4LRAA

Phosphopentomutase s154g variant
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
Knots found
sequence length
391
structure length
390
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTGADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
molecule keywords Phosphopentomutase
source organism Bacillus cereus
molecule tags Isomerase
total genus 139
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lraA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lraA01
2W5RA 3T02A 3WAXA 1ED8A 1P49A 4UOPA 4N7TA 4GTXA 1AUKA 3NKQA 4FDIA 1HDHA 1EW9A 2GSOA 1E33P 1EW2A 4KAYA 2D1GA 3E2DA 3IDDA 5IJSA 2GSNA 2GSUA 2X98A 3DPCA 4UPKA 4LQYA 1EJJA 4GTYA 3KD8A 3LXQA 1O98A 1KHLA 1ED9A 4LRCA 4CXSA 1ZEDA 3NKPA 2W5VA 4MIVA 3WBHA 1EI6A 2GA3A 4GTWA 4QAXA 4ZGAA 4KJDA 1ALIA 3TWZA 3UNYA 3MK0A 2IFYA 3BDGA 2W5SA 2W5QA 4B56A 3NKOA 4MY4A 4LRBA 4UPLA 5GOVA 3IGZB 5EGHA 1ZEFA 1AJCA 5EGEA 4ZG7A 2G9YA 4LREA 1K7HA 5LIAA 3UO0A 1ANJA 3BDGB 4CYSA 1ZEBA 2GLQA 1ELYA 3OT9A 4ZG9A 3M8YA 3TG0A 2W5TA 5DLWA 3MK1A 3M8ZA 1AJDA 1Y7AA 5HRTA 3BDHA 3BDFA 3B5QA 5L0KA 4ZG6A 1URBA 4LRFA 3UN2A 1ELZA 3ED4A 5DLTA 4CXKA 4LR9A 1KH5A 5IJQA 3Q3QA 1KHJA 1E2SP 1AJBA 5C66A 1HJKA 3CMRA 4KJGA 4UOOA 5LRNA 3M7VA 1E3CP 4UPHA 5AJ9A 5K4PA 2ANHA 1ALHA 4LR8A 1EQJA 3UN3A 4FDJA 4UORA 5TJ3A 5KXAA 1FSUA 3M8WA 1O99A 5L0BA 4KAVA 1SHQA 3UN5A 1E1ZP 1KH4A 1ELXA 3T00A 4YR1A 2IUCA 2XRGA 3DYCA 4GTZA 2ZKTA 1AJAA 2QZUA 4NWXA 5DLVA 5LQQA 4TN0A 2XR9A 1URAA 3IGYB 3NKRA 1ANIA 5INHA 1KH9A 3WAWA 1Y6VA 3T01A 5GRRA 1HQAA 3WAVA 1KH7A 2W5WA 4UPIA 1B8JA 4KM4A 4CXUA 3NKMA 5LRMA 1ALJA 2IUCB 1N2KA 1ALKA 1KHNA 3SZZA 3MK2A 3NVLA 2RH6A 4LR7A 3SZYA 5L0EA 4NWJA 3NKNA 2VQRA 1KHKA 4CYRA 2W8DA 4LR2A 2W8SA 3TX0A 3WAYA 4LRDA 2W5XA 4MHXA 4LRAA 1EW8A 1N2LA 3A52A 1SHNA
chains in the Genus database with same CATH superfamily
1LXJA 4EBDA 3G8QA 3PKYA 3VZHA 3DPCA 2EKNA 3CJTA 4DUZJ 1ZAWA 1YHQS 4CXSA 3JAMY 2DNHA 1VRTB 4X4QA 1NHUA 5HO4A 2W5QA 4B56A 2C2MB 5C24A 3GIIA 2DNLA 5IT9U 5B0AA 1KVJA 3TUJC 4A8WA 2K3IA 2IRUA 1PAUB 4NWBA 3WX8A 2X7IA 4ECUA 4RBVA 3CCQS 4KSEB 2FLOA 2VPXB 3FRZA 5E3QA 4C0OC 4TQSA 2RF2A 2VBWA 3QATA 4ZPCA 1NJWA 1FKAF 2G1HA 1S7HA 4HT7A 4M94A 1E1ZP 1PC5A 2EFGA 2YWEA 2GZOA 1RAFB 2CPEA 4QIFA 4PZVA 4DLEA 4LR7A 3FUYA 3GYGA 1X4GA 3ENQA 4IUFA 5HQLA 3QLHB 2B4PA 5EUHA 1L3KA 3IR5B 3NS7B 2AWZA 2ZHOA 5DLFA 3DOLA 4H4KA 1R8BA 3FJ2A 4FYVB 4J90A 4ILRA 2CJXB 3V6KA 3WQPA 5KTQA 2DGUA 2BR0A 2DXFA 5T41A 5CYMB 4HTJA 2QC3A 2A10A 4AFFA 2W4CA 2YKQA 1RBOB 4I6WA 2K06A 4J9NA 1FRLA 4YB7A 1JJHA 2R7QA 1CJVB 2VOPA 2HRUA 4EGLA 1F60B 1JQGA 5GADU 3OL9A 5HL7Q 3OTDA 2GHWA 4V19J 4FS2A 4QWAA 1T7PA 3M8ZA 3OSPA 1NDCA 3MMBB 4CT9A 3M9OB 2DR5A 1PO6A 4RW4B 4DV7F 3LP2A 4CNZA 3NRBA 1U1PA 4ANCA 1A7GE 2ZH7A 3RYLA 4ID5A 2ZH1A 4M5KA 1FXDA 2HS4A 1ZS6A 4JI2J 3SZZA 3ETMA 3L3CA 2OTJS 2NLWA 1HBOB 4FKXA 1SH3A 3H7HB 1U0HB 2R7RA 2ZE2A 2GW8A 1TU0B 2VOOA 2NPFA 3ILOA 3OR1B 4KV8A 4Q45A 2JL9A 3K57A 4F26A 4WU2A 3VAIA 1NH8A 3WBHA 5IOLA 2BXJA 3IM8A 2E9RX 3JTNA 2LFVA 2AJ1A 4ZG7A 4JI4F 2EI5A 3BDGB 3LF0A 4WKYA 3M1VA 2CDQA 1K44A 4UUWA 5LL6d 3WC0A 2DPIA 1PG5B 4KHMA 3L09A 5I42B 4P75A 1U1KA 4KJGA 4QYZJ 1WELA 2MJUA 3UD4P 2GAGC 3LGNA 2KM8C 4NPOA 4ZVGA 2IYGA 1NSKL 2QG9B 2O3DA 2G4BA 2K1RB 2E66A 2CZVC 2V5HG 4EBCA 3NCQA 4CM2A 4C8NA 3W8PA 4LRDA 5LM7E 3BGUA 2KVQE 4RKUC 1UJ6A 1X9MA 2BJ8A 1D8ZA 2J6UA 3MOJB 2HHQA 4DX5A 5CD4A 3KJFB 3S7RA 4DJBA 3QYYA 2UUBF 1QDUB 4ELVA 4DR7J 1FD8A 2FZCB 3AFGA 3KLHB 1OSDA 3PYGA 2JNJA 4LRBA 2J9EA 1QSSA 4ZOSA 2XMWA 2J76E 3MOZA 2DHHA 3T5KA 1Y0HA 3AAWB 2FDNA 4MIWA 5IC6B 4BC7A 3EDQB 4DL5A 5AE1A 2R7SA 4MJKA 2DNKA 2OH2A 3FMBA 3OL8A 2YKPA 4OI3A 2NUUG 3WC2A 2B8QA 5A0YA 3CJKB 2FJWA 1SJ1A 4GVBB 4JI7J 5H9FK 3HVTA 3D0GE 3DLKA 3HXMA 5DZ7A 1N6QB 3TAQA 4FVMA 1NK5A 3KLIA 1OMSA 2VB6A 2JVOA 3THVA 2O1PA 2VQRA 2OFHX 1VQ5S 2HMIA 4UY85 3TOQA 1NJIT 2JH3A 4FF2A 5KT7A 1EP4A 3ETOA 2WVBA 2W5RA 3EGNA 4IQMA 4DL0C 3NKQA 1C2PA 2QLXA 5B08A 1DHMA 2ZWPA 2NUHA 4DV1J 1NRKA 3MM8B 1N36F 5F3TA 3BO3A 4RBTA 1TFWA 4C48A 2BJ9A 3GFYA 2RE1A 5KFMA 1HNXF 1JWWA 1K0TA 1VRQC 3RAQA 1VQ6S 4QIGA 1HQUA 1GMWD 4LBPA 1WSVA 1NK8A 4DR4F 5BR8F 1RT4A 3R7SB 4CM0A 1TKXB 4DSJA 2DNGA 3VTIA 1Y7AA 4WE1B 2NXNA 5IT4A 3TP2A 3D3BJ 2V2KA 2DGWA 2WCXA 1E2SP 3E3XA 2VDIA 1RABB 1IJFB 2BBEA 2LDYA 2DHXA 2QRRA 4WJBA 1M5PC 4ECYA 4X65F 1HWIA 4NZ0A 1JLEA 1ZAXA 1S0NA 4U96A 2HPUA 3V81B 3KWMA 2XCPA 3BBCA 3QSYB 1AUDA 4JI5F 4BDPA 2FLPA 4IG0B 3T41A 2YTCA 1S59A 4J9QA 2DH7A 2GJIA 2LYVA 1D8YA 3I9V9 3P8BB 4OZ0A 2RHQB 4TU9A 1JLBB 2JX2A 4DUZF 2LEAA 2V34A 2CQ1A 1HNWJ 2I2YA 5B0DA 4F67A 4XPCA 2I9SA 1BQXA 1QD1A 4ZGAA 2AEJA 3QGPA 2XGPA 3PVXA 1O51A 1IKYA 4CWBA 2JC1A 4CIOA 2KT5A 1RBAA 3GJQB 3OPKA 1K47A 5HMZA 3J81Y 4QR1A 1RWKB 2L9WA 4DQRA 3G87A 1BQMB 3BR9A 2J7KA 3ZZYA 4U6PA 3MR6A 1U2FA 3DLHA 4ERDA 3CJSA 1SHQA 3MM7B 3PEHA 1UVJA 4NCAA 2VHGA 5J2NB 2XWXA 4Y2IA 2XRGA 3OR2A 3R2CJ 1R6VA 4HH1A 1YBTA 3DHXA 4RW9B 4Y0FA 2EKYA 2B5JB 1WG5A 2H54B 2IAJA 2YNHA 2R7UA 2JZ5A 4KH1B 2BM1A 4YQWA 3M8QB 3A12A 2QMUB 1S1UA 5B0FA 4JYAJ 4PKDB 1PBUA 4CTAB 2XI3A 1X4EA 2FJXA 4ZITA 2QL7B 1BD6A 2MSTA 2MEWA 1QM9A 3V6DB 2R7TA 2E1MC 4ETXA 2Y1IA 4U8VA 5LT5A 2XY6A 4USHA 5EX0A 1RADB 4AQYF 2YKMA 1ELYA 3HK2A 1RLCL 2VD3A 3MMCB 2WAQD 1U8SA 2E29A 1KHJA 4A8SA 1Q78A 4DV5J 2XS5A 3T9NA 1LWEA 3FEYB 2R8IA 2RDIA 1HA1A 3R5DA 3AT1B 3H5YA 1Q5YA 2V50A 3D67A 2M0GB 3KG0A 4B08A 3WAWA 2MQMA 3KLEB 5K9FA 3CC4S 4L73A 5A8RA 3KK1B 1Q8KA 1H2TZ 4PWWA 4PWDA 4B9NA 1EJ7L 3FNNA 4NL5A 2CQCA 3CCZA 4OJ1A 3FC9A 4DDFA 1ED8A 4N7TA 3G2XA 3U1NA 4U67Q 4NCBA 1EETB 3TJAA 3M2RA 4JP8A 1VQMS 3MMAB 3VAHA 2EFNA 2LP4A 3DM2B 3DRSB 2YWFA 3GFXA 2FVPA 4I64A 1Y5LB 4NMLA 6FD1A 4AD6A 2RRAA 4J37A 3SZ2A 4P10A 1FDNA 3K0JA 3KG4A 4B3TJ 2GJ2A 4P52A 1HD0A 1VOMA 3FBCA 1W25A 4DSIA 1PYOB 1SL0A 4Z37A 4ECXA 2KHCA 3KKFA 2PD1A 1ALHA 3C6TB 1JLCB 1RT3A 2H48B 1E6VA 3SDEA 2KO1A 2IMWP 3TVYA 4NA1A 1P8GA 3GPAA 5KT2A 2XCAA 1HYSB 2BEFA 3MEKA 1UVKA 1VLYA 1VBYA 1XNQJ 3SZYA 3DDIA 3ZNUA 3QAEA 3MD1A 1W2BR 1XMOJ 2A3JA 3WZ0A 3LH2S 3K59A 2XMAA 3S01A 1V6HA 1FF2A 2GV1A 3W64A 2BANA 3CJ0A 4USMA 3KLFA 4OHYA 4OQJA 2I5JA 4UOGA 4H4MA 2E1PA 3MM9B 3QJPA 3NGUA 2QO3A 4C8KA 1HQEA 1Q8LA 2W2PP 4MK9A 1M1KT 4LMZA 4G65A 1LV5A 3K17A 1IWAA 5A6WA 2R4FA 2KFYA 1ZM9A 1LK5A 5ETRA 4EWTA 1HI1A 4LF6J 1KOOA 3BDEA 4X4SA 4C8OA 1QAXA 1RU2A 2ZBCA 5HRTA 2AYGA 2JLGA 1S97A 1UZDA 3BSAA 3AY0A 4X64J 4K4VA 5KFUA 2W9BA 4LR8A 5HQ8A 4JI7F 4ILLA 1WACA 5K14A 3W5XA 1JXVA 4GTZA 1XTZA 1HI8A 3VQSA 3T1YJ 3CVKA 3PYFA 4UPIA 2XNQA 1R0CB 1X31C 1GQEA 2ZEJA 5A76A 4F4WA 2DISA 2HFUA 2BE9B 4IRKA 3R5CA 2G0CA 3R6LB 1JLAA 1WOPA 4MHXA 5A8WB 3M32B 4DL7A 1WSRA 2UV8A 4DV1F 2B0GA 4NMXA 3JQJA 3CC2S 4MMOA 5KFNA 5KG3A 3DMJB 1NO8A 1TMMA 4Y34A 4QYRA 3QO9B 4RJVA 4ECWA 4IH5A 4USTA 1KLMB 2HHPA 4DV0F 1REVB 4WK1A 3PTWA 2PFDA 4LFCF 3ZXWA 4P71A 1FCAA 4M8LA 5KFIA 1ICEB 5D4PA 2GGPB 1R6YA 5E2QA 1QAIA 3M8WA 2ZH4A 4ED1A 2CPHA 1IBLF 3IXQA 3NGTA 4ZHRB 4JI1J 2QL9B 2E1CA 3CJRA 2J5AA 3HZEA 4G3IA 4ZLLA 3MEEA 1GXLA 1NH7A 3GTYX 2ASDA 3NKMA 2IRYA 3H2UB 2GMLA 3MR2A 3VAMA 3NWGA 1MROA 3ZTQA 1QTMA 3MR3A 2CZ4A 2JHEA 3BN4A 6FDRA 1HNWF 4IKAA 4UOPA 2LQBA 2R8JA 1E33P 4WK3A 3HVAA 1F9EB 2L08A 2VPZB 2AHOB 3PKMA 1JLFB 3M2VA 3NNAA 2FLNA 3OTOJ 2RIJA 3MGJA 2XMMA 4LSZB 2WW4A 3GFHA 2UUAJ 1S10A 2YQ0A 4TLRA 4UOCA 3PHTA 3NY0A 2F9DA 2AT1B 2YH1A 1F2GA 1UFLA 2NXJA 4QIEA 3EZUA 1T3NA 1RT2A 4ZG6A 1PGZA 5D4NA 2X3GA 4ED6A 4A8OA 1H7XA 3EGWB 4JI3F 2FLLA 1RHJB 1R0BG 1AA1B 2WVCA 4ANDA 1F1BB 1T9UA 3LWMA 5B0GA 4A8KA 3R1HA 5HMWA 3IG1B 3KUGA 4Y2MA 2QE5A 2OKQA 1FFGB 2IVMA 4O4RA 3OVSA 3T1HJ 2EK1A 2FUG9 1WC5A 2B9WA 2IJNA 1SUQA 2ROEA 1CJKA 3CCTA 2GSOA 5HJYA 2PMZD 2FHJA 1RTJA 2PE8A 3CNQP 1SC1B 1OYEA 2PI5A 5KOWA 1MSWD 3VV2B 2WTFA 3GP9A 1HW9A 2MZRA 3KYLA 4WFNQ 3LOUA 4LSLB 3BH6B 3G96A 4FN5A 4EZ6A 3HHLB 2NREA 2CRLA 2C1EB 3ZZPA 4WFYA 3DI6B 3FBEA 4ER8A 1V5VA 1RACB 4ED0A 2HNZB 3L95X 1ZTTA 2RQMA 1HBMA 4GMKA 3PIPQ 5C66A 1CQMA 4LIRA 1CJTA 3A8JA 4XTTA 2AJFE 2CJ9A 2RQKA 3UN5A 1TUWA 4DV2J 3DLLQ 1ELXA 2QSFA 2VC1A 3DOMB 4RW8B 2CG8A 5IM0B 1S77D 2IMOA 4URQU 1RAEB 4RW6B 2G1DA 3M8PA 1WEXA 2AJQA 3KDNA 2RH6A 4B3RF 2FHKA 4CH1A 2WSEC 3MAAA 3PRVA 5CAAA 3Q8YA 1K73T 3C14B 4N5SA 4LT6A 4GTXA 1T9VA 2MKHA 3MM5B 2H1YA 4NI2B 3M8SA 4ETZA 5DQIA 4O3PA 1MN9A 3UVJA 4QCLA 2OD4A 2EG1A 2P9CA 5DRKA 1S9GA 3BDPA 1VGYA 1FKPB 4ZLNA 1ANJA 1TUGB 2FY1A 2LU1A 2ALYB 3OFEA 1LOUA 1RAHB 1PJ6A 2HBRB 5L1JA 3EZ5A 3ZTSA 2CQIA 2KB2A 5K5MA 1TL3B 1YVFA 2XGQA 2LVWA 1HWLA 5HN0A 3R5BA 4BWMA 5AE2A 3O5TB 3OL6A 2IUCA 1T0TV 5LQQA 4JI8J 2Z57B 1W7WA 4ALZA 4LFAF 1WORA 5KG4A 1IKVB 1CULB 5H9EJ 4CT8A 3WAVA 2C2EA 2JDJA 1XMOF 1PKUA 2JEGA 2HWHA 2DIUA 2OPPA 4U7UD 1YJRA 4JI0J 1XN9A 3K5NA 2G0JA 4EEYA 3J81j 4MKYA 3I5BA 3BEGB 1IQZA 1TL7A 1VQYA 2B9YA 3NKPA 3HJFA 1OS5A 4ZVPB 4YS2A 2QN6B 3S8SA 2KL8A 2F4VJ 3NMAA 3LP0A 1S1TB 2QLBB 4BCAA 4J5OA 3H4BA 2WVDA 3K58A 3M8YA 1BQNB 4W4MA 5L0KA 1RAJA 1U6BA 4FVCA 4O4GB 4NLSA 1VCTA 2F3JA 5KFSA 4Y00A 2VIHA 4ANEA 1D9FA 3CDEA 5CYQB 2MXYA 1KRPA 1G6BA 3T1YF 2QTWA 2P8IA 3ADAC 4M5IA 4PR6A 3N28A 1URAA 2FJBB 4YHHJ 1YKWA 5GRRA 2WSFC 1T95A 3I0SB 2FB0A 2KFZA 1PAEX 2EFQA 3I5AA 2MLXA 2JEJA 4BS2A 2HLUA 4I7FB 2HBYB 4OV1A 2HAFA 3K89A 2X98A 2C2DA 4NLYA 3D4JA 1RUSA 3MECB 3R27A 3FGVA 5E3AA 1K8AT 2R2RA 1WEZA 5HBMB 3GG0A 1HD1A 1S0OA 2UP1A 3EXYA 4C0HA 4DU8A 2DGXA 1U1NA 2QLJB 5KG0A 1UW9A 1ZBTA 2OELA 2AMCB 2W2QP 1MLAA 5HROA 2ZH3A 2VG7B 4R5PB 1LWXA 2V4JB 1KH5A 5FIIA 1S99A 2OO4A 2XYGB 3KFWX 3DDNA 1N5YA 1UAWA 3HSDA 4I2QB 5D8HB 1S1XB 5GMEA 3R7BB 3LWLA 3B78A 3SSRA 1IBMJ 1D0EA 3VQTA 1YJTA 1BWEA 2ZZMA 3JQKA 4C7QA 3PJ9A 4Y6IA 1ZM2A 3MCNA 4F02A 2PFFB 2FZKB 3OFHA 4DR6J 2AX0A 3EYZA 5BYSA 5F9LA 2B6AB 3HKWA 1IBKF 3MZIA 1TV6A 2KG1A 3J7YI 1SC4B 4QPXA 5ETNA 3M4XA 3X1LB 1RT1A 1EW9A 5IJSA 4KPCA 3M2UB 1OWXA 1X9WA 2HQCA 3D28A 4Y2CA 1TK8A 2L9DA 4OV6A 4B3MJ 2DEJA 2QMWA 5LXYA 2R2TA 3DOKA 2GVDA 4WFZA 1Q8IA 1WNEA 3MUVP 4FXVA 3MPDA 2YNFB 4OYIA 4OYOA 2Z58B 3DCAA 4XPEA 1S1WA 3H2LA 4ZG9A 3R8YA 4BBYA 3MDFA 3MK1A 5HVFA 2VQFF 4GKJJ 2MZJA 4S0MA 5KFDA 2DGSA 3O6QA 4F4AA 4A46A 4GRSA 2FJVA 1EZZB 3IWLA 1H38A 1LWCA 2O5DA 3BGOP 4P6QA 1WOOA 1TVRB 3K7RA 5CH7B 4MK7A 3NEKA 4GC7A 2HQDA 3E8OA 2V8PA 4N8NA 2I0XA 1FX2A 1R8HA 1IR1A 1NPRA 2BE2A 1P49A 1T11A 1HDHA 4PXBA 1VRTA 3WIUA 5F3ZA 3ENAA 4J9UE 3NOGA 4FYYB 2BZ2A 3H90A 4WYWA 1UJ5A 3G82A 1O98A 1J5OB 4DSKA 2UXCJ 5K8PA 1UA1A 1VFJA 2CJAA 3NKOA 3GB0A 2R2SA 4TY9A 5GOVA 3JAMU 2FPHX 4F2RA 4ZMMA 3DLEB 2OPSA 3NGSA 4RL1A 4NLTA 4OMFG 2BUNA 1XNRJ 2I6WA 3D1OA 2IIHA 1E3CP 4B9LA 4KPYA 2OPRB 3UDEA 1X4BA 5GMKa 5FJ4A 2XEXA 1IN0A 1UA0A 4DBQA 2DGOA 2LXIA 2MY7A 1KN6A 3PIOQ 1SIWB 1V9OA 2OGUA 2DR8A 4HACB 3MFHA 2D74B 2J0SD 2PA3A 5J1EB 3TRGA 3QLHA 4GO5X 3X3UA 2PMHA 1HQ2A 2RS2A 4JV5J 2XB2D 4C8LA 1VC6A 4K0KF 4LRAA 3FRYA 4J9OA 5CYJA 5H9EK 4M5MA 1VRUA 3QRQA 3GILA 3C6UB 2XY5A 2KXFA 3NXZA 3LXQA 1DLOB 4YY3F 2U1AA 5KFQA 2CKWA 3KXDA 2AEMA 3P96A 4URSA 1YITS 1YDLA 3GV7B 3PW5A 2NR0A 2NYHA 2Z30B 2DXEA 4WIQA 3MMBA 4DX7A 2HHUA 1BE4A 1P6TA 5DLWA 4KFBB 3CMES 1AJDA 3DGPB 3HO1A 4KIAA 2DBBA 3UCZP 2DNYA 1GH8A 3OVBA 1FI4A 4K59A 3LP1B 4RW4A 1HBUA 2W2MP 4M5JA 1KR4A 1OQ3A 3OLAA 1FTCA 4ECZA 1UEUA 4IRCA 4X62F 1OYDA 4NASA 1D1UA 1NZAA 4DX6A 4LF8F 1VDHA 1XBWA 1LW2B 5D0HA 4LF9J 3DXBA 3FSYA 4JI0F 1FXLA 1U0HA 2OI2A 5LSLA 2H9ZA 3EZOA 1Q7LB 3TO8A 2FVSA 3H8YA 2QFIA 2RQ4A 1YJ7A 4NX9A 4CLFA 3GJTB 2HHHF 1NZ8A 3NCPA 4Q2LA 2ZHBA 3W65A 4DV3F 2F4VF 4KHPJ 2E1AA 4GTWA 2HFNA 3RUBL 4O3RA 5HATA 3BDGA 1B7YB 2AJ2A 1KEKA 4RUBA 4OYPA 4DQQA 2BOAA 3AQPA 3VAGA 1M0SA 4PQUB 2B9XA 2BKOA 1M5KC 3F73A 3B4MA 5CD4H 3C66A 3L4BC 1BUXA 2RH3A 2HURA 5EWFA 3UPFA 4KGVB 4OIXA 5IQQA 3Q8QB 2DNMA 5F9NA 3C16B 5A2QU 3C3LA 3F0NA 2K1RA 5ETQA 4YHHF 2IA6A 3HM9A 3W9HA 4A4JA 3KOAA 2YKAA 3PY8A 2WB4A 4K2JA 3OUYB 3WBZA 1F5CA 3EWGA 4KKOB 3GLJA 4X4UA 1RAOA 1HHQA 2JEIA 3LO3A 4TU8A 2XLIA 1XR6A 3SYZA 1I94J 2UVUA 5ETTA 4RBUA 3Q89A 4C6AA 1EIYB 4MYTA 3W2VA 3E01B 1R43A 2RKIB 3BQ2A 3PG9A 4JI6J 5HMXA 2EW9A 3KLHA 2BABA 4NRUA 1KHLA 4LJMA 2W5VA 1KQSR 4PAAA 1YK9A 1WKJA 1JJ2R 4ZLJA 1D9AA 2G2ZA 5D0GA 2OTLS 3DGVA 1EARA 4AXIA 4Q8FA 3FQLA 4C98A 3K5LA 1URBA 1TAUA 2NPIA 3CJKA 5ETKA 1C0TA 2HFSA 4GVBA 3UD5A 4LF4J 4HDHA 2BACA 2EFVA 1RHQB 5D0EA 1AFIA 3BO2A 5KG1A 1N6QA 4DR6F 4X84A 2XR9A 1BMQB 5AXKA 1RB0A 4NXNF 2QA1A 1R31A 2VASA 2DVIA 1CLFA 1HNVA 2H5JB 3TAPA 2UVVA 2BE7D 1SIZA 1EB0A 3M6VA 5DDOC 2ZD1B 5JJBA 4RUAA 3I5CA 3MM8A 1SQGA 3AHPA 3JSBA 4H4OB 3U1MA 4QZVB 3DRXA 4LRCA 3BPDA 4Y2AA 3ISZA 2GQCA 3AD9C 1KLNA 4NOHA 1SJRA 1TKXA 3GYNA 2BW2A 4OX7A 1TKDA 1S9FA 2OEJA 5IXUA 1IXKA 2GA7A 2QSWA 4FBUA 4TKTA 4NEYA 2YKOA 3NL0A 3IGNA 1NU4A 1J5EF 3ZZUA 1NBEB 1ZM3A 5JUMA 2BA9A 3ZZOA 2U2FA 3OBIA 3V81A 2WONB 2DH8A 2ALZA 2P5VA 2IC3A 1R27B 5I3PA 4OX9F 1DBDA 2F63A 1KH7A 2OFGX 2CUYA 1VC0A 1PJ5A 1HMVA 3ISND 4IG0A 1MWYA 4FS1A 1U26A 2VG5A 1YWXA 3QJJA 1RT5B 4DR5F 3CDUA 3R3TA 4PYAA 1FK9B 4O3OA 1NPPA 4CH0S 1I5OB 3MPVA 1K9MT 2V63A 1S76D 2XBPA 1FRXA 3KDOA 3BV8A 5U47A 2HRYA 1HPZA 2ZC3A 4OL8A 4AE5A 1X5TA 2O01C 1VHIA 2J9CA 2DIVA 3RU0A 2MGZA 3TX8A 2HNDA 3RG6A 3IWXA 2B56A 1FFWB 5HK4A 1BQMA 3OTEA 1R8AA 1UPPA 2WHOA 3ZNJ1 4J9LA 3KJNB 2ZUGA 4L3KA 1HJKA 5CCLA 1RT6B 3BSNA 5J2NA 1SKWA 1C4CA 4RW9A 2OAUA 2DNQA 4ICLB 1R8CA 5D15A 3DYCA 3B54A 4NWXA 2LQJA 4A47A 3K5PA 3P49B 4LF5F 1R0AB 2VFSA 1JXLA 1G3OA 4PXCA 5F8MA 4FF4A 1NJYA 5B0BA 4P2FA 4L72B 3JTPA 3NS6A 2GFFA 1CJUB 2RF2B 5IWAF 4K4SA 4J9PA 3TVKA 3T6JA 3W5YA 3LUYA 3QBCA 1Q1KA 1U48A 1VQOS 1D9DA 1OY6A 3VGVA 4DS5A 4UW2A 1WTFA 1WTBA 2AGPA 1GNKA 3HJVA 3G6XA 1KQKA 3MMCA 1NDLA 1T05B 1DARA 5DM7Q 3DLGB 3PEJA 1RKJA 3SFGA 4XO0A 1YBAA 4CO2A 4IR1A 4ED5A 3B5QA 4RWXA 2Y1RI 4CXKA 1N5VA 3IS9A 2AJ4A 5RUBA 4JV0A 2WVFA 2J7WA 2NS1B 1DQ8A 5L0BA 3KLEA 1VQNS 1Y4ZB 3KK1A 4PUOB 4C8ZA 4ZA1A 4A8FA 3PW0A 2FJDB 5ETMA 1P27B 2CNNB 3KG1A 2DHAA 1FKOB 2OMLA 1EETA 4DL6A 1YJNS 6AT1B 4B9MA 4KHRA 2VC0A 3VALA 4ID5B 4QIWD 2EC0A 3RJMB 2LU2A 5DG8A 4RW7A 3KUHA 2EC2A 5HJXA 3F41A 1ZEFA 5BXIA 5JXSA 3R97A 4N47A 3RRKA 1CVJA 2CADA 3QRPA 1JLCA 2DO0A 1JKHB 1K1QA 1EKSA 3FCWA 3AOAA 1N33F 3HPOA 4R0EA 4DL4A 1FDBA 3I0RB 1CQNA 2V4QA 1VBKA 3SSQA 2VG6A 1KH4A 4ZVRB 2Y1LB 4P72A 4U95A 3NOCA 4DF8A 1I51B 4X4PA 3M1VB 3RB4A 3KLGB 1MWZA 2OD6A 1C1CB 1I94F 4YB5A 4CO0A 2C3MA 1JNRB 1WJ9A 5KFTA 4KGMA 4RNFA 3HHLD 2V4RA 3MM9A 2C2RA 1N0VC 4F4XA 5L9XA 5HLFA 5A8KB 2GJFA 2EXUA 2KG0A 3DHWC 3ZZRA 4CDIA 3DYAA 1AYEA 3I55S 3QRRA 3TVZA 4USJC 2MQPA 3OJUA 3GIJA 2W2OP 4CLPA 5ETOA 1SI9A 3AQOA 4ED8A 4USKA 4IG3B 3IWNC 2COLA 1IR2A 2XTJP 5EN1A 2YX1A 1WEYA 1FJGJ 3D9BA 1U1RA 3CMRA 2K2PA 1Q79A 2ANHA 1LXNA 4W92B 4C97A 2ILZA 3L9ZA 2IJRA 2RU3A 5L1IA 2O67A 3L7OA 2E5IA 2OP5A 1YJUA 5IV3A 1FWLA 2RILA 5A8WA 3M32A 2CPFA 1YIJS 3BH7B 1RZMA 2N7YA 4WFAQ 3NKNA 1N32J 1M1GA 3JQMA 4MIAA 5KFPA 2V69A 1UVMA 2HNYA 4NYZA 3FZBA 3NWRA 4DQSA 3V6JA 2DYAA 3Q8VA 3DRRA 3QO9A 4ZVTB 4FBTA 4LQYA 2DO4A 3HVTB 1DAXA 2IJFA 1P1LA 4URGA 4PG4A 1KLMA 1KBRA 2MZQA 4USVA 3TJ8A 4WXWA 1REVA 4ZN1A 3PW2A 2W5SA 4WBFA 2GIQA 2YKNB 2QYCA 2HMIB 4JV2A 2MHNA 1T03A 4LQ3A 1EP4B 4HT5A 3N6LA 4EMDA 2FJEB 3NBPA 2IRXA 2GGPA 1S9EB 4LFBF 3B82A 1GXUA 4NZ7A 2HG4A 2IM0A 2QLFB 2NXUA 1HW8A 1Y5IB 4ZHRA 4OZ5A 1QAJA 4NA3A 1U02A 4UPHA 1FJEB 1HWJA 4PCQA 5AE3A 2UUWA 4QWBA 3W1YC 1HQUB 9ATCB 4Y28C 1T9XA 1GMUA 1RT4B 5JVGQ 4DR1J 3S1TA 5M2UA 4CLWA 4R8UA 1ALJA 2DKOB 2ZOFA 2POKA 1TL5A 2HVHA 3HZGA 2DXDA 4PYDA 4NWJA 3FVYA 2AU0A 4CYRA 3ZO7A 3GG1A 1NHKL 3PNIA 2R8KA 3EICA 1Q4RA 4NLQA 3O1LA 1JLFA 5D4OA 2D3O1 1OQ6A 1C0UA 3N6NA 2I38A 4B3OA 2V9WA 4FPRA 1JLEB 3A1YG 1VJQA 2D69A 4P2SA 3M6WA 2RAQA 4WP8A 3PW4A 5H9FJ 3HLUA 1WKLA 2VODA 4OHWA 3MTKA 5GADI 3HX9A 3MEDB 1WC0A 2CPXA 1NM2A 2ZM6J 3WX4A 1OIAA 3BPSP 3ZTOA 3D1HA 2BJ3A 5E7OB 4GC6A 1LW0B 2UUCF 1FE4A 4HEA9 2UXBJ 4C11B 3W63A 1X4CA 3TJ9A 4RU2A 2QZUA 4NLOA 1WC4A 3T5LA 5T7LA 1OY9A 2MZTA 3CJ4A 3P5BP 1H73A 3LALA 4EYHB 1RXOB 4HKQA 2AGQA 2HZAA 4DCOB 3FBBA 2UVWA 3MXHP 1VYAA 4A8XA 2BKPA 1JX4A 1P9QC 4I4BA 1X0PA 3IP0A 1HNZJ 2E5HA 3MHYA 4L6V3 4P7TA 5B0EA 1WI8A 2PN6A 2EK6A 3W62A 3DU6A 4J7CA 3DN9A 5ITHA 3RBZA 2B3TB 1S6UA 3DLBA 4LSLA 2AD9A 1U24A 1PC4A 2ZH5A 1Q0NA 3DI6A 3U7JA 1SC6A 4LVOP 4NLDA 3JYTA 2YNIA 3CDAA 2C22A 1U45A 2ADBA 2CYYA 1IQTA 1S1UB 2ZHAA 3MCSA 2D9PA 2ZH9A 1QY7A 4DFJA 4QW9A 2QMXA 3M7VA 3PJWA 3DOMA 5IM0A 1I6JA 4ZVUB 3BSCA 2R42A 3TEGA 2K8GA 4RW6A 2KXHA 2HIQA 3DLJA 1ZTWA 2D3UA 2YKMB 4ECTA 2FC9A 2AEFA 4DUYF 2H5EA 3ILJA 1T8EA 5A6PA 1NK6A 1URNA 1X5PA 4NA2A 4LIWA 1NEEA 4HVZA 1LWEB 2HBQB 5L46A 4CLUA 3BSOA 2EPIA 2EBEA 3CPWR 4LF2A 2CG4A 2M88A 3U27A 3ZZZA 4NI2A 2V68A 3KMQA 1N34J 3PRBA 2NXCA 4PG5A 2CJBA 1L5UA 4KTQA 4F3MA 3RBEA 1X60A 3QJLA 2MKCA 5A8RB 1FKPA 2DITA 4C9DA 2XHCA 3D1QA 3BO4A 2YWKA 4UZCA 2VFTA 3TI0A 1RTDA 3IGZB 3MAHA 3AD7C 2VF3A 3PCOB 4M5HA 3M2RB 4X66F 2J0WA 3CCLS 1R7IA 2HVDA 4DWIA 5J1NA 2DH9A 2MMYA 1EQJA 5EGYA 3G6ES 4RWWA 5MLCV 1QSYA 2F7VA 1R8PA 5KFOA 2FZGB 3UNGC 5J2PA 2MKKA 1QTNB 2Z8QA 1H2UX 1JNZB 2ASJA 1V3ZA 3CXCR 1RT3B 1F9HA 1GX5A 4BHQA 2C3PA 3VCDA 2Q6BA 3SDEB 2A18A 4KAYA 1K1SA 1LQ9A 2E5GA 2IHR1 3HDSA 1RTIB 2Q79A 3G4SS 4LF7J 2CQBA 5A2QY 2VKRA 4UOFA 3MI7X 2RMLA 4ES1A 2CVEA 4B3SF 3IAS9 3VGUA 2F9JA 4R0JA 5LMUJ 3MPWA 1BQNA 1DTQB 4RNOA 4YUDA 4MT1A 2LCWA 4AYBD 3PHEA 4ZPAA 4O4GA 3I56S 1VQ8S 2V8HA 2RRBA 3ZZ0A 1QVGR 3MPYA 2BANB 2W2NP 3CJQA 3QT8A 2P9EA 2KKHA 3QZ7A 1HQEB 4CO3A 1HI0P 2HHTA 3POTB 2PEHA 3EXCX 4NLRA 2GC8A 1B4SA 1YX2A 2F8MA 2UUTA 4ZJQA 2XWYA 1AB8A 3CCVS 1UEVA 3IRXB 4F8RA 4ZVOB 2VQEJ 1MWQA 2HAIA 1V3SA 2VJUA 1FNXH 3FFIA 2C3YA 3V4MA 2ZH2A 1X8DA 1T02A 5K14B 3IBCB 4DV4J 3IDDA 1RHRB 1VC5A 2FQQB 3G8TA 2IM3A 3TYTA 3QSIA 2V9KA 2KTQA 1ED9A 3C19A 4MIVA 3ILLA 2KFNA 2AYMA 3CD5A 2C2NA 1NK7A 2MJNA 4R5PA 2J0QD 4DI6A 2FGCA 2GVZA 2M9KA 2V4JA 3MD3A 2AZ3A 1G1XA 4OLOA 1S1XA 3UE2A 3MF5A 2ROGA 2LECA 2VV5A 4F0HA 5KG7A 1HNIA 4WCEQ 3GJRB 4I6YA 2YH0A 1HR0F 2E5LJ 5F8GA 4OX8A 2A0FB 2NQPA 2B6AA 4NRTA 3D2WA 3TEHB 1V3RA 1AW0A 2OEKA 5JVHQ 2VFRA 1X7VA 2DNRA 1XMQJ 1NJZA 2ZZNA 3KHHA 1RWMB 1FT8A 5ETVA 3PX0A 4X4OA 2XLJA 3AB4B 2H4YB 3CMQA 2F4FA 2VPYB 4TU7A 5E3PA 2KDOA 2BVZA 3MEEB 4V1Ak 3NLCA 4KO0A 4QWDA 1GX6A 4DV6J 3GV8B 1FXRA 1N54B 1RHKB 1MMLA 2B51A 1AJCA 2K7KA 1F9FA 1PCAA 1JLGA 3GONA 3DRPA 2J6TA 2ZOMA 2M52A 2OHDA 4MIBA 5KFRA 4LR9A 4WYLA 2HLTA 3CJ8A 3QIPA 2UXBF 4Q43A 1S72S 5DG9A 1VK3A 4DHVA 4E98A 1U1MA 3NGRA 2ZWOA 1JIHA 4NZ6A 5KFXA 4ZPBA 2JEFA 2WW8A 2ZKTA 2ZOGA 4CCHA 2BQRA 1TL1A 2ZBRA 3HF5A 4CO4A 2UU9J 1RBLA 2Y8YA 4ATNA 1TMJA 4OYZA 3CWJA 1S12A 4I68A 3T02A 2NYIA 1B0VA 1UFWA 4DCJB 4JB8B 4P2XA 3AJ2A 4BLGA 4UPKA 3L7PA 2YQ3A 1KONA 4GKKJ 2YQ1A 2RHSB 3DLEA 4ZVHA 2R7VA 1WOSA 4P2MA 4MY4A 1YJWS 1QVFR 5ETSA 5AJ3J 3TA0A 2OUGA 4IH7A 5J2MA 1H72C 1SUQB 3B4DA 3HI9A 2VFVA 3I31A 2DNNA 5KG6A 2BRKA 3UW1A 4K8RA 1UVIA 5DGAA 4OZ1A 1RTJB 1MMNA 4MKAA 2OEMA 4BWJA 3THTA 4YN3B 2MQLA 2L48A 2APOA 4DEZA 4RNNA 1TUVA 4AL5A 1RT7A 2WBRA 1AT1B 3D0IE 4USWA 1UMJA 4M1KA 1SJFA 5KT3A 2VICA 4B9UA 1YZ6A 2VUGA 3I32A 5E41A 5DGBA 2CQ2A 3NAHA 3RRGA 1XEZA 1ZA1B 1LWFA 2J8SA 5J1PA 3PO4A 5KFFA 1DQAA 1VBZA 4TLQA 2IDEA 1CJTB 2XQCA 3WAXA 3RR7A 1DLOA 2V8GA 2PMWA 3EGZA 1HHTP 4RNMA 4HHUA 1U6ZA 3RAMA 1IKWA 1ZZNA 2BX6A 3FZ2A 2DR6A 2Z2YB 4CI0B 4HHJA 1H3DA 3B8HA 2QYGA 2K7JA 1CPZA 3TA2A 1SVDA 3LP1A 1FRJA 5EWGA 1GMVA 4JI2F 2XZDB 5IV4A 1Y11A 1N5SA 4W98A 3EGVA 4ELTA 1C1BB 5C42B 2VA3A 5ETPA 5J2QA 3CW2C 4R25A 1LFPA 1FNMA 3OSNA 1S9GB 4CLLA 3HHDA 2XSJB 3K8VA 4DL3A 1OO0B 3FEZA 4OJHA 3OHBA 4HI2A 2ZZTA 4ZDNA 5EX3A 2H3EB 4Q0BB 2C3OA 4PQAA 2E1RA 4A8YA 3NGDA 1RHUB 2ZJRQ 2NSBA 2KXNB 1NKBA 3W61A 2MB0B 1NB7A 4CLSA 2W5XA 3BBFA 4YR3A 4DV7J 4CLYA 2QIFA 3W2WB 4QR0A 4ZCLA 3ZTRA 4XDDA 5CA5A 2XMUA 2RS8A 2WZ1A 4DOZA 4QWCA 2RDJA 3GSIA 1ALIA 1RJJA 2EEYA 3PX6A 4DPXA 2KZZA 1YTYA 2CPYA 2OPPB 2PA8D 1FD2A 3JSYA 2XS2A 1EX8A 4ZS6A 3UDCA 1GMWA 3FQKA 5GAHI 3MUTP 5F8LA 3NG8A 4LUBA 4JOUA 3KK2A 2KYZA 3PR4A 1U47A 3BZQA 3H5XA 4M63A 4EK2A 2DPJA 1ULRA 4RO0A 2IFXA 3VGTA 3UN3A 2QA4G 4UORA 4M5DA 3LP0B 1X5OA 1TELA 3OUYA 5BJRA 4KKOA 1U2CA 2OPQB 4JI4J 2VA2A 3VGSA 5DLVA 3ISNC 1RWWB 4ELUA 4Q7AA 4DR7F 4PG6A 1F3FA 2KT2A 1Q16B 3PYDA 1VQKS 3MK2A 5CCMA 2Z2ZA 2CPJA 2B7BB 5DDQC 2PSZA 2A6MA 3N9UC 2DGQA 2RKIA 3G71S 3G6YA 4OLPA 3VAFA 3C15B 4P73A 4NLXA 4FDIA 2AV5A 1UP1A 1AXQA 1IKXA 4J9MA 2DK2A 2QGFB 3BGRB 3HP6A 3OVAA 1EI6A 1UFKA 2J0XA 1EHWA 3D54A 4N8OA 2HHSA 2P9GA 4OZ2A 2QA2A 1N5QA 5KFLA 3LW5C 1K7HA 4IDKA 3SFUA 3TG0A 1NLKL 4MK8A 2UUBJ 3CMAS 3KNAA 2PC6A 1M5SA 5KAKA 2JLEA 2E5LF 2M8DB 1B64A 2ASLA 3D7SB 3HHEA 1T94A 3BBBA 2B4OA 2C28A 1H2VZ 3OXGA 4H54A 2A2CA 2XY7A 5HROB 2YX7A 4TYBA 3Q8PB 3ITHB 1KHKA 3BKUA 4LR2A 1YRTA 2HGLA 4H4OA 1N5YB 3CDBA 3M30B 3UCUP 2YWHA 3DKDA 3OFFA 3DXSX 3BS9A 4TN2A 1S0MA 4QU7A 3Q2TC 3DU5A 2PO4A 3ILIA 1SL2A 2OMOA 4NCGB 5GAHU 3H2VE 4OZ3A 1SKSA 1RSCA 1S7IA 2AP6A 1M5VC 4ITSA 1S1VA 1KFSA 3NCRA 1TV6B 4XDCA 1HARA 2HFVA 1S6PA 3CE8A 5G0RA 3PZPA 2OJ3A 3CUNA 4ZLPA 5HI7A 3OT9A 5D3GA 4KGXB 1N52B 1JK9B 1N36J 1GK8A 4I6AA 1TFYA 4K50A 1RK8A 3MR7A 4YDXA 4KBIA 2WONA 4FDJA 3AODA 1TAQA 3CO9A 2VBZA 3N5FA 4I2PB 4CYUB 2P2CB 2HK2A 4ZP6A 3QAUA 4CO5A 2AYEA 5BR8J 1S1WB 3T6BA 5L1LA 1DRZA 1WI6A 1RQ0A 5LJ5Y 3BM7A 1JLQB 1WUUA 1X5SA 2GIFA 1RAGB 2D1CA 3LAMA 1SV5A 2P6TA 1M5HA 2HZCA 2P6SA 4G1QB 3THPA 1Q86T 4X65J 1VQ4S 3GMGA 3RRHA 2FY8A 4WKRA 3OTBA 1HFEL 1RCXB 2GHPA 4FZVA 4OZJA 4JI5J 1P9YA 4TY8B 1TKZB 2IBKA 1FWPA 4F4YA 1V5IB 3ZC4A 5EGEA 3KHRA 1KP6A 3TANA 2BE2B 3GR0A 3QNWB 3D3CJ 3QGHA 3CJ3A 1RT6A 1DTTA 2Q1LA 3MEGB 5HVGA 1HBNA 5E3RA 2EWHA 4JBCA 4EO6A 4WP9A 3G82B 3MCOA 2HYIB 3PRDA 5CQGA 4ICLA 3CCMS 4NXMJ 1WF2A 3K2YA 4CLKA 3Q24A 1NXIA 1BGXT 3C2PA 3J80U 1R0AA 1SKRA 4JYAF 1NKEA 3H20A 1ACMB 2IYIA 4TN0A 1TKTB 2E7XA 2OPSB 2CQGA 4CXUA 1CJUA 3MFIA 5IS2A 4YMEA 3HHLC 2HK3A 4E0DA 1HLWA 1ZOTA 1K0VA 3NMRA 3RW6A 4DPWA 3SV4A 1A9NB 4OI6A 4OJGA 3KUEA 3OQ2A 5HMYA 3A8KA 4ZPWR 4CLZA 4DV5F 1T05A 4KJDA 4Y2KA 3SV3A 3DLGA 1SBRA 3RBDA 3FMWA 3EJMA 3F56A 4KAIA 4C2MA 4O0NA 2CPZA 3O8WA 3HD2A 3SMZA 2G9YA 2ZNZA 3FDSA 4OI4A 1VRUB 4PPDA 3CEDA 3HKZD 1Z2LA 3NGKA 3SSSA 3ED4A 5DLTA 2R8HA 2HQ3A 3FK4A 5AJ9A 3RAXA 4PUOA 1Y10A 4KH0B 2LQ9A 1TK0A 1O99A 4LSNA 1YI2S 5E5NA 4AQYJ 4K4YA 4QBUA 1OSCA 4DFPA 2HEKA 5FD1A 1UWAA 3BKTA 1FKOA 4MYUA 1ZA2B 5M2RA 3MWBA 1CS4A 5D0RA 1HBUB 4JUZA 3W5ZA 1T9YA 4B3TF 2R3VA 3GZ7A 5D4LA 2KH9A 4N77A 4U9RA 2R9LA 1HWKA 4ECRA 1Y3JA 2J8AA 2DRAA 2WOMB 1WDTA 5AXMA 2GA3A 3VAJA 2D3OR 2SXLA 3R6GB 3IAM9 1RCOB 3MURP 3JSMB 2AF6A 2ZBQA 3MK0A 5B0CA 4DSEA 2L41A 2W9CB 3IBWA 2NXEA 1JKHA 4ZK7M 2N7CA 2CWKA 3EE3A 5GVQA 3MUMP 2DCLA 4M5GA 1YG0A 4CNYA 2MDAA 2LEPA 1HL6A 1URRA 3I0RA 3RZAA 1XNQF 2XC9A 1IVZA 4KGZB 4ED4A 3ET6A 1RTZA 1U1LA 3T3FA 3R5GA 1UWBB 3AB2B 2R2UA 1RU1A 3KLGA 3GR1A 4LBIA 1UCNA 3ULHA 1C1CA 5F8NA 4EUVA 2Y0SD 2ZBPA 3T01A 1FTRA 4J9RA 3VF0B 5T14A 2LKZA 1X9SA 3GCXP 2CIMA 2W8DA 1PYSB 5A8KA 5DQHA 3KJVB 2BJDA 2NCKL 3BKFA 2HSEB 1TTHB 2BQ3A 1WWHA 2GQ2A 2M8HA 4LF6F 1NB2A 3QWPA 2GSNA 5KFJA 2QZ8A 2IA0A 4U7CA 4KR0B 5DETA 3G6VA 2KM8B 4DQIA 4G1PA 2W9AA 4PXEA 1FFSB 4X64F 4IG3A 5KT4A 2ZJQQ 1GTHA 2CZ9A 2I8EA 1NK0A 1ZAVA 2RQCA 2ERRA 4D3HA 3R5AA 4PEOA 1YJVA 2C2KB 3CIMA 4ES2A 4UT4A 1NSAA 3I96A 3MR5A 5CZXA 3W2VB 3TAMB 4IFYA 1VHFA 3BDFA 4Q44A 3HFKA 3CCRS 3B6BA 1J2VA 2VJVA 5C25B 1DFDA 2KHDA 1NPKA 4RUCA 2XMKA 4UZBA 2MZSA 1KH9A 1FEHA 4GVLA 2C42A 2FVCA 4DFKA 1OPIA 2N3LA 3ELHA 3Q23A 4DQPA 3SCKE 4YB6A 1C0TB 4CLTA 1RA7A 4RUHA 2GO9A 2EFOA 3HCXA 3HT3A 2YWWA 1BC6A 2W24A 1S48A 2FYXA 2YKNA 1WDDA 4TVAB 3PO5A 1HNVB 2J6SA 1YGYA 3IGVA 5FDLA 1YBUA 3ENVA 4IOAQ 2VU5A 5K8OA 4PPZA 1ITPA 2CA9A 1S9EA 2D9OA 4JI1F 3UO0A 2MHEA 3SQGB 3R5JB 4DG1B 4LRFA 3W8GA 4WIIA 1RWPB 2KJWA 1RAIB 1RDRA 1OY8A 3J7AN 4EYIB 3SXLA 1J27A 2FHOB 1UZHA 2NZCA 3HSZA 5K8NA 4YFUA 3CDWA 4YR1A 4DV0J 3A8IA 4MH8A 5F8HA 1IBCB 3SQOP 2D7SA 2MY8A 2RVJA 1R3NA 4LFCJ 1NSPA 1AZSB 3OTOF 1O8BA 2W01A 4KYZA 1LEOA 3GV5B 1RTHB 2UUAF 3TX0A 4U8YA 4B9VA 4DXLA 2HVIA 4I67A 1IBLJ 1N88A 4O44B 1EW2A 2X3DA 3M05A 1H7WA 3PX4A 4OHVA 1CSJA 2IC3B 3KTQA 2RRNA 3MM6A 2XS7A 3MEDA 3ONQA 1VI7A 3NNHA 1HMVB 2ATLA 1Y00A 1U0SA 2VG5B 1X4HA 3OL7A 5SUHA 3SCLE 3VVTA 1VQ7S 1B0TA 1LW0A 4A8MP 2YXLA 3UN2A 1IUJA 5DJBA 4NXMF 3O2IA 4YB1P 3Q8RB 3T1HF 2XYHB 5B09A 2IBOA 5L9NA 2WBMA 3FSXA 4C11A 1HPZB 2G9OA 3SI8A 1PILA 2BJEA 3TZYA 4PG7A 5IFMA 2KN4A 2MGZB 1SQEA 2HNDB 1WHXA 2HQGA 1Y9OA 1W26A 4AL6A 5DDRC 3AXMA 4WTYA 4G1IA 2DD8S 3TQ1A 1UPMB 3N0VA 4OFZA 8RUCA 1FEEA 2IDLA 4JI3J 1QJHA 4ZCMA 2Y8WA 4MFBB 4KE5A 4ZJLA 3E2EA 3UWTA 2B8PA 1FVSA 1PIEA 3BB5A 3H5SA 4KGKA 1E6YB 5CABA 4LQ9A 2FC8A 3J7ZT 1S0VA 2DHGA 4DV2F 5ETLA 4O3NA 1R89A 3KHGA 2PGCA 3PDNA 3CT9A 1VQPS 5KFYA 2V2VA 2KRRA 3C46A 4ZP7A 5KFVA 4QOTA 5LRNA 1XR7A 2ROPA 3GIRA 2V6AA 1O5JA 4XIUA 2KRBA 2M7SA 1UJ4A 2A2DA 4F36A 3CTRA 4ZVSB 3PXGa 5CYMA 4ECVA 3D6MB 5L0EA 1EAYC 2CQ3A 4CP5A 3IS9B 1RI7A 2YNGB 1CJVA 3EMTA 1XC9A 2FHMA 4RPFA 3IBFB 2IVYA 1ZETA 2FJAB 2ZH8A 4QYZK 3E2DA 3GWCA 3V4IB 4WFXA 2C3UA 4U7UK 1NDKA 1RYSA 1Q95G 3MAQA 5L38A 2M2BA 4KC5A 3QFWA 3L7UA 4B3RJ 2VBXA 1VMBA 1L3UA 1S6QB 5KFKA 3FCHA 4JI8F 5THWA 4AUKA 5I3QA 1RWVB 2GLQA 4ZJOA 4Y65A 1IWGA 2RNEA 3KK3B 1ELZA 3DRYA 2BV3A 1WHVA 2RUSA 3EPGA 2KI2A 1HBOA 5D78A 5L8RC 2MSSA 4QIVA 4RW7B 3KMSA 1UTAA 4FXDA 1T3OA 1VQ9S 3OR1A 3QT7A 1QE1B 1VK8A 8AT1B 2B43A 4F3OA 4CO1A 3RGIA 3CGIA 4WFBQ 1NSQA 5FLXU 4C8YA 3H25A 1KS2A 4NLWA 2Q66A 3AOCA 2Z4PA 3AJ1A 4HTIA 1SHNA 2Y1JA 1RWOB 5LSOA 3CF5Q 1RTIA 4PABA 4FYXB 3CCES 2VG6B 3BJYA 2FHJD 4K4TA 3VWSA 4F04B 4LFAJ 1HHSA 2XM3A 3KD8A 5I42A 3RR8A 4DN0A 1WKKA 1EQ0A 1WF1A 1DTQA 1GT8A 2LEBA 1H74A 3PV8A 5IQ6A 2GQQA 3TARA 2HFOA 1F2HA 2JSXA 3F44A 1GXTA 4WP3A 2VPWB 5L1KA 3DC2A 5HLFB 3DYAB 4UQTA 3POTA 1ROFA 3Q3QA 1YJ9S 4C0BA 4IOCQ 1XIQA 2YWGA 2DNOA 4OX6A 1SH0A 2JOQA 3IRXA 1U6FA 2HRTA 1AJAA 3LANA 1NK9A 3UR3C 3AA8A 3ZZTA 2B9EA 1O6XA 1ZPVA 2RT3A 2XSFA 2RSQA 4OYAA 4ENOA 2MKIA 4K5RA 2CPIA 1PBAA 3NKYA 4QR2A 1SPBP 2DRDA 1CC7A 1DJ0A 1FRMA 3IM9A 4TXSA 4UTGA 2AZ1A 3CB4A 5HP1B 2HS3A 2FVRA 4CRJA 1IBMF 2HNYB 4ZVQB 2WRMA 2GX8A 3OFGA 5I3UB 3TUIC 2DY9A 2R8GA 1A6LA 3DRRB 5KT5A 2BQUA 3HVWA 4XK8C 1F3VA 3E51A 5IT0A 4IFVB 4L75A 2CJKA 2C2OB 3U1LA 1T03B 1FJ7A 2V94A 3HFVA 4KQZA 4L3NA 2ZBIA 4BC9A 5DG7A 3CJ5A 1L3TA 4DPTA 4B3MF 3NBPB 4AT1B 1ALKA 3ZFVA 1P1TA 2UVRA 2HHVA 1LKZA 2CQDA 1L3SA 3A52A 5F8IA 5LMNJ 2JJ4D 7FD1A 1SXLA 2MPUA 3GIKA 4WE1A 5F0WA 4GTYA 4GKJF 2RD5C 2GHVC 3IFEA 1BWVA 3QGIA 3QQCD 2WB1D 4R8UB 3UNYA 3Q8UA 1KC8T 1IBKJ 3H0PA 5BYRA 1AUSL 4DR2J 3P45B 2FVQA 2GNKA 1RA6A 2GO8A 5EWEA 3EX7B 3JTOA 1C0UB 2XZTB 3TQEA 3GJSB 4B3OB 3Q86A 4C8MA 4WU3A 3H5UA 4F7VA 2M5YA 4O23A 3BYRA 2Y9HA 5TJ3A 4X4NA 1FSUA 3GU0A 1JLBA 4HLBA 3T9ZA 2CFXA 1ZH5A 1U09A 2WSCC 3VVUA 3IGYB 2VQFJ 3ZTPA 5D77A 1TR0A 4NYPA 2UXCF 3V6HA 2W8SA 5KG5A 1MU2B 2LMIA 1SKUB 1DZ5A 2W1BA 2MQOA 2G13A 2RU9A 4WZQA 3K5OA 5AT1B 2D1GA 3N01A 2LLZA 4OHXA 3CC7S 3OXFA 1U49A 2O66A 5T7LB 2Z2MA 5KFCA 1KD1T 5IT9Y 1XNRF 3HMJG 3J80Y 4C3MA 3QMQA 3MM7A 3HT0A 4J9SA 3RTVA 3QWUA 2LA4A 4OI0A 2W25A 5C24B 3O44A 2B5JA 2W5TA 3A3OB 4DPUA 4I69A 2EFPA 5KFEA 5E0OA 4JV5F 3CD0A 2W4DA 3M8QA 2CDRB 3LAKA 3LGMA 3K5MA 4DFMA 2QLWA 4CTAA 4EO8A 4M5NA 1RWUA 3JYTB 2YNIB 3CSKA 1UW4A 1SH2A 1Y6VA 3V6DA 1CC8A 4Q2MA 3BGLA 4C4WA 3D66A 3I4PA 3TUZC 1XWLA 1F5AA 3WAYA 4NLPA 3IR7B 1WG4A 4H4KC 4F3QA 2DRBA 1U4BA 3A4TA 1YQHA 1AUKA 1FESA 3W60A 1Z2ZA 1EJJA 4DUTA 1QSLA 3WDOA 3DOLB 2XO6A 1UETA 4ZCIA 2AYBA 4J91A 4DZDA 4K0KJ 4ED2A 4DR3J 4K4XA 1BXNA 1VISA 1UVLA 5HQMA 2R7OA 2KYXA 2XLKA 3O3LA 3HFZB 1C1BA 1B7FA 5C42A 4LF9F 4E8UA 2W8LA 4YY3J 2FGOA 2X51A 3BQ0A 2HKEA 4HYKA 3WIVA 2XSJA 3BN7A 3D68A 2QA4S 3CD7A 2X1FA 1UVNA 1JJ4A 4Q0BA 2AKWB 4FNHA 1RTDB 1CG2A 4DU7A 3M6XA 3MMAA 3OJSA 3DM2A 4KT0C 3GCWP 1NCLA 3DRSA 1RWNB 1TP7A 1Q81T 3LP2B 2V2ZA 4KHPF 3PACA 1OJ4A 3US5A 3W2WA 4LVNP 4E2FB 1NK4A 4X62J 1JB0C 2ZE2B 4LF8J 2M70A 3NP5A 5F8JA 2BM0A 1VLOA 4ZPDA 4KV8B 3C6TA 2ZKUA 5J2PB 3AXKA 5DQGA 3G9CA 1S79A 4Y3CA 2Q6CA 2MTLA 3GFZA 2EVZA 5BYQA 4ZIWA 1ZPWX 3CCUS 4TYAA 2X1BA 1HYSA 4CH7A 2HHHJ 2DTJA 4DV3J 4NEZA 2R7XA 3AA9A 2HBZB 1Y5NB 2OPQA 4IYQA 4OZNA 2YPZA 2UXDJ 2CQPA 4DX8H 2MQQA 2XULA 4ZP9A 1U1OA 5GMDA 1VQLS 2CQHA 7FDRA 4JI6F 1MG7A 3TUPA 1G2EA 3N79A 5IC4B 4KM4A 4F0MA 2B4UA 4QU6A 1N2KA 3CO0P 3MTJA 4OI2A 3A8EA 5B7WA 3C15A 4UF4A 1W2IA 5GAGI 3RW7A 1RHMB 1CBKA 5L39A 1NJXA 2QT7A 1GTEA 2LQ5A 2CQ4A 2JLFA 3PJXA 3LQVA 3T5HA 1G4CA 2LDIA 3BGRA 2AX1A 3H59A 3UI3A 1QUVA 3W9IA 4DPOA 2YVSA 5K8MA 4ECQA 1KQFB 3PM9A 4RNHA 2YY3A 3BR8A 1FVQA 1SQFA 2Z56B 4DPYA 1HKAA 3AJDA 4LF4F 3FBFA 4DN9A 3Q2SC 4O0IA 3LA0A 2GIRA 2G0IA 4IQXA 4MTPA 1XJWB 5LIAA 3I87A 3FFIB 4LBHA 4YP3A 1WG1A 2DB1A 2A6OA 1XERA 1FDDA 1Q8BA 2ZVIA 1VJWA 2MKYA 2NZ4A 3OTCA 4FXWA 3P3DA 5EDWA 4DS4A 2VDHA 1KVKA 2VZ9A 3GIMA 4ILMA 3D5MA 2NSCA 1B70B 1RAAB 5A0YB 4DLGA 3DMJA 2D3ZA 2GVZB 3ITHA 4IRDA 5DO2A 5INHA 3R9LA 4IOBA 2Y0BB 1Z4UA 3NS5A 3DFEA 1NKCA 4EFAC 3M30A 5LMNF 3DLKB 4KY3A 2XNRA 2MKJA 1EW8A 3RBXA 3QFHA 3KLIB 1HNIB 2W7OA 4NCGA 3MMJA 2CJYB 4WWSA 2HGNA 4NXNJ 4HDGA 3UDVA 2MLZA 2F1FA 4ZKAA 4DR2F 1MMDA 3OV7A 1A0OB 1VBXA 5KT6A 1G7CB 2FIUA 3HHNB 3LTOA 2XYPB 5LJ3Y 4AXJA 3BGFA 3H4DA 2QJ3A 4P7VA 4DSLA 3M6UA 4CYUA 4I2PA 4EBEA 1AJBA 2M3DA 4KO0B 3JSRA 1TZ0A 3VAKA 4ZPTR 3P5TL 3AOBA 5GAGU 2MYFA 1RGVA 1N48A 1JLQA 2MKSA 2DGVA 1DY3A 1JLGB 2CWXA 1FE0A 3DRPB 1Q5VA 1N8RT 1S57A 2Q3PA 1ELOA 2ACYA 3GSDA 4K4UA 4G6VB 3P6YC 4G1QA 3QIPB 3HD1A 5C7PA 1J5EJ 4PG8A 3C8YA 2UZAA 4QJVA 2OSQA 4F4KA 5K20B 3EM1A 3KHLA 2ZITA 3J7A1 4TY8A 4OX9J 2XI2A 1TL1B 1TKZA 3D6HB 2OLWA 4AL7A 4FPIA 4YOEA 2HFZA 4RZRA 3JB9k 2UV8G 5EGHA 3MEGA 3IRWP 3IG1A 4DR5J 1IKYB 2HVZA 2V8VA 2CVIA 2CAJA 3EVWA 4DMZA 1TKTA 4USIA 3BQ1A 3U02A 3UD3P 5F0UA 5J2MB 3A3PB 5IZHA 2I1RA 1HQAA 2E9TA 3OR2B 3SBMA 3H98A 3TA1A 3TNVA 4EU0A 1O0PA 1WF0A 2IAJB 4UY8T 2YNHB 3NNCA 1XK8A 1RT7B 3HHLA 1MNEA 3QZ8A 1M5OC 3J7YU 1IJEB 1IR0A 2OIHA 3A3NB 3S6EA 3TZZA 2G2YA 2HNZA 3QT5A 5SZTA 3A13A 4LF5J 4X4RA 4OZLA 1F6TA 4B17A 4DR3F 2XMVA 2VKZG 1LWFB 3PYEA 5F41A 3PW7A 4KJIA 3KNGA 1U2RA 5IWAJ 4M5LA 2F8HA 4RW8A 5EHHA 4LREA 2JRSA 4FP9A 4F25A 1B99A 1HWUA 1N5TA 4N76A 3I9ZA 2XG8A 1FRHA 2IM2A 1VIXA 3C14A 1RYRA 2J7UA 4Q5VA 3OD2A 3M9NB 5KXAA 1IKWB 2MQNA 2VL1A 3TW0A 3MM5A 2VH7A 3NKRA 4ED3A 2N4DA 2DHSA 1KTQA 2DNZA 1NMEB 1YRXA 4YR0A 1FA0A 1BLUA 5HVHA 1QAYA 2V2QA 4PWDB 4F4ZA 2PEBA 1VS3A 1X0FA 1REGX 5J2QB 2WOMA 4USUA 2ADCA 1PYTA 3UCGA 3JSMA 1JJCB 4KB7A 1U7LA 2ILYA 3D6TB 2W9CA 3UR0A 1TL3A 2B7CB 3IA0A 4ZCKA 1RKIA 4X4VA 1KOHA 3OW2R 4CYSA 5HANA 5E33A 1IKVA 1CULA 5FLXY 2GMHA 2CNOB 2UXDF 1FHTA 1M90T 1SL1A 1UWBA 4GO7X 4UQGA 2HS0A 4ZPVR 5AXLA 3I82A 2HIYA 2BOPA 1X4DA 3WHIA 5CZVA 1N56A 2KJVA 1BY9A 4QPTA 5G4DA 1E6VB 4ZP8A 2DR7A 3Q83A 7AT1B 3I4HX 1B8JA 3KJQB 1Z1ZA 3KJVA 4OYMA 3KK2B 1S1TA 8ATCB 4WPAA 1N33J 2RB7A 3R7NB 5JMNA 2ZC4A 2WVEA 4M5DB 4ZN3A 4K4ZA 2HVEA 4NE9C 3IMQJ 2MZ1A 3VZIA 2IY5B 2RJZA 4Z7YA 1H98A 1MW7A 1FJGF 4K7QA 3KLFB 1NNDA 2I5JB 4H4MB 2IFYA 3GE9A 2L9NA 5CYQA 3VR1A 3TAMA 2Q43A 2PDAA 4B9SA 2FTRA 3K8WA 5C5JA 3CD6S 3SIPB 3D6FB 3H40A 1PSDA 4MKVA 3UQSA 1FRIA 3I0SA 1XQIA 5C25A 3BDHA 1IKXB 1FRKA 4DCPB 2BJ7A 2ASYA 4RR5A 1DQ9A 1N32F 1AROP 2JFDA 1YRUA 4I7FA 2QEXS 2BW7A 5I4MA 3V2UC 5DS7A 3IR6B 5KFBA 3R1LA 1VIOA 2W9BB 4V19X 1S49A 4IDKB 3MECA 3T5JA 1ZYQA 4FYWB 5LRMA 3W3SA 5HBMA 2QFJA 3JXOA 2GMJA 2V0NA 2LA6A 4TQRA 4CQ1A 2BJ1A 5HSPA 1YZ7A 1FX4A 2DGTA 1UEKA 2E44A 4X2BA 2A1BA 2E9ZA 1JLAB 1EQMA 3HSGA 2VG7A 1I3OB 4CZCA 3CIZA 2RDDA 3HHKA 1MN7A 1WC3A 5LXRA 4I56A 5LSRA 4QAXA 2LXUA 4I2QA 4RLEA 4JV1A 3J7Z5 3HVRA 2AW0A 3SQGA 3N6MA 4IO1A 4TNOA 1N4LA 3RB0A 4O3QA 4N56A 4DG1A 4I0WA 3Q0AA 1SC3B 4DR1F 3IN5A 2XMTA 2EBGA 4L74A 4ID8A 3M9MB 2PI4A 4RX6A 4FF3A 4C3KA 2QV6A 3EUNA 3IC1A 2KZMA 2YBVA 1S1VB 3M2UA 2ZVSA 1KQGB 1D09B 1IM6A 1AZSA 2KU7A 1S6PB 3CULA 5G0RB 3D0HE 4FYDA 1RTHA 4LFBJ 5D3GB 3I6PA 4PWUA 2F8EX 1KHNA 2V8DA 1SJ3P 1GAOA 4O44A 2YNFA 2E7VA 3N4WA 4F2SA 3DNCA 4YEAA 4A8QA 1MROB 1T9WA 1S6OA 2ZM6F 1FNOA 3HULA 5KFAA 4IO9Q 5HAOA 4IH6A 2H4WB 4YR2A 3T19A 1QUPA 3ENWA 2ATCB 4HL9A 3M2VB 1DURA 1NHVA 1TL4A 1NDPA 3H42A 1SV5B 3LGHA 2HW3A 1F0XA 2JVRA 5DDPC 5GAEI 2HWIA 2N4CA 1TVRA 1OPZA 3HSJA 4B9TA 3KLVA 2DR9A 3CCSS 2WK4A 1RT2B 3W66A 2F65A 2Z2LA 4LF1A 2L3MA 3RB3A 2VONA 1HNZF 4HI1A 3RB6A 1APSA 5C2GA 1J5OA 2W5WA 2ZH6A 4DF4A 1DTTB 1WHWA 4O3SA 1KNZA 4MFBA 2XO7A 4P9SA 1HBNB 3BYPA 1ZM4A 1KVIA 3J81U 5CXTA 2UUCJ 1N2LA 2R7WA 2ZJPQ 1UKUA 2E5JA 2Y3YA 3FEXB 1KHVA 4K5SA 2IVFB 1CJKB 1E6YA 1ZEDA 2DY1A 4X4TA 2DT9A 3FSIA 2OPRA 4DL2A 4N41A 4F0KA 3MPUB 2W8KA 3T1AA 4NLGA 2W7AA 1B0PA 4UPLA 1KTVA 2H65B 4KRWA 5C2CA 2JWNA 4OI1A 3CJ2A 4HACA 4WXOA 1KKHA 3BF4A 1EKRA 2CPDA 5J1EA 1TK5A 5AXNA 5E3CA 1S4FA 3UFCX 5H1SV 2CXEA 2BKNA 3FKBA 5KFHA 3FCVA 2QX0A 1B3TA 2M4MA 3EDRB 1HBMB 2DNPA 2ZNYA 2BDPA 3LPEA 1RWXB 3P4UB 4F50A 3IO1A 3C6UA 1Q53A 1N34F 3PFEA 1S4EA 2X1GA 3AH6A 2QL5B 1SB6A 1PJ7A 3W7BA 2YNGA 2BRLA 1QLNA 4W90B 2GS8A 1YSJA 3NAIA 2DJWA 3M8PB 3V4IA 5MAOA 3G8SA 1RLDA 3MAAB 4LSNB 4KFBA 2GSUA 3DGPA 1ZZFA 5ADZA 4Z2XA 2CJQA 3M8RA 5GAEU 1F5BA 5DZ6A 5CHCB 4A48A 4XAKA 4DUYJ 1FWKA 3TWZA 2AJ0A 1S6QA 1FDAA 1KDNA 1CS4B 3UVJB 4ECSA 1D3WA 4Z7CA 3KK3A 1KSPA 3QT6A 2MLYA 1LW2A 1U8WA 2D41A 1SJ4P 2N3OA 2AQ4A 5IJQA 2ACMA 4L76A 3Q8SB 2HZVA 4FF1A 3QGGA 2C2ZB 2HWTA 1QE1A 2EG2A 3SCIE 3T00A 1KHWA 1S5ZA 4LF7F 2LQ8A 4X66J 2IUCB 4B02A 2CNKB 3MCMA 2XMJA 3N5BA 4ZVEA 3GQCA 1WC6A 5LMUF 1KWMA 5LOQA 1WC1A 3ET6B 1HIYA 3PR5B 4PQUA 2DEIA 3SCJE 1NUEA 4ES3A 1U1QA 2B4VA 2DCUB 2KT3A 1FJCA 3LPYA 3ICLA 4UOHA 2ZFHA 4UUXA 5KFGA 3C16A 1LNQA 1TL7B 1U25A 1KFDA 4HH0A 2N82B 1SJQA 5DLGA 1X4AA 2VBYA 4Q8EA 3DDKA 1ZEBA 4OHZA 2V67A 2HHXA 2HGMA 2BMBA 2YX4A 4NLVA 2HQIA 3G86A 4FDFA 4K4WA 2VQEF 4QQBA 1IM4A 1X4FA 4B3SJ 3QIDA 4QW8A 2XZWA 1N0UA 4KAVA 2W7PA 1TQLA 3E01A 3R2DJ 4DV4F 2KVIA 1JXEA 5D6GA 2CNLB 3BREA 3Q22A 2AGOA 4J9KA 4HHHA 4IFYB 1Y7PA 2JFKA 3NVLA 3OLBA 1NAQA 4WZMA 2ZUAA 3OHAA 2GAHC 1GFWB 4MAKA 2OSRA 1RE1B 4DZ6A 5HP1A 4C3LA 2X1AA 4I1TA 4NYOA 1XR5A 5M2PA 4FKYA 1UL3A 2LXFA 2F5GA 4QWEA 5I3UA 2IPOB 1FO1A 1LFWA 3TR5A 2BYCA 2VFUA 2ZDPA 3GYXB 3SEOA 2J9DE 4IR9A 4IFVA 2GCFA 2ZDOA 4EI2A 1Y3KA 2ZD1A 4P74A 9RUBA 1XMQF 5KFWA 2PT0A 3OXLA 5KFZA 1WD6A 5FDLB 4OYWA 3V5RA 2H5IB 2MQ8A 1T9TA 4OJ3A 3AD8C 2J9DA 4ED7A 1BHNA 1CEZA 5DM6Q 2Z0GA 1JMTA 4DV6F 1C4AA 4D3GA 4RU9A 3TZXA 3QPIA 1SCJB 4PXDA 4ZIVA 4NLUA 2HHWA 1H0HB 1HR0J 2CQ0A 2XHWA 4M95A 3VHQA 2IM1A 3W9JA 4WF9Q 2FD2A 4HR2A 2PIIA 4K2XA 2JC0A 1RT1B 3TZWA 1VR6A 2YPYA 3CCWA 1XMBA 1AFJA 5KOXA 1VQSA 3UDLA 1Q82T 2G2OA 2HQFA 3JS9A 3DOKB 1YLXA 1HNXJ 2GVDB 1LK7A 1RISA 1I1GA 4ZVFA 1FERA 2H51B 1RP5A 4DR4J 2UU9F 4MKBA 3EPIA 4OYXA 2F40A 1M1HA 1Q7YT 1L3VA 4UOOA 5K4PA 3MM6B 2AIRB 3EVOA 1RT5A 4WTOB 5KG2A 3CCJS 1H6KX 1FK9A 2W4PA 4PRFA 3PFOA 1ANIA 1GEHA 2ABYA 2E7WA 1MU2A 1LWCB 4DSFA 4GKKF 4J9VA 3EVMA 2RUGA 4EZ9A 4YDDB 4FNIA 4OYBA 1WHYA 5AJ3F 2K3KA
chains in the Genus database with same CATH topology
2W5RA 3T02A 3WAXA 1ED8A 1P49A 4UOPA 4N7TA 4GTXA 1AUKA 3NKQA 4FDIA 1HDHA 1EW9A 2GSOA 1E33P 1EW2A 4KAYA 2D1GA 3E2DA 3IDDA 5IJSA 2GSNA 2GSUA 2X98A 3DPCA 4UPKA 4LQYA 1EJJA 4GTYA 3KD8A 3LXQA 1O98A 1KHLA 1ED9A 4LRCA 4CXSA 1ZEDA 3NKPA 2W5VA 4MIVA 3WBHA 1EI6A 2GA3A 4GTWA 4QAXA 4ZGAA 4KJDA 1ALIA 3TWZA 3UNYA 3MK0A 2IFYA 3BDGA 2W5SA 2W5QA 4B56A 3NKOA 4MY4A 4LRBA 4UPLA 5GOVA 3IGZB 5EGHA 1ZEFA 1AJCA 5EGEA 4ZG7A 2G9YA 4LREA 1K7HA 5LIAA 3UO0A 1ANJA 3BDGB 4CYSA 1ZEBA 2GLQA 1ELYA 3OT9A 4ZG9A 3M8YA 3TG0A 2W5TA 5DLWA 3MK1A 3M8ZA 1AJDA 1Y7AA 5HRTA 3BDHA 3BDFA 3B5QA 5L0KA 4ZG6A 1URBA 4LRFA 3UN2A 1ELZA 3ED4A 5DLTA 4CXKA 4LR9A 1KH5A 5IJQA 3Q3QA 1KHJA 1E2SP 1AJBA 5C66A 1HJKA 3CMRA 4KJGA 4UOOA 5LRNA 3M7VA 1E3CP 4UPHA 5AJ9A 5K4PA 2ANHA 1ALHA 4LR8A 1EQJA 3UN3A 4FDJA 4UORA 5TJ3A 5KXAA 1FSUA 3M8WA 1O99A 5L0BA 4KAVA 1SHQA 3UN5A 1E1ZP 1KH4A 1ELXA 3T00A 4YR1A 2IUCA 2XRGA 3DYCA 4GTZA 2ZKTA 1AJAA 2QZUA 4NWXA 5DLVA 5LQQA 4TN0A 2XR9A 1URAA 3IGYB 3NKRA 1ANIA 5INHA 1KH9A 3WAWA 1Y6VA 3T01A 5GRRA 1HQAA 3WAVA 1KH7A 2W5WA 4UPIA 1B8JA 4KM4A 4CXUA 3NKMA 5LRMA 1ALJA 2IUCB 1N2KA 1ALKA 1KHNA 3SZZA 3MK2A 3NVLA 2RH6A 4LR7A 3SZYA 5L0EA 4NWJA 3NKNA 2VQRA 1KHKA 4CYRA 2W8DA 4LR2A 2W8SA 3TX0A 3WAYA 4LRDA 2W5XA 4MHXA 4LRAA 1EW8A 1N2LA 3A52A 1SHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W5R A;  3T02 A;  3WAX A;  1ED8 A;  1P49 A;  4UOP A;  4N7T A;  4GTX A;  1AUK A;  3NKQ A;  4FDI A;  1HDH A;  1EW9 A;  2GSO A;  1E33 P;  1EW2 A;  4KAY A;  2D1G A;  3E2D A;  3IDD A;  5IJS A;  2GSN A;  2GSU A;  2X98 A;  3DPC A;  4UPK A;  4LQY A;  1EJJ A;  4GTY A;  3KD8 A;  3LXQ A;  1O98 A;  1KHL A;  1ED9 A;  4LRC A;  4CXS A;  1ZED A;  3NKP A;  2W5V A;  4MIV A;  3WBH A;  1EI6 A;  2GA3 A;  4GTW A;  4QAX A;  4ZGA A;  4KJD A;  1ALI A;  3TWZ A;  3UNY A;  3MK0 A;  2IFY A;  3BDG A;  2W5S A;  2W5Q A;  4B56 A;  3NKO A;  4MY4 A;  4LRB A;  4UPL A;  5GOV A;  3IGZ B;  5EGH A;  1ZEF A;  1AJC A;  5EGE A;  4ZG7 A;  2G9Y A;  4LRE A;  1K7H A;  5LIA A;  3UO0 A;  1ANJ A;  3BDG B;  4CYS A;  1ZEB A;  2GLQ A;  1ELY A;  3OT9 A;  4ZG9 A;  3M8Y A;  3TG0 A;  2W5T A;  5DLW A;  3MK1 A;  3M8Z A;  1AJD A;  1Y7A A;  5HRT A;  3BDH A;  3BDF A;  3B5Q A;  5L0K A;  4ZG6 A;  1URB A;  4LRF A;  3UN2 A;  1ELZ A;  3ED4 A;  5DLT A;  4CXK A;  4LR9 A;  1KH5 A;  5IJQ A;  3Q3Q A;  1KHJ A;  1E2S P;  1AJB A;  5C66 A;  1HJK A;  3CMR A;  4KJG A;  4UOO A;  5LRN A;  3M7V A;  1E3C P;  4UPH A;  5AJ9 A;  5K4P A;  2ANH A;  1ALH A;  4LR8 A;  1EQJ A;  3UN3 A;  4FDJ A;  4UOR A;  5TJ3 A;  5KXA A;  1FSU A;  3M8W A;  1O99 A;  5L0B A;  4KAV A;  1SHQ A;  3UN5 A;  1E1Z P;  1KH4 A;  1ELX A;  3T00 A;  4YR1 A;  2IUC A;  2XRG A;  3DYC A;  4GTZ A;  2ZKT A;  1AJA A;  2QZU A;  4NWX A;  5DLV A;  5LQQ A;  4TN0 A;  2XR9 A;  1URA A;  3IGY B;  3NKR A;  1ANI A;  5INH A;  1KH9 A;  3WAW A;  1Y6V A;  3T01 A;  5GRR A;  1HQA A;  3WAV A;  1KH7 A;  2W5W A;  4UPI A;  1B8J A;  4KM4 A;  4CXU A;  3NKM A;  5LRM A;  1ALJ A;  2IUC B;  1N2K A;  1ALK A;  1KHN A;  3SZZ A;  3MK2 A;  3NVL A;  2RH6 A;  4LR7 A;  3SZY A;  5L0E A;  4NWJ A;  3NKN A;  2VQR A;  1KHK A;  4CYR A;  2W8D A;  4LR2 A;  2W8S A;  3TX0 A;  3WAY A;  4LRD A;  2W5X A;  4MHX A;  4LRA A;  1EW8 A;  1N2L A;  3A52 A;  1SHN A; 
#chains in the Genus database with same CATH topology
 1LXJ A;  4EBD A;  3G8Q A;  3PKY A;  3VZH A;  3DPC A;  2EKN A;  3CJT A;  4DUZ J;  1ZAW A;  1YHQ S;  4CXS A;  3JAM Y;  2DNH A;  1VRT B;  4X4Q A;  1NHU A;  5HO4 A;  2W5Q A;  4B56 A;  2C2M B;  5C24 A;  3GII A;  2DNL A;  5IT9 U;  5B0A A;  1KVJ A;  3TUJ C;  4A8W A;  2K3I A;  2IRU A;  1PAU B;  4NWB A;  3WX8 A;  2X7I A;  4ECU A;  4RBV A;  3CCQ S;  4KSE B;  2FLO A;  2VPX B;  3FRZ A;  5E3Q A;  4C0O C;  4TQS A;  2RF2 A;  2VBW A;  3QAT A;  4ZPC A;  1NJW A;  1FKA F;  2G1H A;  1S7H A;  4HT7 A;  4M94 A;  1E1Z P;  1PC5 A;  2EFG A;  2YWE A;  2GZO A;  1RAF B;  2CPE A;  4QIF A;  4PZV A;  4DLE A;  4LR7 A;  3FUY A;  3GYG A;  1X4G A;  3ENQ A;  4IUF A;  5HQL A;  3QLH B;  2B4P A;  5EUH A;  1L3K A;  3IR5 B;  3NS7 B;  2AWZ A;  2ZHO A;  5DLF A;  3DOL A;  4H4K A;  1R8B A;  3FJ2 A;  4FYV B;  4J90 A;  4ILR A;  2CJX B;  3V6K A;  3WQP A;  5KTQ A;  2DGU A;  2BR0 A;  2DXF A;  5T41 A;  5CYM B;  4HTJ A;  2QC3 A;  2A10 A;  4AFF A;  2W4C A;  2YKQ A;  1RBO B;  4I6W A;  2K06 A;  4J9N A;  1FRL A;  4YB7 A;  1JJH A;  2R7Q A;  1CJV B;  2VOP A;  2HRU A;  4EGL A;  1F60 B;  1JQG A;  5GAD U;  3OL9 A;  5HL7 Q;  3OTD A;  2GHW A;  4V19 J;  4FS2 A;  4QWA A;  1T7P A;  3M8Z A;  3OSP A;  1NDC A;  3MMB B;  4CT9 A;  3M9O B;  2DR5 A;  1PO6 A;  4RW4 B;  4DV7 F;  3LP2 A;  4CNZ A;  3NRB A;  1U1P A;  4ANC A;  1A7G E;  2ZH7 A;  3RYL A;  4ID5 A;  2ZH1 A;  4M5K A;  1FXD A;  2HS4 A;  1ZS6 A;  4JI2 J;  3SZZ A;  3ETM A;  3L3C A;  2OTJ S;  2NLW A;  1HBO B;  4FKX A;  1SH3 A;  3H7H B;  1U0H B;  2R7R A;  2ZE2 A;  2GW8 A;  1TU0 B;  2VOO A;  2NPF A;  3ILO A;  3OR1 B;  4KV8 A;  4Q45 A;  2JL9 A;  3K57 A;  4F26 A;  4WU2 A;  3VAI A;  1NH8 A;  3WBH A;  5IOL A;  2BXJ A;  3IM8 A;  2E9R X;  3JTN A;  2LFV A;  2AJ1 A;  4ZG7 A;  4JI4 F;  2EI5 A;  3BDG B;  3LF0 A;  4WKY A;  3M1V A;  2CDQ A;  1K44 A;  4UUW A;  5LL6 d;  3WC0 A;  2DPI A;  1PG5 B;  4KHM A;  3L09 A;  5I42 B;  4P75 A;  1U1K A;  4KJG A;  4QYZ J;  1WEL A;  2MJU A;  3UD4 P;  2GAG C;  3LGN A;  2KM8 C;  4NPO A;  4ZVG A;  2IYG A;  1NSK L;  2QG9 B;  2O3D A;  2G4B A;  2K1R B;  2E66 A;  2CZV C;  2V5H G;  4EBC A;  3NCQ A;  4CM2 A;  4C8N A;  3W8P A;  4LRD A;  5LM7 E;  3BGU A;  2KVQ E;  4RKU C;  1UJ6 A;  1X9M A;  2BJ8 A;  1D8Z A;  2J6U A;  3MOJ B;  2HHQ A;  4DX5 A;  5CD4 A;  3KJF B;  3S7R A;  4DJB A;  3QYY A;  2UUB F;  1QDU B;  4ELV A;  4DR7 J;  1FD8 A;  2FZC B;  3AFG A;  3KLH B;  1OSD A;  3PYG A;  2JNJ A;  4LRB A;  2J9E A;  1QSS A;  4ZOS A;  2XMW A;  2J76 E;  3MOZ A;  2DHH A;  3T5K A;  1Y0H A;  3AAW B;  2FDN A;  4MIW A;  5IC6 B;  4BC7 A;  3EDQ B;  4DL5 A;  5AE1 A;  2R7S A;  4MJK A;  2DNK A;  2OH2 A;  3FMB A;  3OL8 A;  2YKP A;  4OI3 A;  2NUU G;  3WC2 A;  2B8Q A;  5A0Y A;  3CJK B;  2FJW A;  1SJ1 A;  4GVB B;  4JI7 J;  5H9F K;  3HVT A;  3D0G E;  3DLK A;  3HXM A;  5DZ7 A;  1N6Q B;  3TAQ A;  4FVM A;  1NK5 A;  3KLI A;  1OMS A;  2VB6 A;  2JVO A;  3THV A;  2O1P A;  2VQR A;  2OFH X;  1VQ5 S;  2HMI A;  4UY8 5;  3TOQ A;  1NJI T;  2JH3 A;  4FF2 A;  5KT7 A;  1EP4 A;  3ETO A;  2WVB A;  2W5R A;  3EGN A;  4IQM A;  4DL0 C;  3NKQ A;  1C2P A;  2QLX A;  5B08 A;  1DHM A;  2ZWP A;  2NUH A;  4DV1 J;  1NRK A;  3MM8 B;  1N36 F;  5F3T A;  3BO3 A;  4RBT A;  1TFW A;  4C48 A;  2BJ9 A;  3GFY A;  2RE1 A;  5KFM A;  1HNX F;  1JWW A;  1K0T A;  1VRQ C;  3RAQ A;  1VQ6 S;  4QIG A;  1HQU A;  1GMW D;  4LBP A;  1WSV A;  1NK8 A;  4DR4 F;  5BR8 F;  1RT4 A;  3R7S B;  4CM0 A;  1TKX B;  4DSJ A;  2DNG A;  3VTI A;  1Y7A A;  4WE1 B;  2NXN A;  5IT4 A;  3TP2 A;  3D3B J;  2V2K A;  2DGW A;  2WCX A;  1E2S P;  3E3X A;  2VDI A;  1RAB B;  1IJF B;  2BBE A;  2LDY A;  2DHX A;  2QRR A;  4WJB A;  1M5P C;  4ECY A;  4X65 F;  1HWI A;  4NZ0 A;  1JLE A;  1ZAX A;  1S0N A;  4U96 A;  2HPU A;  3V81 B;  3KWM A;  2XCP A;  3BBC A;  3QSY B;  1AUD A;  4JI5 F;  4BDP A;  2FLP A;  4IG0 B;  3T41 A;  2YTC A;  1S59 A;  4J9Q A;  2DH7 A;  2GJI A;  2LYV A;  1D8Y A;  3I9V 9;  3P8B B;  4OZ0 A;  2RHQ B;  4TU9 A;  1JLB B;  2JX2 A;  4DUZ F;  2LEA A;  2V34 A;  2CQ1 A;  1HNW J;  2I2Y A;  5B0D A;  4F67 A;  4XPC A;  2I9S A;  1BQX A;  1QD1 A;  4ZGA A;  2AEJ A;  3QGP A;  2XGP A;  3PVX A;  1O51 A;  1IKY A;  4CWB A;  2JC1 A;  4CIO A;  2KT5 A;  1RBA A;  3GJQ B;  3OPK A;  1K47 A;  5HMZ A;  3J81 Y;  4QR1 A;  1RWK B;  2L9W A;  4DQR A;  3G87 A;  1BQM B;  3BR9 A;  2J7K A;  3ZZY A;  4U6P A;  3MR6 A;  1U2F A;  3DLH A;  4ERD A;  3CJS A;  1SHQ A;  3MM7 B;  3PEH A;  1UVJ A;  4NCA A;  2VHG A;  5J2N B;  2XWX A;  4Y2I A;  2XRG A;  3OR2 A;  3R2C J;  1R6V A;  4HH1 A;  1YBT A;  3DHX A;  4RW9 B;  4Y0F A;  2EKY A;  2B5J B;  1WG5 A;  2H54 B;  2IAJ A;  2YNH A;  2R7U A;  2JZ5 A;  4KH1 B;  2BM1 A;  4YQW A;  3M8Q B;  3A12 A;  2QMU B;  1S1U A;  5B0F A;  4JYA J;  4PKD B;  1PBU A;  4CTA B;  2XI3 A;  1X4E A;  2FJX A;  4ZIT A;  2QL7 B;  1BD6 A;  2MST A;  2MEW A;  1QM9 A;  3V6D B;  2R7T A;  2E1M C;  4ETX A;  2Y1I A;  4U8V A;  5LT5 A;  2XY6 A;  4USH A;  5EX0 A;  1RAD B;  4AQY F;  2YKM A;  1ELY A;  3HK2 A;  1RLC L;  2VD3 A;  3MMC B;  2WAQ D;  1U8S A;  2E29 A;  1KHJ A;  4A8S A;  1Q78 A;  4DV5 J;  2XS5 A;  3T9N A;  1LWE A;  3FEY B;  2R8I A;  2RDI A;  1HA1 A;  3R5D A;  3AT1 B;  3H5Y A;  1Q5Y A;  2V50 A;  3D67 A;  2M0G B;  3KG0 A;  4B08 A;  3WAW A;  2MQM A;  3KLE B;  5K9F A;  3CC4 S;  4L73 A;  5A8R A;  3KK1 B;  1Q8K A;  1H2T Z;  4PWW A;  4PWD A;  4B9N A;  1EJ7 L;  3FNN A;  4NL5 A;  2CQC A;  3CCZ A;  4OJ1 A;  3FC9 A;  4DDF A;  1ED8 A;  4N7T A;  3G2X A;  3U1N A;  4U67 Q;  4NCB A;  1EET B;  3TJA A;  3M2R A;  4JP8 A;  1VQM S;  3MMA B;  3VAH A;  2EFN A;  2LP4 A;  3DM2 B;  3DRS B;  2YWF A;  3GFX A;  2FVP A;  4I64 A;  1Y5L B;  4NML A;  6FD1 A;  4AD6 A;  2RRA A;  4J37 A;  3SZ2 A;  4P10 A;  1FDN A;  3K0J A;  3KG4 A;  4B3T J;  2GJ2 A;  4P52 A;  1HD0 A;  1VOM A;  3FBC A;  1W25 A;  4DSI A;  1PYO B;  1SL0 A;  4Z37 A;  4ECX A;  2KHC A;  3KKF A;  2PD1 A;  1ALH A;  3C6T B;  1JLC B;  1RT3 A;  2H48 B;  1E6V A;  3SDE A;  2KO1 A;  2IMW P;  3TVY A;  4NA1 A;  1P8G A;  3GPA A;  5KT2 A;  2XCA A;  1HYS B;  2BEF A;  3MEK A;  1UVK A;  1VLY A;  1VBY A;  1XNQ J;  3SZY A;  3DDI A;  3ZNU A;  3QAE A;  3MD1 A;  1W2B R;  1XMO J;  2A3J A;  3WZ0 A;  3LH2 S;  3K59 A;  2XMA A;  3S01 A;  1V6H A;  1FF2 A;  2GV1 A;  3W64 A;  2BAN A;  3CJ0 A;  4USM A;  3KLF A;  4OHY A;  4OQJ A;  2I5J A;  4UOG A;  4H4M A;  2E1P A;  3MM9 B;  3QJP A;  3NGU A;  2QO3 A;  4C8K A;  1HQE A;  1Q8L A;  2W2P P;  4MK9 A;  1M1K T;  4LMZ A;  4G65 A;  1LV5 A;  3K17 A;  1IWA A;  5A6W A;  2R4F A;  2KFY A;  1ZM9 A;  1LK5 A;  5ETR A;  4EWT A;  1HI1 A;  4LF6 J;  1KOO A;  3BDE A;  4X4S A;  4C8O A;  1QAX A;  1RU2 A;  2ZBC A;  5HRT A;  2AYG A;  2JLG A;  1S97 A;  1UZD A;  3BSA A;  3AY0 A;  4X64 J;  4K4V A;  5KFU A;  2W9B A;  4LR8 A;  5HQ8 A;  4JI7 F;  4ILL A;  1WAC A;  5K14 A;  3W5X A;  1JXV A;  4GTZ A;  1XTZ A;  1HI8 A;  3VQS A;  3T1Y J;  3CVK A;  3PYF A;  4UPI A;  2XNQ A;  1R0C B;  1X31 C;  1GQE A;  2ZEJ A;  5A76 A;  4F4W A;  2DIS A;  2HFU A;  2BE9 B;  4IRK A;  3R5C A;  2G0C A;  3R6L B;  1JLA A;  1WOP A;  4MHX A;  5A8W B;  3M32 B;  4DL7 A;  1WSR A;  2UV8 A;  4DV1 F;  2B0G A;  4NMX A;  3JQJ A;  3CC2 S;  4MMO A;  5KFN A;  5KG3 A;  3DMJ B;  1NO8 A;  1TMM A;  4Y34 A;  4QYR A;  3QO9 B;  4RJV A;  4ECW A;  4IH5 A;  4UST A;  1KLM B;  2HHP A;  4DV0 F;  1REV B;  4WK1 A;  3PTW A;  2PFD A;  4LFC F;  3ZXW A;  4P71 A;  1FCA A;  4M8L A;  5KFI A;  1ICE B;  5D4P A;  2GGP B;  1R6Y A;  5E2Q A;  1QAI A;  3M8W A;  2ZH4 A;  4ED1 A;  2CPH A;  1IBL F;  3IXQ A;  3NGT A;  4ZHR B;  4JI1 J;  2QL9 B;  2E1C A;  3CJR A;  2J5A A;  3HZE A;  4G3I A;  4ZLL A;  3MEE A;  1GXL A;  1NH7 A;  3GTY X;  2ASD A;  3NKM A;  2IRY A;  3H2U B;  2GML A;  3MR2 A;  3VAM A;  3NWG A;  1MRO A;  3ZTQ A;  1QTM A;  3MR3 A;  2CZ4 A;  2JHE A;  3BN4 A;  6FDR A;  1HNW F;  4IKA A;  4UOP A;  2LQB A;  2R8J A;  1E33 P;  4WK3 A;  3HVA A;  1F9E B;  2L08 A;  2VPZ B;  2AHO B;  3PKM A;  1JLF B;  3M2V A;  3NNA A;  2FLN A;  3OTO J;  2RIJ A;  3MGJ A;  2XMM A;  4LSZ B;  2WW4 A;  3GFH A;  2UUA J;  1S10 A;  2YQ0 A;  4TLR A;  4UOC A;  3PHT A;  3NY0 A;  2F9D A;  2AT1 B;  2YH1 A;  1F2G A;  1UFL A;  2NXJ A;  4QIE A;  3EZU A;  1T3N A;  1RT2 A;  4ZG6 A;  1PGZ A;  5D4N A;  2X3G A;  4ED6 A;  4A8O A;  1H7X A;  3EGW B;  4JI3 F;  2FLL A;  1RHJ B;  1R0B G;  1AA1 B;  2WVC A;  4AND A;  1F1B B;  1T9U A;  3LWM A;  5B0G A;  4A8K A;  3R1H A;  5HMW A;  3IG1 B;  3KUG A;  4Y2M A;  2QE5 A;  2OKQ A;  1FFG B;  2IVM A;  4O4R A;  3OVS A;  3T1H J;  2EK1 A;  2FUG 9;  1WC5 A;  2B9W A;  2IJN A;  1SUQ A;  2ROE A;  1CJK A;  3CCT A;  2GSO A;  5HJY A;  2PMZ D;  2FHJ A;  1RTJ A;  2PE8 A;  3CNQ P;  1SC1 B;  1OYE A;  2PI5 A;  5KOW A;  1MSW D;  3VV2 B;  2WTF A;  3GP9 A;  1HW9 A;  2MZR A;  3KYL A;  4WFN Q;  3LOU A;  4LSL B;  3BH6 B;  3G96 A;  4FN5 A;  4EZ6 A;  3HHL B;  2NRE A;  2CRL A;  2C1E B;  3ZZP A;  4WFY A;  3DI6 B;  3FBE A;  4ER8 A;  1V5V A;  1RAC B;  4ED0 A;  2HNZ B;  3L95 X;  1ZTT A;  2RQM A;  1HBM A;  4GMK A;  3PIP Q;  5C66 A;  1CQM A;  4LIR A;  1CJT A;  3A8J A;  4XTT A;  2AJF E;  2CJ9 A;  2RQK A;  3UN5 A;  1TUW A;  4DV2 J;  3DLL Q;  1ELX A;  2QSF A;  2VC1 A;  3DOM B;  4RW8 B;  2CG8 A;  5IM0 B;  1S77 D;  2IMO A;  4URQ U;  1RAE B;  4RW6 B;  2G1D A;  3M8P A;  1WEX A;  2AJQ A;  3KDN A;  2RH6 A;  4B3R F;  2FHK A;  4CH1 A;  2WSE C;  3MAA A;  3PRV A;  5CAA A;  3Q8Y A;  1K73 T;  3C14 B;  4N5S A;  4LT6 A;  4GTX A;  1T9V A;  2MKH A;  3MM5 B;  2H1Y A;  4NI2 B;  3M8S A;  4ETZ A;  5DQI A;  4O3P A;  1MN9 A;  3UVJ A;  4QCL A;  2OD4 A;  2EG1 A;  2P9C A;  5DRK A;  1S9G A;  3BDP A;  1VGY A;  1FKP B;  4ZLN A;  1ANJ A;  1TUG B;  2FY1 A;  2LU1 A;  2ALY B;  3OFE A;  1LOU A;  1RAH B;  1PJ6 A;  2HBR B;  5L1J A;  3EZ5 A;  3ZTS A;  2CQI A;  2KB2 A;  5K5M A;  1TL3 B;  1YVF A;  2XGQ A;  2LVW A;  1HWL A;  5HN0 A;  3R5B A;  4BWM A;  5AE2 A;  3O5T B;  3OL6 A;  2IUC A;  1T0T V;  5LQQ A;  4JI8 J;  2Z57 B;  1W7W A;  4ALZ A;  4LFA F;  1WOR A;  5KG4 A;  1IKV B;  1CUL B;  5H9E J;  4CT8 A;  3WAV A;  2C2E A;  2JDJ A;  1XMO F;  1PKU A;  2JEG A;  2HWH A;  2DIU A;  2OPP A;  4U7U D;  1YJR A;  4JI0 J;  1XN9 A;  3K5N A;  2G0J A;  4EEY A;  3J81 j;  4MKY A;  3I5B A;  3BEG B;  1IQZ A;  1TL7 A;  1VQY A;  2B9Y A;  3NKP A;  3HJF A;  1OS5 A;  4ZVP B;  4YS2 A;  2QN6 B;  3S8S A;  2KL8 A;  2F4V J;  3NMA A;  3LP0 A;  1S1T B;  2QLB B;  4BCA A;  4J5O A;  3H4B A;  2WVD A;  3K58 A;  3M8Y A;  1BQN B;  4W4M A;  5L0K A;  1RAJ A;  1U6B A;  4FVC A;  4O4G B;  4NLS A;  1VCT A;  2F3J A;  5KFS A;  4Y00 A;  2VIH A;  4ANE A;  1D9F A;  3CDE A;  5CYQ B;  2MXY A;  1KRP A;  1G6B A;  3T1Y F;  2QTW A;  2P8I A;  3ADA C;  4M5I A;  4PR6 A;  3N28 A;  1URA A;  2FJB B;  4YHH J;  1YKW A;  5GRR A;  2WSF C;  1T95 A;  3I0S B;  2FB0 A;  2KFZ A;  1PAE X;  2EFQ A;  3I5A A;  2MLX A;  2JEJ A;  4BS2 A;  2HLU A;  4I7F B;  2HBY B;  4OV1 A;  2HAF A;  3K89 A;  2X98 A;  2C2D A;  4NLY A;  3D4J A;  1RUS A;  3MEC B;  3R27 A;  3FGV A;  5E3A A;  1K8A T;  2R2R A;  1WEZ A;  5HBM B;  3GG0 A;  1HD1 A;  1S0O A;  2UP1 A;  3EXY A;  4C0H A;  4DU8 A;  2DGX A;  1U1N A;  2QLJ B;  5KG0 A;  1UW9 A;  1ZBT A;  2OEL A;  2AMC B;  2W2Q P;  1MLA A;  5HRO A;  2ZH3 A;  2VG7 B;  4R5P B;  1LWX A;  2V4J B;  1KH5 A;  5FII A;  1S99 A;  2OO4 A;  2XYG B;  3KFW X;  3DDN A;  1N5Y A;  1UAW A;  3HSD A;  4I2Q B;  5D8H B;  1S1X B;  5GME A;  3R7B B;  3LWL A;  3B78 A;  3SSR A;  1IBM J;  1D0E A;  3VQT A;  1YJT A;  1BWE A;  2ZZM A;  3JQK A;  4C7Q A;  3PJ9 A;  4Y6I A;  1ZM2 A;  3MCN A;  4F02 A;  2PFF B;  2FZK B;  3OFH A;  4DR6 J;  2AX0 A;  3EYZ A;  5BYS A;  5F9L A;  2B6A B;  3HKW A;  1IBK F;  3MZI A;  1TV6 A;  2KG1 A;  3J7Y I;  1SC4 B;  4QPX A;  5ETN A;  3M4X A;  3X1L B;  1RT1 A;  1EW9 A;  5IJS A;  4KPC A;  3M2U B;  1OWX A;  1X9W A;  2HQC A;  3D28 A;  4Y2C A;  1TK8 A;  2L9D A;  4OV6 A;  4B3M J;  2DEJ A;  2QMW A;  5LXY A;  2R2T A;  3DOK A;  2GVD A;  4WFZ A;  1Q8I A;  1WNE A;  3MUV P;  4FXV A;  3MPD A;  2YNF B;  4OYI A;  4OYO A;  2Z58 B;  3DCA A;  4XPE A;  1S1W A;  3H2L A;  4ZG9 A;  3R8Y A;  4BBY A;  3MDF A;  3MK1 A;  5HVF A;  2VQF F;  4GKJ J;  2MZJ A;  4S0M A;  5KFD A;  2DGS A;  3O6Q A;  4F4A A;  4A46 A;  4GRS A;  2FJV A;  1EZZ B;  3IWL A;  1H38 A;  1LWC A;  2O5D A;  3BGO P;  4P6Q A;  1WOO A;  1TVR B;  3K7R A;  5CH7 B;  4MK7 A;  3NEK A;  4GC7 A;  2HQD A;  3E8O A;  2V8P A;  4N8N A;  2I0X A;  1FX2 A;  1R8H A;  1IR1 A;  1NPR A;  2BE2 A;  1P49 A;  1T11 A;  1HDH A;  4PXB A;  1VRT A;  3WIU A;  5F3Z A;  3ENA A;  4J9U E;  3NOG A;  4FYY B;  2BZ2 A;  3H90 A;  4WYW A;  1UJ5 A;  3G82 A;  1O98 A;  1J5O B;  4DSK A;  2UXC J;  5K8P A;  1UA1 A;  1VFJ A;  2CJA A;  3NKO A;  3GB0 A;  2R2S A;  4TY9 A;  5GOV A;  3JAM U;  2FPH X;  4F2R A;  4ZMM A;  3DLE B;  2OPS A;  3NGS A;  4RL1 A;  4NLT A;  4OMF G;  2BUN A;  1XNR J;  2I6W A;  3D1O A;  2IIH A;  1E3C P;  4B9L A;  4KPY A;  2OPR B;  3UDE A;  1X4B A;  5GMK a;  5FJ4 A;  2XEX A;  1IN0 A;  1UA0 A;  4DBQ A;  2DGO A;  2LXI A;  2MY7 A;  1KN6 A;  3PIO Q;  1SIW B;  1V9O A;  2OGU A;  2DR8 A;  4HAC B;  3MFH A;  2D74 B;  2J0S D;  2PA3 A;  5J1E B;  3TRG A;  3QLH A;  4GO5 X;  3X3U A;  2PMH A;  1HQ2 A;  2RS2 A;  4JV5 J;  2XB2 D;  4C8L A;  1VC6 A;  4K0K F;  4LRA A;  3FRY A;  4J9O A;  5CYJ A;  5H9E K;  4M5M A;  1VRU A;  3QRQ A;  3GIL A;  3C6U B;  2XY5 A;  2KXF A;  3NXZ A;  3LXQ A;  1DLO B;  4YY3 F;  2U1A A;  5KFQ A;  2CKW A;  3KXD A;  2AEM A;  3P96 A;  4URS A;  1YIT S;  1YDL A;  3GV7 B;  3PW5 A;  2NR0 A;  2NYH A;  2Z30 B;  2DXE A;  4WIQ A;  3MMB A;  4DX7 A;  2HHU A;  1BE4 A;  1P6T A;  5DLW A;  4KFB B;  3CME S;  1AJD A;  3DGP B;  3HO1 A;  4KIA A;  2DBB A;  3UCZ P;  2DNY A;  1GH8 A;  3OVB A;  1FI4 A;  4K59 A;  3LP1 B;  4RW4 A;  1HBU A;  2W2M P;  4M5J A;  1KR4 A;  1OQ3 A;  3OLA A;  1FTC A;  4ECZ A;  1UEU A;  4IRC A;  4X62 F;  1OYD A;  4NAS A;  1D1U A;  1NZA A;  4DX6 A;  4LF8 F;  1VDH A;  1XBW A;  1LW2 B;  5D0H A;  4LF9 J;  3DXB A;  3FSY A;  4JI0 F;  1FXL A;  1U0H A;  2OI2 A;  5LSL A;  2H9Z A;  3EZO A;  1Q7L B;  3TO8 A;  2FVS A;  3H8Y A;  2QFI A;  2RQ4 A;  1YJ7 A;  4NX9 A;  4CLF A;  3GJT B;  2HHH F;  1NZ8 A;  3NCP A;  4Q2L A;  2ZHB A;  3W65 A;  4DV3 F;  2F4V F;  4KHP J;  2E1A A;  4GTW A;  2HFN A;  3RUB L;  4O3R A;  5HAT A;  3BDG A;  1B7Y B;  2AJ2 A;  1KEK A;  4RUB A;  4OYP A;  4DQQ A;  2BOA A;  3AQP A;  3VAG A;  1M0S A;  4PQU B;  2B9X A;  2BKO A;  1M5K C;  3F73 A;  3B4M A;  5CD4 H;  3C66 A;  3L4B C;  1BUX A;  2RH3 A;  2HUR A;  5EWF A;  3UPF A;  4KGV B;  4OIX A;  5IQQ A;  3Q8Q B;  2DNM A;  5F9N A;  3C16 B;  5A2Q U;  3C3L A;  3F0N A;  2K1R A;  5ETQ A;  4YHH F;  2IA6 A;  3HM9 A;  3W9H A;  4A4J A;  3KOA A;  2YKA A;  3PY8 A;  2WB4 A;  4K2J A;  3OUY B;  3WBZ A;  1F5C A;  3EWG A;  4KKO B;  3GLJ A;  4X4U A;  1RAO A;  1HHQ A;  2JEI A;  3LO3 A;  4TU8 A;  2XLI A;  1XR6 A;  3SYZ A;  1I94 J;  2UVU A;  5ETT A;  4RBU A;  3Q89 A;  4C6A A;  1EIY B;  4MYT A;  3W2V A;  3E01 B;  1R43 A;  2RKI B;  3BQ2 A;  3PG9 A;  4JI6 J;  5HMX A;  2EW9 A;  3KLH A;  2BAB A;  4NRU A;  1KHL A;  4LJM A;  2W5V A;  1KQS R;  4PAA A;  1YK9 A;  1WKJ A;  1JJ2 R;  4ZLJ A;  1D9A A;  2G2Z A;  5D0G A;  2OTL S;  3DGV A;  1EAR A;  4AXI A;  4Q8F A;  3FQL A;  4C98 A;  3K5L A;  1URB A;  1TAU A;  2NPI A;  3CJK A;  5ETK A;  1C0T A;  2HFS A;  4GVB A;  3UD5 A;  4LF4 J;  4HDH A;  2BAC A;  2EFV A;  1RHQ B;  5D0E A;  1AFI A;  3BO2 A;  5KG1 A;  1N6Q A;  4DR6 F;  4X84 A;  2XR9 A;  1BMQ B;  5AXK A;  1RB0 A;  4NXN F;  2QA1 A;  1R31 A;  2VAS A;  2DVI A;  1CLF A;  1HNV A;  2H5J B;  3TAP A;  2UVV A;  2BE7 D;  1SIZ A;  1EB0 A;  3M6V A;  5DDO C;  2ZD1 B;  5JJB A;  4RUA A;  3I5C A;  3MM8 A;  1SQG A;  3AHP A;  3JSB A;  4H4O B;  3U1M A;  4QZV B;  3DRX A;  4LRC A;  3BPD A;  4Y2A A;  3ISZ A;  2GQC A;  3AD9 C;  1KLN A;  4NOH A;  1SJR A;  1TKX A;  3GYN A;  2BW2 A;  4OX7 A;  1TKD A;  1S9F A;  2OEJ A;  5IXU A;  1IXK A;  2GA7 A;  2QSW A;  4FBU A;  4TKT A;  4NEY A;  2YKO A;  3NL0 A;  3IGN A;  1NU4 A;  1J5E F;  3ZZU A;  1NBE B;  1ZM3 A;  5JUM A;  2BA9 A;  3ZZO A;  2U2F A;  3OBI A;  3V81 A;  2WON B;  2DH8 A;  2ALZ A;  2P5V A;  2IC3 A;  1R27 B;  5I3P A;  4OX9 F;  1DBD A;  2F63 A;  1KH7 A;  2OFG X;  2CUY A;  1VC0 A;  1PJ5 A;  1HMV A;  3ISN D;  4IG0 A;  1MWY A;  4FS1 A;  1U26 A;  2VG5 A;  1YWX A;  3QJJ A;  1RT5 B;  4DR5 F;  3CDU A;  3R3T A;  4PYA A;  1FK9 B;  4O3O A;  1NPP A;  4CH0 S;  1I5O B;  3MPV A;  1K9M T;  2V63 A;  1S76 D;  2XBP A;  1FRX A;  3KDO A;  3BV8 A;  5U47 A;  2HRY A;  1HPZ A;  2ZC3 A;  4OL8 A;  4AE5 A;  1X5T A;  2O01 C;  1VHI A;  2J9C A;  2DIV A;  3RU0 A;  2MGZ A;  3TX8 A;  2HND A;  3RG6 A;  3IWX A;  2B56 A;  1FFW B;  5HK4 A;  1BQM A;  3OTE A;  1R8A A;  1UPP A;  2WHO A;  3ZNJ 1;  4J9L A;  3KJN B;  2ZUG A;  4L3K A;  1HJK A;  5CCL A;  1RT6 B;  3BSN A;  5J2N A;  1SKW A;  1C4C A;  4RW9 A;  2OAU A;  2DNQ A;  4ICL B;  1R8C A;  5D15 A;  3DYC A;  3B54 A;  4NWX A;  2LQJ A;  4A47 A;  3K5P A;  3P49 B;  4LF5 F;  1R0A B;  2VFS A;  1JXL A;  1G3O A;  4PXC A;  5F8M A;  4FF4 A;  1NJY A;  5B0B A;  4P2F A;  4L72 B;  3JTP A;  3NS6 A;  2GFF A;  1CJU B;  2RF2 B;  5IWA F;  4K4S A;  4J9P A;  3TVK A;  3T6J A;  3W5Y A;  3LUY A;  3QBC A;  1Q1K A;  1U48 A;  1VQO S;  1D9D A;  1OY6 A;  3VGV A;  4DS5 A;  4UW2 A;  1WTF A;  1WTB A;  2AGP A;  1GNK A;  3HJV A;  3G6X A;  1KQK A;  3MMC A;  1NDL A;  1T05 B;  1DAR A;  5DM7 Q;  3DLG B;  3PEJ A;  1RKJ A;  3SFG A;  4XO0 A;  1YBA A;  4CO2 A;  4IR1 A;  4ED5 A;  3B5Q A;  4RWX A;  2Y1R I;  4CXK A;  1N5V A;  3IS9 A;  2AJ4 A;  5RUB A;  4JV0 A;  2WVF A;  2J7W A;  2NS1 B;  1DQ8 A;  5L0B A;  3KLE A;  1VQN S;  1Y4Z B;  3KK1 A;  4PUO B;  4C8Z A;  4ZA1 A;  4A8F A;  3PW0 A;  2FJD B;  5ETM A;  1P27 B;  2CNN B;  3KG1 A;  2DHA A;  1FKO B;  2OML A;  1EET A;  4DL6 A;  1YJN S;  6AT1 B;  4B9M A;  4KHR A;  2VC0 A;  3VAL A;  4ID5 B;  4QIW D;  2EC0 A;  3RJM B;  2LU2 A;  5DG8 A;  4RW7 A;  3KUH A;  2EC2 A;  5HJX A;  3F41 A;  1ZEF A;  5BXI A;  5JXS A;  3R97 A;  4N47 A;  3RRK A;  1CVJ A;  2CAD A;  3QRP A;  1JLC A;  2DO0 A;  1JKH B;  1K1Q A;  1EKS A;  3FCW A;  3AOA A;  1N33 F;  3HPO A;  4R0E A;  4DL4 A;  1FDB A;  3I0R B;  1CQN A;  2V4Q A;  1VBK A;  3SSQ A;  2VG6 A;  1KH4 A;  4ZVR B;  2Y1L B;  4P72 A;  4U95 A;  3NOC A;  4DF8 A;  1I51 B;  4X4P A;  3M1V B;  3RB4 A;  3KLG B;  1MWZ A;  2OD6 A;  1C1C B;  1I94 F;  4YB5 A;  4CO0 A;  2C3M A;  1JNR B;  1WJ9 A;  5KFT A;  4KGM A;  4RNF A;  3HHL D;  2V4R A;  3MM9 A;  2C2R A;  1N0V C;  4F4X A;  5L9X A;  5HLF A;  5A8K B;  2GJF A;  2EXU A;  2KG0 A;  3DHW C;  3ZZR A;  4CDI A;  3DYA A;  1AYE A;  3I55 S;  3QRR A;  3TVZ A;  4USJ C;  2MQP A;  3OJU A;  3GIJ A;  2W2O P;  4CLP A;  5ETO A;  1SI9 A;  3AQO A;  4ED8 A;  4USK A;  4IG3 B;  3IWN C;  2COL A;  1IR2 A;  2XTJ P;  5EN1 A;  2YX1 A;  1WEY A;  1FJG J;  3D9B A;  1U1R A;  3CMR A;  2K2P A;  1Q79 A;  2ANH A;  1LXN A;  4W92 B;  4C97 A;  2ILZ A;  3L9Z A;  2IJR A;  2RU3 A;  5L1I A;  2O67 A;  3L7O A;  2E5I A;  2OP5 A;  1YJU A;  5IV3 A;  1FWL A;  2RIL A;  5A8W A;  3M32 A;  2CPF A;  1YIJ S;  3BH7 B;  1RZM A;  2N7Y A;  4WFA Q;  3NKN A;  1N32 J;  1M1G A;  3JQM A;  4MIA A;  5KFP A;  2V69 A;  1UVM A;  2HNY A;  4NYZ A;  3FZB A;  3NWR A;  4DQS A;  3V6J A;  2DYA A;  3Q8V A;  3DRR A;  3QO9 A;  4ZVT B;  4FBT A;  4LQY A;  2DO4 A;  3HVT B;  1DAX A;  2IJF A;  1P1L A;  4URG A;  4PG4 A;  1KLM A;  1KBR A;  2MZQ A;  4USV A;  3TJ8 A;  4WXW A;  1REV A;  4ZN1 A;  3PW2 A;  2W5S A;  4WBF A;  2GIQ A;  2YKN B;  2QYC A;  2HMI B;  4JV2 A;  2MHN A;  1T03 A;  4LQ3 A;  1EP4 B;  4HT5 A;  3N6L A;  4EMD A;  2FJE B;  3NBP A;  2IRX A;  2GGP A;  1S9E B;  4LFB F;  3B82 A;  1GXU A;  4NZ7 A;  2HG4 A;  2IM0 A;  2QLF B;  2NXU A;  1HW8 A;  1Y5I B;  4ZHR A;  4OZ5 A;  1QAJ A;  4NA3 A;  1U02 A;  4UPH A;  1FJE B;  1HWJ A;  4PCQ A;  5AE3 A;  2UUW A;  4QWB A;  3W1Y C;  1HQU B;  9ATC B;  4Y28 C;  1T9X A;  1GMU A;  1RT4 B;  5JVG Q;  4DR1 J;  3S1T A;  5M2U A;  4CLW A;  4R8U A;  1ALJ A;  2DKO B;  2ZOF A;  2POK A;  1TL5 A;  2HVH A;  3HZG A;  2DXD A;  4PYD A;  4NWJ A;  3FVY A;  2AU0 A;  4CYR A;  3ZO7 A;  3GG1 A;  1NHK L;  3PNI A;  2R8K A;  3EIC A;  1Q4R A;  4NLQ A;  3O1L A;  1JLF A;  5D4O A;  2D3O 1;  1OQ6 A;  1C0U A;  3N6N A;  2I38 A;  4B3O A;  2V9W A;  4FPR A;  1JLE B;  3A1Y G;  1VJQ A;  2D69 A;  4P2S A;  3M6W A;  2RAQ A;  4WP8 A;  3PW4 A;  5H9F J;  3HLU A;  1WKL A;  2VOD A;  4OHW A;  3MTK A;  5GAD I;  3HX9 A;  3MED B;  1WC0 A;  2CPX A;  1NM2 A;  2ZM6 J;  3WX4 A;  1OIA A;  3BPS P;  3ZTO A;  3D1H A;  2BJ3 A;  5E7O B;  4GC6 A;  1LW0 B;  2UUC F;  1FE4 A;  4HEA 9;  2UXB J;  4C11 B;  3W63 A;  1X4C A;  3TJ9 A;  4RU2 A;  2QZU A;  4NLO A;  1WC4 A;  3T5L A;  5T7L A;  1OY9 A;  2MZT A;  3CJ4 A;  3P5B P;  1H73 A;  3LAL A;  4EYH B;  1RXO B;  4HKQ A;  2AGQ A;  2HZA A;  4DCO B;  3FBB A;  2UVW A;  3MXH P;  1VYA A;  4A8X A;  2BKP A;  1JX4 A;  1P9Q C;  4I4B A;  1X0P A;  3IP0 A;  1HNZ J;  2E5H A;  3MHY A;  4L6V 3;  4P7T A;  5B0E A;  1WI8 A;  2PN6 A;  2EK6 A;  3W62 A;  3DU6 A;  4J7C A;  3DN9 A;  5ITH A;  3RBZ A;  2B3T B;  1S6U A;  3DLB A;  4LSL A;  2AD9 A;  1U24 A;  1PC4 A;  2ZH5 A;  1Q0N A;  3DI6 A;  3U7J A;  1SC6 A;  4LVO P;  4NLD A;  3JYT A;  2YNI A;  3CDA A;  2C22 A;  1U45 A;  2ADB A;  2CYY A;  1IQT A;  1S1U B;  2ZHA A;  3MCS A;  2D9P A;  2ZH9 A;  1QY7 A;  4DFJ A;  4QW9 A;  2QMX A;  3M7V A;  3PJW A;  3DOM A;  5IM0 A;  1I6J A;  4ZVU B;  3BSC A;  2R42 A;  3TEG A;  2K8G A;  4RW6 A;  2KXH A;  2HIQ A;  3DLJ A;  1ZTW A;  2D3U A;  2YKM B;  4ECT A;  2FC9 A;  2AEF A;  4DUY F;  2H5E A;  3ILJ A;  1T8E A;  5A6P A;  1NK6 A;  1URN A;  1X5P A;  4NA2 A;  4LIW A;  1NEE A;  4HVZ A;  1LWE B;  2HBQ B;  5L46 A;  4CLU A;  3BSO A;  2EPI A;  2EBE A;  3CPW R;  4LF2 A;  2CG4 A;  2M88 A;  3U27 A;  3ZZZ A;  4NI2 A;  2V68 A;  3KMQ A;  1N34 J;  3PRB A;  2NXC A;  4PG5 A;  2CJB A;  1L5U A;  4KTQ A;  4F3M A;  3RBE A;  1X60 A;  3QJL A;  2MKC A;  5A8R B;  1FKP A;  2DIT A;  4C9D A;  2XHC A;  3D1Q A;  3BO4 A;  2YWK A;  4UZC A;  2VFT A;  3TI0 A;  1RTD A;  3IGZ B;  3MAH A;  3AD7 C;  2VF3 A;  3PCO B;  4M5H A;  3M2R B;  4X66 F;  2J0W A;  3CCL S;  1R7I A;  2HVD A;  4DWI A;  5J1N A;  2DH9 A;  2MMY A;  1EQJ A;  5EGY A;  3G6E S;  4RWW A;  5MLC V;  1QSY A;  2F7V A;  1R8P A;  5KFO A;  2FZG B;  3UNG C;  5J2P A;  2MKK A;  1QTN B;  2Z8Q A;  1H2U X;  1JNZ B;  2ASJ A;  1V3Z A;  3CXC R;  1RT3 B;  1F9H A;  1GX5 A;  4BHQ A;  2C3P A;  3VCD A;  2Q6B A;  3SDE B;  2A18 A;  4KAY A;  1K1S A;  1LQ9 A;  2E5G A;  2IHR 1;  3HDS A;  1RTI B;  2Q79 A;  3G4S S;  4LF7 J;  2CQB A;  5A2Q Y;  2VKR A;  4UOF A;  3MI7 X;  2RML A;  4ES1 A;  2CVE A;  4B3S F;  3IAS 9;  3VGU A;  2F9J A;  4R0J A;  5LMU J;  3MPW A;  1BQN A;  1DTQ B;  4RNO A;  4YUD A;  4MT1 A;  2LCW A;  4AYB D;  3PHE A;  4ZPA A;  4O4G A;  3I56 S;  1VQ8 S;  2V8H A;  2RRB A;  3ZZ0 A;  1QVG R;  3MPY A;  2BAN B;  2W2N P;  3CJQ A;  3QT8 A;  2P9E A;  2KKH A;  3QZ7 A;  1HQE B;  4CO3 A;  1HI0 P;  2HHT A;  3POT B;  2PEH A;  3EXC X;  4NLR A;  2GC8 A;  1B4S A;  1YX2 A;  2F8M A;  2UUT A;  4ZJQ A;  2XWY A;  1AB8 A;  3CCV S;  1UEV A;  3IRX B;  4F8R A;  4ZVO B;  2VQE J;  1MWQ A;  2HAI A;  1V3S A;  2VJU A;  1FNX H;  3FFI A;  2C3Y A;  3V4M A;  2ZH2 A;  1X8D A;  1T02 A;  5K14 B;  3IBC B;  4DV4 J;  3IDD A;  1RHR B;  1VC5 A;  2FQQ B;  3G8T A;  2IM3 A;  3TYT A;  3QSI A;  2V9K A;  2KTQ A;  1ED9 A;  3C19 A;  4MIV A;  3ILL A;  2KFN A;  2AYM A;  3CD5 A;  2C2N A;  1NK7 A;  2MJN A;  4R5P A;  2J0Q D;  4DI6 A;  2FGC A;  2GVZ A;  2M9K A;  2V4J A;  3MD3 A;  2AZ3 A;  1G1X A;  4OLO A;  1S1X A;  3UE2 A;  3MF5 A;  2ROG A;  2LEC A;  2VV5 A;  4F0H A;  5KG7 A;  1HNI A;  4WCE Q;  3GJR B;  4I6Y A;  2YH0 A;  1HR0 F;  2E5L J;  5F8G A;  4OX8 A;  2A0F B;  2NQP A;  2B6A A;  4NRT A;  3D2W A;  3TEH B;  1V3R A;  1AW0 A;  2OEK A;  5JVH Q;  2VFR A;  1X7V A;  2DNR A;  1XMQ J;  1NJZ A;  2ZZN A;  3KHH A;  1RWM B;  1FT8 A;  5ETV A;  3PX0 A;  4X4O A;  2XLJ A;  3AB4 B;  2H4Y B;  3CMQ A;  2F4F A;  2VPY B;  4TU7 A;  5E3P A;  2KDO A;  2BVZ A;  3MEE B;  4V1A k;  3NLC A;  4KO0 A;  4QWD A;  1GX6 A;  4DV6 J;  3GV8 B;  1FXR A;  1N54 B;  1RHK B;  1MML A;  2B51 A;  1AJC A;  2K7K A;  1F9F A;  1PCA A;  1JLG A;  3GON A;  3DRP A;  2J6T A;  2ZOM A;  2M52 A;  2OHD A;  4MIB A;  5KFR A;  4LR9 A;  4WYL A;  2HLT A;  3CJ8 A;  3QIP A;  2UXB F;  4Q43 A;  1S72 S;  5DG9 A;  1VK3 A;  4DHV A;  4E98 A;  1U1M A;  3NGR A;  2ZWO A;  1JIH A;  4NZ6 A;  5KFX A;  4ZPB A;  2JEF A;  2WW8 A;  2ZKT A;  2ZOG A;  4CCH A;  2BQR A;  1TL1 A;  2ZBR A;  3HF5 A;  4CO4 A;  2UU9 J;  1RBL A;  2Y8Y A;  4ATN A;  1TMJ A;  4OYZ A;  3CWJ A;  1S12 A;  4I68 A;  3T02 A;  2NYI A;  1B0V A;  1UFW A;  4DCJ B;  4JB8 B;  4P2X A;  3AJ2 A;  4BLG A;  4UPK A;  3L7P A;  2YQ3 A;  1KON A;  4GKK J;  2YQ1 A;  2RHS B;  3DLE A;  4ZVH A;  2R7V A;  1WOS A;  4P2M A;  4MY4 A;  1YJW S;  1QVF R;  5ETS A;  5AJ3 J;  3TA0 A;  2OUG A;  4IH7 A;  5J2M A;  1H72 C;  1SUQ B;  3B4D A;  3HI9 A;  2VFV A;  3I31 A;  2DNN A;  5KG6 A;  2BRK A;  3UW1 A;  4K8R A;  1UVI A;  5DGA A;  4OZ1 A;  1RTJ B;  1MMN A;  4MKA A;  2OEM A;  4BWJ A;  3THT A;  4YN3 B;  2MQL A;  2L48 A;  2APO A;  4DEZ A;  4RNN A;  1TUV A;  4AL5 A;  1RT7 A;  2WBR A;  1AT1 B;  3D0I E;  4USW A;  1UMJ A;  4M1K A;  1SJF A;  5KT3 A;  2VIC A;  4B9U A;  1YZ6 A;  2VUG A;  3I32 A;  5E41 A;  5DGB A;  2CQ2 A;  3NAH A;  3RRG A;  1XEZ A;  1ZA1 B;  1LWF A;  2J8S A;  5J1P A;  3PO4 A;  5KFF A;  1DQA A;  1VBZ A;  4TLQ A;  2IDE A;  1CJT B;  2XQC A;  3WAX A;  3RR7 A;  1DLO A;  2V8G A;  2PMW A;  3EGZ A;  1HHT P;  4RNM A;  4HHU A;  1U6Z A;  3RAM A;  1IKW A;  1ZZN A;  2BX6 A;  3FZ2 A;  2DR6 A;  2Z2Y B;  4CI0 B;  4HHJ A;  1H3D A;  3B8H A;  2QYG A;  2K7J A;  1CPZ A;  3TA2 A;  1SVD A;  3LP1 A;  1FRJ A;  5EWG A;  1GMV A;  4JI2 F;  2XZD B;  5IV4 A;  1Y11 A;  1N5S A;  4W98 A;  3EGV A;  4ELT A;  1C1B B;  5C42 B;  2VA3 A;  5ETP A;  5J2Q A;  3CW2 C;  4R25 A;  1LFP A;  1FNM A;  3OSN A;  1S9G B;  4CLL A;  3HHD A;  2XSJ B;  3K8V A;  4DL3 A;  1OO0 B;  3FEZ A;  4OJH A;  3OHB A;  4HI2 A;  2ZZT A;  4ZDN A;  5EX3 A;  2H3E B;  4Q0B B;  2C3O A;  4PQA A;  2E1R A;  4A8Y A;  3NGD A;  1RHU B;  2ZJR Q;  2NSB A;  2KXN B;  1NKB A;  3W61 A;  2MB0 B;  1NB7 A;  4CLS A;  2W5X A;  3BBF A;  4YR3 A;  4DV7 J;  4CLY A;  2QIF A;  3W2W B;  4QR0 A;  4ZCL A;  3ZTR A;  4XDD A;  5CA5 A;  2XMU A;  2RS8 A;  2WZ1 A;  4DOZ A;  4QWC A;  2RDJ A;  3GSI A;  1ALI A;  1RJJ A;  2EEY A;  3PX6 A;  4DPX A;  2KZZ A;  1YTY A;  2CPY A;  2OPP B;  2PA8 D;  1FD2 A;  3JSY A;  2XS2 A;  1EX8 A;  4ZS6 A;  3UDC A;  1GMW A;  3FQK A;  5GAH I;  3MUT P;  5F8L A;  3NG8 A;  4LUB A;  4JOU A;  3KK2 A;  2KYZ A;  3PR4 A;  1U47 A;  3BZQ A;  3H5X A;  4M63 A;  4EK2 A;  2DPJ A;  1ULR A;  4RO0 A;  2IFX A;  3VGT A;  3UN3 A;  2QA4 G;  4UOR A;  4M5D A;  3LP0 B;  1X5O A;  1TEL A;  3OUY A;  5BJR A;  4KKO A;  1U2C A;  2OPQ B;  4JI4 J;  2VA2 A;  3VGS A;  5DLV A;  3ISN C;  1RWW B;  4ELU A;  4Q7A A;  4DR7 F;  4PG6 A;  1F3F A;  2KT2 A;  1Q16 B;  3PYD A;  1VQK S;  3MK2 A;  5CCM A;  2Z2Z A;  2CPJ A;  2B7B B;  5DDQ C;  2PSZ A;  2A6M A;  3N9U C;  2DGQ A;  2RKI A;  3G71 S;  3G6Y A;  4OLP A;  3VAF A;  3C15 B;  4P73 A;  4NLX A;  4FDI A;  2AV5 A;  1UP1 A;  1AXQ A;  1IKX A;  4J9M A;  2DK2 A;  2QGF B;  3BGR B;  3HP6 A;  3OVA A;  1EI6 A;  1UFK A;  2J0X A;  1EHW A;  3D54 A;  4N8O A;  2HHS A;  2P9G A;  4OZ2 A;  2QA2 A;  1N5Q A;  5KFL A;  3LW5 C;  1K7H A;  4IDK A;  3SFU A;  3TG0 A;  1NLK L;  4MK8 A;  2UUB J;  3CMA S;  3KNA A;  2PC6 A;  1M5S A;  5KAK A;  2JLE A;  2E5L F;  2M8D B;  1B64 A;  2ASL A;  3D7S B;  3HHE A;  1T94 A;  3BBB A;  2B4O A;  2C28 A;  1H2V Z;  3OXG A;  4H54 A;  2A2C A;  2XY7 A;  5HRO B;  2YX7 A;  4TYB A;  3Q8P B;  3ITH B;  1KHK A;  3BKU A;  4LR2 A;  1YRT A;  2HGL A;  4H4O A;  1N5Y B;  3CDB A;  3M30 B;  3UCU P;  2YWH A;  3DKD A;  3OFF A;  3DXS X;  3BS9 A;  4TN2 A;  1S0M A;  4QU7 A;  3Q2T C;  3DU5 A;  2PO4 A;  3ILI A;  1SL2 A;  2OMO A;  4NCG B;  5GAH U;  3H2V E;  4OZ3 A;  1SKS A;  1RSC A;  1S7I A;  2AP6 A;  1M5V C;  4ITS A;  1S1V A;  1KFS A;  3NCR A;  1TV6 B;  4XDC A;  1HAR A;  2HFV A;  1S6P A;  3CE8 A;  5G0R A;  3PZP A;  2OJ3 A;  3CUN A;  4ZLP A;  5HI7 A;  3OT9 A;  5D3G A;  4KGX B;  1N52 B;  1JK9 B;  1N36 J;  1GK8 A;  4I6A A;  1TFY A;  4K50 A;  1RK8 A;  3MR7 A;  4YDX A;  4KBI A;  2WON A;  4FDJ A;  3AOD A;  1TAQ A;  3CO9 A;  2VBZ A;  3N5F A;  4I2P B;  4CYU B;  2P2C B;  2HK2 A;  4ZP6 A;  3QAU A;  4CO5 A;  2AYE A;  5BR8 J;  1S1W B;  3T6B A;  5L1L A;  1DRZ A;  1WI6 A;  1RQ0 A;  5LJ5 Y;  3BM7 A;  1JLQ B;  1WUU A;  1X5S A;  2GIF A;  1RAG B;  2D1C A;  3LAM A;  1SV5 A;  2P6T A;  1M5H A;  2HZC A;  2P6S A;  4G1Q B;  3THP A;  1Q86 T;  4X65 J;  1VQ4 S;  3GMG A;  3RRH A;  2FY8 A;  4WKR A;  3OTB A;  1HFE L;  1RCX B;  2GHP A;  4FZV A;  4OZJ A;  4JI5 J;  1P9Y A;  4TY8 B;  1TKZ B;  2IBK A;  1FWP A;  4F4Y A;  1V5I B;  3ZC4 A;  5EGE A;  3KHR A;  1KP6 A;  3TAN A;  2BE2 B;  3GR0 A;  3QNW B;  3D3C J;  3QGH A;  3CJ3 A;  1RT6 A;  1DTT A;  2Q1L A;  3MEG B;  5HVG A;  1HBN A;  5E3R A;  2EWH A;  4JBC A;  4EO6 A;  4WP9 A;  3G82 B;  3MCO A;  2HYI B;  3PRD A;  5CQG A;  4ICL A;  3CCM S;  4NXM J;  1WF2 A;  3K2Y A;  4CLK A;  3Q24 A;  1NXI A;  1BGX T;  3C2P A;  3J80 U;  1R0A A;  1SKR A;  4JYA F;  1NKE A;  3H20 A;  1ACM B;  2IYI A;  4TN0 A;  1TKT B;  2E7X A;  2OPS B;  2CQG A;  4CXU A;  1CJU A;  3MFI A;  5IS2 A;  4YME A;  3HHL C;  2HK3 A;  4E0D A;  1HLW A;  1ZOT A;  1K0V A;  3NMR A;  3RW6 A;  4DPW A;  3SV4 A;  1A9N B;  4OI6 A;  4OJG A;  3KUE A;  3OQ2 A;  5HMY A;  3A8K A;  4ZPW R;  4CLZ A;  4DV5 F;  1T05 A;  4KJD A;  4Y2K A;  3SV3 A;  3DLG A;  1SBR A;  3RBD A;  3FMW A;  3EJM A;  3F56 A;  4KAI A;  4C2M A;  4O0N A;  2CPZ A;  3O8W A;  3HD2 A;  3SMZ A;  2G9Y A;  2ZNZ A;  3FDS A;  4OI4 A;  1VRU B;  4PPD A;  3CED A;  3HKZ D;  1Z2L A;  3NGK A;  3SSS A;  3ED4 A;  5DLT A;  2R8H A;  2HQ3 A;  3FK4 A;  5AJ9 A;  3RAX A;  4PUO A;  1Y10 A;  4KH0 B;  2LQ9 A;  1TK0 A;  1O99 A;  4LSN A;  1YI2 S;  5E5N A;  4AQY J;  4K4Y A;  4QBU A;  1OSC A;  4DFP A;  2HEK A;  5FD1 A;  1UWA A;  3BKT A;  1FKO A;  4MYU A;  1ZA2 B;  5M2R A;  3MWB A;  1CS4 A;  5D0R A;  1HBU B;  4JUZ A;  3W5Z A;  1T9Y A;  4B3T F;  2R3V A;  3GZ7 A;  5D4L A;  2KH9 A;  4N77 A;  4U9R A;  2R9L A;  1HWK A;  4ECR A;  1Y3J A;  2J8A A;  2DRA A;  2WOM B;  1WDT A;  5AXM A;  2GA3 A;  3VAJ A;  2D3O R;  2SXL A;  3R6G B;  3IAM 9;  1RCO B;  3MUR P;  3JSM B;  2AF6 A;  2ZBQ A;  3MK0 A;  5B0C A;  4DSE A;  2L41 A;  2W9C B;  3IBW A;  2NXE A;  1JKH A;  4ZK7 M;  2N7C A;  2CWK A;  3EE3 A;  5GVQ A;  3MUM P;  2DCL A;  4M5G A;  1YG0 A;  4CNY A;  2MDA A;  2LEP A;  1HL6 A;  1URR A;  3I0R A;  3RZA A;  1XNQ F;  2XC9 A;  1IVZ A;  4KGZ B;  4ED4 A;  3ET6 A;  1RTZ A;  1U1L A;  3T3F A;  3R5G A;  1UWB B;  3AB2 B;  2R2U A;  1RU1 A;  3KLG A;  3GR1 A;  4LBI A;  1UCN A;  3ULH A;  1C1C A;  5F8N A;  4EUV A;  2Y0S D;  2ZBP A;  3T01 A;  1FTR A;  4J9R A;  3VF0 B;  5T14 A;  2LKZ A;  1X9S A;  3GCX P;  2CIM A;  2W8D A;  1PYS B;  5A8K A;  5DQH A;  3KJV B;  2BJD A;  2NCK L;  3BKF A;  2HSE B;  1TTH B;  2BQ3 A;  1WWH A;  2GQ2 A;  2M8H A;  4LF6 F;  1NB2 A;  3QWP A;  2GSN A;  5KFJ A;  2QZ8 A;  2IA0 A;  4U7C A;  4KR0 B;  5DET A;  3G6V A;  2KM8 B;  4DQI A;  4G1P A;  2W9A A;  4PXE A;  1FFS B;  4X64 F;  4IG3 A;  5KT4 A;  2ZJQ Q;  1GTH A;  2CZ9 A;  2I8E A;  1NK0 A;  1ZAV A;  2RQC A;  2ERR A;  4D3H A;  3R5A A;  4PEO A;  1YJV A;  2C2K B;  3CIM A;  4ES2 A;  4UT4 A;  1NSA A;  3I96 A;  3MR5 A;  5CZX A;  3W2V B;  3TAM B;  4IFY A;  1VHF A;  3BDF A;  4Q44 A;  3HFK A;  3CCR S;  3B6B A;  1J2V A;  2VJV A;  5C25 B;  1DFD A;  2KHD A;  1NPK A;  4RUC A;  2XMK A;  4UZB A;  2MZS A;  1KH9 A;  1FEH A;  4GVL A;  2C42 A;  2FVC A;  4DFK A;  1OPI A;  2N3L A;  3ELH A;  3Q23 A;  4DQP A;  3SCK E;  4YB6 A;  1C0T B;  4CLT A;  1RA7 A;  4RUH A;  2GO9 A;  2EFO A;  3HCX A;  3HT3 A;  2YWW A;  1BC6 A;  2W24 A;  1S48 A;  2FYX A;  2YKN A;  1WDD A;  4TVA B;  3PO5 A;  1HNV B;  2J6S A;  1YGY A;  3IGV A;  5FDL A;  1YBU A;  3ENV A;  4IOA Q;  2VU5 A;  5K8O A;  4PPZ A;  1ITP A;  2CA9 A;  1S9E A;  2D9O A;  4JI1 F;  3UO0 A;  2MHE A;  3SQG B;  3R5J B;  4DG1 B;  4LRF A;  3W8G A;  4WII A;  1RWP B;  2KJW A;  1RAI B;  1RDR A;  1OY8 A;  3J7A N;  4EYI B;  3SXL A;  1J27 A;  2FHO B;  1UZH A;  2NZC A;  3HSZ A;  5K8N A;  4YFU A;  3CDW A;  4YR1 A;  4DV0 J;  3A8I A;  4MH8 A;  5F8H A;  1IBC B;  3SQO P;  2D7S A;  2MY8 A;  2RVJ A;  1R3N A;  4LFC J;  1NSP A;  1AZS B;  3OTO F;  1O8B A;  2W01 A;  4KYZ A;  1LEO A;  3GV5 B;  1RTH B;  2UUA F;  3TX0 A;  4U8Y A;  4B9V A;  4DXL A;  2HVI A;  4I67 A;  1IBL J;  1N88 A;  4O44 B;  1EW2 A;  2X3D A;  3M05 A;  1H7W A;  3PX4 A;  4OHV A;  1CSJ A;  2IC3 B;  3KTQ A;  2RRN A;  3MM6 A;  2XS7 A;  3MED A;  3ONQ A;  1VI7 A;  3NNH A;  1HMV B;  2ATL A;  1Y00 A;  1U0S A;  2VG5 B;  1X4H A;  3OL7 A;  5SUH A;  3SCL E;  3VVT A;  1VQ7 S;  1B0T A;  1LW0 A;  4A8M P;  2YXL A;  3UN2 A;  1IUJ A;  5DJB A;  4NXM F;  3O2I A;  4YB1 P;  3Q8R B;  3T1H F;  2XYH B;  5B09 A;  2IBO A;  5L9N A;  2WBM A;  3FSX A;  4C11 A;  1HPZ B;  2G9O A;  3SI8 A;  1PIL A;  2BJE A;  3TZY A;  4PG7 A;  5IFM A;  2KN4 A;  2MGZ B;  1SQE A;  2HND B;  1WHX A;  2HQG A;  1Y9O A;  1W26 A;  4AL6 A;  5DDR C;  3AXM A;  4WTY A;  4G1I A;  2DD8 S;  3TQ1 A;  1UPM B;  3N0V A;  4OFZ A;  8RUC A;  1FEE A;  2IDL A;  4JI3 J;  1QJH A;  4ZCM A;  2Y8W A;  4MFB B;  4KE5 A;  4ZJL A;  3E2E A;  3UWT A;  2B8P A;  1FVS A;  1PIE A;  3BB5 A;  3H5S A;  4KGK A;  1E6Y B;  5CAB A;  4LQ9 A;  2FC8 A;  3J7Z T;  1S0V A;  2DHG A;  4DV2 F;  5ETL A;  4O3N A;  1R89 A;  3KHG A;  2PGC A;  3PDN A;  3CT9 A;  1VQP S;  5KFY A;  2V2V A;  2KRR A;  3C46 A;  4ZP7 A;  5KFV A;  4QOT A;  5LRN A;  1XR7 A;  2ROP A;  3GIR A;  2V6A A;  1O5J A;  4XIU A;  2KRB A;  2M7S A;  1UJ4 A;  2A2D A;  4F36 A;  3CTR A;  4ZVS B;  3PXG a;  5CYM A;  4ECV A;  3D6M B;  5L0E A;  1EAY C;  2CQ3 A;  4CP5 A;  3IS9 B;  1RI7 A;  2YNG B;  1CJV A;  3EMT A;  1XC9 A;  2FHM A;  4RPF A;  3IBF B;  2IVY A;  1ZET A;  2FJA B;  2ZH8 A;  4QYZ K;  3E2D A;  3GWC A;  3V4I B;  4WFX A;  2C3U A;  4U7U K;  1NDK A;  1RYS A;  1Q95 G;  3MAQ A;  5L38 A;  2M2B A;  4KC5 A;  3QFW A;  3L7U A;  4B3R J;  2VBX A;  1VMB A;  1L3U A;  1S6Q B;  5KFK A;  3FCH A;  4JI8 F;  5THW A;  4AUK A;  5I3Q A;  1RWV B;  2GLQ A;  4ZJO A;  4Y65 A;  1IWG A;  2RNE A;  3KK3 B;  1ELZ A;  3DRY A;  2BV3 A;  1WHV A;  2RUS A;  3EPG A;  2KI2 A;  1HBO A;  5D78 A;  5L8R C;  2MSS A;  4QIV A;  4RW7 B;  3KMS A;  1UTA A;  4FXD A;  1T3O A;  1VQ9 S;  3OR1 A;  3QT7 A;  1QE1 B;  1VK8 A;  8AT1 B;  2B43 A;  4F3O A;  4CO1 A;  3RGI A;  3CGI A;  4WFB Q;  1NSQ A;  5FLX U;  4C8Y A;  3H25 A;  1KS2 A;  4NLW A;  2Q66 A;  3AOC A;  2Z4P A;  3AJ1 A;  4HTI A;  1SHN A;  2Y1J A;  1RWO B;  5LSO A;  3CF5 Q;  1RTI A;  4PAB A;  4FYX B;  3CCE S;  2VG6 B;  3BJY A;  2FHJ D;  4K4T A;  3VWS A;  4F04 B;  4LFA J;  1HHS A;  2XM3 A;  3KD8 A;  5I42 A;  3RR8 A;  4DN0 A;  1WKK A;  1EQ0 A;  1WF1 A;  1DTQ A;  1GT8 A;  2LEB A;  1H74 A;  3PV8 A;  5IQ6 A;  2GQQ A;  3TAR A;  2HFO A;  1F2H A;  2JSX A;  3F44 A;  1GXT A;  4WP3 A;  2VPW B;  5L1K A;  3DC2 A;  5HLF B;  3DYA B;  4UQT A;  3POT A;  1ROF A;  3Q3Q A;  1YJ9 S;  4C0B A;  4IOC Q;  1XIQ A;  2YWG A;  2DNO A;  4OX6 A;  1SH0 A;  2JOQ A;  3IRX A;  1U6F A;  2HRT A;  1AJA A;  3LAN A;  1NK9 A;  3UR3 C;  3AA8 A;  3ZZT A;  2B9E A;  1O6X A;  1ZPV A;  2RT3 A;  2XSF A;  2RSQ A;  4OYA A;  4ENO A;  2MKI A;  4K5R A;  2CPI A;  1PBA A;  3NKY A;  4QR2 A;  1SPB P;  2DRD A;  1CC7 A;  1DJ0 A;  1FRM A;  3IM9 A;  4TXS A;  4UTG A;  2AZ1 A;  3CB4 A;  5HP1 B;  2HS3 A;  2FVR A;  4CRJ A;  1IBM F;  2HNY B;  4ZVQ B;  2WRM A;  2GX8 A;  3OFG A;  5I3U B;  3TUI C;  2DY9 A;  2R8G A;  1A6L A;  3DRR B;  5KT5 A;  2BQU A;  3HVW A;  4XK8 C;  1F3V A;  3E51 A;  5IT0 A;  4IFV B;  4L75 A;  2CJK A;  2C2O B;  3U1L A;  1T03 B;  1FJ7 A;  2V94 A;  3HFV A;  4KQZ A;  4L3N A;  2ZBI A;  4BC9 A;  5DG7 A;  3CJ5 A;  1L3T A;  4DPT A;  4B3M F;  3NBP B;  4AT1 B;  1ALK A;  3ZFV A;  1P1T A;  2UVR A;  2HHV A;  1LKZ A;  2CQD A;  1L3S A;  3A52 A;  5F8I A;  5LMN J;  2JJ4 D;  7FD1 A;  1SXL A;  2MPU A;  3GIK A;  4WE1 A;  5F0W A;  4GTY A;  4GKJ F;  2RD5 C;  2GHV C;  3IFE A;  1BWV A;  3QGI A;  3QQC D;  2WB1 D;  4R8U B;  3UNY A;  3Q8U A;  1KC8 T;  1IBK J;  3H0P A;  5BYR A;  1AUS L;  4DR2 J;  3P45 B;  2FVQ A;  2GNK A;  1RA6 A;  2GO8 A;  5EWE A;  3EX7 B;  3JTO A;  1C0U B;  2XZT B;  3TQE A;  3GJS B;  4B3O B;  3Q86 A;  4C8M A;  4WU3 A;  3H5U A;  4F7V A;  2M5Y A;  4O23 A;  3BYR A;  2Y9H A;  5TJ3 A;  4X4N A;  1FSU A;  3GU0 A;  1JLB A;  4HLB A;  3T9Z A;  2CFX A;  1ZH5 A;  1U09 A;  2WSC C;  3VVU A;  3IGY B;  2VQF J;  3ZTP A;  5D77 A;  1TR0 A;  4NYP A;  2UXC F;  3V6H A;  2W8S A;  5KG5 A;  1MU2 B;  2LMI A;  1SKU B;  1DZ5 A;  2W1B A;  2MQO A;  2G13 A;  2RU9 A;  4WZQ A;  3K5O A;  5AT1 B;  2D1G A;  3N01 A;  2LLZ A;  4OHX A;  3CC7 S;  3OXF A;  1U49 A;  2O66 A;  5T7L B;  2Z2M A;  5KFC A;  1KD1 T;  5IT9 Y;  1XNR F;  3HMJ G;  3J80 Y;  4C3M A;  3QMQ A;  3MM7 A;  3HT0 A;  4J9S A;  3RTV A;  3QWU A;  2LA4 A;  4OI0 A;  2W25 A;  5C24 B;  3O44 A;  2B5J A;  2W5T A;  3A3O B;  4DPU A;  4I69 A;  2EFP A;  5KFE A;  5E0O A;  4JV5 F;  3CD0 A;  2W4D A;  3M8Q A;  2CDR B;  3LAK A;  3LGM A;  3K5M A;  4DFM A;  2QLW A;  4CTA A;  4EO8 A;  4M5N A;  1RWU A;  3JYT B;  2YNI B;  3CSK A;  1UW4 A;  1SH2 A;  1Y6V A;  3V6D A;  1CC8 A;  4Q2M A;  3BGL A;  4C4W A;  3D66 A;  3I4P A;  3TUZ C;  1XWL A;  1F5A A;  3WAY A;  4NLP A;  3IR7 B;  1WG4 A;  4H4K C;  4F3Q A;  2DRB A;  1U4B A;  3A4T A;  1YQH A;  1AUK A;  1FES A;  3W60 A;  1Z2Z A;  1EJJ A;  4DUT A;  1QSL A;  3WDO A;  3DOL B;  2XO6 A;  1UET A;  4ZCI A;  2AYB A;  4J91 A;  4DZD A;  4K0K J;  4ED2 A;  4DR3 J;  4K4X A;  1BXN A;  1VIS A;  1UVL A;  5HQM A;  2R7O A;  2KYX A;  2XLK A;  3O3L A;  3HFZ B;  1C1B A;  1B7F A;  5C42 A;  4LF9 F;  4E8U A;  2W8L A;  4YY3 J;  2FGO A;  2X51 A;  3BQ0 A;  2HKE A;  4HYK A;  3WIV A;  2XSJ A;  3BN7 A;  3D68 A;  2QA4 S;  3CD7 A;  2X1F A;  1UVN A;  1JJ4 A;  4Q0B A;  2AKW B;  4FNH A;  1RTD B;  1CG2 A;  4DU7 A;  3M6X A;  3MMA A;  3OJS A;  3DM2 A;  4KT0 C;  3GCW P;  1NCL A;  3DRS A;  1RWN B;  1TP7 A;  1Q81 T;  3LP2 B;  2V2Z A;  4KHP F;  3PAC A;  1OJ4 A;  3US5 A;  3W2W A;  4LVN P;  4E2F B;  1NK4 A;  4X62 J;  1JB0 C;  2ZE2 B;  4LF8 J;  2M70 A;  3NP5 A;  5F8J A;  2BM0 A;  1VLO A;  4ZPD A;  4KV8 B;  3C6T A;  2ZKU A;  5J2P B;  3AXK A;  5DQG A;  3G9C A;  1S79 A;  4Y3C A;  2Q6C A;  2MTL A;  3GFZ A;  2EVZ A;  5BYQ A;  4ZIW A;  1ZPW X;  3CCU S;  4TYA A;  2X1B A;  1HYS A;  4CH7 A;  2HHH J;  2DTJ A;  4DV3 J;  4NEZ A;  2R7X A;  3AA9 A;  2HBZ B;  1Y5N B;  2OPQ A;  4IYQ A;  4OZN A;  2YPZ A;  2UXD J;  2CQP A;  4DX8 H;  2MQQ A;  2XUL A;  4ZP9 A;  1U1O A;  5GMD A;  1VQL S;  2CQH A;  7FDR A;  4JI6 F;  1MG7 A;  3TUP A;  1G2E A;  3N79 A;  5IC4 B;  4KM4 A;  4F0M A;  2B4U A;  4QU6 A;  1N2K A;  3CO0 P;  3MTJ A;  4OI2 A;  3A8E A;  5B7W A;  3C15 A;  4UF4 A;  1W2I A;  5GAG I;  3RW7 A;  1RHM B;  1CBK A;  5L39 A;  1NJX A;  2QT7 A;  1GTE A;  2LQ5 A;  2CQ4 A;  2JLF A;  3PJX A;  3LQV A;  3T5H A;  1G4C A;  2LDI A;  3BGR A;  2AX1 A;  3H59 A;  3UI3 A;  1QUV A;  3W9I A;  4DPO A;  2YVS A;  5K8M A;  4ECQ A;  1KQF B;  3PM9 A;  4RNH A;  2YY3 A;  3BR8 A;  1FVQ A;  1SQF A;  2Z56 B;  4DPY A;  1HKA A;  3AJD A;  4LF4 F;  3FBF A;  4DN9 A;  3Q2S C;  4O0I A;  3LA0 A;  2GIR A;  2G0I A;  4IQX A;  4MTP A;  1XJW B;  5LIA A;  3I87 A;  3FFI B;  4LBH A;  4YP3 A;  1WG1 A;  2DB1 A;  2A6O A;  1XER A;  1FDD A;  1Q8B A;  2ZVI A;  1VJW A;  2MKY A;  2NZ4 A;  3OTC A;  4FXW A;  3P3D A;  5EDW A;  4DS4 A;  2VDH A;  1KVK A;  2VZ9 A;  3GIM A;  4ILM A;  3D5M A;  2NSC A;  1B70 B;  1RAA B;  5A0Y B;  4DLG A;  3DMJ A;  2D3Z A;  2GVZ B;  3ITH A;  4IRD A;  5DO2 A;  5INH A;  3R9L A;  4IOB A;  2Y0B B;  1Z4U A;  3NS5 A;  3DFE A;  1NKC A;  4EFA C;  3M30 A;  5LMN F;  3DLK B;  4KY3 A;  2XNR A;  2MKJ A;  1EW8 A;  3RBX A;  3QFH A;  3KLI B;  1HNI B;  2W7O A;  4NCG A;  3MMJ A;  2CJY B;  4WWS A;  2HGN A;  4NXN J;  4HDG A;  3UDV A;  2MLZ A;  2F1F A;  4ZKA A;  4DR2 F;  1MMD A;  3OV7 A;  1A0O B;  1VBX A;  5KT6 A;  1G7C B;  2FIU A;  3HHN B;  3LTO A;  2XYP B;  5LJ3 Y;  4AXJ A;  3BGF A;  3H4D A;  2QJ3 A;  4P7V A;  4DSL A;  3M6U A;  4CYU A;  4I2P A;  4EBE A;  1AJB A;  2M3D A;  4KO0 B;  3JSR A;  1TZ0 A;  3VAK A;  4ZPT R;  3P5T L;  3AOB A;  5GAG U;  2MYF A;  1RGV A;  1N48 A;  1JLQ A;  2MKS A;  2DGV A;  1DY3 A;  1JLG B;  2CWX A;  1FE0 A;  3DRP B;  1Q5V A;  1N8R T;  1S57 A;  2Q3P A;  1ELO A;  2ACY A;  3GSD A;  4K4U A;  4G6V B;  3P6Y C;  4G1Q A;  3QIP B;  3HD1 A;  5C7P A;  1J5E J;  4PG8 A;  3C8Y A;  2UZA A;  4QJV A;  2OSQ A;  4F4K A;  5K20 B;  3EM1 A;  3KHL A;  2ZIT A;  3J7A 1;  4TY8 A;  4OX9 J;  2XI2 A;  1TL1 B;  1TKZ A;  3D6H B;  2OLW A;  4AL7 A;  4FPI A;  4YOE A;  2HFZ A;  4RZR A;  3JB9 k;  2UV8 G;  5EGH A;  3MEG A;  3IRW P;  3IG1 A;  4DR5 J;  1IKY B;  2HVZ A;  2V8V A;  2CVI A;  2CAJ A;  3EVW A;  4DMZ A;  1TKT A;  4USI A;  3BQ1 A;  3U02 A;  3UD3 P;  5F0U A;  5J2M B;  3A3P B;  5IZH A;  2I1R A;  1HQA A;  2E9T A;  3OR2 B;  3SBM A;  3H98 A;  3TA1 A;  3TNV A;  4EU0 A;  1O0P A;  1WF0 A;  2IAJ B;  4UY8 T;  2YNH B;  3NNC A;  1XK8 A;  1RT7 B;  3HHL A;  1MNE A;  3QZ8 A;  1M5O C;  3J7Y U;  1IJE B;  1IR0 A;  2OIH A;  3A3N B;  3S6E A;  3TZZ A;  2G2Y A;  2HNZ A;  3QT5 A;  5SZT A;  3A13 A;  4LF5 J;  4X4R A;  4OZL A;  1F6T A;  4B17 A;  4DR3 F;  2XMV A;  2VKZ G;  1LWF B;  3PYE A;  5F41 A;  3PW7 A;  4KJI A;  3KNG A;  1U2R A;  5IWA J;  4M5L A;  2F8H A;  4RW8 A;  5EHH A;  4LRE A;  2JRS A;  4FP9 A;  4F25 A;  1B99 A;  1HWU A;  1N5T A;  4N76 A;  3I9Z A;  2XG8 A;  1FRH A;  2IM2 A;  1VIX A;  3C14 A;  1RYR A;  2J7U A;  4Q5V A;  3OD2 A;  3M9N B;  5KXA A;  1IKW B;  2MQN A;  2VL1 A;  3TW0 A;  3MM5 A;  2VH7 A;  3NKR A;  4ED3 A;  2N4D A;  2DHS A;  1KTQ A;  2DNZ A;  1NME B;  1YRX A;  4YR0 A;  1FA0 A;  1BLU A;  5HVH A;  1QAY A;  2V2Q A;  4PWD B;  4F4Z A;  2PEB A;  1VS3 A;  1X0F A;  1REG X;  5J2Q B;  2WOM A;  4USU A;  2ADC A;  1PYT A;  3UCG A;  3JSM A;  1JJC B;  4KB7 A;  1U7L A;  2ILY A;  3D6T B;  2W9C A;  3UR0 A;  1TL3 A;  2B7C B;  3IA0 A;  4ZCK A;  1RKI A;  4X4V A;  1KOH A;  3OW2 R;  4CYS A;  5HAN A;  5E33 A;  1IKV A;  1CUL A;  5FLX Y;  2GMH A;  2CNO B;  2UXD F;  1FHT A;  1M90 T;  1SL1 A;  1UWB A;  4GO7 X;  4UQG A;  2HS0 A;  4ZPV R;  5AXL A;  3I82 A;  2HIY A;  2BOP A;  1X4D A;  3WHI A;  5CZV A;  1N56 A;  2KJV A;  1BY9 A;  4QPT A;  5G4D A;  1E6V B;  4ZP8 A;  2DR7 A;  3Q83 A;  7AT1 B;  3I4H X;  1B8J A;  3KJQ B;  1Z1Z A;  3KJV A;  4OYM A;  3KK2 B;  1S1T A;  8ATC B;  4WPA A;  1N33 J;  2RB7 A;  3R7N B;  5JMN A;  2ZC4 A;  2WVE A;  4M5D B;  4ZN3 A;  4K4Z A;  2HVE A;  4NE9 C;  3IMQ J;  2MZ1 A;  3VZI A;  2IY5 B;  2RJZ A;  4Z7Y A;  1H98 A;  1MW7 A;  1FJG F;  4K7Q A;  3KLF B;  1NND A;  2I5J B;  4H4M B;  2IFY A;  3GE9 A;  2L9N A;  5CYQ A;  3VR1 A;  3TAM A;  2Q43 A;  2PDA A;  4B9S A;  2FTR A;  3K8W A;  5C5J A;  3CD6 S;  3SIP B;  3D6F B;  3H40 A;  1PSD A;  4MKV A;  3UQS A;  1FRI A;  3I0S A;  1XQI A;  5C25 A;  3BDH A;  1IKX B;  1FRK A;  4DCP B;  2BJ7 A;  2ASY A;  4RR5 A;  1DQ9 A;  1N32 F;  1ARO P;  2JFD A;  1YRU A;  4I7F A;  2QEX S;  2BW7 A;  5I4M A;  3V2U C;  5DS7 A;  3IR6 B;  5KFB A;  3R1L A;  1VIO A;  2W9B B;  4V19 X;  1S49 A;  4IDK B;  3MEC A;  3T5J A;  1ZYQ A;  4FYW B;  5LRM A;  3W3S A;  5HBM A;  2QFJ A;  3JXO A;  2GMJ A;  2V0N A;  2LA6 A;  4TQR A;  4CQ1 A;  2BJ1 A;  5HSP A;  1YZ7 A;  1FX4 A;  2DGT A;  1UEK A;  2E44 A;  4X2B A;  2A1B A;  2E9Z A;  1JLA B;  1EQM A;  3HSG A;  2VG7 A;  1I3O B;  4CZC A;  3CIZ A;  2RDD A;  3HHK A;  1MN7 A;  1WC3 A;  5LXR A;  4I56 A;  5LSR A;  4QAX A;  2LXU A;  4I2Q A;  4RLE A;  4JV1 A;  3J7Z 5;  3HVR A;  2AW0 A;  3SQG A;  3N6M A;  4IO1 A;  4TNO A;  1N4L A;  3RB0 A;  4O3Q A;  4N56 A;  4DG1 A;  4I0W A;  3Q0A A;  1SC3 B;  4DR1 F;  3IN5 A;  2XMT A;  2EBG A;  4L74 A;  4ID8 A;  3M9M B;  2PI4 A;  4RX6 A;  4FF3 A;  4C3K A;  2QV6 A;  3EUN A;  3IC1 A;  2KZM A;  2YBV A;  1S1V B;  3M2U A;  2ZVS A;  1KQG B;  1D09 B;  1IM6 A;  1AZS A;  2KU7 A;  1S6P B;  3CUL A;  5G0R B;  3D0H E;  4FYD A;  1RTH A;  4LFB J;  5D3G B;  3I6P A;  4PWU A;  2F8E X;  1KHN A;  2V8D A;  1SJ3 P;  1GAO A;  4O44 A;  2YNF A;  2E7V A;  3N4W A;  4F2S A;  3DNC A;  4YEA A;  4A8Q A;  1MRO B;  1T9W A;  1S6O A;  2ZM6 F;  1FNO A;  3HUL A;  5KFA A;  4IO9 Q;  5HAO A;  4IH6 A;  2H4W B;  4YR2 A;  3T19 A;  1QUP A;  3ENW A;  2ATC B;  4HL9 A;  3M2V B;  1DUR A;  1NHV A;  1TL4 A;  1NDP A;  3H42 A;  1SV5 B;  3LGH A;  2HW3 A;  1F0X A;  2JVR A;  5DDP C;  5GAE I;  2HWI A;  2N4C A;  1TVR A;  1OPZ A;  3HSJ A;  4B9T A;  3KLV A;  2DR9 A;  3CCS S;  2WK4 A;  1RT2 B;  3W66 A;  2F65 A;  2Z2L A;  4LF1 A;  2L3M A;  3RB3 A;  2VON A;  1HNZ F;  4HI1 A;  3RB6 A;  1APS A;  5C2G A;  1J5O A;  2W5W A;  2ZH6 A;  4DF4 A;  1DTT B;  1WHW A;  4O3S A;  1KNZ A;  4MFB A;  2XO7 A;  4P9S A;  1HBN B;  3BYP A;  1ZM4 A;  1KVI A;  3J81 U;  5CXT A;  2UUC J;  1N2L A;  2R7W A;  2ZJP Q;  1UKU A;  2E5J A;  2Y3Y A;  3FEX B;  1KHV A;  4K5S A;  2IVF B;  1CJK B;  1E6Y A;  1ZED A;  2DY1 A;  4X4T A;  2DT9 A;  3FSI A;  2OPR A;  4DL2 A;  4N41 A;  4F0K A;  3MPU B;  2W8K A;  3T1A A;  4NLG A;  2W7A A;  1B0P A;  4UPL A;  1KTV A;  2H65 B;  4KRW A;  5C2C A;  2JWN A;  4OI1 A;  3CJ2 A;  4HAC A;  4WXO A;  1KKH A;  3BF4 A;  1EKR A;  2CPD A;  5J1E A;  1TK5 A;  5AXN A;  5E3C A;  1S4F A;  3UFC X;  5H1S V;  2CXE A;  2BKN A;  3FKB A;  5KFH A;  3FCV A;  2QX0 A;  1B3T A;  2M4M A;  3EDR B;  1HBM B;  2DNP A;  2ZNY A;  2BDP A;  3LPE A;  1RWX B;  3P4U B;  4F50 A;  3IO1 A;  3C6U A;  1Q53 A;  1N34 F;  3PFE A;  1S4E A;  2X1G A;  3AH6 A;  2QL5 B;  1SB6 A;  1PJ7 A;  3W7B A;  2YNG A;  2BRL A;  1QLN A;  4W90 B;  2GS8 A;  1YSJ A;  3NAI A;  2DJW A;  3M8P B;  3V4I A;  5MAO A;  3G8S A;  1RLD A;  3MAA B;  4LSN B;  4KFB A;  2GSU A;  3DGP A;  1ZZF A;  5ADZ A;  4Z2X A;  2CJQ A;  3M8R A;  5GAE U;  1F5B A;  5DZ6 A;  5CHC B;  4A48 A;  4XAK A;  4DUY J;  1FWK A;  3TWZ A;  2AJ0 A;  1S6Q A;  1FDA A;  1KDN A;  1CS4 B;  3UVJ B;  4ECS A;  1D3W A;  4Z7C A;  3KK3 A;  1KSP A;  3QT6 A;  2MLY A;  1LW2 A;  1U8W A;  2D41 A;  1SJ4 P;  2N3O A;  2AQ4 A;  5IJQ A;  2ACM A;  4L76 A;  3Q8S B;  2HZV A;  4FF1 A;  3QGG A;  2C2Z B;  2HWT A;  1QE1 A;  2EG2 A;  3SCI E;  3T00 A;  1KHW A;  1S5Z A;  4LF7 F;  2LQ8 A;  4X66 J;  2IUC B;  4B02 A;  2CNK B;  3MCM A;  2XMJ A;  3N5B A;  4ZVE A;  3GQC A;  1WC6 A;  5LMU F;  1KWM A;  5LOQ A;  1WC1 A;  3ET6 B;  1HIY A;  3PR5 B;  4PQU A;  2DEI A;  3SCJ E;  1NUE A;  4ES3 A;  1U1Q A;  2B4V A;  2DCU B;  2KT3 A;  1FJC A;  3LPY A;  3ICL A;  4UOH A;  2ZFH A;  4UUX A;  5KFG A;  3C16 A;  1LNQ A;  1TL7 B;  1U25 A;  1KFD A;  4HH0 A;  2N82 B;  1SJQ A;  5DLG A;  1X4A A;  2VBY A;  4Q8E A;  3DDK A;  1ZEB A;  4OHZ A;  2V67 A;  2HHX A;  2HGM A;  2BMB A;  2YX4 A;  4NLV A;  2HQI A;  3G86 A;  4FDF A;  4K4W A;  2VQE F;  4QQB A;  1IM4 A;  1X4F A;  4B3S J;  3QID A;  4QW8 A;  2XZW A;  1N0U A;  4KAV A;  2W7P A;  1TQL A;  3E01 A;  3R2D J;  4DV4 F;  2KVI A;  1JXE A;  5D6G A;  2CNL B;  3BRE A;  3Q22 A;  2AGO A;  4J9K A;  4HHH A;  4IFY B;  1Y7P A;  2JFK A;  3NVL A;  3OLB A;  1NAQ A;  4WZM A;  2ZUA A;  3OHA A;  2GAH C;  1GFW B;  4MAK A;  2OSR A;  1RE1 B;  4DZ6 A;  5HP1 A;  4C3L A;  2X1A A;  4I1T A;  4NYO A;  1XR5 A;  5M2P A;  4FKY A;  1UL3 A;  2LXF A;  2F5G A;  4QWE A;  5I3U A;  2IPO B;  1FO1 A;  1LFW A;  3TR5 A;  2BYC A;  2VFU A;  2ZDP A;  3GYX B;  3SEO A;  2J9D E;  4IR9 A;  4IFV A;  2GCF A;  2ZDO A;  4EI2 A;  1Y3K A;  2ZD1 A;  4P74 A;  9RUB A;  1XMQ F;  5KFW A;  2PT0 A;  3OXL A;  5KFZ A;  1WD6 A;  5FDL B;  4OYW A;  3V5R A;  2H5I B;  2MQ8 A;  1T9T A;  4OJ3 A;  3AD8 C;  2J9D A;  4ED7 A;  1BHN A;  1CEZ A;  5DM6 Q;  2Z0G A;  1JMT A;  4DV6 F;  1C4A A;  4D3G A;  4RU9 A;  3TZX A;  3QPI A;  1SCJ B;  4PXD A;  4ZIV A;  4NLU A;  2HHW A;  1H0H B;  1HR0 J;  2CQ0 A;  2XHW A;  4M95 A;  3VHQ A;  2IM1 A;  3W9J A;  4WF9 Q;  2FD2 A;  4HR2 A;  2PII A;  4K2X A;  2JC0 A;  1RT1 B;  3TZW A;  1VR6 A;  2YPY A;  3CCW A;  1XMB A;  1AFJ A;  5KOX A;  1VQS A;  3UDL A;  1Q82 T;  2G2O A;  2HQF A;  3JS9 A;  3DOK B;  1YLX A;  1HNX J;  2GVD B;  1LK7 A;  1RIS A;  1I1G A;  4ZVF A;  1FER A;  2H51 B;  1RP5 A;  4DR4 J;  2UU9 F;  4MKB A;  3EPI A;  4OYX A;  2F40 A;  1M1H A;  1Q7Y T;  1L3V A;  4UOO A;  5K4P A;  3MM6 B;  2AIR B;  3EVO A;  1RT5 A;  4WTO B;  5KG2 A;  3CCJ S;  1H6K X;  1FK9 A;  2W4P A;  4PRF A;  3PFO A;  1ANI A;  1GEH A;  2ABY A;  2E7W A;  1MU2 A;  1LWC B;  4DSF A;  4GKK F;  4J9V A;  3EVM A;  2RUG A;  4EZ9 A;  4YDD B;  4FNI A;  4OYB A;  1WHY A;  5AJ3 F;  2K3K A; 
#chains in the Genus database with same CATH homology
 2W5R A;  3T02 A;  3WAX A;  1ED8 A;  1P49 A;  4UOP A;  4N7T A;  4GTX A;  1AUK A;  3NKQ A;  4FDI A;  1HDH A;  1EW9 A;  2GSO A;  1E33 P;  1EW2 A;  4KAY A;  2D1G A;  3E2D A;  3IDD A;  5IJS A;  2GSN A;  2GSU A;  2X98 A;  3DPC A;  4UPK A;  4LQY A;  1EJJ A;  4GTY A;  3KD8 A;  3LXQ A;  1O98 A;  1KHL A;  1ED9 A;  4LRC A;  4CXS A;  1ZED A;  3NKP A;  2W5V A;  4MIV A;  3WBH A;  1EI6 A;  2GA3 A;  4GTW A;  4QAX A;  4ZGA A;  4KJD A;  1ALI A;  3TWZ A;  3UNY A;  3MK0 A;  2IFY A;  3BDG A;  2W5S A;  2W5Q A;  4B56 A;  3NKO A;  4MY4 A;  4LRB A;  4UPL A;  5GOV A;  3IGZ B;  5EGH A;  1ZEF A;  1AJC A;  5EGE A;  4ZG7 A;  2G9Y A;  4LRE A;  1K7H A;  5LIA A;  3UO0 A;  1ANJ A;  3BDG B;  4CYS A;  1ZEB A;  2GLQ A;  1ELY A;  3OT9 A;  4ZG9 A;  3M8Y A;  3TG0 A;  2W5T A;  5DLW A;  3MK1 A;  3M8Z A;  1AJD A;  1Y7A A;  5HRT A;  3BDH A;  3BDF A;  3B5Q A;  5L0K A;  4ZG6 A;  1URB A;  4LRF A;  3UN2 A;  1ELZ A;  3ED4 A;  5DLT A;  4CXK A;  4LR9 A;  1KH5 A;  5IJQ A;  3Q3Q A;  1KHJ A;  1E2S P;  1AJB A;  5C66 A;  1HJK A;  3CMR A;  4KJG A;  4UOO A;  5LRN A;  3M7V A;  1E3C P;  4UPH A;  5AJ9 A;  5K4P A;  2ANH A;  1ALH A;  4LR8 A;  1EQJ A;  3UN3 A;  4FDJ A;  4UOR A;  5TJ3 A;  5KXA A;  1FSU A;  3M8W A;  1O99 A;  5L0B A;  4KAV A;  1SHQ A;  3UN5 A;  1E1Z P;  1KH4 A;  1ELX A;  3T00 A;  4YR1 A;  2IUC A;  2XRG A;  3DYC A;  4GTZ A;  2ZKT A;  1AJA A;  2QZU A;  4NWX A;  5DLV A;  5LQQ A;  4TN0 A;  2XR9 A;  1URA A;  3IGY B;  3NKR A;  1ANI A;  5INH A;  1KH9 A;  3WAW A;  1Y6V A;  3T01 A;  5GRR A;  1HQA A;  3WAV A;  1KH7 A;  2W5W A;  4UPI A;  1B8J A;  4KM4 A;  4CXU A;  3NKM A;  5LRM A;  1ALJ A;  2IUC B;  1N2K A;  1ALK A;  1KHN A;  3SZZ A;  3MK2 A;  3NVL A;  2RH6 A;  4LR7 A;  3SZY A;  5L0E A;  4NWJ A;  3NKN A;  2VQR A;  1KHK A;  4CYR A;  2W8D A;  4LR2 A;  2W8S A;  3TX0 A;  3WAY A;  4LRD A;  2W5X A;  4MHX A;  4LRA A;  1EW8 A;  1N2L A;  3A52 A;  1SHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...