG6 A;  1ZPV A;  2EKY A;  3I82 A;  4EYH B;  4BS2 A;  5KFT A;  3HPO A;  1JWW A;  3BSC A;  2XWX A;  2ZOG A;  3MM8 B;  2MQQ A;  3GON A;  3V5R A;  2CAJ A;  4P52 A;  1TL4 A;  1S72 S;  2H5I B;  3JQJ A;  2HMI B;  2IRY A;  3BGF A;  2H5E A;  1KN6 A;  2KVQ E;  2W1B A;  1LK7 A;  2ACM A;  2VC0 A;  3ZNU A;  4ZP6 A;  4TXS A;  1T03 B;  1H73 A;  1L3T A;  2VFU A;  2GML A;  3H2L A;  1YTY A;  3CDU A;  2ADB A;  4KPY A;  4ANE A;  1GXL A;  2EG1 A;  1FE4 A;  1LW0 B;  2NXE A;  2CDQ A;  2E1R A;  5KFH A;  1XER A;  2HVZ A;  5F0U A;  1URB A;  2CNL B;  3KG0 A;  2HG4 A;  4J9U E;  4ZN1 A;  1WKK A;  2DGW A;  5D4N A;  2QJ3 A;  3HZG A;  3MMB A;  4XAK A;  5K8P A;  1M90 T;  2AEM A;  3UD3 P;  3C2P A;  4LMZ A;  5L0E A;  1UL3 A;  3V4I A;  1IBC B;  4CH0 S;  3QGI A;  1B0P A;  1CQM A;  2JJ4 D;  2KYX A;  3U02 A;  4JP8 A;  4AFF A;  1JLQ B;  1F2G A;  1VC5 A;  5GME A;  1N52 B;  1C1B B;  1EKR A;  3PDN A;  4MIA A;  2AWZ A;  2E66 A;  2JRS A;  3V2U C;  4IG3 A;  5IQ6 A;  3PR5 B;  3KK3 A;  4UPK A;  2CZV C;  2GJI A;  4G1P A;  4DZD A;  1KD1 T;  4PPD A;  1N0U A;  1BGX T;  4DUT A;  2IAJ A;  1YJ7 A;  3G8S A;  1TL7 A;  2V8G A;  4JI6 F;  3GFX A;  3MHY A;  1UKU A;  5KFJ A;  3FDS A;  3H90 A;  3I0S A;  3B54 A;  1N8R T;  1S6Q A;  5AJ9 A;  2KB2 A;  1HFE L;  4CXU A;  2WVF A;  5DRK A;  4TY8 A;  4OZ5 A;  4A8X A;  2RE1 A;  2MGZ A;  1DQA A;  4I6W A;  3T19 A;  5DGB A;  2HHV A;  2BUN A;  1V6H A;  3CW2 C;  2E7X A;  5DO2 A;  4L3N A;  5E3Q A;  1Y3J A;  1VJQ A;  5ETP A;  5HL7 Q;  2M8D B;  4YB1 P;  4DQI A;  1KVJ A;  2EEY A;  2BE9 B;  1S1W B;  3VAH A;  3WAX A;  2IM2 A;  1IR0 A;  3CJ8 A;  1U6F A;  4PG8 A;  4DR1 J;  1VOM A;  1T7P A;  4ECV A;  1HLW A;  5K8N A;  4DR5 F;  3AHP A;  4O44 B;  1E1Z P;  2JDJ A;  3C6U A;  3H8Y A;  1WF0 A;  2V34 A;  4OLO A;  1NU4 A;  3DRP B;  2ZE2 A;  3QWP A;  4DFP A;  3NKM A;  1BD6 A;  1S1T B;  4K2J A;  3OL9 A;  4DR6 J;  3NRB A;  1MN9 A;  4X2B A;  1H6K X;  2LEA A;  4WFZ A;  3TUI C;  1YHQ S;  5DQI A;  5G4D A;  3KD8 A;  1WI6 A;  2AYM A;  4FYX B;  3FK4 A;  3A3O B;  2B8Q A;  4JI7 F;  1MRO A;  2DPI A;  4UQG A;  1REG X;  5D0H A;  2UUC J;  2MQM A;  1TL1 B;  2GA3 A;  3M8R A;  4ES2 A;  4DL5 A;  1S1T A;  1S5Z A;  2X1G A;  1N32 J;  2MZS A;  5KFW A;  2MLX A;  5J2N A;  1TAQ A;  3GJS B;  3I56 S;  1ZM9 A;  2E44 A;  3GMG A;  2PMZ D;  1FNO A;  1K73 T;  1P9Q C;  5CAB A;  2UUB J;  3MGJ A;  1BLU A;  4Z2X A;  1BXN A;  4QW8 A;  3CPW R;  1S1U B;  4M5I A;  4ILR A;  2NSC A;  2MHN A;  3AQO A;  3KHR A;  1JJC B;  3IBF B;  4NLX A;  2PI4 A;  3G71 S;  1DTQ B;  3B6B A;  3G96 A;  4DL6 A;  1VRT A;  2HHH F;  5TJ3 A;  3R5B A;  4LRD A;  4CLF A;  5JUM A;  3PY8 A;  5HJY A;  2GCF A;  2XMM A;  3TJ9 A;  2DJW A;  4FPI A;  2HNZ A;  2CQ3 A;  4NWB A;  3Q24 A;  3EGZ A;  4CXK A;  2BAN B;  1NM2 A;  4DZ6 A;  3KNG A;  2CAD A;  2KRR A;  3Q8Y A;  4OL8 A;  1YZ7 A;  2FQQ B;  3RB3 A;  3THT A;  4WF9 Q;  5FJ4 A;  1S48 A;  1YWX A;  3A1Y G;  1YLX A;  1IN0 A;  3UCU P;  4UZC A;  2IYG A;  2ZH4 A;  1NO8 A;  4ECQ A;  1ELY A;  2QA2 A;  3ZZO A;  1QE1 B;  2HWT A;  4QOT A;  3QBC A;  2RUS A;  1MW7 A;  2CG8 A;  5K14 A;  2CWX A;  1FTR A;  4XPC A;  1JLC B;  1KHN A;  3FNN A;  4I2P B;  1HAR A;  4ZPW R;  1IJF B;  2B6A A;  3SCK E;  1N33 J;  4FVM A;  2B51 A;  2RIL A;  1Q16 B;  3OXG A;  4JYA J;  5GAE U;  3T6J A;  3EYZ A;  3PYG A;  1R43 A;  2D3O R;  4LQY A;  3CD7 A;  3M32 B;  2HK3 A;  2CPD A;  1URA A;  4CXS A;  2XY5 A;  3D5M A;  4DLG A;  1R6V A;  3ITH A;  1CC7 A;  1WC6 A;  2HFO A;  1QY7 A;  2R7V A;  3QAT A;  3BDF A;  1SJR A;  2NXJ A;  1ZBT A;  3SQO P;  1P27 B;  2XI3 A;  5LJ3 Y;  3WX4 A;  3X1L B;  1VIO A;  4CM2 A;  3TZZ A;  3PRB A;  4O3P A;  5KT7 A;  5IT0 A;  4Y3C A;  3GIL A;  5D0R A;  5IC6 B;  2YH0 A;  1YRU A;  1IWA A;  1CJU A;  2OI2 A;  1TL5 A;  2C3Y A;  4N77 A;  5HSP A;  1H38 A;  7AT1 B;  2V4J A;  4Z7Y A;  3OTC A;  3CIZ A;  3PO5 A;  3AOD A;  4KFB A;  3RR8 A;  2HIY A;  2FVC A;  4ZVE A;  5I3Q A;  1TUG B;  2QFJ A;  1E6V A;  5EGH A;  1HHS A;  5ETK A;  2H54 B;  2XMV A;  3EE3 A;  2HAF A;  2M3D A;  1FX4 A;  1Q4R A;  2WOM B;  3MMC B;  3NOC A;  4IG0 B;  3UD4 P;  4LF9 F;  1N36 J;  1SC6 A;  2LYV A;  4CYS A;  1RT2 A;  3G6X A;  1UVK A;  1VBX A;  1S1V B;  1Y5I B;  1SB6 A;  2IC3 B;  5D15 A;  1TL3 B;  1TQL A;  2BQR A;  4KB7 A;  1Y5L B;  4LF6 F;  3GV8 B;  1QUV A;  2FB0 A;  1WG5 A;  1NKC A;  3A8I A;  3M30 B;  3BGO P;  4ZJO A;  4HKQ A;  2GC8 A;  1U4B A;  3BF4 A;  1T11 A;  4DSI A;  2W24 A;  3EJM A;  4AXI A;  3UQS A;  1FJG F;  2ZC4 A;  4U6P A;  3D28 A;  4RU9 A;  4I67 A;  4AL6 A;  1B0V A;  2ZBP A;  2IA0 A;  1WHY A;  4O4G B;  4TVA B;  4AND A;  4DOZ A;  5E41 A;  2XCA A;  2LEP A;  3A13 A;  4DR7 F;  2UUT A;  1H72 C;  2IC3 A;  4WTO B;  1UJ4 A;  3NCP A;  2EBG A;  3TAQ A;  1EET A;  2YWG A;  4KAI A;  3GJQ B;  2J9D E;  2R2T A;  2YX1 A;  9ATC B;  2F4F A;  3KLG A;  2YNG B;  4OYP A;  4LSN A;  2KXN B;  5DLF A;  1Y10 A;  1JLB A;  1DY3 A;  2D9O A;  3AJ1 A;  3HUL A;  4GVL A;  4HT5 A;  1RAD B;  2VL1 A;  3QGP A;  2W9C B;  2KFZ A;  2XEX A;  1CJK A;  3N9U C;  3NCR A;  5GAD U;  4UOR A;  1WOS A;  1Q81 T;  2J0S D;  3CSK A;  5KXA A;  1CBK A;  1HQ2 A;  3DNC A;  4J5O A;  1RYR A;  3M2V A;  1PAE X;  2Z4P A;  2QLF B;  4B3M F;  5ETV A;  2R7O A;  3VZI A;  3U1L A;  1NND A;  1VLO A;  2OGU A;  5B0G A;  5F8I A;  4WCE Q;  2KFY A;  4MAK A;  2VON A;  1CJK B;  1X4A A;  2Z58 B;  4CNY A;  4OX7 A;  3MR5 A;  3FQK A;  5SUH A;  4N5S A;  2LA6 A;  2QMW A;  4IKA A;  4NLW A;  5CYM B;  4CLP A;  1AFJ A;  1S1X A;  4RKU C;  2MKY A;  3L7O A;  4ZP9 A;  1UEU A;  1D8Z A;  4WBF A;  1E3C P;  3BDG B;  4UPH A;  4KV8 A;  1BQN A;  3DLJ A;  2FUG 9;  2AGQ A;  3VAK A;  3W3S A;  1KHW A;  3M05 A;  5C42 A;  1U1R A;  4Z37 A;  3LF0 A;  2BR0 A;  3G9C A;  2DNP A;  3WC0 A;  4UOF A;  2UU9 F;  1WC3 A;  1FRH A;  2FVS A;  1UVJ A;  3BSN A;  2OPP B;  1KHJ A;  2IA6 A;  1P1T A;  3TVZ A;  1NH8 A;  4QWB A;  4U7U D;  4RW8 A;  5DLV A;  3RGI A;  1ELX A;  4B9S A;  5AXN A;  3GR1 A;  4ANC A;  4ECY A;  2AF6 A;  3G6E S;  2W2O P;  1U8W A;  2CNO B;  2Q1L A;  1EQ0 A;  3Q86 A;  3R7S B;  3EM1 A;  3OTO J;  4IRD A;  2DNR A;  4GTY A;  4FS1 A;  2AJ0 A;  1RCO B;  2WSE C;  4KGZ B;  3GFZ A;  2BX6 A;  2GSN A;  3MR7 A;  5A8R B;  1ARO P;  2VA3 A;  1C0T A;  5L0K A;  2VDI A;  3SCJ E;  4ICL A;  4RPF A;  2H51 B;  4BCA A;  5DG9 A;  2VBY A;  2OIH A;  2RHQ B;  1RT6 A;  1W2B R;  2PFF B;  3DDN A;  2X7I A;  3K5P A;  3PX6 A;  2OEK A;  2QRR A;  2CJ9 A;  2IYI A;  1YIT S;  4MFB A;  2K7K A;  4M95 A;  1SKR A;  3NGS A;  5DLW A;  2J0W A;  4ZPD A;  4N41 A;  2LMI A;  3K2Y A;  3NGT A;  4K5R A;  4N8N A;  1HBN B;  2CXE A;  2E5G A;  5FII A;  5JJB A;  1EP4 A;  4IYQ A;  2M9K A;  5KFI A;  5IV3 A;  2R8J A;  4JBC A;  3U7J A;  4ZKA A;  4ED7 A;  3KTQ A;  2J8A A;  3RB0 A;  1LWE B;  2H48 B;  2H5J B;  3MCM A;  1VK8 A;  4KO0 A;  8RUC A;  2ASJ A;  4JOU A;  4PWW A;  2E9T A;  4MFB B;  2D3O 1;  5LXR A;  2CJK A;  4MKA A;  4PWD B;  1IWG A;  5FLX U;  4KAY A;  1V3S A;  1BQM A;  2JWN A;  3R7N B;  4RR5 A;  2ZJP Q;  2YBV A;  1M5H A;  3I0R A;  2JFK A;  4NZ0 A;  5HQM A;  1FDB A;  1Y00 A;  2MGZ B;  3BBC A;  2JLG A;  4DFM A;  5D3G A;  2HFV A;  5HQL A;  2ZKT A;  3DHX A;  2HVE A;  5FLX Y;  3W64 A;  3PRD A;  1NHK L;  1RHJ B;  2ACY A;  2KN4 A;  4O0I A;  3DYC A;  3GYX B;  2EW9 A;  3FFI A;  3OPK A;  3S01 A;  2YWH A;  4DV3 J;  4TYA A;  3H40 A;  4CO4 A;  5KFB A;  4HLB A;  5IV4 A;  2W9A A;  1VQ4 S;  2AGO A;  1CC8 A;  1U1P A;  5HMZ A;  1RHK B;  3J81 Y;  2ATL A;  1TKX B;  1FHT A;  2J7W A;  1GT8 A;  4EEY A;  1KNZ A;  1OYD A;  3DFE A;  2DT9 A;  2V6A A;  3CIM A;  3E3X A;  2E5L J;  2W5T A;  4DUY F;  4JI2 J;  3W62 A;  2YNI B;  4RX6 A;  2QMU B;  1GTE A;  2HZA A;  2LFV A;  2GGP B;  4OIX A;  5C25 B;  2I8E A;  2CJA A;  3QNW B;  2W7A A;  4NLS A;  1X31 C;  3KHL A;  2YKM A;  4BBY A;  3NGU A;  4F4A A;  3TO8 A;  4NLO A;  3CD5 A;  1W7W A;  2IDE A;  3AAW B;  2HPU A;  4ETZ A;  4X4S A;  3HXM A;  1K8A T;  3T02 A;  3CF5 Q;  1OY6 A;  2CPI A;  4A8S A;  1SXL A;  4C48 A;  1TK5 A;  3MMB B;  3NKP A;  2XLI A;  2EWH A;  4KPC A;  4L6V 3;  2OPS A;  2R42 A;  1S97 A;  3PW0 A;  2GFF A;  3CMQ A;  4KGX B;  2CKW A;  4MK9 A;  2HMI A;  4KHP F;  3PV8 A;  4TQS A;  4BWJ A;  4C11 B;  1ZAX A;  2DHX A;  3CDB A;  4ZDN A;  4ZPV R;  2POK A;  4CIO A;  1K0V A;  1CUL A;  1AYE A;  2PA3 A;  4B9N A;  1WOP A;  3QZ7 A;  1FK9 B;  1FXD A;  1URR A;  4B56 A;  3FMB A;  1LW0 A;  1REV B;  2QSW A;  4DR2 F;  4AXJ A;  4FF3 A;  3WBZ A;  1B8J A;  3RZA A;  2CQG A;  1RHM B;  3VAL A;  2YTC A;  1ZM4 A;  3MZI A;  4RNO A;  1VI7 A;  2Z2Y B;  2OSR A;  3CJR A;  5KFG A;  1IQT A;  3IXQ A;  3KLF B;  2PA8 D;  2FHO B;  2WON B;  1RTH B;  3F44 A;  5G0R A;  4FBT A;  4D3G A;  4QR1 A;  3BM7 A;  1BMQ B;  2RRB A;  4F4X A;  3PVX A;  1X0F A;  4Y2A A;  1NHV A;  3G8T A;  5INH A;  2VIC A;  3KLV A;  1D09 B;  4RNM A;  2DCL A;  1D8Y A;  2FVQ A;  1FDA A;  3VCD A;  4P74 A;  1QSY A;  3Q23 A;  4Z7C A;  3JQK A;  3HSG A;  4HVZ A;  3MAA B;  1KLN A;  2ZJR Q;  1K7H A;  3OLB A;  1HWK A;  3M8P A;  1FD2 A;  1YDL A;  4MKY A;  4LFC F;  2CQ1 A;  1VGY A;  1FKA F;  2HBZ B;  3NKO A;  1ZS6 A;  5F3Z A;  1JIH A;  1NPK A;  1RTJ B;  1WJ9 A;  3ILI A;  1AW0 A;  2JEF A;  4YEA A;  3K89 A;  5KFE A;  1H7W A;  1HR0 F;  2N7C A;  5T7L A;  4FF2 A;  3IRX B;  1TR0 A;  3QQC D;  2D1G A;  2HBY B;  2FD2 A;  4CT8 A;  3CCS S;  2PEB A;  9RUB A;  1CJU B;  3TUJ C;  4RWX A;  1S6P A;  2ZH8 A;  3EWG A;  4NA3 A;  2ZVS A;  1Q8B A;  2B4P A;  1X0P A;  4FF4 A;  3AOB A;  1FRI A;  3ENQ A;  2BJE A;  3MM7 A;  4P6Q A;  4PYA A;  3ZTP A;  2MQO A;  1HNZ J;  4Q0B A;  3PJW A;  5C25 A;  1HNW F;  1HWJ A;  2I1R A;  3BKT A;  3HZE A;  3KK1 B;  3PX4 A;  2CJQ A;  2B4O A;  3MDF A;  4NEY A;  2HZC A;  2XSF A;  2YKM B;  1XMO F;  1KH4 A;  3UD5 A;  3D6F B;  1KDN A;  3ONQ A;  2DO4 A;  2MLZ A;  2ZOM A;  2QT7 A;  3D66 A;  3TZX A;  1N34 F;  2QSF A;  5A8K B;  4C4W A;  3BBF A;  3J7Y U;  5HRO B;  3B4M A;  4NEZ A;  4JI1 F;  4YOE A;  2EFO A;  1SIW B;  4F2R A;  3SZZ A;  3MM8 A;  5D4P A;  4U9R A;  4ZLJ A;  3D0I E;  2QYG A;  2AJ4 A;  2LU1 A;  4OYX A;  2D9P A;  3UPF A;  1MMN A;  3TX8 A;  5GVQ A;  5HMW A;  2C2K B;  2FJV A;  3GPA A;  4FZV A;  5KFR A;  4NLR A;  1YKW A;  1T9T A;  4M5J A;  4DDF A;  3GV5 B;  1FJE B;  5K4P A;  1RBL A;  2CZ4 A;  2ZUG A;  4ID5 A;  1SIZ A;  2HHQ A;  2W5Q A;  2DK2 A;  5A6W A;  2W8S A;  5LRN A;  2NUH A;  1XIQ A;  2J9C A;  2KI2 A;  2BEF A;  3C14 A;  4X4T A;  1JLB B;  3W5Y A;  4IOC Q;  5KOX A;  4QYR A;  1FCA A;  4X65 J;  5I42 A;  4ED1 A;  1DAX A;  3D0G E;  4EWT A;  2DHH A;  2BW7 A;  2YKP A;  3DLG B;  3GSD A;  1XR7 A;  2CYY A;  4B3S F;  1EB0 A;  1XQI A;  2W4C A;  5KG3 A;  2YNH B;  4M5H A;  1X4E A;  2C2N A;  4CLU A;  2HHX A;  4UOP A;  4W98 A;  1S9G B;  1RLD A;  4KAV A;  3DRX A;  2FLN A;  1AFI A;  2E1A A;  2R7R A;  2RT3 A;  4UOH A;  5IM0 A;  1QAX A;  1NSP A;  2X3D A;  3DOL A;  3BJY A;  1I94 J;  2IFY A;  5L0B A;  1ZM2 A;  1CJV B;  2XC9 A;  2L48 A;  3MWB A;  2VG7 A;  3PYF A;  4B02 A;  3DU5 A;  3V6J A;  4DSF A;  2I6W A;  2HIQ A;  5HJX A;  3FZB A;  1PC4 A;  2DXF A;  1JX4 A;  3IAS 9;  4QWE A;  1S59 A;  1R89 A;  2C2O B;  2DGT A;  4LF4 J;  1WG4 A;  1QJH A;  3POT B;  4R25 A;  1KFD A;  2C2E A;  4EGL A;  3AT1 B;  2R7Q A;  1RJJ A;  2ATC B;  2BXJ A;  4RBT A;  5HBM B;  1TUW A;  4LUB A;  2EFP A;  2IUC B;  2BKO A;  5DS7 A;  5KFY A;  1IR1 A;  2PC6 A;  8AT1 B;  4O44 A;  5ITH A;  5J2P A;  2C22 A;  3W2V A;  4P75 A;  2XUL A;  3TAM A;  1RK8 A;  4I4B A;  3HO1 A;  1YJN S;  3L9Z A;  1NB2 A;  4TU9 A;  4HHJ A;  4PQU B;  5CCL A;  3CWJ A;  1FRX A;  3O8W A;  5H9E J;  2OTL S;  4DS4 A;  1HNI A;  2O66 A;  1ZAW A;  1PJ5 A;  3W2V B;  1S49 A;  3BO4 A;  1C4A A;  4ECZ A;  4B3R J;  2W01 A;  1HMV B;  3KK2 B;  1FWP A;  1WTB A;  2A1B A;  1RWP B;  1RLC L;  2CZ9 A;  1N5Q A;  3I5A A;  5D0E A;  4DV2 F;  1VHF A;  4Y6I A;  3K8W A;  4PQU A;  3KHH A;  3SDE B;  4DFK A;  4HTI A;  3QT5 A;  5A76 A;  4DR5 J;  3GII A;  2EXU A;  2Q66 A;  5L46 A;  5KFK A;  5I3U A;  1FX2 A;  1P9Y A;  1UWB B;  2LVW A;  1HQE B;  2XYH B;  1DTQ A;  1ZPW X;  2DHS A;  1YJW S;  4NXM J;  1U1K A;  2XZD B;  4ELV A;  1SHN A;  3PRV A;  4ED3 A;  3JSY A;  4IR1 A;  4C7Q A;  4QIW D;  2P5V A;  3LQV A;  4E2F B;  4CDI A;  2V4R A;  1X5T A;  1FKP A;  3DLG A;  4PXB A;  3ZZR A;  4KGK A;  1RTD A;  1HL6 A;  4DQP A;  2KFN A;  1UWB A;  4G1Q A;  2NYI A;  4ZVR B;  5J2M A;  3KLG B;  2HS3 A;  3IA0 A;  4LRC A;  3SSQ A;  4LF5 J;  3TP2 A;  1K44 A;  2YKQ A;  4X4N A;  4OHW A;  3AD7 C;  5ETS A;  3E2D A;  1A7G E;  3SYZ A;  2O67 A;  4JI3 J;  3MFI A;  5DLT A;  1X4H A;  3L95 X;  4F0H A;  1Q7L B;  3D6M B;  1E2S P;  4WFX A;  2W8L A;  1WOR A;  1UA1 A;  3H5X A;  2W7O A;  3OVB A;  1DFD A;  4OX9 F;  3MEK A;  3AB2 B;  5K8O A;  2F7V A;  1NK9 A;  1SBR A;  1D9F A;  1CEZ A;  1JXE A;  5LT5 A;  4XPE A;  1R0A B;  4EZ9 A;  1HW8 A;  1VYA A;  4IH7 A;  1VQN S;  3GV7 B;  2HBR B;  2W4P A;  4LF7 F;  3WDO A;  3C6T A;  3H2U B;  3K17 A;  2L08 A;  5KTQ A;  4ER8 A;  4PG5 A;  4EZ6 A;  2F8M A;  4RUA A;  2FC8 A;  2J7U A;  1XMO J;  1FER A;  2QMX A;  4ZPC A;  5KFF A;  4CH1 A;  4C8Y A;  3ZTO A;  3O1L A;  2ZH5 A;  1X4F A;  1T3O A;  4KFB B;  2DNN A;  2HQI A;  2RSQ A;  2GMH A;  1OIA A;  2KT5 A;  3SV4 A;  3KOA A;  2R2R A;  2C28 A;  4ZG9 A;  3IN5 A;  1YJT A;  4ZCM A;  2AEF A;  2XNQ A;  3A8J A;  1VQK S;  2J8S A;  4KH1 B;  2V63 A;  1J2V A;  1HBN A;  1SV5 A;  2V8P A;  1XK8 A;  2I0X A;  1Q5V A;  3C15 B;  3ZZZ A;  4DX7 A;  3K59 A;  5LQQ A;  5J1E A;  1E6V B;  2DH7 A;  1G3O A;  1LW2 A;  1U0H B;  4CTA B;  4CYU B;  1IR2 A;  1RSC A;  2ZBR A;  4UOG A;  3WC2 A;  1M5K C;  1KKH A;  2W2Q P;  2DR6 A;  3HX9 A;  1F9H A;  2E5H A;  2XTJ P;  4LF2 A;  1OPZ A;  4N56 A;  1EHW A;  1HQU B;  4OJH A;  1GMU A;  2YX7 A;  3N01 A;  4RNN A;  1GX5 A;  2XMA A;  4C8K A;  3QJL A;  1U2C A;  1HYS A;  3OFH A;  3Q89 A;  5ETL A;  3S8S A;  1KQF B;  3W7B A;  4LRF A;  3KJF B;  3W9I A;  1TK0 A;  1K0T A;  3R7B B;  1KQK A;  5BR8 F;  3TI0 A;  3DLK B;  1A6L A;  3CCU S;  1I5O B;  2J6U A;  3BBB A;  4WXW A;  1F2H A;  2KHC A;  2YNG A;  5DDR C;  3H98 A;  1Q5Y A;  5DDO C;  4G1I A;  1LQ9 A;  2ZH1 A;  3UN5 A;  2A6O A;  4JV0 A;  2QEX S;  1N88 A;  4GO7 X;  3ZZ0 A;  2AJ2 A;  3I0R B;  1TMM A;  2G9Y A;  1M5O C;  1IBM J;  2EC0 A;  1M1H A;  4D3H A;  3R5D A;  4ECX A;  1FFG B;  1SC1 B;  3N4W A;  1Z2Z A;  2F63 A;  1PIL A;  3IS9 A;  4PUO B;  5FDL B;  3HHL D;  3K5N A;  2YH1 A;  2BM0 A;  2HHH J;  4IR9 A;  1ED8 A;  2BBE A;  3HDS A;  1IBK J;  4DL0 C;  2GNK A;  2LQ8 A;  5C66 A;  1RA6 A;  1WKJ A;  2FIU A;  2IM3 A;  4URQ U;  5B09 A;  1V9O A;  3EVW A;  3A52 A;  4CZC A;  1FVQ A;  4K5S A;  3PEJ A;  2AP6 A;  5HVF A;  2GJ2 A;  3GIK A;  4LRE A;  2UVW A;  1TKX A;  3C3L A;  4LF7 J;  2ZZM A;  4ZLN A;  4RLE A;  3BQ2 A;  3D0H E;  4OX6 A;  4R5P B;  3NS5 A;  1M5V C;  3PIP Q;  3DLL Q;  4B3T F;  1SJ3 P;  4RUC A;  4FXD A;  3NKR A;  3UN3 A;  1YRX A;  2VPW B;  1NME B;  3F0N A;  2ASD A;  3HSJ A;  4RZR A;  3GYG A;  2BRL A;  3MCO A;  1WC4 A;  4U96 A;  1J5E F;  4J9V A;  3H4B A;  1X9M A;  2FZG B;  3DXB A;  5KFN A;  4ZIV A;  2ZH9 A;  5IT9 U;  2W4D A;  2A6M A;  3CO9 A;  3KK1 A;  1AUK A;  2W5W A;  4K4U A;  2PN6 A;  2Z2Z A;  2HFZ A;  4N8O A;  1OYE A;  1O98 A;  5EGE A;  2WW8 A;  4OJ3 A;  1EJ7 L;  2FPH X;  1UVL A;  3T41 A;  3RBE A;  3MM5 A;  2C2R A;  2OEJ A;  4OMF G;  2CQ4 A;  3HVT B;  4I6Y A;  2XHC A;  2Y0S D;  3BH6 B;  4MYT A;  1XMB A;  1NJZ A;  4LSL B;  3US5 A;  3AOA A;  2HW3 A;  4M5M A;  3AD8 C;  4MKV A;  3B78 A;  1D9D A;  1T9V A;  4FS2 A;  3OBI A;  5B0B A;  2CJB A;  3X3U A;  1IJE B;  4HYK A;  2LXI A;  1EJJ A;  3H4D A;  4K7Q A;  3BN4 A;  5CD4 A;  2V9K A;  2E5L F;  3VGU A;  4JI2 F;  4LSL A;  3NKN A;  1LFP A;  3QAE A;  4Q44 A;  2R2S A;  2F8E X;  2ZHA A;  1UMJ A;  2C42 A;  2ZM6 F;  2QGF B;  2V2V A;  2HLU A;  4IFV B;  1M1K T;  5IOL A;  2NQP A;  3QLH A;  3CUL A;  2M7S A;  4GVB B;  3TJ8 A;  2MKI A;  3Q8Q B;  1J27 A;  3KUG A;  2VQF F;  5CAA A;  4ZVQ B;  4YB7 A;  3CCE S;  4OYM A;  3A3P B;  3IBC B;  1REV A;  2G0C A;  3UDL A;  3VGV A;  3CB4 A;  1RT4 B;  1DHM A;  2YX4 A;  5ETR A;  4KKO B;  2LXF A;  4NAS A;  4ZP8 A;  2RJZ A;  3ZNJ 1;  5AE3 A;  3HMJ G;  1DBD A;  1FDD A;  2BV3 A;  2YPY A;  5EUH A;  3PW4 A;  2XI2 A;  2CJX B;  3DOM A;  3LAM A;  3MEE A;  3NGR A;  4NL5 A;  4HHH A;  3GIJ A;  1CJV A;  3EXY A;  5KT4 A;  4JI3 F;  4YDD B;  3N28 A;  5G0R B;  3Q8R B;  2JLF A;  1S7H A;  5AXK A;  3LWL A;  2KT2 A;  7FDR A;  5L9X A;  1U09 A;  2IMW P;  5L39 A;  1S4F A;  5EWG A;  5DG7 A;  5DET A;  2F4V J;  3QO9 B;  2PE8 A;  1L3K A;  1X4D A;  2F5G A;  2IMO A;  2FTR A;  3FBC A;  1VBY A;  2UXB J;  4IUF A;  3BDH A;  2E29 A;  4CYR A;  1R8B A;  1HD0 A;  3P8B B;  2FHJ D;  1JB0 C;  2MKJ A;  5L9N A;  4H4O B;  3WHI A;  4PWD A;  3NG8 A;  3KLH A;  1VMB A;  3KG4 A;  2WBM A;  3F56 A;  3B5Q A;  2I5J A;  2VA2 A;  2HVI A;  3JSM A;  1RB0 A;  3QO9 A;  2KJW A;  2ZM6 J;  1DLO B;  1ELO A;  1W26 A;  2NLW A;  2RIJ A;  2DIU A;  2CIM A;  3AA9 A;  3CJ0 A;  2H3E B;  2A2C A;  1U25 A;  2QA4 S;  1YI2 S;  2XQC A;  5HRO A;  4DV0 F;  3QIP A;  1M0S A;  1GX6 A;  1R27 B;  2G0J A;  1HBM B;  1XR6 A;  1RU1 A;  1KLM A;  3R5J B;  1L3S A;  2FHJ A;  4Q8E A;  4NX9 A;  2VDH A;  1W2I A;  3PKY A;  2KH9 A;  1SHQ A;  2D7S A;  1RBO B;  2XZT B;  1CJT A;  4OJG A;  3NEK A;  5CQG A;  1NK5 A;  1K47 A;  2IRX A;  2WZ1 A;  3LO3 A;  1NK4 A;  4ERD A;  2QL9 B;  1FJC A;  2MEW A;  2W25 A;  3OXF A;  1LWC B;  1B7F A;  1APS A;  2GLQ A;  2HFN A;  1UP1 A;  3KDO A;  3MEC A;  3TVK A;  2R7W A;  2R9L A;  2VPZ B;  3KLI A;  4EO8 A;  1RKJ A;  3SDE A;  4WZM A;  4F3M A;  4MJK A;  3HVW A;  4FXV A;  2G9O A;  2RDI A;  3UO0 A;  4Q43 A;  3PM9 A;  1S0O A;  3LGH A;  2UU9 J;  4L75 A;  4YHH J;  3QRP A;  3JYT B;  5BJR A;  3BKU A;  3L7U A;  3C46 A;  1WUU A;  2DH8 A;  2FLL A;  5KFO A;  2FLP A;  3CJK A;  1U1Q A;  4CCH A;  1GXU A;  2AHO B;  4C6A A;  4QCL A;  3RG6 A;  2JEG A;  2VQE J;  4UY8 T;  2XGQ A;  4ZMM A;  1NJW A;  1NZA A;  5THW A;  3MUM P;  5BR8 J;  1IVZ A;  2J9D A;  2J7K A;  3ZFV A;  1FES A;  2CPZ A;  4I2P A;  3C14 B;  1KSP A;  3VAI A;  1JLQ A;  1SUQ B;  3RRG A;  5E3C A;  5J1P A;  2MKS A;  1ICE B;  3LTO A;  1L5U A;  3ITH B;  4JI8 J;  3W5Z A;  1X5S A;  3CVK A;  4OYW A;  2ZKU A;  1VQ6 S;  2MQL A;  2MJN A;  3LP0 B;  3QGG A;  3HM9 A;  4Q2L A;  4ETX A;  4A4J A;  4DX6 A;  1G1X A;  2KRB A;  3R6G B;  1TKZ B;  1VQS A;  4QPX A;  1LXJ A;  2C2D A;  2WB1 D;  3JAM U;  1QSS A;  1EQM A;  2XNR A;  1WI8 A;  3DYA A;  3MPU B;  5EGY A;  1XR5 A;  4PCQ A;  4USV A;  5B0F A;  4P7T A;  2D3U A;  4RW4 A;  2DO0 A;  3TRG A;  3WIU A;  5F3T A;  2G13 A;  5H1S V;  1B0T A;  1N54 B;  3VHQ A;  5MLC V;  1N48 A;  4F0M A;  2X51 A;  1S0M A;  1EW9 A;  3DPC A;  3GE9 A;  3I96 A;  4PG7 A;  4CLL A;  4IDK A;  1XNR F;  1FA0 A;  3LGM A;  4RJV A;  2ZNZ A;  5CCM A;  2V8D A;  3JB9 k;  1LWX A;  4WPA A;  4OYA A;  4KSE B;  1FNX H;  2MDA A;  5BYS A;  4FKX A;  1IBM F;  3VGS A;  4W92 B;  5D6G A;  3P49 B;  4ZVP B;  6FDR A;  3QIP B;  5K5M A;  4X66 F;  1HBM A;  3KXD A;  2AJ1 A;  2WVD A;  4C8M A;  2K7J A;  1N36 F;  3G86 A;  4PAB A;  3NS7 B;  3SXL A;  4DV4 J;  1RBA A;  4LR2 A;  1JXV A;  4IFY A;  4TLQ A;  1H98 A;  3Q8P B;  1H2T Z;  5ETQ A;  2GX8 A;  4ZG7 A;  5H9F K;  2LQ5 A;  2Y1I A;  1LW2 B;  4CTA A;  1RT1 A;  3B4D A;  3CDE A;  3GIR A;  4CYU A;  4MHX A;  1MRO B;  2VF3 A;  3VZH A;  4F4K A;  3S7R A;  1QTM A;  2CNN B;  1VRT B;  5A2Q Y;  3IGY B;  4I69 A;  2MQP A;  1BY9 A;  3J80 Y;  3FMW A;  3I87 A;  1UAW A;  2GO8 A;  4ZVS B;  4LQ3 A;  3QFW A;  2W9B A;  4MIB A;  2DNL A;  3A8E A;  1S1U A;  2HK2 A;  5LM7 E;  2ZH7 A;  1SQE A;  2HNZ B;  4HL9 A;  2QTW A;  2DIV A;  2WK4 A;  3C8Y A;  3LAN A;  1U1O A;  4MIW A;  1F1B B;  4C3K A;  2K1R B;  3HHN B;  1FF2 A;  4QU6 A;  3O44 A;  1KQG B;  3AH6 A;  4IO1 A;  1DRZ A;  4OV6 A;  1ZAV A;  4OYO A;  5EX0 A;  4AT1 B;  1IXK A;  1DJ0 A;  1YBA A;  3GYN A;  3HFZ B;  3FJ2 A;  4KTQ A;  1PBA A;  2VJU A;  2Y8W A;  2V68 A;  3I4H X;  2AJF E;  3GTY X;  2UUC F;  4DV4 F;  1T9Y A;  1SUQ A;  4Q2M A;  1TK8 A;  1S7I A;  3IG1 A;  3CD0 A;  1S9E B;  8ATC B;  3N6L A;  4NYO A;  3UCZ P;  4QQB A;  2YNF B;  3LUY A;  4X4U A;  2MSS A;  3H2V E;  3Q2S C;  4H4K C;  2W5R A;  4ED0 A;  2QLB B;  2YNH A;  2HKE A;  2PDA A;  4RW7 A;  2VG7 B;  2QA4 G;  1AT1 B;  3HI9 A;  2Z2L A;  2ZDP A;  4MT1 A;  1RI7 A;  4KC5 A;  3UR0 A;  5JVG Q;  2D69 A;  2V4J B;  3GFY A;  1X9S A;  1GMW A;  1AJA A;  1WSR A;  4C3L A;  2MMY A;  1RTI B;  2CA9 A;  2MTL A;  2IVF B;  5AJ3 J;  2MKH A;  4Y2M A;  4Y34 A;  4PKD B;  3J81 U;  5MAO A;  3J7Z T;  2OJ3 A;  3SIP B;  4EBE A;  3NWR A;  4IOB A;  5E5N A;  1QD1 A;  1VR6 A;  5F8L A;  3SV3 A;  2CQH A;  2FJX A;  2ZE2 B;  2LLZ A;  3QJP A;  1XMQ F;  1U2R A;  2OKQ A;  3P4U B;  4NI2 A;  1JLG A;  1QAJ A;  4S0M A;  2ZWO A;  1PBU A;  1KOO A;  2IRU A;  2RKI A;  3O2I A;  5IT4 A;  3OW2 R;  4H4M A;  2F9D A;  3ISN D;  4X62 J;  3R5G A;  5GRR A;  4N7T A;  3HKW A;  1OSD A;  1LEO A;  2XSJ A;  1WD6 A;  3HHE A;  4U8Y A;  4KJD A;  3ETM A;  1V5I B;  1HWU A;  1SJQ A;  5HQ8 A;  1KEK A;  1D9A A;  5EWE A;  2VKZ G;  3BRE A;  3CCR S;  2UUA F;  4IFY B;  3C16 A;  2K2P A;  3RB6 A;  2W2P P;  3ET6 B;  3CC7 S;  2R7S A;  5EWF A;  1VQ9 S;  1JLF A;  2RNE A;  4O4R A;  4OQJ A;  4ES3 A;  5AE1 A;  2AYG A;  2CVI A;  2JHE A;  4YQW A;  1RT1 B;  1NK6 A;  3A12 A;  3HLU A;  1ZM3 A;  4ZPA A;  2ROG A;  2DNG A;  1UEK A;  1EKS A;  1JK9 B;  4K59 A;  3R1L A;  3LPE A;  4ECS A;  3T6B A;  1KS2 A;  1JKH A;  1MU2 A;  3S1T A;  2XB2 D;  3ET6 A;  4DX8 H;  1F3F A;  1LWF B;  3AA8 A;  5C2C A;  2QX0 A;  3AXM A;  4WFY A;  3PTW A;  4L74 A;  4Q5V A;  1HMV A;  3VAM A;  4OYI A;  4Q7A A;  3D3C J;  4YR2 A;  3DLK A;  1UPP A;  2BA9 A;  1HNX F;  2AZ3 A;  3C66 A;  4C97 A;  2CPF A;  3TG0 A;  1JKH B;  1MU2 B;  2XMK A;  3I4P A;  4NZ7 A;  3VF0 B;  1B70 B;  4FPR A;  3QGH A;  3BPS P;  5E7O B;  3FVY A;  2BVZ A;  1S9F A;  1C1C B;  3B82 A;  4F4W A;  1QE1 A;  1U1N A;  1VQO S;  1SJ4 P;  2BKP A;  3GP9 A;  1WEZ A;  1ANI A;  1HQE A;  4OX8 A;  4RBV A;  1NCL A;  3QSY B;  3W2W A;  1LV5 A;  2WHO A;  2F40 A;  3CJ2 A;  5J2Q A;  3THV A;  2IJR A;  1Q53 A;  3LPY A;  2E9Z A;  4F3Q A;  2FLO A;  5F8N A;  3DKD A;  3FSI A;  4Q45 A;  5KT3 A;  4DV6 J;  1RWM B;  4USJ C;  2EK6 A;  2W2N P;  4NRT A;  2ALZ A;  2YQ1 A;  4XIU A;  4ZVT B;  2KM8 B;  3E01 B;  4DPW A;  3TNV A;  3KLH B;  5HAO A;  4HAC A;  1VC6 A;  2MY7 A;  3PO4 A;  5CYQ A;  1BQN B;  1KC8 T;  4KHR A;  4JUZ A;  2DNH A;  3T00 A;  3Q8V A;  4DR7 J;  2UVV A;  2G1H A;  3U1N A;  1UZD A;  1BC6 A;  4TN0 A;  2B9W A;  2ZH6 A;  2ZUA A;  4LBI A;  3VVU A;  1R0C B;  3AJD A;  3DMJ A;  2NXU A;  2PD1 A;  2X1F A;  2DNY A;  5F8G A;  3DOK A;  2B5J A;  4RNH A;  4DUY J;  2HQC A;  4K4V A;  1ITP A;  1FJ7 A;  3SZY A;  3RRH A;  5FD1 A;  1C0T B;  5L1I A;  4CO1 A;  4OI2 A;  5T14 A;  4O3Q A;  3OTD A;  1W25 A;  5H9E K;  4LFB J;  1WEL A;  2ALY B;  2OPS B;  2ZJQ Q;  4WP3 A;  5KG4 A;  1FK9 A;  1KH7 A;  1RAJ A;  3PNI A;  2EC2 A;  3KJV B;  1T9W A;  2RU3 A;  1YIJ S;  4RUB A;  3Q3Q A;  1YSJ A;  2BQ3 A;  1QTN B;  3AJ2 A;  5HI7 A;  1KWM A;  1FTC A;  3ILJ A;  2IPO B;  4Y65 A;  4CO3 A;  4MYU A;  4DV6 F;  1S77 D;  4KM4 A;  3TZY A;  1PG5 B;  3FEX B;  3T1A A;  3M6X A;  1GH8 A;  1RHR B;  2DNZ A;  2WAQ D;  3MED A;  4MKB A;  5L1L A;  1HI0 P;  3T01 A;  4EI2 A;  5K9F A;  4ICL B;  3IP0 A;  4L72 B;  1HBU B;  2B4U A;  2ZBQ A;  5EDW A;  2KZM A;  2NCK L;  3BN7 A;  1J5E J;  3OHB A;  1F6T A;  2MPU A;  4DV7 F;  1HBO B;  2P9G A;  1U0H A;  2FYX A;  3R1H A;  1NPP A;  4OI3 A;  1TL7 B;  2IIH A;  1PGZ A;  4NXN J;  2OH2 A;  1JLA A;  4UW2 A;  5LSO A;  5E33 A;  3LP2 B;  2XR9 A;  2VAS A;  2XMT A;  3VWS A;  3CCV S;  1HBU A;  2LQ9 A;  4DU8 A;  2PSZ A;  2OPR A;  4JI4 F;  2BAB A;  4OHZ A;  4ED5 A;  2X1A A;  1TP7 A;  4DSJ A;  2ZHO A;  3M2V B;  2HGL A;  3MR3 A;  2LXU A;  2WB4 A;  3H42 A;  2WSC C;  2VZ9 A;  2KKH A;  2QL5 B;  2EVZ A;  3V6H A;  1RTJ A;  3LH2 S;  4QR2 A;  3NNC A;  4RUH A;  1NJY A;  3BB5 A;  3O6Q A;  3PXG a;  3JSR A;  1RE1 B;  2DGS A;  2YKN B;  4F26 A;  2D41 A;  5CYM A;  2R7X A;  4H4O A;  3EMT A;  1KOH A;  2CQ0 A;  4LJM A;  4P71 A;  4C0B A;  2ZNY A;  4K0K F;  3LWM A;  1UPM B;  4ZVU B;  3ADA C;  3NAI A;  4IDK B;  3GG1 A;  3RYL A;  3EDR B;  1JJ4 A;  3CJ3 A;  4RBU A;  1DLO A;  4ED6 A;  1ZTT A;  2XS2 A;  4WKR A;  3GWC A;  3M8Y A;  3N79 A;  1IBL F;  1GQE A;  2B9X A;  2CQI A;  2HND B;  1PIE A;  1WAC A;  3H59 A;  3HVR A;  3RU0 A;  2VQF J;  3KHG A;  2A0F B;  1IM4 A;  4IRC A;  3D3B J;  4QIE A;  2DR7 A;  2HNY B;  1KVI A;  1I1G A;  2Q6C A;  3DMJ B;  3M2R A;  1FFW B;  4FN5 A;  3OVA A;  1C0U A;  4I68 A;  1FRK A;  3RB4 A;  4NYP A;  1N34 J;  2JX2 A;  2DGU A;  4ID8 A;  2HGM A;  1AXQ A;  1HNV B;  3H20 A;  5DM6 Q;  1FEH A;  3BDE A;  2DEI A;  2BDP A;  3WQP A;  2ZOF A;  1R3N A;  3I9Z A;  1RAB B;  1CUL B;  5D78 A;  2KL8 A;  5E3P A;  4DPO A;  3F73 A;  5LSL A;  2UVR A;  1E33 P;  2ILY A;  3NBP A;  1WNE A;  2XBP A;  3KG1 A;  3KLI B;  4LBH A;  3FBE A;  3ISN C;  2QFI A;  3PFE A;  1L3U A;  1KON A;  1KTQ A;  4OI0 A;  1RAC B;  2LU2 A;  2JEJ A;  3ZZP A;  4GKJ F;  2VQR A;  2UXC J;  4C0H A;  4WP8 A;  4X62 F;  2KO1 A;  3MM5 B;  1UW9 A;  3OD2 A;  2R8H A;  3PHE A;  3OL6 A;  3HP6 A;  4FYW B;  1Y0H A;  3MR6 A;  2RQM A;  1VRQ C;  2Q79 A;  3GU0 A;  3CGI A;  3HJV A;  1RT7 A;  1LXN A;  3NY0 A;  1H0H B;  1AJC A;  1YJ9 S;  4TY8 B;  2GS8 A;  1LK5 A;  3TJA A;  1TUV A;  3IR7 B;  1WKL A;  2QZ8 A;  4IO9 Q;  1EIY B;  1RT5 A;  4NLV A;  3TEG A;  3N5B A;  4ZVF A;  2B6A B;  5D0G A;  3UE2 A;  4IRK A;  4LF9 J;  2E1C A;  1N5T A;  1U47 A;  2K06 A;  5IWA J;  3RTV A;  1KHV A;  1WDD A;  1KBR A;  2DB1 A;  2MKC A;  2QO3 A;  4DCO B;  5KG5 A;  3K57 A;  1EQJ A;  3QT7 A;  4TYB A;  3T1H J;  5HRT A;  2C3U A;  4GC7 A;  4WE1 A;  2OPQ B;  2BAC A;  1LOU A;  4KKO A;  2N4C A;  4DXL A;  2HHU A;  3QAU A;  1GFW B;  3MCN A;  3R9L A;  1X4B A;  2EFQ A;  3HHL A;  1UFW A;  2DKO B;  4ZHR B;  1VLY A;  2QN6 B;  2HBQ B;  4NML A;  2HQF A;  3R5A A;  4UZB A;  3CC4 S;  1K1S A;  4ED2 A;  4F2S A;  3KNA A;  4IOA Q;  4E98 A;  1EW8 A;  4QAX A;  4FNI A;  3R27 A;  2NZC A;  2GHP A;  5KFS A;  3KDN A;  1DAR A;  4Y0F A;  1FWL A;  2FDN A;  1DQ9 A;  5B08 A;  3EPG A;  2KG0 A;  1ALH A;  2SXL A;  1IKY B;  5KFV A;  4NMX A;  1Z2L A;  1TEL A;  1IQZ A;  1T05 A;  3UDE A;  1EW2 A;  3HHL B;  4ZHR A;  4CLK A;  2DGX A;  1NEE A;  1ZEF A;  2J76 E;  2B56 A;  2JC0 A;  3IO1 A;  3IRX A;  1QAI A;  2VOD A;  5KFD A;  4O3O A;  4Q0B B;  1RAF B;  3GCX P;  4R8U B;  2RDJ A;  2APO A;  2IHR 1;  3PW2 A;  1Y4Z B;  4TN2 A;  3IR6 B;  1QM9 A;  4U8V A;  4BWM A;  1DTT A;  4B3M J;  4KT0 C;  2QZU A;  1TVR A;  1ANJ A;  3WBH A;  2RDD A;  4A47 A;  1S0N A;  4B3R F;  1HKA A;  1OMS A;  2HSE B;  1OQ6 A;  3QPI A;  5K8M A;  1CG2 A;  2Y0B B;  4USU A;  2MKK A;  3CJ4 A;  3JTN A;  2WTF A;  4ZG6 A;  1IKV B;  1DUR A;  1OJ4 A;  4ZVH A;  1NPR A;  5I3U B;  4DR3 J;  3V4M A;  3W61 A;  4CI0 B;  4L3K A;  1FJG J;  1S57 A;  2J9E A;  4CH7 A;  1Y5N B;  1YK9 A;  3NAH A;  5HP1 A;  1XN9 A;  2LDY A;  3BPD A;  4ZJQ A;  4NLG A;  3NKY A;  4NZ6 A;  4KJI A;  2QL7 B;  1S6U A;  4PG6 A;  5LXY A;  4DUZ F;  5B7W A;  4FDF A;  2PO4 A;  2OLW A;  5IS2 A;  4NE9 C;  2RH3 A;  2NXN A;  2OML A;  2J6T A;  3IFE A;  3M1V A;  1F9E B;  2GHV C;  2VFR A;  3DRR B;  4L73 A;  6FD1 A;  4CRJ A;  2NR0 A;  3WAV A;  1SC4 B;  2UV8 G;  2XMJ A;  3QT8 A;  4KGM A;  1GK8 A;  4WII A;  1HI1 A;  3NGD A;  3RW6 A;  1RHQ B;  4M5N A;  2XG8 A;  2XHW A;  4EMD A;  5KT6 A;  4J9Q A;  4K4Y A;  1RAA B;  4P10 A;  4B9L A;  2KXF A;  5GMD A;  3O3L A;  4L76 A;  1G7C B;  3TQ1 A;  2DPJ A;  2MB0 B;  4JI6 J;  1S0V A;  1Y11 A;  4JB8 B;  2N3L A;  4RW7 B;  5GAG U;  1B4S A;  1WHW A;  4WIQ A;  3CJK B;  2F3J A;  4LR9 A;  4AL5 A;  2AW0 A;  3M8S A;  1OWX A;  1Q1K A;  2BYC A;  4DV1 F;  4UUW A;  1S9E A;  2K8G A;  1S6Q B;  4QWA A;  3MK1 A;  3DOL B;  1RTI A;  2YWF A;  4DL2 A;  1O5J A;  4DBQ A;  4DN9 A;  4F36 A;  2O3D A;  5M2P A;  4DR2 J;  4G3I A;  2CQ2 A;  3FZ2 A;  3MEG A;  4OZN A;  1U1M A;  2XYG B;  4LQ9 A;  4A46 A;  1NHU A;  1Z1Z A;  1N5Y B;  1M1G A;  1S1W A;  1ZZN A;  1T94 A;  4U7U K;  2J6S A;  4Q8F A;  2V2Q A;  3KUE A;  4J9M A;  2OD6 A;  2DIT A;  4OYB A;  1QUP A;  2CQC A;  3MMJ A;  1T0T V;  4KRW A;  1I51 B;  3SSS A;  1QVF R;  3OR2 A;  3HFK A;  3LP1 B;  4ZN3 A;  3LXQ A;  4KE5 A;  3ILL A;  4PXD A;  2EG2 A;  2CPH A;  3TAP A;  2WCX A;  2N3O A;  3D1O A;  3AXK A;  2NYH A;  4JV1 A;  2MXY A;  4NRU A;  2XMW A;  5HAN A;  1ACM B;  2BE2 A;  2CFX A;  3S6E A;  1S12 A;  4U67 Q;  3MUR P;  3EPI A;  4F4Z A;  4NLP A;  3MUT P;  4ECU A;  3IGV A;  5KG7 A;  2O01 C;  3MTK A;  2YWK A;  2ROP A;  1F3V A;  2RQC A;  4B9U A;  2ZZN A;  1IKX B;  1VC0 A;  3DDK A;  2DXE A;  4ZLP A;  1KH5 A;  3V6D B;  4NLD A;  2E5I A;  3TR5 A;  1ZYQ A;  2JVR A;  3P6Y C;  2KXH A;  5A8K A;  1KFS A;  4OZL A;  5DM7 Q;  4YP3 A;  2CWK A;  2DEJ A;  5KFM A;  2O1P A;  2PT0 A;  3FKB A;  3LOU A;  4NLQ A;  1KRP A;  1MSW D;  3L3C A;  1OY9 A;  1CQN A;  2CUY A;  5LSR A;  2W2M P;  3SQG A;  1WHV A;  4ECW A;  2M88 A;  3RJM B;  2EFV A;  3T1Y J;  1YJR A;  2DHG A;  1HNI B;  4K2X A;  5L8R C;  1UVI A;  1IM6 A;  2V8V A;  1SQG A;  1Y7P A;  3RBX A;  5BXI A;  1I6J A;  1FRJ A;  2JFD A;  3IDD A;  2E7W A;  3L7P A;  1AB8 A;  2DY1 A;  3D1Q A;  3GZ7 A;  3VQS A;  3W63 A;  2BJ7 A;  3AD9 C;  1U8S A;  2PEH A;  1VQM S;  3PJ9 A;  5GAH U;  2JZ5 A;  1MMD A;  2OPR B;  1FRL A;  1P8G A;  1WSV A;  2VC1 A;  3JTO A;  4UT4 A;  1ZED A;  1KH9 A;  1EET B;  1JJ2 R;  1IKW A;  3CCZ A;  3FSY A;  1RHU B;  2BZ2 A;  3CTR A;  3M8Z A;  4Y2C A;  4J7C A;  3W9J A;  1RZM A;  3E01 A;  5JMN A;  5RUB A;  4EYI B;  3T5L A;  4M5K A;  2ZWP A;  3RRK A;  1H3D A;  2R8K A;  1VJW A;  4W90 B;  2JH3 A;  3QRQ A;  2UUA J;  2KHD A;  3H7H B;  3ENW A;  4F02 A;  4PXE A;  4BDP A;  2QLJ B;  1N0V C;  3EVM A;  4M5D A;  4AQY J;  5A8W B;  1PSD A;  1D0E A;  5GAG I;  1NKE A;  3ED4 A;  2C2M B;  3DM2 B;  2LQB A;  3Q83 A;  3MEG B;  2DGV A;  2PMW A;  1GNK A;  2EI5 A;  2FHK A;  3IG1 B;  2YKA A;  3NS6 A;  1VFJ A;  4J9N A;  3R8Y A;  4P2X A;  7FD1 A;  2E1P A;  2HS0 A;  2NS1 B;  3M7V A;  1F5C A;  4KV8 B;  4ZIW A;  3LP1 A;  2CVE A;  5CYQ B;  5ETN A;  2X98 A;  1SKU B;  4DG1 B;  2Z8Q A;  3GCW P;  4ZPT R;  2G2O A;  5D77 A;  2JNJ A;  2NPF A;  1OQ3 A;  2KM8 C;  3M6U A;  1NRK A;  4K50 A;  2RS8 A;  4UPI A;  1M5P C;  1RT6 B;  3TAM B;  2GVD B;  5L1K A;  4A8Q A;  4LF6 J;  5U47 A;  2B5J B;  4FP9 A;  1Q78 A;  1PYS B;  2CPE A;  2JOQ A;  3J7Z 5;  2HUR A;  4DG1 A;  3OV7 A;  5AE2 A;  3J7A 1;  4NI2 B;  4ILL A;  1UET A;  2QG9 B;  4NWX A;  2WVB A;  4NCA A;  2VOO A;  2B9Y A;  3UWT A;  4FXW A;  3PYD A;  4X4R A;  1MML A;  5JVH Q;  3IWN C;  1AJD A;  3KYL A;  4UF4 A;  4P2M A;  2BJ3 A;  1I3O B;  3ZC4 A;  2X1B A;  5F8M A;  2XM3 A;  1XWL A;  4KGV B;  3GLJ A;  5KAK A;  2R2U A;  2D1C A;  2BOA A;  2IY5 B;  4WFB Q;  2NUU G;  5LMN F;  2N82 B;  2ASL A;  3CCJ S;  3SFU A;  3U1M A;  1R8P A;  4Y2I A;  3TAN A;  2LCW A;  1FVS A;  1URN A;  2ZBI A;  4XDD A;  1LWF A;  1RP5 A;  1R8H A;  4I6A A;  3RW7 A;  2LA4 A;  2LEB A;  2XLJ A;  4ELU A;  3HT0 A;  3JTP A;  1RT4 A;  2H4W B;  2DNO A;  2VFT A;  5JXS A;  5HMY A;  3HHL C;  2DGO A;  3M8Q A;  2XRG A;  1NJI T;  3M2U B;  3N5F A;  6AT1 B;  2V9W A;  1TFY A;  3I5C A;  3J7A N;  4OJ1 A;  2P2C B;  2QLX A;  2XMU A;  2GVZ B;  3DRY A;  5HMX A;  4ZLL A;  5DQH A;  3M8P B;  1UJ5 A;  5CD4 H;  2E9R X;  1X5O A;  3MM9 B;  4X4O A;  1ROF A;  3KLE A;  4M1K A;  4OZ1 A;  4JI0 F;  2FVP A;  4DV1 J;  4CQ1 A;  4O3R A;  3MK2 A;  1ULR A;  3DLB A;  2F4V F;  3THP A;  2PII A;  1VRU B;  2HYI B;  2YQ3 A;  3IBW A;  3RUB L;  1AUD A;  1ED9 A;  4DN0 A;  5LRM A;  1X9W A;  2IM1 A;  1JQG A;  3C6U B;  3D2W A;  2ZHB A;  1SC3 B;  2LKZ A;  2C1E B;  2R4F A;  3DDI A;  3ZZT A;  3T5J A;  3CD6 S;  1IUJ A;  1DZ5 A;  2M0G B;  2HFS A;  4DWI A;  2B43 A;  3OUY A;  4CP5 A;  4X65 F;  4YME A;  3M9O B;  5DGA A;  1GXT A;  3J80 U;  4RL1 A;  2PGC A;  2DIS A;  2AZ1 A;  2OP5 A;  1TL1 A;  3C6T B;  2O5D A;  1QDU B;  1HNX J;  4YFU A;  1YRT A;  5A0Y B;  3O5T B;  3NNH A;  1OO0 B;  1YX2 A;  2H9Z A;  4J91 A;  4TLR A;  3BEG B;  2OFG X;  4H54 A;  5ETM A;  4USM A;  2PFD A;  3HCX A;  2FVR A;  1U26 A;  2HFU A;  2XO7 A;  4W4M A;  4CNZ A;  4EUV A;  4ECR A;  1D1U A;  2HRY A;  1VQP S;  1RTZ A;  3ZZY A;  3CCL S;  1Q95 G;  3EUN A;  3NMA A;  4GKJ J;  1UVN A;  1EX8 A;  3KFW X;  4ES1 A;  1QAY A;  1NH7 A;  1N2L A;  1NLK L;  1VDH A;  2NXC A;  4QYZ J;  2D3Z A;  2BAN A;  3P45 B;  3OR1 B;  3EGN A;  3IR5 B;  5LL6 d;  2I2Y A;  2KTQ A;  3CMR A;  2CQP A;  4C2M A;  1X8D A;  1TTH B;  5IC4 B;  1BWV A;  2DBB A;  4X4Q A;  4A8M P;  3G82 B;  2A3J A;  4YB6 A;  4DF8 A;  2GZO A;  2ZEJ A;  2KZZ A;  4YY3 J;  2RQ4 A;  2GQC A;  2E1M C;  1LFW A;  2IDL A;  2ABY A;  1TZ0 A;  2FGC A;  4NOH A;  5DZ7 A;  3R97 A;  1R7I A;  3G6Y A;  2DCU B;  2GW8 A;  3J81 j;  2Z2M A;  1TV6 B;  3BR8 A;  2RUG A;  3DYA B;  1BQM B;  1HI8 A;  3FEY B;  3UR3 C;  2L9N A;  1WDT A;  4NXN F;  1HBO A;  1PJ6 A;  1B3T A;  3CCM S;  1FNM A;  1SH2 A;  1FT8 A;  1Y9O A;  2WON A;  2OTJ S;  5K20 B;  4ALZ A;  4PEO A;  3QZ8 A;  3P96 A;  4WKY A;  3V6D A;  1PJ7 A;  4XTT A;  2R8I A;  3ICL A;  1G2E A;  2QC3 A;  4YS2 A;  3AY0 A;  5E2Q A;  2BW2 A;  1U6B A;  1ZH5 A;  1CLF A;  2AIR B;  3K0J A;  3MPV A;  3GJT B;  1JMT A;  1UJ6 A;  4OI6 A;  2GA7 A;  2MZR A;  2JLE A;  4GTZ A;  5IJS A;  2RS2 A;  3HK2 A;  2GMJ A;  3HVA A;  4PZV A;  1NBE B;  1UEV A;  5HLF B;  1B64 A;  2RRA A;  3BYP A;  3PAC A;  1F9F A;  2GQQ A;  2W8D A;  3OFF A;  4P72 A;  3QMQ A;  1V5V A;  3D6H B;  4FDJ A;  5C7P A;  3M9M B;  1WHX A;  4I0W A;  5E3A A;  4ZCI A;  5C24 A;  1V3R A;  1PYO B;  2GIQ A;  2M4M A;  2ZD1 A;  4ZCK A;  5F9L A;  2ILZ A;  3SFG A;  4U95 A;  2V69 A;  5ADZ A;  3GJR B;  3MR2 A;  4X64 J;  4B9M A;  1FI4 A;  1TMJ A;  1TAU A;  2WSF C;  3BGR A;  2JL9 A;  2ROE A;  1RYS A;  4B08 A;  5DJB A;  5KFX A;  1CJT B;  2FJW A;  2VG6 B;  2ZZT A;  3HD1 A;  1WC0 A;  1HNV A;  4EU0 A;  1NB7 A;  3P5T L;  4A8F A;  1FXR A;  2HLT A;  2YPZ A;  5EX3 A;  1O99 A;  3M2R B;  2HAI A;  3M1V B;  3HVT A;  3ELH A;  3N0V A;  3SZ2 A;  3MXH P;  4DR4 J;  1WF2 A;  4J9S A;  3M9N B;  3HKZ D;  3T3F A;  2AGP A;  2MYF A;  1HJK A;  3I5B A;  4QWD A;  4DV5 J;  3BV8 A;  2G2Y A;  2Q3P A;  1PKU A;  4OZ3 A;  1OY8 A;  2K1R A;  2R7T A;  3TEH B;  3DGP A;  1EAY C;  4OYZ A;  4USK A;  2NZ4 A;  4RU2 A;  4DMZ A;  2KVI A;  4I7F B;  3QT6 A;  5KG2 A;  4J9P A;  1AUS L;  3CED A;  5IXU A;  3RAQ A;  3KK3 B;  2IJF A;  1YJU A;  4DPT A;  4DFJ A;  1JNZ B;  1A0O B;  3W1Y C;  4M94 A;  5L1J A;  1XBW A;  2L3M A;  5KOW A;  3PZP A;  3MI7 X;  3W8P A;  3V4I B;  3DLE B;  2Q6B A;  5A6P A;  4LF8 J;  1RWK B;  2VB6 A;  4KIA A;  2BJ9 A;  2IFX A;  4QIG A;  1F5A A;  5BYR A;  3V81 A;  1C1B A;  1U02 A;  2C3O A;  1UW4 A;  4OFZ A;  2ERR A;  4J9L A;  3DI6 A;  2ZVI A;  2HWH A;  4K4W A;  2OFH X;  1YBT A;  4EBD A;  4DQQ A;  3PKM A;  3HHK A;  1MWY A;  4TY9 A;  3OTO F;  3SEO A;  5D4L A;  2CJY B;  4DR3 F;  3SCL E;  4C8L A;  3BDG A;  3PG9 A;  4DR4 F;  4GKK J;  3M6V A;  2LQJ A;  4MY4 A;  2QLW A;  4Y00 A;  3I0S B;  3EZO A;  4K4T A;  2FJB B;  1N4L A;  4LR8 A;  2J5A A;  2FGO A;  4OZJ A;  1SJF A;  4OX9 J;  3ENV A;  3LP0 A;  1UZH A;  3BQ1 A;  3NVL A;  2GAG C;  2U1A A;  3MPY A;  4DUZ J;  4LVN P;  3OTB A;  4KYZ A;  3FBB A;  3Q8U A;  4H4M B;  4WZQ A;  3V6K A;  4UQT A;  3AFG A;  4P7V A;  4E8U A;  3PR4 A;  2VKR A;  3EXC X;  4LRA A;  4JI7 J;  2FZC B;  4G65 A;  3W8G A;  4DEZ A;  1MLA A;  4N76 A;  4FNH A;  2BJD A;  4NA2 A;  4ZJL A;  4UOO A;  4LIR A;  4USH A;  2IVY A;  5HK4 A;  3ZTS A;  1HNZ F;  2WW4 A;  2RKI B;  3T9Z A;  1JLE B;  2DHA A;  1JLF B;  1FD8 A;  1Q7Y T;  4EK2 A;  1UWA A;  1RAH B;  5AT1 B;  1HPZ B;  3PJX A;  2XCP A;  2UP1 A;  5HBM A;  4ECT A;  2IBK A;  2CPX A;  1N32 F;  5ETT A;  3Q22 A;  5KFC A;  4BC9 A;  2OEM A;  4MK7 A;  4O4G A;  3OSN A;  5EN1 A;  5F8J A;  2UUB F;  4GTW A;  3ZTR A;  2VBX A;  1JLE A;  1S79 A;  1RT3 A;  3LGN A;  3CUN A;  1NJX A;  3BDP A;  3ZXW A;  5LIA A;  4LFC J;  3MEC B;  4J9K A;  1DQ8 A;  2MLY A;  2DRA A;  2VD3 A;  3A4T A;  4QJV A;  1NZ8 A;  1FO1 A;  2A18 A;  1KQS R;  2ZC3 A;  4ID5 B;  4NCG B;  4EO6 A;  3TA0 A;  3UN2 A;  5I4M A;  2XWY A;  3Q0A A;  2DXD A;  2ZIT A;  4P9S A;  2QV6 A;  5CZX A;  4DL7 A;  3SI8 A;  3M8Q B;  1Q8L A;  3IM9 A;  3DGP B;  4KY3 A;  1GAO A;  2VFV A;  3D54 A;  1KP6 A;  1RIS A;  2FY1 A;  4B3S J;  4KH0 B;  1T95 A;  1VIS A;  3AQP A;  1PC5 A;  2G2Z A;  1U1L A;  3HSD A;  1I94 F;  2UXD F;  2B9E A;  1RWW B;  3ILO A;  3W65 A;  3Q8S B;  4PUO A;  2LDI A;  2AV5 A;  3DRR A;  3W2W B;  5KFZ A;  4DCJ B;  1EI6 A;  4AD6 A;  2Y3Y A;  2V0N A;  4OI4 A;  3MPW A;  2IM0 A;  3KMQ A;  2OSQ A;  4O23 A;  5F0W A;  3SBM A;  4AL7 A;  3CME S;  4FYD A;  3WAY A;  4TQR A;  1Y7A A;  3CJT A;  2AX0 A;  4LF4 F;  1T3N A;  3VQT A;  2G1D A;  1YVF A;  5KT5 A;  2C3M A;  4RW8 B;  1ZA2 B;  1XC9 A;  4B3O A;  3TA2 A;  3D68 A;  1SQF A;  2M70 A;  5KFL A;  1FKO B;  3J7Y I;  3MFH A;  2FZK B;  4ZCL A;  5D8H B;  1BQX A;  2M8H A;  2YNF A;  2L9W A;  4ED8 A;  1CPZ A;  2VU5 A;  1K1Q A;  4RW9 A;  3UDV A;  1E6Y B;  3MMA B;  2GQ2 A;  3H5U A;  4DSK A;  3NGK A;  4PPZ A;  5M2U A;  4HTJ A;  3G6V A;  4F50 A;  4QU7 A;  5B0C A;  3DU6 A;  1HWL A;  3T5K A;  5CZV A;  5HO4 A;  3WIV A;  3T1H F;  3NCQ A;  1MG7 A;  4P2F A;  2HHS A;  4FYV B;  4I64 A;  1WTF A;  4NWJ A;  3PX0 A;  2JSX A;  3FRY A;  3L09 A;  3RAX A;  1TFW A;  1S10 A;  3IM8 A;  4DL4 A;  4F8R A;  1XEZ A;  3R5C A;  2XSJ B;  4DV3 F;  1FEE A;  4QIF A;  4UOC A;  2UVU A;  2WVC A;  1BE4 A;  4I56 A;  4DHV A;  3K5L A;  2XYP B;  1JLG B;  5E0O A;  4O3N A;  2XLK A;  2RD5 C;  4YN3 B;  1EAR A;  1TL3 A;  4BC7 A;  3T9N A;  4DV5 F;  2RAQ A;  4GRS A;  1KR4 A;  1U0S A;  3K7R A;  3OT9 A;  3PYE A;  4KO0 B;  3KK2 A;  4UPL A;  1ZET A;  1OS5 A;  2B0G A;  5IT9 Y;  2H65 B;  4NLY A;  1O6X A;  4B17 A;  1F0X A;  4NXM F;  1EP4 B;  3C16 B;  4OHV A;  2GO9 A;  3UI3 A;  3QLH B;  4RNF A;  4DV7 J;  3SMZ A;  1P6T A;  2GAH C;  2GIR A;  3OJU A;  2BE7 D;  2BQU A;  1T8E A;  1HR0 J;  4WJB A;  4JV2 A;  4JI5 F;  3DRS A;  4NCG A;  3DN9 A;  2VPX B;  2EPI A;  1BUX A;  2N4D A;  2QE5 A;  4WFA Q;  4DCP B;  3T5H A;  1KHL A;  2U2F A;  3KLE B;  4I1T A;  4LRB A;  3I9V 9;  1AZS A;  2VG5 A;  2DNQ A;  2L9D A;  1JNR B;  2NRE A;  2RF2 A;  3OSP A;  2W9C A;  3FC9 A;  3NXZ A;  1LNQ A;  1XMQ J;  1HIY A;  1SL1 A;  2DRB A;  3QYY A;  4KHM A;  4PG4 A;  4CLT A;  3MAA A;  1ZEB A;  4JI4 J;  1LWE A;  4HI2 A;  1C1C A;  2ZH3 A;  3UNG C;  3UW1 A;  3GIM A;  3TW0 A;  5DDP C;  1VQL S;  2GSU A;  2RRN A;  1RKI A;  2QYC A;  4V1A k;  5DZ6 A;  1RA7 A;  5B0A A;  3SCI E;  5HVH A;  3NMR A;  3LA0 A;  4K4Z A;  2I9S A;  3L4B C;  4X84 A;  3CCQ S;  3HJF A;  2OMO A;  3M2U A;  2NSB A;  3GB0 A;  4DQS A;  1PCA A;  3VV2 B;  4WYW A;  2KJV A;  2HGN A;  2CG4 A;  2GGP A;  4K0K J;  4F25 A;  2DYA A;  3PEH A;  3DM2 A;  3KKF A;  5FDL A;  4QW9 A;  3DOK B;  2JC1 A;  1N56 A;  3QWU A;  5HAT A;  1U24 A;  2WRM A;  3D6T B;  5F8H A;  2PMH A;  3OLA A;  3OUY B;  4B3O B;  4GTX A;  1ALJ A;  1YG0 A;  2HND A;  3MAH A;  2ANH A;  5C42 B;  3R2C J;  2HHP A;  2M52 A;  3VGT A;  4C9D A;  1N6Q B;  3N6N A;  5KG1 A;  4LBP A;  3MF5 A;  1ALI A;  2M5Y A;  3R2D J;  2P6S A;  2Z0G A;  2DY9 A;  2FY8 A;  2P6T A;  2HZV A;  3MM6 A;  4DL3 A;  5C5J A;  2W8K A;  2F9J A;  2YNI A;  3D9B A;  3FCH A;  3HF5 A;  3JSB A;  4TKT A;  3W60 A;  4ILM A;  3MAQ A;  1N5S A;  1SPB P;  4M63 A;  1Q86 T;  3E2E A;  1NAQ A;  2OPP A;  3BH7 B;  1PAU B;  3FGV A;  4DX5 A;  3HFV A;  3OL8 A;  2GVD A;  5GAD I;  3TUP A;  4DJB A;  1RWU A;  5A0Y A;  3IC1 A;  1XNQ F;  1UCN A;  2DNM A;  4PAA A;  4A48 A;  4DR1 F;  4C8O A;  4ZOS A;  4CLW A;  1RAG B;  2AMC B;  2ZDO A;  2V4Q A;  3LAK A;  1RT7 B;  1O51 A;  2P9C A;  1T9X A;  3G82 A;  4URG A;  3CCT A;  1OSC A;  3IRW P;  2IAJ B;  4XK8 C;  5IQQ A;  2BKN A;  3HHD A;  4FKY A;  3TA1 A;  4ZA1 A;  2R7U A;  4A8O A;  5AXL A;  4I7F A;  2MST A;  1YZ6 A;  3IMQ J;  2G4B A;  2FHM A;  1KHK A;  1HYS B;  5GOV A;  2Y9H A;  4M5G A;  5IFM A;  1H7X A;  3P3D A;  4DPX A;  1UFK A;  1O8B A;  1RAO A;  1RWN B;  2A10 A;  2GHW A;  2Y1J A;  3OR1 A;  1CVJ A;  4G6V B;  4X66 J;  2OD4 A;  3G4S S;  3EZ5 A;  4NA1 A;  1QSL A;  3NKQ A;  4TU7 A;  5GAE I;  1O0P A;  2EFG A;  2HS4 A;  1TV6 A;  5M2R A;  1RCX B;  5GAH I;  5IM0 B;  2MZT A;  4F0K A;  3VR1 A;  4V19 X;  3QRR A;  3ZTQ A;  3MCS A;  2MZQ A;  1FE0 A;  1HA1 A;  2RH6 A;  1U45 A;  1NSK L;  3RR7 A;  3BGU A;  4AYB D;  3OL7 A;  2Q43 A;  3QID A;  2AX1 A;  3MOZ A;  4MTP A;  3CXC R;  1NKB A;  1Q82 T;  2IBO A;  2VFS A;  3SSR A;  4XO0 A;  1T05 B;  1SH3 A;  4O3S A;  4PR6 A;  3TX0 A;  5IWA F;  3H25 A;  4NCB A;  1J5O A;  5HN0 A;  5AXM A;  3NL0 A;  2VOP A;  4I2Q B;  2ZFH A;  1VRU A;  3GG0 A;  4MK8 A;  3MPD A;  4TNO A;  1C2P A;  4CM0 A;  5C24 B;  2F1F A;  2XY7 A;  1Q8K A;  1MN7 A;  2B7B B;  1YJV A;  3DRP A;  4V19 J;  5IZH A;  1QLN A;  2CDR B;  3FFI B;  3CDA A;  3H0P A;  3D7S B;  2E5J A;  2UZA A;  5LMN J;  3BGR B;  3BSA A;  4BHQ A;  4FVC A;  1X5P A;  2JVO A;  3GSI A;  1NSQ A;  2Z57 B;  3NOG A;  4OZ0 A;  2VPY B;  1Y3K A;  4QR0 A;  3ETO A;  1GMW D;  4C3M A;  5IJQ A;  3BGL A;  2HNY A;  5KT2 A;  1RDR A;  4CO2 A;  1XNR J;  2I5J B;  2OUG A;  1U2F A;  3BR9 A;  3PHT A;  1DTT B;  3QSI A;  2RB7 A;  4O0N A;  5LMU F;  3H5Y A;  3GQC A;  4HR2 A;  1VBZ A;  5D4O A;  4LF5 F;  2HHT A;  3K5M A;  1FFS B;  3CO0 P;  1UFL A;  4GMK A;  2M2B A;  3CNQ P;  5ETO A;  1NSA A;  2B4V A;  3W66 A;  4LFA F;  1T03 A;  4TU8 A;  3BQ0 A;  2XGP A;  3LW5 C;  3JYT A;  1KLM B;  1S76 D;  1S6O A;  2VBW A;  1HDH A;  1IBK F;  4R0J A;  4FYY B;  1OPI A;  2OEL A;  2ZH2 A;  1NXI A;  2LP4 A;  4IQM A;  2CPY A;  3M4X A;  1CSJ A;  4C11 A;  3KWM A;  2G0I A;  2C2Z B;  1BWE A;  1LWC A;  2CQD A;  2NPI A;  1WC1 A;  2YWE A;  1XTZ A;  4BLG A;  3F41 A;  2B8P A;  3E8O A;  1M5S A;  3MED B;  4YB5 A;  4DI6 A;  4K4X A;  1S9G A;  2MJU A;  2JEI A;  5CH7 B;  3FRZ A;  2V67 A;  2COL A;  4F04 B;  1NK0 A;  2VUG A;  4M5L A;  2F65 A;  1ZOT A;  3BYR A;  1SH0 A;  3GR0 A;  1B99 A;  4Y28 C;  5DLG A;  4JI5 J;  4LFB F;  3LAL A;  1F60 B;  3PIO Q;  4G1Q B;  5J2M B;  3HT3 A;  3VVT A;  4OHX A;  5EHH A;  1RTD B;  3MK0 A;  3W9H A;  1JLA B;  2YWW A;  3WAW A;  1TKD A;  3DCA A;  3EVO A;  3OQ2 A;  4WWS A;  4CO0 A;  3DI6 B;  4IG3 B;  4OZ2 A;  1RAE B;  1XJW B;  2WVE A;  4LT6 A;  2I38 A;  2B3T B;  4QZV B;  4RW4 B;  3DLE A;  3WX8 A;  3EDQ B;  1NK8 A;  3Q2T C;  5DDQ C;  4C8Z A;  4GKK F;  1WEX A;  4KBI A;  2RML A;  2KT3 A;  1B7Y B;  4PQA A;  3TAR A;  1GTH A;  1N5Y A;  4AUK A;  1VBK A;  2HQG A;  4NLU A;  3RBZ A;  1TU0 B;  2UXB F;  4N47 A;  4WK1 A;  3FQL A;  4OI1 A;  3W5X A;  1YQH A;  1RWV B;  1HQA A;  3CMA S;  2BE2 B;  2YKN A;  4ATN A;  3OHA A;  5AJ3 F;  1YGY A;  3DGV A;  2OPQ A;  3GFH A;  3IWX A;  2J0Q D;  1TKZ A;  3TZW A;  3BO2 A;  1HNW J;  3MMC A;  2HVH A;  1A9N B;  1RU2 A;  2RU9 A;  5J2N B;  1VQ8 S;  1NDK A;  1R8C A;  4DU7 A;  1WWH A;  2IVM A;  2K3I A;  3EGV A;  2DR5 A;  4K4S A;  5T7L B;  3G87 A;  2X3G A;  3MM7 B;  4HDH A;  4H4K A;  2YY3 A;  3RAM A;  4CLZ A;  3E51 A;  4E0D A;  4Y2K A;  4RW6 A;  1X4C A;  1IKV A;  1H2V Z;  1X7V A;  4QIV A;  2AD9 A;  4B9T A;  5HLF A;  1T9U A;  2GV1 A;  3CJQ A;  4HHU A;  4HT7 A;  4GO5 X;  1S6P B;  1Z4U A;  3JQM A;  4IH6 A;  4UST A;  3DLH A;  1FSU A;  1VK3 A;  4KJG A;  4ZK7 M;  1S1V A;  2YVS A;  1TVR B;  2VH7 A;  4PWU A;  2AT1 B;  4DR6 F;  3RBD A;  5I3P A;  4JI1 J;  4JYA F;  5CA5 A;  4J37 A;  3CDW A;  2K3K A;  3AB4 B;  1SL2 A;  2ZD1 B;  1HPZ A;  1HW9 A;  4AE5 A;  3ISZ A;  4R8U A;  1RXO B;  3A3N B;  1UA0 A;  2V5H G;  4OLP A;  1VQ5 S;  2KDO A;  2ZBC A;  4LR7 A;  4DPU A;  1HD1 A;  3NBP B;  2ADC A;  4U7C A;  1UTA A;  3T1Y F;  4F3O A;  2RVJ A;  4ED4 A;  2LEC A;  4OHY A;  1X4G A;  1LKZ A;  1ALK A;  3DXS X;  5KG6 A;  2VQE F;  1Q79 A;  1ZA1 B;  4USW A;  4CT9 A;  4MMO A;  3VAJ A;  3VAG A;  2V2Z A;  2CRL A;  1VHI A;  5KFQ A;  4UTG A; 
#chains in the Genus database with same CATH homology
 3T02 A;  3M8W A;  4CYR A;  4UOP A;  5LQQ A;  4KAV A;  3B5Q A;  4CXS A;  1KH7 A;  3OT9 A;  2IFY A;  5L0B A;  4UPL A;  3IDD A;  3Q3Q A;  4QAX A;  1EW8 A;  1E1Z P;  3BDG A;  3NKP A;  4KM4 A;  1P49 A;  5IJQ A;  1ALH A;  4MY4 A;  3NKM A;  4UOR A;  4LR8 A;  1ZED A;  1EW2 A;  4LRF A;  1SHQ A;  2W5R A;  3M8Z A;  3NVL A;  3T01 A;  1KHL A;  4ZGA A;  3KD8 A;  1ZEF A;  4LRB A;  3UN5 A;  4LRA A;  2GLQ A;  1N2L A;  4YR1 A;  2GA3 A;  2G9Y A;  2QZU A;  2IUC B;  1AJA A;  1AJB A;  1ZEB A;  1HDH A;  3CMR A;  3IGZ B;  1B8J A;  4B56 A;  4UOO A;  1ANJ A;  5DLT A;  3WBH A;  3ED4 A;  2GSU A;  2W5X A;  1E3C P;  3UO0 A;  2XR9 A;  3BDG B;  4UPH A;  5C66 A;  4ZG6 A;  1ELZ A;  3A52 A;  2IUC A;  3UNY A;  4LRE A;  5TJ3 A;  2GSO A;  4GTW A;  4LRD A;  1KHJ A;  3M7V A;  5INH A;  5DLV A;  5GRR A;  1ELX A;  4N7T A;  2X98 A;  3UN3 A;  3NKR A;  4CXK A;  1ALJ A;  4GTX A;  4KJD A;  5LIA A;  2ANH A;  3BDF A;  3MK0 A;  3WAV A;  3WAW A;  1ALI A;  4UPI A;  4GTY A;  2W5W A;  1AUK A;  3NKO A;  2GSN A;  1ELY A;  3UN2 A;  3M8Y A;  1KHN A;  1O98 A;  5EGE A;  5L0K A;  2D1G A;  4NWX A;  4GTZ A;  5IJS A;  4LR9 A;  1SHN A;  1AJD A;  1N2K A;  4ZG7 A;  5EGH A;  3MK1 A;  2W8D A;  5DLW A;  3TWZ A;  1HQA A;  4FDJ A;  3TG0 A;  4LQY A;  1EI6 A;  1KH9 A;  1EW9 A;  1URA A;  4FDI A;  4LRC A;  3DPC A;  3WAY A;  3E2D A;  1EJJ A;  1KH4 A;  1E33 P;  4MIV A;  1Y7A A;  3WAX A;  1URB A;  1E2S P;  3NKN A;  5HRT A;  1ANI A;  2XRG A;  5L0E A;  1KHK A;  5GOV A;  4KAY A;  2VQR A;  3LXQ A;  3SZZ A;  1O99 A;  1FSU A;  4KJG A;  4LR2 A;  2ZKT A;  1Y6V A;  3NKQ A;  3DYC A;  5K4P A;  1HJK A;  3MK2 A;  4MHX A;  4UPK A;  2W5Q A;  1AJC A;  5KXA A;  2W8S A;  1ED9 A;  2RH6 A;  5LRN A;  4LR7 A;  3T00 A;  5LRM A;  2W5V A;  1KH5 A;  4CYS A;  4TN0 A;  3IGY B;  2W5S A;  4NWJ A;  1ALK A;  2W5T A;  3TX0 A;  1ED8 A;  5AJ9 A;  3SZY A;  1EQJ A;  4CXU A;  4ZG9 A;  1K7H A;  3BDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...