4LRBA

Phosphopentomutase s154g variant soaked with 2,3-dideoxyribose 5-phosphate
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTGADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 146
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrbA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrbA01
1EI6A 4NWXA 1ANIA 3WBHA 3UN5A 1KHKA 4CXKA 4FDJA 2VQRA 5L0KA 3BDGB 3SZZA 3NVLA 5DLTA 4LREA 2W5QA 1ZEFA 4B56A 2QZUA 4LRAA 3NKQA 3T02A 1KH5A 4NWJA 1P49A 3M8ZA 1AJBA 1EW2A 2W8DA 5IJQA 3B5QA 1ZEBA 1E1ZP 1ELYA 4LRCA 1N2KA 3T00A 1ALKA 5C66A 1B8JA 4FDIA 4LRFA 5LIAA 5LQQA 5EGHA 1SHQA 2G9YA 1ALIA 1KHJA 1Y6VA 3MK1A 1E2SP 1ELXA 2W5VA 3NKNA 3NKRA 5GRRA 1O99A 4LR7A 2W8SA 3IDDA 3MK2A 4CYSA 1EQJA 4KJDA 2RH6A 3BDHA 1ALJA 2GLQA 2GSNA 4LR8A 4UPKA 2GSOA 4CYRA 5EGEA 3UNYA 3BDGA 3TG0A 1E3CP 3SZYA 5K4PA 4UORA 4YR1A 3TWZA 1KHNA 1ALHA 1AUKA 2W5SA 4TN0A 2XRGA 5GOVA 5LRMA 3NKOA 4GTWA 3UN3A 3NKPA 4ZGAA 4GTXA 1KH9A 4MIVA 2IUCA 4CXSA 3CMRA 4LRDA 2XR9A 2GA3A 5INHA 4GTYA 4ZG6A 5LRNA 3WAYA 4N7TA 4KAYA 4KAVA 4KM4A 1EW9A 4UOOA 1EJJA 4CXUA 3Q3QA 5IJSA 1HDHA 3A52A 3M7VA 4MY4A 1HQAA 2ZKTA 3IGZB 4KJGA 1FSUA 4ZG7A 3T01A 2IUCB 1AJDA 3NKMA 3WAVA 1K7HA 4LQYA 5DLVA 4LR9A 1E33P 1O98A 3DYCA 2X98A 3BDFA 4LRBA 3UN2A 1HJKA 2W5RA 5DLWA 5HRTA 1ED8A 3DPCA 2W5TA 3OT9A 3UO0A 2W5XA 1SHNA 4UPHA 3WAWA 1ED9A 3IGYB 3ED4A 2ANHA 3LXQA 4GTZA 5AJ9A 1ELZA 1KH7A 2D1GA 2GSUA 4UPIA 4ZG9A 1EW8A 5L0EA 4LR2A 2IFYA 4UPLA 3WAXA 3MK0A 1ANJA 1KHLA 4MHXA 1KH4A 5L0BA 1Y7AA 2W5WA 3E2DA 1N2LA 3TX0A 5KXAA 1ZEDA 3M8YA 3M8WA 1URBA 1AJCA 1URAA 4QAXA 1AJAA 4UOPA 5TJ3A 3KD8A
chains in the Genus database with same CATH superfamily
3CIZA 3QFWA 1JXLA 2HFUA 3OFHA 4AD6A 3CJ3A 3M9MB 2V8HA 2NXJA 1NJYA 2ZITA 3EPGA 2ZVSA 1FXRA 4CXKA 1JLFB 1RCXB 4RNNA 4AXJA 3FUYA 1OPIA 3CO0P 2KYZA 1A7GE 1NSPA 2D3UA 4ZN1A 1K44A 5J2PA 3CC2S 5BJRA 3CB4A 2BE9B 4KFBA 1MMLA 1TL5A 4C8NA 4B08A 5LMNJ 3RR8A 2QFIA 1OO0B 3NRBA 3GFYA 2IVFB 5C7PA 4X62J 1NNDA 3I0SB 3ZTRA 3PO5A 3NGSA 1YTYA 1S72S 4OYBA 2KM8C 2B5JA 1SKUB 2XS7A 3ENAA 5SUHA 3MEEA 1N5YA 1MLAA 2MQQA 3T1AA 3C14A 4F36A 3OL6A 1BWEA 4KJIA 5KFQA 1MROB 1EETB 3HLUA 1VQ5S 2ZEJA 1SCJB 5A2QU 1IXKA 1TV6A 2FHKA 2DHGA 2MMYA 2WHOA 5DLGA 4EBCA 1HD0A 2C3OA 2JHEA 1GAOA 1ELXA 1WDTA 4WFZA 5EDWA 1AUDA 2DRBA 3X3UA 1F2GA 2B0GA 1X31C 1NEEA 3CJSA 3CTRA 3BDHA 3OSNA 4CRJA 4DL2A 4C97A 2KZMA 3BSAA 5D8HB 4A8MP 1S76D 5KG0A 2OFHX 2XCPA 1GXUA 2ZC3A 2ZVIA 5EWGA 4B3RJ 1XR5A 4LMZA 1IQTA 2JSXA 3DU6A 2H1YA 4GO7X 3CD6S 2HHTA 2HNYB 4UY8T 4ES3A 1C2PA 4ZVFA 2BW2A 1NPRA 4NZ6A 4UOFA 4UZCA 2HPUA 2WSCC 5K8PA 3I5AA 3BO2A 2MZTA 4DSLA 5H9EK 3NKPA 2V68A 5IV3A 4ECSA 1OQ3A 1OY6A 4O3QA 5DG8A 1S57A 2HHWA 3CSKA 1IWGA 3OJSA 1SL0A 4L6V3 2KHCA 3ILJA 3PCOB 5H9FJ 3CPWR 2PFDA 2ZHOA 2BDPA 1H3DA 5HL7Q 2R7QA 3BGFA 4CLWA 4ED2A 2JFKA 3V4IA 2R8KA 2DJWA 2BOAA 4IFVB 4ZG6A 3X1LB 4ZS6A 3IAS9 1V3ZA 2MHNA 3A3PB 2E5LF 4C8KA 4OL8A 3O44A 3V4IB 3AODA 2FHMA 2OEKA 1G2EA 1KOOA 3OXLA 1FKOB 4O44B 2C3PA 3ISZA 2DNKA 4CYUA 2KT3A 4F50A 3UCUP 2PFFB 4DSEA 5AXMA 1VQMS 1KQKA 1P9YA 3BGLA 2JC0A 5F8IA 1R3NA 1K9MT 1IBCB 1NLKL 4H4MA 5LOQA 2X98A 2I5JA 1UFLA 5JXSA 2N4DA 2ZM6F 4F4XA 5DLWA 1F2HA 2HNYA 3DPCA 3TUIC 3NNCA 1SHNA 4CO5A 1UZHA 2ZWOA 3AT1B 2G9OA 2QT7A 4KE5A 1MU2B 2XWXA 4EFAC 2E5LJ 2V67A 3M6XA 1D8YA 3WAXA 1RTJA 2UXDF 3GJSB 5L9XA 3Q0AA 1DLOB 1ZTTA 1FJ7A 2EKYA 3BGRB 3BZQA 5T7LB 3RW6A 2HNZB 2QC3A 5KFZA 5ETNA 3R1HA 1SJ3P 1T02A 2H4YB 2KT2A 3NG8A 1H38A 4JI2J 2XY5A 3LALA 2UUTA 2GGPA 5A8RB 3BBFA 2RH3A 2DHSA 3MAAB 2R8GA 4ZJQA 4H4OA 4KHPF 2EBGA 3NAHA 4ILRA 3AJ2A 3D66A 1CQMA 3EX7B 1T03A 1QUVA 2WCXA 4KKOA 1RTDA 2CPYA 2W9AA 1T05A 1REGX 2UUBJ 4P75A 2QMWA 3DM2A 1NDLA 1RK8A 2LKZA 2WW4A 2V94A 4I6AA 1WJ9A 4M95A 1KHKA 3I4PA 2JEIA 2CRLA 2W7OA 5KFKA 1SC4B 2AJFE 2CJQA 4PABA 2JRSA 3A3NB 4I1TA 2Q3PA 1Z2ZA 2VU5A 3OVSA 1KFSA 4FVMA 1LKZA 1RT6B 2HGNA 3ADAC 1J5EF 1R31A 2HVIA 3ZZPA 4B56A 2B9EA 2LXFA 4LRAA 3TARA 2VV5A 5D0GA 4XPCA 2ATLA 3WC2A 1PIEA 3FEZA 2BJDA 2AJ2A 1EW2A 1EB0A 2R4FA 3CDBA 2WVDA 2RJZA 2V69A 4I2QB 3GIJA 1P49A 4ES1A 3T00A 2VPWB 1DQ9A 4ZJLA 2R9LA 3D3BJ 3FJ2A 1B8JA 3MCSA 4HI1A 1S12A 2CJ9A 1X9SA 2BJ1A 4UPHA 5B08A 2GO9A 1VBZA 2G9YA 4JI8F 2ASJA 3PG9A 5A2QY 1LV5A 3A4TA 3BPSP 3H2LA 3RBZA 5DQHA 2DR9A 5DG9A 2HQDA 4HI2A 1GFWB 4PZVA 4J91A 4ZP7A 2JWNA 3W2WB 4CLFA 2ADCA 1V3RA 2RH6A 2XWYA 3ZO7A 1J5EJ 4PEOA 4ZJOA 2XO6A 3BR8A 4KAIA 1KVJA 4UPKA 2MJUA 3R6LB 4C8LA 1RBLA 4RJVA 1GXLA 2Z2MA 3DLEB 3KUEA 4RW8A 3KK1B 4DPYA 3KOAA 4K59A 4CLTA 4USTA 3J7Z5 2LEAA 3EICA 4WIQA 3KUGA 3K58A 1C4AA 3GZ7A 5DO2A 5B0EA 4W92B 4PG6A 4TVAB 2J8AA 3KLFA 5H9EJ 2JL9A 1WF1A 4H4KA 4ID5B 1DTQA 4UOHA 4MMOA 3OBIA 4USKA 4H4OB 1TU0B 4PYAA 5BR8J 3CCMS 5H9FK 4FKXA 1RE1B 1VGYA 3W7BA 1N4LA 1HBUB 1V6HA 1FRHA 4NLUA 1N8RT 4FF1A 2IVMA 2PMHA 3I31A 3VTIA 2W8LA 1UVLA 4LF5F 1WI6A 2FLNA 1RP5A 3CDUA 3PO4A 1WUUA 1VQOS 2BKNA 3WQPA 4HH1A 4QIVA 2DNYA 2CG4A 3LP1A 5CZVA 4ZVSB 2L41A 2GMLA 3CIMA 4M1KA 3NY0A 2JEFA 1NM2A 1CJUB 1AJDA 2EFQA 3IM8A 1YJ9S 1NHKL 1TMJA 2IBOA 4CH0S 1CC7A 4C6AA 4WCEQ 4IOAQ 5F8NA 1RT7B 4CO0A 4ER8A 4LRBA 3UN2A 1FRIA 5DS7A 4EMDA 4DV4F 5HAOA 4C3KA 2A1BA 2VD3A 1LWCA 2AF6A 4KV8B 1TK8A 2XMUA 3W3SA 4LSLA 1HD1A 1WOSA 2V8VA 2BKPA 4YB5A 2G2YA 2OP5A 5CYQA 1AB8A 1K73T 1RBAA 2KZZA 1T9XA 3ED4A 2WAQD 4DQQA 1PJ5A 4CTAA 4NRUA 4PUOA 1I94F 1C1BB 4NPOA 3M8SA 1XTZA 4LF6F 2CPJA 3GP9A 3R1LA 1RU2A 1Y7AA 1NJIT 3A8JA 2E9RX 3TX0A 1V5IB 3KLVA 4NI2B 2EKNA 5KFOA 1F60B 3ZZRA 2FHJA 4MJKA 2H3EB 3HD1A 3D54A 3KXDA 1QSLA 2HWTA 2C2RA 3KMSA 3D2WA 4NZ0A 2L9NA 3R5BA 3V2UC 4CLPA 2MKKA 1WELA 2H51B 3C6UA 3I87A 3MMCA 3T1HF 1EI6A 4AL5A 2LQ9A 1PJ7A 5C42B 1F5AA 4NWXA 3HHLD 4RR5A 2AU0A 5IT4A 4USIA 2W24A 4JP8A 2EW9A 1R0AB 4PXCA 3M4XA 3RGIA 1N5SA 4ITSA 4R0EA 4DUYF 4FN5A 1FJGJ 1J27A 4Y2CA 5KT2A 3SZZA 2PE8A 4X4VA 2VZ9A 3OR2B 1N54B 5KFUA 3IM9A 1VQ7S 5A8KB 1TKTA 2YWEA 3NGTA 1RISA 1TMMA 2I38A 4WTYA 5EUHA 4ECUA 4JB8B 4OHVA 4JUZA 4AL7A 3MM7B 3OR1B 4I6WA 4LF9J 2LFVA 1N56A 4RNFA 3E8OA 1PJ6A 2A6MA 2PO4A 3Q8UA 4MYUA 4WFYA 2UXBF 4TLRA 4LF7F 4LRCA 1FVSA 5GVQA 4RPFA 5HATA 1KQSR 4DR7J 5L39A 2YX7A 1G6BA 4FNHA 4OX9J 1ALKA 4DV5F 1FKPA 1C0TB 3IS9A 1O6XA 1U1MA 4P71A 1URRA 1RWOB 1TUVA 3CMES 1U7LA 4P6QA 3WIVA 4LSZB 2NUHA 1NPKA 2Z4PA 4WU3A 2YQ3A 5HANA 2B5JB 4DUYJ 4LF8J 1FJGF 3GFHA 4FP9A 3HHLB 3BPDA 5E3RA 2ZC4A 1U8WA 2VA2A 2VODA 2R8JA 2H4WB 1YJRA 1HBMA 3MEDA 2RILA 5C24B 3J81j 1U6BA 1HQUA 3R97A 2DGXA 3UE2A 2DB1A 2YX1A 4IH7A 3N01A 3GG0A 1NBEB 2CUYA 4G6VB 4TXSA 4PG8A 2R3VA 1A9NB 3CJKB 3C16A 4XIUA 2ERRA 1Q8KA 3P6YC 2ACMA 4PAAA 4WK1A 3W9IA 1N88A 4TU9A 4Q0BA 4W98A 1AA1B 1Q8IA 3B4DA 1ZAVA 3PW4A 1ALHA 1T9UA 1TFWA 1MW7A 4AQYF 3W61A 3JTOA 3S01A 5M2PA 4ZGAA 2BM1A 4GTXA 1IQZA 4K2XA 2Z58B 3RRKA 2FLPA 4M63A 4B3TJ 1HBUA 5A76A 3KHRA 4C11A 4J37A 4Q8FA 1FNXH 3TEHB 5KT7A 2LA6A 4Z7YA 4LRDA 4KYZA 5KFTA 4UUXA 1NB2A 1VQ9S 1JLCB 1UFKA 3NCRA 5LRNA 1MN7A 4FYWB 3MM5A 4DCJB 4KAYA 1PBUA 1R7IA 3BN4A 3A12A 1Q78A 4ZPAA 1UVNA 3NXZA 3L4BC 3TVKA 2NSCA 4QIWD 5ETOA 2JVRA 1SKWA 2XS5A 1NKCA 4RW8B 3A8EA 1FESA 2D69A 3F41A 1FNMA 2MQ8A 2RUGA 4K5RA 4ZVHA 4OHZA 2MZSA 4Y2IA 4C3MA 4WFBQ 3VAKA 1ZZNA 2IUCB 4LQYA 3H2UB 1NO8A 3IA0A 4YQWA 3SZ2A 2ZBPA 1X4AA 3M6WA 4NA1A 2W9BA 3HJVA 2O67A 3LTOA 2EK6A 1OMSA 1YZ6A 2HG4A 2KM8B 4DV1J 1KOHA 1YJVA 3M2RB 3G6YA 2KTQA 1KDNA 2ABYA 4YB7A 2CQBA 1VQLS 2BV3A 3PTWA 3QGPA 3EGZA 3ZFVA 1YJWS 3MXHP 2GFFA 4ICLA 4EO6A 2BR0A 3DN9A 4MIAA 1GMVA 3QZ8A 4EYIB 4A8WA 1JLQA 1WF2A 3M05A 3OUYB 1Y00A 2CQ4A 4RU9A 1RB0A 3MAHA 5C25A 4A8KA 2HS3A 1U1PA 3CJ4A 3IWLA 1DBDA 1FFGB 1SH0A 3K5PA 4BLGA 1TL3A 4K4VA 4LBIA 2CJKA 1FA0A 1X8DA 4GVLA 5LMUJ 1U02A 3CE8A 5HJYA 2XMKA 1QAJA 2MKHA 2ASYA 2XQCA 2OKQA 3FKBA 4G1QB 3I32A 5D4NA 2DR5A 2FPHX 2Z8QA 3CCQS 3I82A 5CD4A 3KK3B 3M1VA 4FDJA 2UVWA 2R7UA 2BX6A 5L0KA 2FQQB 2Y0BB 4OYAA 1KQFB 2IRYA 3BDGB 4ANCA 4A8YA 4MYTA 1Z2LA 2V34A 2R8HA 3KLEB 2VHGA 3Q22A 1GTEA 4LREA 2C3MA 1ZEFA 4RBUA 4EBEA 1QY7A 4C8YA 1S79A 3DDKA 3W65A 2QTWA 3CD7A 4YB6A 2W8DA 5DM7Q 3UW1A 1XWLA 4RLEA 3QIDA 5K5MA 4RW4A 4DMZA 3HSZA 3R5AA 4C8OA 1N2KA 1FKPB 2HQFA 2QA1A 1M5PC 3MM5B 1U48A 2V8PA 3GSIA 1EP4B 1M1GA 2LQBA 3D9BA 1EKRA 2K06A 3K2YA 3ULHA 4X4TA 4TU8A 3GILA 5HLFA 2ASDA 1XMOF 4JI0J 1HMVB 4KC5A 4ED8A 1Y6VA 4Y00A 2FY1A 4MK8A 4DJBA 2FZGB 5FIIA 2RRNA 1LW2B 4USWA 4R5PA 1UEVA 4AQYJ 3PV8A 1JXVA 3DRRB 2C2NA 5HROB 1TKTB 1F9HA 3NP5A 1I1GA 2GLQA 4EZ9A 3T1YJ 3B54A 3NBPB 1E6YA 1HPZB 2ZDPA 3AQPA 3MHYA 2WVCA 4KQZA 4M5JA 1U47A 4K4UA 3C16B 2QV6A 3S8SA 4DV6J 2NSBA 3VR1A 3D5MA 5HMWA 2OSQA 3UR0A 4QCLA 3ETOA 2CAJA 1UFWA 3OTOJ 2KFZA 4DR5F 1TL1B 3DFEA 2BRLA 4NLRA 5BYRA 2MXYA 3OL7A 2ZZNA 2QJ3A 2XULA 2B8QA 2QLFB 3AOBA 3T6JA 4WBFA 3W8PA 1VQNS 1U1QA 2PEHA 1RQ0A 2EPIA 3HHLA 2RDDA 5KFVA 4Q2LA 5ETMA 2F7VA 3T6BA 3M9OB 4QWCA 3JQKA 4B3OB 3KDOA 2CQ3A 5EWFA 2NREA 3O8WA 3THTA 2IHR1 4IOCQ 5LJ5Y 3LUYA 4DSFA 2RKIA 1U1OA 3PKYA 1FHTA 3KK2B 3C6TB 1UVKA 1LEOA 2XGQA 2QSWA 4I0WA 5DDOC 5ETPA 1TUGB 2ZJQQ 4KM4A 4DR1F 4O0IA 3EGWB 1DTTB 1S99A 5LM7E 4MY4A 2FIUA 4RWWA 3MPVA 1FDBA 1OJ4A 2FYXA 3C8YA 4BDPA 5CYQB 3HVRA 4U8YA 5I3QA 4OX8A 4Z7CA 3PIOQ 2WB1D 3N6NA 1TUWA 1NK7A 1Q0NA 3BBCA 1E6YB 1HPZA 5L1LA 4Y34A 3VAGA 1ITPA 3Q2TC 4FS2A 3BYPA 2QLXA 4CLKA 2NPIA 1UKUA 1RBOB 2KJVA 3W2VB 4OHYA 1D09B 2J5AA 2M4MA 3BM7A 3FQKA 3LP0A 3M8QA 4OZNA 1RA6A 2BA9A 3HVTB 4HDHA 4V1Ak 4C0HA 5K8MA 5CYMB 1G3OA 5K8NA 1B0PA 3MMBB 2KXHA 3GCXP 5KFMA 4CNZA 5D4LA 4X66J 1QTNB 2XC9A 2MZ1A 4ED0A 3IGYB 5LL6d 4DX6A 4ILLA 3LP1B 1EP4A 2E1MC 1RT2B 3POTA 2F65A 3HT3A 3GV8B 1HW8A 1ZPVA 2C2DA 4FBUA 5MAOA 4YY3F 3AA8A 4QR1A 4WKRA 2H9ZA 3MEEB 4GC7A 1KH4A 4ZVTB 1KLMB 3HDSA 4NEYA 1X60A 1ZAWA 4J9RA 1N34F 5D6GA 3QJPA 2PIIA 3CW2C 1JLGB 2WRMA 2Q66A 2WOMA 1FRKA 3K7RA 4ZIWA 2V5HG 2KRRA 4EYHB 1NJWA 4KPYA 3KKFA 2X1FA 4G65A 4TKTA 5IOLA 4U7UD 4OJGA 4PUOB 2RQMA 2I0XA 2HWIA 3OD2A 2ZH7A 2JNJA 5H1SV 3GV5B 1N33J 4CO4A 1KEKA 1TQLA 1S10A 2FVPA 5CYJA 5CABA 3NOGA 2U2FA 5D4OA 1UA0A 3HHLC 4C9DA 5IS2A 4MK7A 4WXWA 5E0OA 1FI4A 3TAPA 1TKDA 2GJ2A 2AWZA 2CXEA 2M7SA 4HACB 4EBDA 2MQLA 2WBRA 3ICLA 1H98A 4LSNA 4DWIA 1Q5VA 3AY0A 1ACMB 3ZXWA 4WZMA 2AMCB 1RTIA 4WIIA 3IO1A 5E3CA 2VFUA 4OI1A 2F4VF 3G71S 1N33F 1KH5A 1TKXB 2CZVC 2AJQA 1GX6A 4NWJA 5IJQA 3M8ZA 5C25B 2Z2ZA 2VG5A 3K89A 1O0PA 2LP4A 1VBYA 2G13A 2KL8A 2LU2A 4C3LA 3H4DA 2FVQA 4LF9F 1OY8A 4YOEA 4P7VA 4ERDA 4YR3A 5GMEA 1VRUA 1LWFB 1VRUB 2K7KA 4J9PA 3Q8RB 1EIYB 2JEGA 4JI5F 2MJNA 2RQKA 5GAGU 3EUNA 2BBEA 2O01C 3HSDA 2RQCA 4NYZA 3RAXA 2RNEA 5IWAF 2OEJA 3BR9A 3GV7B 1E2SP 1U09A 4OYOA 4F3QA 2V4JB 5I3UB 4ZPTR 4YEAA 3TP2A 3CNQP 1X0FA 3MR6A 3U1LA 2VQEF 1TP7A 3QLHB 1I3OB 4Y2KA 3HHNB 4GC6A 3O3LA 1UCNA 1IR2A 2F9DA 1HW9A 4L72B 3POTB 4IDKA 3CCTA 1OS5A 4LR8A 3T9NA 1CSJA 5HSPA 3PJ9A 5LSOA 2FTRA 3PVXA 2RSQA 2GNKA 2GCFA 1ULRA 2A6OA 3PHEA 3MM9A 3FQLA 2MDAA 3BH7B 3AAWB 3H7HB 4JI8J 4QIEA 3W1YC 4J9MA 5L1IA 4YMEA 2AEMA 1FE0A 1NK8A 1KTVA 4ZP6A 5KFNA 3H40A 1VLYA 1Z4UA 3GG1A 1JLCA 1DURA 2WOMB 4TY8A 1S1VB 1S6OA 2Y8WA 2XR9A 5LMNF 3NNAA 1RHRB 1ZBTA 3JSBA 1WC3A 2MY7A 3MEGA 5KTQA 1U1LA 2XB2D 1M5HA 1WEZA 3MR7A 4KHRA 5D4PA 2FJXA 3NGDA 2I9SA 2ZWPA 3ONQA 4LF2A 2NZ4A 1XMQF 3DLGB 1HQAA 2HQGA 2ZKTA 2YKPA 3CCLS 1FRLA 1NMEB 3CEDA 1F6TA 5CYMA 3BGOP 5IQQA 2DPIA 3H5XA 5CCLA 4B3SJ 2DNPA 2WSFC 3UD4P 4GO5X 4ED1A 1O98A 3HVWA 4HTIA 4LF1A 3BDFA 4H4MB 2AHOB 2GS8A 1IKWB 3CDEA 2MB0B 2GHWA 2UP1A 4KTQA 4LIWA 3EZ5A 4JYAJ 3ZZUA 2EEYA 2V2KA 3OTCA 3VV2B 1S6UA 3LF0A 4U95A 2E5JA 1NK4A 4UPIA 3GU0A 4DL5A 3HT0A 2AX1A 4WFNQ 4Z2XA 2QL9B 3BO3A 4WKYA 3V6KA 1D1UA 2B4OA 2XTJP 4M5HA 3D1QA 1JX4A 2HMIA 3DRRA 1TAQA 4F4ZA 3CXCR 3MM6B 4UT4A 2J9DE 4BBYA 1UL3A 2N4CA 2YNIB 3CCUS 1Q79A 2CJXB 3PNIA 2CQ2A 3SYZA 2C2ZB 1KFDA 1WEYA 3UCGA 2CQHA 2N7CA 3RZAA 1KHWA 2BANB 4ZLNA 1XBWA 3A1YG 2HLTA 3E3XA 4PPZA 4NXNF 2E9ZA 3KD8A 4LBHA 1PILA 4ECVA 1BQMA 2ZBCA 1REVB 2AX0A 2IM1A 5C2CA 5B0BA 2OIHA 4OYWA 2BJEA 2OJ3A 4Y2MA 4K0KF 2UXCF 3Q8PB 1S9FA 2O1PA 5C42A 1IBLF 4P2SA 1QAYA 4A48A 1FEEA 1Y10A 1GXTA 1M5KC 4GVBA 1VJWA 3NCQA 1D9AA 2ZOMA 5EN1A 2W5QA 2QX0A 2H5JB 3QIPA 3WZ0A 2AGPA 2WTFA 1UWAA 3C2PA 1OSCA 3LANA 1PAEX 1TV6B 1YGYA 4K8RA 1E1ZP 4DDFA 1NJZA 1M5OC 3NKQA 5HJXA 1C1BA 1WC4A 3GE9A 1U49A 5JUMA 5C66A 1HNIA 5IC6B 4WF9Q 1NCLA 1SVDA 2AGQA 4OZ2A 3H5YA 3VVTA 1GTHA 1F9EB 1HYSA 1U45A 2DKOB 2E5HA 3LO3A 3IFEA 2CQIA 3D0GE 2ZNZA 3ITHB 4ZVQB 4F0HA 1NB7A 1FKAF 3NAIA 1R27B 2IRXA 3EXCX 2EFNA 2CKWA 1CJKA 2QL5B 3D4JA 2APOA 3I0SA 3OSPA 3HO1A 1R8AA 5KG3A 2W8SA 4L73A 3T1YF 4KJDA 2XM3A 4WWSA 2UUAF 5J1EB 2GAGC 1GMWD 2DR7A 3VCDA 1CJUA 5K20B 3MEKA 2XI2A 2J7WA 3SDEB 1HQEB 4MFBB 1FRJA 1RT3B 2A2DA 2DBBA 3SV3A 4Q7AA 2FC8A 2ZE2A 4N5SA 3KK3A 3PJWA 4CI0B 1ZYQA 4DS5A 2WSEC 5E5NA 2C2OB 5I42B 2MTLA 4U96A 3PY8A 3RAQA 1FNOA 1S1TB 4ZHRB 2CQ0A 4ELUA 4F3OA 2DHHA 1U25A 3MMJA 1VQKS 4NZ7A 4IR1A 2IPOB 3ILLA 1H2UX 4CXSA 4USHA 2ACYA 4DF4A 2J0QD 3E2DA 4JI0F 5CXTA 1WKKA 2WW8A 1CPZA 3NGRA 2XSFA 3RYLA 2KVIA 4NE9C 3QT6A 2ZBIA 1U26A 1SUQB 2ZD1A 4I68A 4DZ6A 4CDIA 2MQOA 2BABA 4A8OA 3BH6B 3M6VA 2BEFA 1NU4A 3I0RA 3I0RB 3IBFB 5AE3A 4DV7J 4DFMA 3IG1A 1HR0F 3Q3QA 2ZD1B 3LH2S 3DOKA 4ICLB 1K47A 1WD6A 1CLFA 2EFPA 1RACB 2D3ZA 2K7JA 4JV5J 3IGZB 3KK1A 2M52A 3IR6B 1EKSA 3LQVA 1FSUA 4NLYA 4Q44A 3CCWA 4WFXA 2W01A 4BCAA 2IIHA 3J7ZT 1N6QB 4OZ1A 1B4SA 1S49A 4YS2A 2WVEA 3AD8C 1S1TA 4QQBA 3SCJE 1SL2A 1KKHA 2F9JA 1VQ4S 3DLBA 1GMUA 5K4PA 1DY3A 3QT5A 2X3GA 2HQIA 3CJKA 5KG1A 2RT3A 3D6TB 1ED9A 1QSSA 2RD5C 3AQOA 4PQAA 1R8HA 1KH7A 5EX0A 1S7HA 3GFXA 1EAYC 4ZK7M 2IFYA 3FFIB 4M5NA 2XS2A 3G8QA 1RAOA 3BGUA 4LFAJ 3UWTA 3TUPA 2VA3A 4X4UA 1TR0A 3HVAA 4JI5J 4M8LA 2ZH3A 4QWDA 1Y3KA 3ITHA 3HHKA 4R25A 4BWJA 1R8CA 1U8SA 3D28A 4DL7A 3QJJA 4K7QA 4FYYB 3VGSA 1QAIA 4DR1J 3CJRA 3B8HA 2OELA 2RAQA 2HZCA 2ALYB 4OX9F 2YTCA 3G82A 1WF0A 1A6LA 3D68A 4OV1A 2W2OP 3TYTA 4C0BA 2FVCA 4USMA 2XHWA 5J1PA 1U0SA 1JNZB 3UN5A 3WX4A 2W5RA 3IXQA 1KD1T 4B9NA 1HI8A 4OZJA 1UMJA 3SQOP 4DXLA 2ADBA 1XJWB 4NXMF 1B99A 2ZZTA 2JH3A 3EE3A 1HL6A 5DLTA 5C24A 3T5LA 1L3KA 3LA0A 3T41A 1VS3A 5A8RA 1SJRA 2VPYB 2Z57B 4XK8C 4PKDB 3MUTP 1QJHA 1B70B 3AXMA 4ZPDA 2MKCA 2MEWA 5A0YB 1RCOB 1DQ8A 2Y0SD 3KFWX 4CM0A 2GVDA 3R2DJ 1N5TA 3ZZZA 2FJWA 1ZAXA 4OJ3A 2C28A 5ETQA 2CWXA 2BUNA 3R27A 2OPQB 2GAHC 5DZ7A 3OQ2A 3SSSA 1BQMB 4EU0A 1KNZA 2KI2A 3T1HJ 3F0NA 6AT1B 2DCUB 2HS4A 5BYQA 1RT2A 4CCHA 3M2VA 5LSLA 2QMUB 2IAJA 4ANEA 3SFUA 5GAGI 1ROFA 1SHQA 3W5XA 1OQ6A 2CPDA 2Y9HA 4NI2A 2MLXA 3ZC4A 3KLIA 5GRRA 1FK9A 1TTHB 3AA9A 2CVEA 4IRCA 1WG4A 2I5JB 2JDJA 1AXQA 5KT5A 4X4SA 1HWUA 3CJ2A 3FC9A 1I51B 2E29A 3BJYA 2MQMA 3DNCA 4P9SA 2E5GA 2W7PA 1RWMB 5T14A 1W7WA 4F4KA 4E98A 2HHUA 1JJHA 1X4CA 1QDUB 5KFHA 3UD3P 4KPCA 4FF3A 4QR2A 3OHAA 4UORA 5KFPA 2IFXA 5SZTA 3MWBA 3E01B 1QLNA 4NA2A 2HS0A 1YSJA 1ZZFA 2QN6B 4NASA 4Y6IA 2B4PA 4HDGA 2XZWA 3DGPB 1KH9A 4RU2A 2PI5A 1Q95G 1NUEA 4HHHA 3NMRA 2YVSA 1YITS 3TVYA 4Z37A 1D8ZA 3DRSB 4JI6F 4B9MA 3IBWA 2R7XA 4WP3A 1AUSL 4RW9A 2ZJRQ 3D1OA 3MAQA 1KR4A 1WTFA 4DSIA 4J90A 4OI4A 2PA8D 3P45B 3GQCA 5HP1A 2ROPA 2DXFA 2P5VA 4LFCJ 1RGVA 1FWPA 2BMBA 2HNDB 2RUSA 4ZA1A 3KLHB 4HVZA 1ICEB 4EWTA 1ZETA 1S0MA 2NQPA 2HVDA 1SL1A 1UEKA 2BJ9A 2D74B 5IT0A 2L9DA 4BWMA 2B4UA 1T9VA 1YHQS 3I5BA 2NXNA 3MI7X 4KV8A 2PA3A 4CH1A 2WB4A 1U4BA 2FY8A 3WHIA 5FLXU 3HJFA 3MECA 5E3AA 3G6ES 5A8WA 4B3RF 4P10A 3F73A 4B3SF 4DR6F 2EK1A 4FKYA 2DGUA 1S6QA 1Q8LA 2KO1A 3HSGA 2Z2LA 5CCMA 1PGZA 4PPDA 4IUFA 1FDAA 2HW3A 2V50A 4L74A 2G1DA 2PMZD 3UPFA 2GQQA 4JV0A 4F2SA 2W5XA 3ENWA 2ROEA 3OL9A 2UXDJ 3M2VB 4LR2A 3KWMA 1FE4A 2CPFA 4IYQA 4IR9A 2V2QA 2SXLA 3MK0A 2XEXA 2ZJPQ 1JQGA 2QYGA 3W2WA 1RWPB 1TVRA 1WHVA 3M30B 4M5LA 6FD1A 1T94A 5HQMA 1UAWA 4TQRA 3I4HX 3HFVA 3HHDA 3JSRA 2IJNA 4R0JA 2C2KB 2OGUA 1GNKA 4LFBJ 3I96A 4X64J 2CWKA 3MD3A 3PFOA 1VCTA 2R2RA 2D3O1 2ZUGA 4A8QA 3DKDA 5IM0A 4ED5A 3KJVA 4K4SA 3EM1A 3MPUB 4B3TF 1DTQB 2DNRA 5KG5A 1EHWA 1JJCB 4YR2A 2OO4A 1X9WA 3TJ8A 3UDCA 2IBKA 1OSDA 1IKVA 3AB2B 1ANIA 1RZMA 4ECRA 1IBKF 3BSOA 4F2RA 2CNNB 1AROP 4M5MA 1T3NA 3M1VB 1CVJA 2VQRA 2Y3YA 1FD2A 1S9EA 1TKZA 3OXGA 3VZHA 4U6PA 3RU0A 2VH7A 5JVGQ 2ILYA 3A8IA 1MN9A 1O5JA 1RWUA 3GYGA 4NLSA 4NMLA 1H6KX 1S1UB 2WONA 2YY3A 4IFYB 4ZCMA 1L3UA 1XNQF 2QZUA 3QPIA 5LJ3Y 2B6AB 4ZCLA 3TZWA 2OPPB 4ZMMA 2H54B 3ISNC 5LMUF 2NPFA 3PYDA 2PC6A 4GKKF 3FZ2A 5CD4H 4RO0A 4ELTA 4F8RA 3OFEA 2FC9A 4P2XA 2R7TA 1NSAA 3FBBA 3K8WA 4UY85 4RNOA 3SV4A 3MK1A 2BQRA 2UZAA 5KG6A 2GVZA 1ZPWX 5IC4B 4LR7A 4F4AA 2ZFHA 1R8BA 3EZOA 3BGRA 2VQFF 4OHWA 1EQJA 3D67A 1ALJA 1L3SA 2ZBRA 2XSJA 4IRKA 3WIUA 2EFOA 2W8KA 3US5A 2K8GA 4FDFA 1SI9A 4CWBA 2W4PA 2UU9F 5AE1A 2JLEA 5AT1B 3LP2B 3O6QA 3TG0A 3BDPA 1DARA 5J2QB 3L7UA 4USVA 1Q8BA 2OI2A 1XMOJ 3KNAA 3SZYA 1HARA 1R0BG 1XK8A 3EVMA 4I6YA 3R2CJ 3NWRA 2UV8A 3HVTA 2Z56B 2R2TA 4KKOB 1MWYA 4YR1A 3Q8SB 2W2QP 3W2VA 1TAUA 1NDKA 4I4BA 3NKOA 4F7VA 1YLXA 4NYOA 1FWLA 1KVKA 2LYVA 4JI3F 1I94J 2CNLB 2VB6A 4OLPA 2NZCA 5J2MB 4KBIA 1QD1A 1XNRF 4P2MA 2J8SA 4JI4J 1VQYA 1PYTA 4DUZF 3GJRB 2IYGA 3DRPA 5KFIA 2CJYB 5KT3A 4EO8A 2MGZB 2LQ8A 2HNDA 3DHXA 4QWBA 4ZHRA 2DCLA 2M70A 3MCNA 3W64A 4F0MA 1KBRA 3N5FA 4NLTA 4LIRA 2ZHBA 5GAEU 2RKIB 3CCSS 2EFVA 4ECTA 4X65J 2LXUA 1HWIA 2BQUA 3HFKA 4RW7A 3TNVA 1VQPS 3VHQA 4WYLA 4NWBA 3TAMB 3KJNB 2VDIA 3C66A 4HLBA 3WX8A 4DCOB 4X4RA 3GYNA 4RL1A 1BE4A 1Y9OA 4QWEA 3IN5A 1E33P 4CT9A 3HFZB 4IG0B 4IG0A 3MURP 3O2IA 5FLXY 1HJKA 1QVGR 1FFWB 1CJKB 3W9JA 1G1XA 3I5CA 4AT1B 2FHJD 1LW0B 4C2MA 2Y1IA 1JXEA 3HZGA 5IV4A 4X4QA 4GTZA 2DXDA 1U0HA 4R8UB 3RBDA 2E1RA 4O4RA 1EW8A 1YBTA 2AJ1A 4ZG9A 5L0EA 3THPA 1S1WA 2HQ3A 1TELA 3N28A 2Z0GA 4AYBD 8AT1B 5HROA 1Y4ZB 5KFCA 4RUAA 1W2BR 2KT5A 3UCZP 2C42A 2KKHA 3VAJA 3JYTB 4R5PB 5DG7A 4WU2A 5HMXA 4NLXA 4JI6J 3OTDA 1S97A 5KXAA 4TN2A 2MZJA 2HZVA 2G4BA 3ZTSA 1T95A 1AJCA 3R7BB 4QAXA 2LA4A 4URSA 4J7CA 4OI3A 3DLKA 4B9UA 2R7RA 2QLWA 1RTHA 1SJQA 1XMBA 2CPXA 4ECXA 1VISA 1R6VA 2ROGA 1Q53A 3BSNA 1WC1A 2B4VA 1NRKA 3B6BA 4CO3A 5AXNA 3I9ZA 1LW0A 3L7OA 4C0OC 2HHHJ 1GMWA 1YRTA 2F40A 2YKMA 5A0YA 1BQXA 1JMTA 1VC0A 2Z30B 1KSPA 3NVLA 8ATCB 4DG1A 1WOPA 4B02A 4ZITA 2DNNA 4ZCIA 3M9NB 4ECYA 3VAIA 1VJQA 2VPXB 4YUDA 2K1RA 1BC6A 3ETMA 4WXOA 2H5EA 2D41A 2KXFA 1SQFA 2FGCA 1QUPA 2VFSA 3Q83A 3H90A 5A6PA 3TZXA 4OZ5A 3MR3A 3CUNA 4ES2A 3MM8B 4GKJJ 3W62A 3B5QA 2MLYA 2DGTA 3UDEA 3DHWC 1CS4A 1ZS6A 4X4OA 1NK6A 4DFPA 2HEKA 3ILIA 4LF5J 2CQDA 4G1PA 4OIXA 5KFWA 2FHOB 5B0AA 3N6MA 3P3DA 4UW2A 1Q7YT 2FB0A 5M2RA 1S1VA 1N36J 3V81A 1H7WA 2GQ2A 5E33A 4CLUA 2NLWA 3NKRA 2B56A 4QYRA 4UF4A 3LAKA 1MWZA 2EBEA 1VOMA 3A3OB 3D6MB 4IFYA 1JKHA 2BE2B 2LEBA 3PM9A 1MSWD 3BBBA 3DU5A 2JLFA 4IH6A 2OAUA 1FCAA 3T5HA 1VC6A 4LF4J 4DFKA 4QIGA 2KG0A 1HFEL 2VDHA 3QRQA 3MM9B 5D15A 3G86A 3VVUA 5F9LA 1XMQJ 3RB3A 3P5TL 2GMJA 1FDNA 1FF2A 1NK5A 1DRZA 2J6UA 1X4HA 4QPXA 1YI2S 1FTRA 1YG0A 4K5SA 2DHAA 4RUCA 4LF7J 4L75A 3QAEA 4KHMA 3Q24A 2CPEA 3S1TA 4KRWA 2DRDA 2IUCA 1S6PA 4ZKAA 1RT1A 2GVZB 2M9KA 1P8GA 2XY7A 3C19A 1J5OB 3CC7S 4TY8B 1ZTWA 3MFIA 2DD8S 2IM0A 2JC1A 1IJEB 2UUBF 4DPTA 4K0KJ 2A18A 2LQ5A 1KWMA 1E6VA 1BHNA 1KP6A 4IG3B 4N7TA 4KAVA 1N0VC 2IJRA 1KQGB 2OD4A 5AE2A 4DR2F 4UUWA 1HA1A 1DFDA 1Q7LB 1F3FA 1RDRA 4DL0C 3GYXB 4O23A 2XMTA 4PXBA 2OFGX 4RUBA 4D3GA 1NH8A 1CG2A 1FD8A 1S4FA 1Y11A 2HRTA 2OPPA 1NH7A 1K8AT 1R0CB 4FF2A 2VBXA 2OEMA 2V4QA 2Y1RI 4IDKB 1RTIB 5F3ZA 3TAQA 1S1UA 2QZ8A 2WONB 5FDLB 1M5SA 3ZTOA 3VQTA 3HP6A 3PKMA 4LSNB 3CD0A 1TK0A 2AEJA 3HKZD 2R8IA 3HULA 4PR6A 3RJMB 2RB7A 2BM0A 2CQ1A 3CMAS 5DLFA 2W5TA 4DV7F 3NNHA 4HTJA 4LT6A 2YNGB 2QLBB 3ISND 1UEUA 3DLJA 3PRDA 4I7FA 5K14B 1RT4A 2LCWA 1H7XA 2F8MA 3ZZ0A 2ZZMA 1LWEB 3SDEA 2PD1A 2XMWA 2MZQA 2YQ0A 1IKVB 2D7SA 3THVA 3OLAA 2AD9A 2XMMA 1V5VA 3PR4A 1RYSA 2V9KA 3GTYX 4JI3J 1HBMB 1I5OB 1Z1ZA 2B43A 2P9CA 4IH5A 4DN0A 3HXMA 1ANJA 1RWNB 3CGIA 4I2QA 1KHLA 4MHXA 2J9DA 1SIWB 1JLGA 1WSRA 3FGVA 1NKEA 3IGVA 2QMXA 4LVOP 4DV4J 4DZDA 3RUBL 2ZH2A 5GAHU 1SH2A 4NEZA 1HYSB 1URAA 2GZOA 3DGPA 1T3OA 3BB5A 4BHQA 2NS1B 2Z2YB 3IR7B 4GRSA 1N32J 3GPAA 4UTGA 5FD1A 3TO8A 3GIMA 5I4MA 4DSJA 1J2VA 3BKTA 3MDFA 3UQSA 2CPHA 2EXUA 5HMYA 4V19X 1X5OA 3WBHA 2AYBA 2RMLA 2IY5B 5FJ4A 2DISA 3T19A 3OXFA 4M5IA 2W25A 1DZ5A 2MHEA 1F3VA 1UETA 3D1HA 4UZBA 2XGPA 4E8UA 2UVVA 3DC2A 1P6TA 3R5DA 1C1CB 4NX9A 3PYEA 1JNRB 1SB6A 2DNQA 1VBXA 3Q8QB 3PW7A 1PCAA 2BJ3A 4ZVGA 3OTOF 4OQJA 1R0AA 3DOMB 4TYAA 2ZBQA 4Y65A 1B3TA 3LPYA 4DHVA 3H25A 4Q8EA 1RLDA 2KYXA 4WE1A 1RT5A 3Q86A 4K4YA 3MMAB 1ZEBA 3M32B 1NK9A 2MKIA 4DN9A 2IC3B 4DF8A 5L38A 1CJVA 4YDDB 5L8RC 4CM2A 3ZTQA 4LQ3A 3DLKB 5EGHA 4FVCA 4ZOSA 3IWNC 2NYHA 3WBZA 3FCVA 1ALIA 1X7VA 3DRSA 4JI4F 2AZ3A 3MMBA 4CO1A 4Q5VA 1U1RA 4ZDNA 5B0CA 4WTOB 3M8QB 3K5MA 1D0EA 1T9YA 2CQGA 2CZ4A 2GV1A 1WG5A 2BYCA 2MPUA 2QG9B 4UQTA 3EPIA 2BXJA 1A0OB 3QT7A 4BC9A 1RAEB 1U24A 1QTMA 1P1TA 4FPIA 5D77A 3MPWA 1HHTP 3CJTA 4U9RA 1SQEA 3LGHA 1NDCA 2PMWA 4UQGA 3FEYB 1H2VZ 4I2PA 2OTLS 2VPZB 2E44A 2DPJA 1E3CP 3V6JA 4DCPB 2A3JA 2DY9A 2LMIA 1DTTA 2GO8A 3R9LA 3PIPQ 1ZA2B 2W4DA 3BF4A 3NBPA 5AXKA 4C7QA 1KC8T 4DPOA 1M1HA 2CDRB 2GIRA 3C6TA 4I56A 5EX3A 3W8GA 3PW2A 1ZH5A 4DR4J 1T9WA 4GTWA 1B64A 3DOLB 1GEHA 1LW2A 1LWXA 1SQGA 4Y2AA 2R7SA 3CMRA 1R89A 3QSYB 4ED3A 2YXLA 2OMLA 3FRZA 1PO6A 3DLGA 1RLCL 3B82A 5EWEA 4JV2A 2GA3A 1RI7A 2MY8A 1UVMA 2DTJA 4I67A 3DDNA 5KOXA 4J9KA 1S48A 4DV3F 3H42A 4UOOA 1M1KT 2AEFA 1C0UB 3R6GB 5DETA 2OPQA 4DSKA 2JVOA 4ZCKA 1TL1A 2DK2A 4GKKJ 1JLBA 4O3SA 5GAEI 3M8PA 5BR8F 2HFOA 4FNIA 4EUVA 2X1BA 2V63A 2DGSA 4KIAA 2F1FA 3W9HA 1VI7A 1VIXA 3BQ0A 3BQ1A 1K7HA 1C1CA 2VOOA 1UW9A 2BW7A 2CPZA 2CQPA 2XY6A 2XMAA 3R7SB 3SFGA 3K8VA 1GH8A 2J6TA 3EVWA 4O3NA 1FX4A 4B3MF 1UJ6A 1UWBB 5G4DA 5HN0A 3EZUA 4MKBA 3LOUA 2DNOA 4OI0A 5AJ3J 2K3KA 3FCWA 4EEYA 4JV5F 5KFAA 3EVOA 4G1QA 4QW9A 1BLUA 2Q6CA 2X51A 3IBCB 4ED7A 1S1XB 4JI7J 1URNA 2GHPA 2KH9A 2E7VA 1NKBA 1D9FA 5CA5A 2XSJB 2RRBA 1RXOB 1UVIA 4ZG7A 3KTQA 4N47A 3QAUA 2J9CA 4ILMA 2H65B 4L3NA 2U1AA 4A8FA 2W5WA 5JJBA 5IFMA 3IGNA 1N52B 2RU9A 4NLWA 1ZEDA 3M8WA 1F5CA 1U6FA 2YWGA 3KHHA 1JK9B 1URBA 2FLOA 4C98A 1RJJA 2K2PA 3AXKA 3HHEA 2A0FB 1T7PA 3OTEA 3OUYA 4DV2F 1LOUA 4PYDA 5CHCB 4ECZA 5KFLA 1AJAA 2EC2A 1JLEA 2HURA 1PKUA 4ZVUB 3FMWA 2AYEA 4N76A 3QGIA 2FVSA 1RT4B 1PYSB 3AD9C 3NMAA 3Q89A 2J0WA 4MFBA 5JVHQ 3UR3C 1RAGB 3GMGA 1ZM9A 2GIFA 1CULA 2PN6A 3TX8A 3G9CA 4P2FA 2W9BB 2GHVC 2BE2A 2HRUA 4DU7A 1VK3A 3T9ZA 1HBNB 2ZH4A 3QO9A 3NOCA 4PQUB 3VGVA 2GQCA 2J0XA 2G0CA 3MTKA 5GADI 1SC3B 3CC4S 3D0IE 1P27B 1PYOB 3W5YA 5ITHA 2F5GA 3SXLA 2KXNB 3IR5B 4X4PA 2ZH1A 1T05B 4NCAA 3IG1B 1JLQB 3V5RA 2XLIA 1Y5NB 2JZ5A 2ASLA 3CCJS 4JI1F 3JS9A 2XBPA 1KRPA 3EGNA 3H0PA 5K8OA 5HVFA 4DBQA 2AV5A 5KFYA 1N5VA 2QSFA 2QE5A 3MM8A 4PRFA 3RRGA 2V9WA 5LXRA 1FO1A 2CNOB 2X1AA 3GIKA 2FVRA 3NKNA 1UWBA 1CEZA 1SV5B 4N8OA 3TVZA 2CFXA 4AFFA 3QJLA 2F8HA 3RB4A 4PWDA 2K1RB 1FERA 3FK4A 4ECQA 4RZRA 1B0VA 3E2EA 3IWXA 1FJCA 3IAM9 4YHHJ 5I42A 2GSNA 4DR7F 1HWLA 2B7CB 2JOQA 3FSYA 4C4WA 2ZE2B 1ZOTA 4PCQA 3UVJA 2YKOA 4CLSA 1JLAA 5F41A 2G0IA 2HFSA 2K3IA 4U8VA 2XMVA 3J80Y 4DL4A 3CT9A 4MT1A 3UD5A 2DH7A 3H4BA 1Q4RA 1RA7A 3PRVA 3J7A1 4LFBF 4U7CA 3IRXB 5A8WB 1JKHB 3KUHA 1KTQA 1RTHB 2RS8A 3FNNA 2XRGA 5GOVA 5B0DA 5LRMA 4Q43A 2VFRA 3L09A 3TEGA 3GSDA 5KG2A 1YX2A 5HQ8A 2YWWA 2R7OA 1ZM2A 4DPWA 3T5JA 2UU9J 3PX4A 1X4FA 2ZH9A 2W2NP 4O44A 2HQCA 4FXVA 3IS9B 1W2IA 1C0TA 2HBRB 3H20A 2VC1A 3GR0A 4URQU 4OI2A 3OL8A 3KLHA 3VAMA 4J9QA 5GADU 5HP1B 3QSIA 3KJFB 4ED4A 4HEA9 3QMQA 4KGKA 2FZCB 3TUJC 2VL1A 3KYLA 2YPYA 1JJ4A 3A52A 3ZZTA 3CDWA 4KJGA 4LF4F 3AOCA 2HHHF 2DR6A 4H54A 4MKVA 4OHXA 2HK3A 4KO0A 1HQUB 2VF3A 4LBPA 3SMZA 3TR5A 1RABB 1YJ7A 2CJAA 5A8KA 4YB1P 2WK4A 3LWMA 2ZM6J 4B9LA 2M0GB 3MEDB 3NS7B 5CH7B 5F8JA 1N0UA 4F02A 3W66A 2VBZA 1Q82T 1HI1A 3GCWP 3MCMA 2Y1JA 2VBYA 2J0SD 3TAMA 5ETLA 2E9TA 4TYBA 4OZ3A 2F4VJ 2BACA 4WFAQ 4MK9A 1LQ9A 2V2ZA 4NLVA 2A2CA 1REVA 5CZXA 1IR0A 4AL6A 4ID8A 2IA0A 2D1GA 1VYAA 4QIFA 4OZ0A 5L46A 3HX9A 3J81Y 3SIPB 1WC5A 2OH2A 2OPSA 2HIYA 1HBOB 3HI9A 5D0HA 1H74A 3FEXB 1IM4A 1Y5LB 4JI2F 5J2NA 2UVUA 3RB0A 1EJ7L 1FK9B 4NA3A 1O8BA 4DV1F 4FXWA 2N82B 3JYTA 2JEJA 4C8MA 3EXYA 1WORA 2DNLA 2HMIB 4USUA 1VQ8S 4G3IA 5ETSA 2LDYA 3AJ1A 2VASA 1WKJA 4F3MA 1S1WB 2YNHB 3FZBA 1V9OA 3C14B 4K4ZA 3IRXA 1I6JA 3JQMA 2EWHA 1YK9A 3BYRA 2E5IA 4U67Q 2KFNA 1WWHA 2GVDB 3JAMU 3GLJA 5RUBA 3MCOA 3ZTPA 5GMDA 1T11A 1LWCB 3UVJB 3K0JA 4O3PA 3RAMA 2VG7B 2DGWA 3DXBA 3UNGC 3IMQJ 4FXDA 2L3MA 2NYIA 3UFCX 3R5GA 5DDQC 2M8HA 2V8GA 4WJBA 5HVGA 1WC0A 1EX8A 2X3DA 4UOCA 5K9FA 4MIWA 3N4WA 3PXGa 5I3UA 2HIQA 3C3LA 2DNZA 5F8LA 3OFGA 2CVIA 3CCZA 4DR3J 2LEPA 1Y0HA 2FJBB 3AB4B 3K17A 4OYZA 5F8MA 3B78A 2BJ7A 5L9NA 2XHCA 3U02A 4E0DA 3KG0A 3VAHA 1PG5B 1NXIA 4LRFA 2OHDA 3PEHA 3SCKE 1WG1A 2A10A 3DRPB 4AUKA 2WVFA 2MGZA 1NSKL 1LWEA 3G96A 2W1BA 3NLCA 2VIHA 5L1KA 1BUXA 1HR0J 1U2FA 4LSLB 5K14A 3K5NA 1TKXA 2FJAB 1IKXB 4F4WA 2D9PA 2BJ8A 4EZ6A 1EQMA 1HBNA 3IRWP 1TFYA 2EC0A 2UXCJ 4ZVPB 1F9FA 2DGVA 1RT7A 2WZ1A 3UDLA 4ID5A 9ATCB 1FT8A 1XNQJ 2I8EA 3AD7C 4FYXB 1Q81T 2CPIA 1NJXA 4HACA 2I2YA 3UNYA 5EGEA 4M5DB 1H72C 4X65F 4X4NA 1M90T 2HWHA 4CLZA 5IT9Y 1RAJA 5DQIA 1S4EA 4DR4F 3G6XA 1CBKA 4UOGA 4ZN3A 1RHMB 2E1CA 2LLZA 4Q45A 2VQFJ 4DFJA 4ZVRB 1SXLA 3O5TB 2OLWA 1TK5A 2FJVA 3J7YU 1B7YB 1OY9A 2XCAA 4C8ZA 1EQ0A 2RS2A 3G2XA 3MPYA 4ZPBA 1FVQA 3H5SA 5DM6Q 3PW5A 1S6PB 3A13A 1ZM4A 3RTVA 1KLNA 1RAFB 5INHA 1N5QA 1BQNA 1LWFA 3WAYA 3RBXA 3C15A 2B3TB 2IA6A 1K0VA 1MWQA 4PXEA 4MKAA 4NXNJ 1AFJA 1HDHA 2QLJB 4YP3A 2ZDOA 4O4GA 2V6AA 4K4WA 2HKEA 2DEIA 4HHUA 4M5DA 5E3PA 5F3TA 3UDVA 3D7SB 3QBCA 1F5BA 4OZLA 3G8TA 3T01A 2HVHA 1RWVB 4YY3J 3PW0A 2MKSA 2MQNA 1HLWA 3NL0A 4TLQA 5HRTA 1KS2A 5KG7A 2H5IB 3H2VE 2M3DA 2VFVA 5D0RA 4A8SA 3JXOA 5HVHA 4DR2J 4M94A 4IO1A 1IKYB 3ET6A 4YDXA 3KLGB 2DXEA 3GFZA 1XEZA 4OX6A 1LK5A 1S9GB 4G1IA 2ZH6A 3MFHA 5GMKa 3LPEA 3FDSA 2ANHA 3LXQA 3GJTB 2KB2A 3E51A 1JLEB 1X9MA 1C0UA 1CS4B 1ZM3A 4Y0FA 5J1EA 4MAKA 3PR5B 3CO9A 3KJVB 5IM0B 2GX8A 3KK2A 4IO9Q 1S7IA 4WK3A 2QO3A 5KT4A 1SJ4P 3S7RA 2P9EA 3QNWB 4CLLA 2B8PA 4DV5J 2IRUA 1IUJA 2DITA 2PDAA 3BV8A 4F67A 7AT1B 3DLHA 2HNZA 2BZ2A 1TL7B 1KLMA 4OJ1A 4P72A 1VQSA 1BXNA 1WC6A 1H0HB 3N79A 3DOLA 5D3GB 4UOPA 5TJ3A 2E1PA 2D3OR 1S59A 1CJTA 1HNVB 2YWFA 3ENQA 5L1JA 1BD6A 4LFCF 2HHVA 1WOOA 2HGLA 4PG7A 3JTPA 2FJEB 2XG8A 2HZAA 2JLGA 4KGVB 3TJ9A 2BQ3A 2YKMB 3LGNA 5HMZA 1HNWJ 2N3OA 3EJMA 3J80U 2X7IA 1RHUB 4RUHA 2OPRA 3TRGA 1P9QC 5THWA 2QFJA 5HLFB 2B9XA 4DLGA 2CQCA 1T03B 3TW0A 2HFNA 4X84A 4A47A 4DS4A 1B0TA 2BOPA 4QYZK 3IP0A 2C2MB 2YBVA 3DRXA 1M5VC 4KHPJ 4QYZJ 1IVZA 2B9WA 4DEZA 3OJUA 5E3QA 3W63A 1VK8A 3ILOA 1X5SA 4O3OA 1HNZF 1APSA 1DAXA 3H5UA 5T7LA 3V6DA 1QSYA 2N3LA 1WHYA 1ELYA 2HGMA 2RIJA 4B9VA 1VMBA 3BN7A 1RTJB 4L76A 3AHPA 2PGCA 2ZKUA 4IFVA 1SBRA 4TY9A 1HNVA 5LIAA 2HVZA 3O1LA 3PEJA 2ZH8A 2IC3A 3BDEA 1S77D 3VWSA 4X66F 1U2CA 3SCIE 4WZQA 1FDDA 1RYRA 1RT5B 2FD2A 1VHIA 2I1RA 2KVQE 2YNIA 4WE1B 1KHJA 1HQ2A 5E7OB 2DNGA 2VJVA 1XQIA 2VUGA 5ETKA 2GMHA 4HYKA 3BKFA 1O99A 5F9NA 3WAVA 1SC1B 2UUWA 4M5GA 2GJFA 5BYSA 3OPKA 5F8HA 2V8DA 1ELOA 3I9V9 3PX0A 5KAKA 3TI0A 4V19J 4XAKA 3EGVA 1UP1A 4CYUB 1HNXF 1R6YA 3D6HB 5C2GA 4NXMJ 1MG7A 4DX5A 1IKYA 3ET6B 1WEXA 4BC7A 3CF5Q 2PI4A 1WNEA 4ETXA 2HYIB 1VRQC 1VFJA 1IKWA 1QVFR 1X0PA 2YH0A 4CNYA 2VOPA 2OTJS 2JFDA 4TU7A 2P6SA 4ZP8A 2VQEJ 2FGOA 1C4CA 1OIAA 2HAIA 3JSYA 4F4YA 2XLJA 3PX6A 4J9LA 1X4DA 1TL7A 3AOAA 2CNKB 3W60A 2YWKA 5ADZA 3HM9A 2EG1A 2L48A 2R2SA 4F26A 2IM2A 3HD2A 4O4GB 4F0KA 4N8NA 2AYGA 4RKUC 4ALZA 4JOUA 2UVRA 2O3DA 2KN4A 2HK2A 5LXYA 3BS9A 4HL9A 3DI6B 1JJ2R 2F63A 2P6TA 2FZKB 2XMJA 4PG5A 3MEGB 3UI3A 2W7AA 1S0OA 3L7PA 2ILZA 1HNZJ 2JX2A 4DUTA 4FYDA 2E1AA 3Q8YA 1S9GA 3S6EA 2RHSB 3EWGA 3LW5C 4CIOA 2LDIA 2FUG9 4P74A 5KFBA 1K0TA 5BXIA 3K5OA 3JTNA 4ZIVA 2DYAA 2FDNA 4OYIA 4Y3CA 5CAAA 2N7YA 1L5UA 1H73A 1RAHB 3M6UA 3HPOA 3AFGA 3PDNA 4DV3J 1SV5A 2R42A 1SJFA 3LAMA 1D3WA 4DG1B 4ZPCA 1O51A 3GIIA 4MTPA 4DLEA 3DDIA 2GA7A 2YH1A 4DQIA 3KNGA 2QA4G 5JMNA 3VQSA 1B7FA 3DLEA 1EETA 1AZSB 1DJ0A 1MROA 4KGMA 4KT0C 2PSZA 2ALZA 4RX6A 3FBFA 4FYVB 4Q2MA 4UPLA 3HSJA 2RQ4A 1BQNB 2IJFA 4IG3A 5J1NA 1SIZA 2DHXA 1CQNA 3VZIA 3I6PA 2B7BB 1BMQB 4OJHA 5IT9U 5B09A 3DRYA 1IKXA 1XNRJ 5F0WA 2JJ4D 5IXUA 4FBTA 2NR0A 2B6AA 3M8YA 2YWHA 1IN0A 1U6ZA 3GB0A 3QO9B 4C11B 1IBMJ 1WTBA 1T0TV 2HFVA 4NLPA 2RHQB 2GW8A 3R5JB 4KFBB 1XC9A 4X64F 4B9TA 2ATCB 4YR0A 3LGMA 3CMQA 2DR8A 3QGGA 5DDPC 4TQSA 4JI7F 3MUMP 3HK2A 3FMBA 3D3CJ 4I64A 3HCXA 5ETRA 3KG4A 2ZOFA 3JAMY 2OSRA 3MUVP 4GKJF 3ZZOA 2YNGA 1RT3A 4I7FB 1NHUA 2UV8G 3KHGA 2YQ1A 1L3TA 3DGVA 2DVIA 4RNHA 4LQ9A 5DJBA 1K1SA 4RBTA 2AT1B 1X5TA 5KG4A 2CYYA 2D1CA 4LJMA 1DQAA 5KFFA 3ZNJ1 3QFHA 3J7YI 1N6QA 2UUAJ 1F0XA 1HIYA 4D3HA 5HQLA 3SSRA 3K5LA 2LECA 4FF4A 3DXSX 1RKIA 2CJBA 3TA0A 3QATA 2VC0A 1CC8A 2P8IA 5G0RA 5HBMA 4F25A 1AJBA 1BGXT 3KG1A 1YIJS 2RDJA 2AP6A 3WC0A 3VAFA 1LFWA 1HKAA 4XDCA 2BKOA 2F8EX 3KHLA 2B9YA 2YNHA 2YPZA 1HNIB 4OI6A 1UTAA 1E6VB 1HHQA 4FDIA 1MMDA 4EI2A 3JQJA 2AGOA 3BKUA 5LQQA 2RDIA 2GGPB 2QEXS 1YKWA 3V6HA 2KG1A 3PYGA 9RUBA 1MMNA 2LXIA 4PWDB 2RVJA 3BQ2A 1FRMA 1WHXA 1K1QA 4NCGA 3V4MA 3OVAA 4CYSA 2PT0A 2W2PP 5AJ3F 3NGUA 1DHMA 3HKWA 3TOQA 4RWXA 4K50A 3GONA 2DIVA 3TZZA 1HNWF 3Q8VA 3R7NB 2GSOA 2EFGA 2P9GA 3H59A 3QZ7A 2BE7D 4OLOA 4DR5J 3CCVS 2WVBA 1HQEA 4OYMA 1S5ZA 2HHPA 4DX7A 2OD6A 4DL3A 2M2BA 1RWKB 2YX4A 3J81U 3DI6A 4ANDA 5KFXA 1L3VA 1AUKA 3CJQA 4X62F 2MLZA 1RWWB 2Y8YA 5KFEA 1QE1A 2BANA 4QZVB 4CO2A 5F0UA 4IKAA 4KO0B 4ENOA 4DR3F 1IBLJ 2YKNB 4RW6A 2EI5A 1V3SA 3P4UB 3PYFA 1WDDA 2Q79A 3MM6A 1YJNS 1N34J 3J7AN 1FKOA 1HWKA 2XZDB 5T41A 3K57A 1VRTA 3CJ0A 4EK2A 4OFZA 4RBVA 4K4XA 2M8DB 1UZDA 3QYYA 4DUZJ 3U7JA 2UUCF 4QW8A 4DPUA 4ETZA 3CJ5A 4B3MJ 4DV0J 1U1NA 4CP5A 2PEBA 4P73A 1JWWA 1EJJA 1VRTB 2CA9A 4DU8A 5IWAJ 3SQGA 1NDPA 3GJQB 2XLKA 2HRYA 3Q2SC 4WP8A 3OFFA 4I2PB 3QT8A 1NZAA 3F56A 3QIPB 4X2BA 1QM9A 2HBQB 4FPRA 4B3OA 2GIQA 1Y3JA 1UA1A 4QU6A 1YZ7A 3QQCD 4LR9A 2MSTA 3ZNUA 1IWAA 4LF6J 2DNHA 3OR2A 3SEOA 1VLOA 5GAHI 3TJAA 2DO0A 4AE5A 2EVZA 3L95X 4U7UK 4DQRA 2C1EB 1T9TA 2KFYA 2CG8A 3KLIB 3OT9A 2RF2A 5DGBA 1ED8A 4NL5A 4B9SA 4J9NA 1SC6A 4E2FB 4XDDA 5AJ9A 4JBCA 3ELHA 2IMWP 1RKJA 4H4KC 3P96A 4CT8A 3TA2A 1RHKB 2P2CB 5KFDA 4DPXA 1CJVB 1RTZA 1YRXA 2F3JA 2AJ4A 5HK4A 4Y28C 5D0EA 1WI8A 3U1MA 4A46A 3GR1A 5IJSA 1VHFA 2CADA 2J9EA 1G7CB 4ZPWR 1XR7A 4URGA 4ZLJA 4ECWA 2XNQA 3MOJB 2LQJA 5KFGA 4CH7A 4WPAA 3I55S 3MZIA 5KOWA 1GX5A 1Q5YA 3N6LA 1LNQA 4OV6A 2C3YA 3MR2A 3OTBA 3CJ8A 1YQHA 3SBMA 4JI1J 4DQSA 1TZ0A 4PXDA 1U0HB 2IVYA 4R8UA 1N5YB 1WKLA 2IM3A 2E7WA 4RW4B 3FRYA 1SKRA 4LUBA 3QRPA 4DV6F 2POKA 2R2UA 4IRDA 5B7WA 2MQPA 4C48A 4CLYA 1FXLA 1F1BB 4F04B 2ZOGA 2I6WA 4N56A 3DMJA 4OYXA 4A8XA 2C22A 1PSDA 1CJTB 1SJ1A 2FJDB 2FLLA 3OVBA 3W5ZA 2HHSA 4JV1A 1Q86T 3C46A 5I3PA 1CULB 1NZ8A 5D3GA 4HHJA 3RG6A 3QGHA 3DYAA 1IR1A 3PFEA 3NGKA 3VALA 4RW7B 1JLFA 3WDOA 1N32F 1UW4A 1TL4A 2QL7B 1W26A 2MYFA 1WHWA 2O66A 3G4SS 1U2RA 2VICA 1H2TZ 2H48B 2QYCA 1FJEB 2NXUA 3TUZC 1HWJA 4DL6A 2DGOA 2QIFA 1X4GA 3R3TA 1IBMF 3CWJA 2CDQA 1SKSA 2C3UA 3DLLQ 1X5PA 2CZ9A 7FD1A 3CDAA 5EGYA 4P52A 3CULA 2W5VA 5KT6A 5B0FA 3IDDA 3MK2A 2DIUA 4ZPVR 1RT6A 3P8BB 4KGZB 5B0GA 1FFSB 2W2MP 1PC4A 2XYPB 3OHBA 4IQXA 1MNEA 2V4RA 1S1XA 2OUGA 4CYRA 2YKQA 1AZSA 1GQEA 2Y1LB 5DQGA 2J7UA 2AW0A 2V0NA 3RR7A 3D6FB 4NLQA 1TKZB 5LT5A 1S9EB 3ENVA 4ZP9A 2UXBJ 4W90B 3LP2A 2KHDA 3SSQA 1JIHA 1KVIA 3M2RA 4M5KA 2Q1LA 1EZZB 2DY1A 3MD1A 1NK0A 2HHQA 3DYCA 3EMTA 3L9ZA 3TWZA 5IZHA 3K59A 5HO4A 3BO4A 4K4TA 3QLHA 3H98A 3PACA 8RUCA 1G4CA 1SUQA 2L08A 3JSMA 2RRAA 4MKYA 3FVYA 2CIMA 2V4JA 2VG6A 3MPDA 4MIVA 2NUUG 4N41A 3D0HE 1UJ4A 4LF8F 1RAIB 4USJC 1ZA1B 3CCRS 4O3RA 4YFUA 1NHVA 1NPPA 2QA4S 2D9OA 2VG6B 3M8PB 5IQ6A 2AKWB 2R7VA 3M30A 4A4JA 4J9SA 1YBAA 4GTYA 3FSXA 2J76E 4QU7A 3RRHA 4W4MA 1RHJB 1YBUA 3N9UC 1LXNA 3R8YA 5EHHA 2C2EA 3QWPA 1AT1B 2MSSA 3FCHA 3TA1A 1N36F 1GT8A 4CXUA 2W4CA 1MU2A 2VG5B 3M7VA 4GMKA 4FS1A 2XNRA 4XTTA 1GK8A 1NSQA 3GIRA 3DYAB 2AJ0A 3P5BP 1XR6A 4N77A 3PZPA 3NKMA 3AJDA 1S6QB 4WP9A 3FBCA 4RNMA 2XO7A 2KDOA 5M2UA 5KFRA 2WBMA 4IOBA 3ZZYA 3DMJB 1UVJA 2HHXA 1OPZA 1OWXA 4QJVA 2VJUA 2NXEA 1LFPA 1UPMB 4ED6A 3GWCA 1S0NA 4Q0BB 2XYHB 4ATNA 3UO0A 3V81B 3DM2B 2DH9A 2GC8A 5LSRA 2G1HA 2NCKL 3G8SA 1IBKJ 4HKQA 3M2UA 2W9CA 3T5KA 1JLBB 1RTDB 2HBZB 1ELZA 1KONA 2HVEA 2IYIA 2J6SA 3HZEA 4L3KA 3CD5A 2YKAA 2OMOA 1WSVA 4AXIA 3EDRB 3A8KA 3MAAA 2MKJA 3R5CA 5L0BA 1VR6A 3QWUA 1R8PA 3CVKA 2EG2A 4NRTA 4RW9B 5AXLA 2HLUA 3HF5A 4ZLPA 2GJIA 3I56S 4J9OA 4KY3A 1BY9A 3TQ1A 5F8GA 1U1KA 1HI0P 4QBUA 1TVRB 3SCLE 3CCES 3TANA 3NS5A 4K2JA 5D78A 1DLOA 2QRRA 2VONA 3NKYA 1SPBP 3H8YA 4DR6J 2IDLA 2KU7A 4DV0F 4GVBB 4HR2A 1KN6A 1Y5IB 4KB7A 3OLBA 6FDRA 3L3CA 3M32A 2VG7A 3BSCA 3F44A 3MMAA 4HH0A 4MH8A 3T3FA 4ZVOB 3V6DB 1VQ6S 2AIRB 3VGTA 4KR0B 2RF2B 1HNXJ 4QPTA 3MM7A 1FWKA 3OR1A 3LP0B 3KLFB 3PHTA 3N0VA 3PRBA 3G6VA 2AZ1A 3Q23A 1YJUA 3N5BA 1UJ5A 4NYPA 1PC5A 3MECB 4P7TA 4JYAF 1IM6A 1NAQA 2ZUAA 4NLGA 3MF5A 4HT7A 3FSIA 2J7KA 2M5YA 2Q6BA 2OPRB 1XIQA 1QAXA 1VIOA 4NLDA 4QWAA 3SQGB 3NS6A 4DQPA 1HBOA 2XI3A 2OPSB 5J2NB 4DI6A 5ETTA 2DH8A 5A6WA 2IAJB 3FBEA 2BRKA 1LK7A 3C6UB 3EDQB 2B51A 3MMCB 2QA2A 2Q43A 1FEHA 2DNMA 2KJWA 4OMFG 3HMJG 4NMXA 3MOZA 1JB0C 1EARA 1RHQB 4HT5A 4J9UE 2YKNA 4RW6B 2G2ZA 1RSCA 1RADB 3DOMA 3OV7A 2DRAA 2G2OA 2BVZA 1X4EA 1YRUA 4YN3B 4NCBA 3G87A 1D9DA 1W25A 1R43A 1XERA 1YVFA 2X1GA 4NLOA 3RBEA 5CQGA 3U1NA 3KLEA 3E01A 1YJTA 4KGXB 4CTAB 1AYEA 2RU3A 1VC5A 3BDGA 1RU1A 2W9CB 3M2UB 2HAFA 3BREA 4J5OA 3VGUA 3KLGA 5MLCV 1AFIA 2MZRA 2L9WA 4S0MA 2XZTB 1VDHA 2VBWA 5HI7A 5C5JA 2AYMA 3KJQB 1KHNA 2E66A 2W5SA 4TN0A 2ZNYA 4TNOA 4QR0A 1M0SA 3LWLA 1OYDA 3TZYA 2F4FA 5FDLA 4PWUA 3UN3A 2COLA 1S0VA 1SH3A 4NCGB 2IDEA 3QRRA 1FTCA 1BWVA 2V2VA 3B4MA 7FDRA 2M88A 3NEKA 5J2MA 1RWXB 2AQ4A 4XO0A 1HMVA 5KFJA 2UUCJ 4PG4A 4XPEA 3NCPA 3NWGA 4CQ1A 5DZ6A 1T8EA 2HBYB 1KHVA 1QE1B 1RAAB 4MIBA 2ZH5A 1N48A 2ZHAA 2LU1A 2YNFB 5ETVA 2R7WA 5DGAA 3C15B 1EW9A 3FFIA 2DT9A 4OYPA 4QOTA 4DV2J 4KH0B 3MTJA 3JB9k 4ZVEA 5DRKA 1XN9A 1JLAB 3IC1A 4NOHA 2VKZG 5G0RB 5HBMB 5J2QA 2NXCA 2LVWA 4WYWA 1RUSA 1J5OA 3KDNA 3MGJA 4I69A 2XYGB 3BEGB 4YHHF 3T02A 2HFZA 2O5DA 4FZVA 4O0NA 2E7XA 3JSMB 5DLVA 3EYZA 5J2PB 3MR5A 3U27A 1P1LA 2DGQA 3DCAA 3OW2R 5E2QA 5U47A 4B17A 3SI8A 1Y7PA 2MKYA 2G0JA 1WACA 2QGFB 4LVNP 4DX8H 1Q1KA 2DO4A 3AH6A 3PJXA 5E41A 1YWXA 4KH1B 3WAWA 1Q16B 5KFSA 1VBKA 4KSEB 3TQEA 3G82B 3DOKB 4DOZA 1AW0A 4BS2A 2GSUA 4OX7A 1X4BA 1HHSA 4LFAF 1UPPA 4ZLLA 4IQMA 4J9VA 2YNFA 2IMOA 4CZCA 3RW7A 1FX2A 5DDRC 3KMQA 1TL3B 2VFTA 3RB6A 1PBAA 1LXJA 2KRBA 2RE1A 1N2LA 1YDLA 4PQUA 2DEJA 1PAUB 1OYEA 1FXDA 1FRXA 1RT1B 3P49B 2HSEB 2VKRA 4PWWA 4EGLA 3M8RA 1IJFB 3VF0B 4ELVA
chains in the Genus database with same CATH topology
1EI6A 4NWXA 1ANIA 3WBHA 3UN5A 1KHKA 4CXKA 4FDJA 2VQRA 5L0KA 3BDGB 3SZZA 3NVLA 5DLTA 4LREA 2W5QA 1ZEFA 4B56A 2QZUA 4LRAA 3NKQA 3T02A 1KH5A 4NWJA 1P49A 3M8ZA 1AJBA 1EW2A 2W8DA 5IJQA 3B5QA 1ZEBA 1E1ZP 1ELYA 4LRCA 1N2KA 3T00A 1ALKA 5C66A 1B8JA 4FDIA 4LRFA 5LIAA 5LQQA 5EGHA 1SHQA 2G9YA 1ALIA 1KHJA 1Y6VA 3MK1A 1E2SP 1ELXA 2W5VA 3NKNA 3NKRA 5GRRA 1O99A 4LR7A 2W8SA 3IDDA 3MK2A 4CYSA 1EQJA 4KJDA 2RH6A 3BDHA 1ALJA 2GLQA 2GSNA 4LR8A 4UPKA 2GSOA 4CYRA 5EGEA 3UNYA 3BDGA 3TG0A 1E3CP 3SZYA 5K4PA 4UORA 4YR1A 3TWZA 1KHNA 1ALHA 1AUKA 2W5SA 4TN0A 2XRGA 5GOVA 5LRMA 3NKOA 4GTWA 3UN3A 3NKPA 4ZGAA 4GTXA 1KH9A 4MIVA 2IUCA 4CXSA 3CMRA 4LRDA 2XR9A 2GA3A 5INHA 4GTYA 4ZG6A 5LRNA 3WAYA 4N7TA 4KAYA 4KAVA 4KM4A 1EW9A 4UOOA 1EJJA 4CXUA 3Q3QA 5IJSA 1HDHA 3A52A 3M7VA 4MY4A 1HQAA 2ZKTA 3IGZB 4KJGA 1FSUA 4ZG7A 3T01A 2IUCB 1AJDA 3NKMA 3WAVA 1K7HA 4LQYA 5DLVA 4LR9A 1E33P 1O98A 3DYCA 2X98A 3BDFA 4LRBA 3UN2A 1HJKA 2W5RA 5DLWA 5HRTA 1ED8A 3DPCA 2W5TA 3OT9A 3UO0A 2W5XA 1SHNA 4UPHA 3WAWA 1ED9A 3IGYB 3ED4A 2ANHA 3LXQA 4GTZA 5AJ9A 1ELZA 1KH7A 2D1GA 2GSUA 4UPIA 4ZG9A 1EW8A 5L0EA 4LR2A 2IFYA 4UPLA 3WAXA 3MK0A 1ANJA 1KHLA 4MHXA 1KH4A 5L0BA 1Y7AA 2W5WA 3E2DA 1N2LA 3TX0A 5KXAA 1ZEDA 3M8YA 3M8WA 1URBA 1AJCA 1URAA 4QAXA 1AJAA 4UOPA 5TJ3A 3KD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EI6 A;  4NWX A;  1ANI A;  3WBH A;  3UN5 A;  1KHK A;  4CXK A;  4FDJ A;  2VQR A;  5L0K A;  3BDG B;  3SZZ A;  3NVL A;  5DLT A;  4LRE A;  2W5Q A;  1ZEF A;  4B56 A;  2QZU A;  4LRA A;  3NKQ A;  3T02 A;  1KH5 A;  4NWJ A;  1P49 A;  3M8Z A;  1AJB A;  1EW2 A;  2W8D A;  5IJQ A;  3B5Q A;  1ZEB A;  1E1Z P;  1ELY A;  4LRC A;  1N2K A;  3T00 A;  1ALK A;  5C66 A;  1B8J A;  4FDI A;  4LRF A;  5LIA A;  5LQQ A;  5EGH A;  1SHQ A;  2G9Y A;  1ALI A;  1KHJ A;  1Y6V A;  3MK1 A;  1E2S P;  1ELX A;  2W5V A;  3NKN A;  3NKR A;  5GRR A;  1O99 A;  4LR7 A;  2W8S A;  3IDD A;  3MK2 A;  4CYS A;  1EQJ A;  4KJD A;  2RH6 A;  3BDH A;  1ALJ A;  2GLQ A;  2GSN A;  4LR8 A;  4UPK A;  2GSO A;  4CYR A;  5EGE A;  3UNY A;  3BDG A;  3TG0 A;  1E3C P;  3SZY A;  5K4P A;  4UOR A;  4YR1 A;  3TWZ A;  1KHN A;  1ALH A;  1AUK A;  2W5S A;  4TN0 A;  2XRG A;  5GOV A;  5LRM A;  3NKO A;  4GTW A;  3UN3 A;  3NKP A;  4ZGA A;  4GTX A;  1KH9 A;  4MIV A;  2IUC A;  4CXS A;  3CMR A;  4LRD A;  2XR9 A;  2GA3 A;  5INH A;  4GTY A;  4ZG6 A;  5LRN A;  3WAY A;  4N7T A;  4KAY A;  4KAV A;  4KM4 A;  1EW9 A;  4UOO A;  1EJJ A;  4CXU A;  3Q3Q A;  5IJS A;  1HDH A;  3A52 A;  3M7V A;  4MY4 A;  1HQA A;  2ZKT A;  3IGZ B;  4KJG A;  1FSU A;  4ZG7 A;  3T01 A;  2IUC B;  1AJD A;  3NKM A;  3WAV A;  1K7H A;  4LQY A;  5DLV A;  4LR9 A;  1E33 P;  1O98 A;  3DYC A;  2X98 A;  3BDF A;  4LRB A;  3UN2 A;  1HJK A;  2W5R A;  5DLW A;  5HRT A;  1ED8 A;  3DPC A;  2W5T A;  3OT9 A;  3UO0 A;  2W5X A;  1SHN A;  4UPH A;  3WAW A;  1ED9 A;  3IGY B;  3ED4 A;  2ANH A;  3LXQ A;  4GTZ A;  5AJ9 A;  1ELZ A;  1KH7 A;  2D1G A;  2GSU A;  4UPI A;  4ZG9 A;  1EW8 A;  5L0E A;  4LR2 A;  2IFY A;  4UPL A;  3WAX A;  3MK0 A;  1ANJ A;  1KHL A;  4MHX A;  1KH4 A;  5L0B A;  1Y7A A;  2W5W A;  3E2D A;  1N2L A;  3TX0 A;  5KXA A;  1ZED A;  3M8Y A;  3M8W A;  1URB A;  1AJC A;  1URA A;  4QAX A;  1AJA A;  4UOP A;  5TJ3 A;  3KD8 A; 
#chains in the Genus database with same CATH topology
 3CIZ A;  3QFW A;  1JXL A;  2HFU A;  3OFH A;  4AD6 A;  3CJ3 A;  3M9M B;  2V8H A;  2NXJ A;  1NJY A;  2ZIT A;  3EPG A;  2ZVS A;  1FXR A;  4CXK A;  1JLF B;  1RCX B;  4RNN A;  4AXJ A;  3FUY A;  1OPI A;  3CO0 P;  2KYZ A;  1A7G E;  1NSP A;  2D3U A;  4ZN1 A;  1K44 A;  5J2P A;  3CC2 S;  5BJR A;  3CB4 A;  2BE9 B;  4KFB A;  1MML A;  1TL5 A;  4C8N A;  4B08 A;  5LMN J;  3RR8 A;  2QFI A;  1OO0 B;  3NRB A;  3GFY A;  2IVF B;  5C7P A;  4X62 J;  1NND A;  3I0S B;  3ZTR A;  3PO5 A;  3NGS A;  1YTY A;  1S72 S;  4OYB A;  2KM8 C;  2B5J A;  1SKU B;  2XS7 A;  3ENA A;  5SUH A;  3MEE A;  1N5Y A;  1MLA A;  2MQQ A;  3T1A A;  3C14 A;  4F36 A;  3OL6 A;  1BWE A;  4KJI A;  5KFQ A;  1MRO B;  1EET B;  3HLU A;  1VQ5 S;  2ZEJ A;  1SCJ B;  5A2Q U;  1IXK A;  1TV6 A;  2FHK A;  2DHG A;  2MMY A;  2WHO A;  5DLG A;  4EBC A;  1HD0 A;  2C3O A;  2JHE A;  1GAO A;  1ELX A;  1WDT A;  4WFZ A;  5EDW A;  1AUD A;  2DRB A;  3X3U A;  1F2G A;  2B0G A;  1X31 C;  1NEE A;  3CJS A;  3CTR A;  3BDH A;  3OSN A;  4CRJ A;  4DL2 A;  4C97 A;  2KZM A;  3BSA A;  5D8H B;  4A8M P;  1S76 D;  5KG0 A;  2OFH X;  2XCP A;  1GXU A;  2ZC3 A;  2ZVI A;  5EWG A;  4B3R J;  1XR5 A;  4LMZ A;  1IQT A;  2JSX A;  3DU6 A;  2H1Y A;  4GO7 X;  3CD6 S;  2HHT A;  2HNY B;  4UY8 T;  4ES3 A;  1C2P A;  4ZVF A;  2BW2 A;  1NPR A;  4NZ6 A;  4UOF A;  4UZC A;  2HPU A;  2WSC C;  5K8P A;  3I5A A;  3BO2 A;  2MZT A;  4DSL A;  5H9E K;  3NKP A;  2V68 A;  5IV3 A;  4ECS A;  1OQ3 A;  1OY6 A;  4O3Q A;  5DG8 A;  1S57 A;  2HHW A;  3CSK A;  1IWG A;  3OJS A;  1SL0 A;  4L6V 3;  2KHC A;  3ILJ A;  3PCO B;  5H9F J;  3CPW R;  2PFD A;  2ZHO A;  2BDP A;  1H3D A;  5HL7 Q;  2R7Q A;  3BGF A;  4CLW A;  4ED2 A;  2JFK A;  3V4I A;  2R8K A;  2DJW A;  2BOA A;  4IFV B;  4ZG6 A;  3X1L B;  4ZS6 A;  3IAS 9;  1V3Z A;  2MHN A;  3A3P B;  2E5L F;  4C8K A;  4OL8 A;  3O44 A;  3V4I B;  3AOD A;  2FHM A;  2OEK A;  1G2E A;  1KOO A;  3OXL A;  1FKO B;  4O44 B;  2C3P A;  3ISZ A;  2DNK A;  4CYU A;  2KT3 A;  4F50 A;  3UCU P;  2PFF B;  4DSE A;  5AXM A;  1VQM S;  1KQK A;  1P9Y A;  3BGL A;  2JC0 A;  5F8I A;  1R3N A;  1K9M T;  1IBC B;  1NLK L;  4H4M A;  5LOQ A;  2X98 A;  2I5J A;  1UFL A;  5JXS A;  2N4D A;  2ZM6 F;  4F4X A;  5DLW A;  1F2H A;  2HNY A;  3DPC A;  3TUI C;  3NNC A;  1SHN A;  4CO5 A;  1UZH A;  2ZWO A;  3AT1 B;  2G9O A;  2QT7 A;  4KE5 A;  1MU2 B;  2XWX A;  4EFA C;  2E5L J;  2V67 A;  3M6X A;  1D8Y A;  3WAX A;  1RTJ A;  2UXD F;  3GJS B;  5L9X A;  3Q0A A;  1DLO B;  1ZTT A;  1FJ7 A;  2EKY A;  3BGR B;  3BZQ A;  5T7L B;  3RW6 A;  2HNZ B;  2QC3 A;  5KFZ A;  5ETN A;  3R1H A;  1SJ3 P;  1T02 A;  2H4Y B;  2KT2 A;  3NG8 A;  1H38 A;  4JI2 J;  2XY5 A;  3LAL A;  2UUT A;  2GGP A;  5A8R B;  3BBF A;  2RH3 A;  2DHS A;  3MAA B;  2R8G A;  4ZJQ A;  4H4O A;  4KHP F;  2EBG A;  3NAH A;  4ILR A;  3AJ2 A;  3D66 A;  1CQM A;  3EX7 B;  1T03 A;  1QUV A;  2WCX A;  4KKO A;  1RTD A;  2CPY A;  2W9A A;  1T05 A;  1REG X;  2UUB J;  4P75 A;  2QMW A;  3DM2 A;  1NDL A;  1RK8 A;  2LKZ A;  2WW4 A;  2V94 A;  4I6A A;  1WJ9 A;  4M95 A;  1KHK A;  3I4P A;  2JEI A;  2CRL A;  2W7O A;  5KFK A;  1SC4 B;  2AJF E;  2CJQ A;  4PAB A;  2JRS A;  3A3N B;  4I1T A;  2Q3P A;  1Z2Z A;  2VU5 A;  3OVS A;  1KFS A;  4FVM A;  1LKZ A;  1RT6 B;  2HGN A;  3ADA C;  1J5E F;  1R31 A;  2HVI A;  3ZZP A;  4B56 A;  2B9E A;  2LXF A;  4LRA A;  3TAR A;  2VV5 A;  5D0G A;  4XPC A;  2ATL A;  3WC2 A;  1PIE A;  3FEZ A;  2BJD A;  2AJ2 A;  1EW2 A;  1EB0 A;  2R4F A;  3CDB A;  2WVD A;  2RJZ A;  2V69 A;  4I2Q B;  3GIJ A;  1P49 A;  4ES1 A;  3T00 A;  2VPW B;  1DQ9 A;  4ZJL A;  2R9L A;  3D3B J;  3FJ2 A;  1B8J A;  3MCS A;  4HI1 A;  1S12 A;  2CJ9 A;  1X9S A;  2BJ1 A;  4UPH A;  5B08 A;  2GO9 A;  1VBZ A;  2G9Y A;  4JI8 F;  2ASJ A;  3PG9 A;  5A2Q Y;  1LV5 A;  3A4T A;  3BPS P;  3H2L A;  3RBZ A;  5DQH A;  2DR9 A;  5DG9 A;  2HQD A;  4HI2 A;  1GFW B;  4PZV A;  4J91 A;  4ZP7 A;  2JWN A;  3W2W B;  4CLF A;  2ADC A;  1V3R A;  2RH6 A;  2XWY A;  3ZO7 A;  1J5E J;  4PEO A;  4ZJO A;  2XO6 A;  3BR8 A;  4KAI A;  1KVJ A;  4UPK A;  2MJU A;  3R6L B;  4C8L A;  1RBL A;  4RJV A;  1GXL A;  2Z2M A;  3DLE B;  3KUE A;  4RW8 A;  3KK1 B;  4DPY A;  3KOA A;  4K59 A;  4CLT A;  4UST A;  3J7Z 5;  2LEA A;  3EIC A;  4WIQ A;  3KUG A;  3K58 A;  1C4A A;  3GZ7 A;  5DO2 A;  5B0E A;  4W92 B;  4PG6 A;  4TVA B;  2J8A A;  3KLF A;  5H9E J;  2JL9 A;  1WF1 A;  4H4K A;  4ID5 B;  1DTQ A;  4UOH A;  4MMO A;  3OBI A;  4USK A;  4H4O B;  1TU0 B;  4PYA A;  5BR8 J;  3CCM S;  5H9F K;  4FKX A;  1RE1 B;  1VGY A;  3W7B A;  1N4L A;  1HBU B;  1V6H A;  1FRH A;  4NLU A;  1N8R T;  4FF1 A;  2IVM A;  2PMH A;  3I31 A;  3VTI A;  2W8L A;  1UVL A;  4LF5 F;  1WI6 A;  2FLN A;  1RP5 A;  3CDU A;  3PO4 A;  1WUU A;  1VQO S;  2BKN A;  3WQP A;  4HH1 A;  4QIV A;  2DNY A;  2CG4 A;  3LP1 A;  5CZV A;  4ZVS B;  2L41 A;  2GML A;  3CIM A;  4M1K A;  3NY0 A;  2JEF A;  1NM2 A;  1CJU B;  1AJD A;  2EFQ A;  3IM8 A;  1YJ9 S;  1NHK L;  1TMJ A;  2IBO A;  4CH0 S;  1CC7 A;  4C6A A;  4WCE Q;  4IOA Q;  5F8N A;  1RT7 B;  4CO0 A;  4ER8 A;  4LRB A;  3UN2 A;  1FRI A;  5DS7 A;  4EMD A;  4DV4 F;  5HAO A;  4C3K A;  2A1B A;  2VD3 A;  1LWC A;  2AF6 A;  4KV8 B;  1TK8 A;  2XMU A;  3W3S A;  4LSL A;  1HD1 A;  1WOS A;  2V8V A;  2BKP A;  4YB5 A;  2G2Y A;  2OP5 A;  5CYQ A;  1AB8 A;  1K73 T;  1RBA A;  2KZZ A;  1T9X A;  3ED4 A;  2WAQ D;  4DQQ A;  1PJ5 A;  4CTA A;  4NRU A;  4PUO A;  1I94 F;  1C1B B;  4NPO A;  3M8S A;  1XTZ A;  4LF6 F;  2CPJ A;  3GP9 A;  3R1L A;  1RU2 A;  1Y7A A;  1NJI T;  3A8J A;  2E9R X;  3TX0 A;  1V5I B;  3KLV A;  4NI2 B;  2EKN A;  5KFO A;  1F60 B;  3ZZR A;  2FHJ A;  4MJK A;  2H3E B;  3HD1 A;  3D54 A;  3KXD A;  1QSL A;  2HWT A;  2C2R A;  3KMS A;  3D2W A;  4NZ0 A;  2L9N A;  3R5B A;  3V2U C;  4CLP A;  2MKK A;  1WEL A;  2H51 B;  3C6U A;  3I87 A;  3MMC A;  3T1H F;  1EI6 A;  4AL5 A;  2LQ9 A;  1PJ7 A;  5C42 B;  1F5A A;  4NWX A;  3HHL D;  4RR5 A;  2AU0 A;  5IT4 A;  4USI A;  2W24 A;  4JP8 A;  2EW9 A;  1R0A B;  4PXC A;  3M4X A;  3RGI A;  1N5S A;  4ITS A;  4R0E A;  4DUY F;  4FN5 A;  1FJG J;  1J27 A;  4Y2C A;  5KT2 A;  3SZZ A;  2PE8 A;  4X4V A;  2VZ9 A;  3OR2 B;  1N54 B;  5KFU A;  3IM9 A;  1VQ7 S;  5A8K B;  1TKT A;  2YWE A;  3NGT A;  1RIS A;  1TMM A;  2I38 A;  4WTY A;  5EUH A;  4ECU A;  4JB8 B;  4OHV A;  4JUZ A;  4AL7 A;  3MM7 B;  3OR1 B;  4I6W A;  4LF9 J;  2LFV A;  1N56 A;  4RNF A;  3E8O A;  1PJ6 A;  2A6M A;  2PO4 A;  3Q8U A;  4MYU A;  4WFY A;  2UXB F;  4TLR A;  4LF7 F;  4LRC A;  1FVS A;  5GVQ A;  4RPF A;  5HAT A;  1KQS R;  4DR7 J;  5L39 A;  2YX7 A;  1G6B A;  4FNH A;  4OX9 J;  1ALK A;  4DV5 F;  1FKP A;  1C0T B;  3IS9 A;  1O6X A;  1U1M A;  4P71 A;  1URR A;  1RWO B;  1TUV A;  3CME S;  1U7L A;  4P6Q A;  3WIV A;  4LSZ B;  2NUH A;  1NPK A;  2Z4P A;  4WU3 A;  2YQ3 A;  5HAN A;  2B5J B;  4DUY J;  4LF8 J;  1FJG F;  3GFH A;  4FP9 A;  3HHL B;  3BPD A;  5E3R A;  2ZC4 A;  1U8W A;  2VA2 A;  2VOD A;  2R8J A;  2H4W B;  1YJR A;  1HBM A;  3MED A;  2RIL A;  5C24 B;  3J81 j;  1U6B A;  1HQU A;  3R97 A;  2DGX A;  3UE2 A;  2DB1 A;  2YX1 A;  4IH7 A;  3N01 A;  3GG0 A;  1NBE B;  2CUY A;  4G6V B;  4TXS A;  4PG8 A;  2R3V A;  1A9N B;  3CJK B;  3C16 A;  4XIU A;  2ERR A;  1Q8K A;  3P6Y C;  2ACM A;  4PAA A;  4WK1 A;  3W9I A;  1N88 A;  4TU9 A;  4Q0B A;  4W98 A;  1AA1 B;  1Q8I A;  3B4D A;  1ZAV A;  3PW4 A;  1ALH A;  1T9U A;  1TFW A;  1MW7 A;  4AQY F;  3W61 A;  3JTO A;  3S01 A;  5M2P A;  4ZGA A;  2BM1 A;  4GTX A;  1IQZ A;  4K2X A;  2Z58 B;  3RRK A;  2FLP A;  4M63 A;  4B3T J;  1HBU A;  5A76 A;  3KHR A;  4C11 A;  4J37 A;  4Q8F A;  1FNX H;  3TEH B;  5KT7 A;  2LA6 A;  4Z7Y A;  4LRD A;  4KYZ A;  5KFT A;  4UUX A;  1NB2 A;  1VQ9 S;  1JLC B;  1UFK A;  3NCR A;  5LRN A;  1MN7 A;  4FYW B;  3MM5 A;  4DCJ B;  4KAY A;  1PBU A;  1R7I A;  3BN4 A;  3A12 A;  1Q78 A;  4ZPA A;  1UVN A;  3NXZ A;  3L4B C;  3TVK A;  2NSC A;  4QIW D;  5ETO A;  2JVR A;  1SKW A;  2XS5 A;  1NKC A;  4RW8 B;  3A8E A;  1FES A;  2D69 A;  3F41 A;  1FNM A;  2MQ8 A;  2RUG A;  4K5R A;  4ZVH A;  4OHZ A;  2MZS A;  4Y2I A;  4C3M A;  4WFB Q;  3VAK A;  1ZZN A;  2IUC B;  4LQY A;  3H2U B;  1NO8 A;  3IA0 A;  4YQW A;  3SZ2 A;  2ZBP A;  1X4A A;  3M6W A;  4NA1 A;  2W9B A;  3HJV A;  2O67 A;  3LTO A;  2EK6 A;  1OMS A;  1YZ6 A;  2HG4 A;  2KM8 B;  4DV1 J;  1KOH A;  1YJV A;  3M2R B;  3G6Y A;  2KTQ A;  1KDN A;  2ABY A;  4YB7 A;  2CQB A;  1VQL S;  2BV3 A;  3PTW A;  3QGP A;  3EGZ A;  3ZFV A;  1YJW S;  3MXH P;  2GFF A;  4ICL A;  4EO6 A;  2BR0 A;  3DN9 A;  4MIA A;  1GMV A;  3QZ8 A;  4EYI B;  4A8W A;  1JLQ A;  1WF2 A;  3M05 A;  3OUY B;  1Y00 A;  2CQ4 A;  4RU9 A;  1RB0 A;  3MAH A;  5C25 A;  4A8K A;  2HS3 A;  1U1P A;  3CJ4 A;  3IWL A;  1DBD A;  1FFG B;  1SH0 A;  3K5P A;  4BLG A;  1TL3 A;  4K4V A;  4LBI A;  2CJK A;  1FA0 A;  1X8D A;  4GVL A;  5LMU J;  1U02 A;  3CE8 A;  5HJY A;  2XMK A;  1QAJ A;  2MKH A;  2ASY A;  2XQC A;  2OKQ A;  3FKB A;  4G1Q B;  3I32 A;  5D4N A;  2DR5 A;  2FPH X;  2Z8Q A;  3CCQ S;  3I82 A;  5CD4 A;  3KK3 B;  3M1V A;  4FDJ A;  2UVW A;  2R7U A;  2BX6 A;  5L0K A;  2FQQ B;  2Y0B B;  4OYA A;  1KQF B;  2IRY A;  3BDG B;  4ANC A;  4A8Y A;  4MYT A;  1Z2L A;  2V34 A;  2R8H A;  3KLE B;  2VHG A;  3Q22 A;  1GTE A;  4LRE A;  2C3M A;  1ZEF A;  4RBU A;  4EBE A;  1QY7 A;  4C8Y A;  1S79 A;  3DDK A;  3W65 A;  2QTW A;  3CD7 A;  4YB6 A;  2W8D A;  5DM7 Q;  3UW1 A;  1XWL A;  4RLE A;  3QID A;  5K5M A;  4RW4 A;  4DMZ A;  3HSZ A;  3R5A A;  4C8O A;  1N2K A;  1FKP B;  2HQF A;  2QA1 A;  1M5P C;  3MM5 B;  1U48 A;  2V8P A;  3GSI A;  1EP4 B;  1M1G A;  2LQB A;  3D9B A;  1EKR A;  2K06 A;  3K2Y A;  3ULH A;  4X4T A;  4TU8 A;  3GIL A;  5HLF A;  2ASD A;  1XMO F;  4JI0 J;  1HMV B;  4KC5 A;  4ED8 A;  1Y6V A;  4Y00 A;  2FY1 A;  4MK8 A;  4DJB A;  2FZG B;  5FII A;  2RRN A;  1LW2 B;  4USW A;  4R5P A;  1UEV A;  4AQY J;  3PV8 A;  1JXV A;  3DRR B;  2C2N A;  5HRO B;  1TKT B;  1F9H A;  3NP5 A;  1I1G A;  2GLQ A;  4EZ9 A;  3T1Y J;  3B54 A;  3NBP B;  1E6Y A;  1HPZ B;  2ZDP A;  3AQP A;  3MHY A;  2WVC A;  4KQZ A;  4M5J A;  1U47 A;  4K4U A;  3C16 B;  2QV6 A;  3S8S A;  4DV6 J;  2NSB A;  3VR1 A;  3D5M A;  5HMW A;  2OSQ A;  3UR0 A;  4QCL A;  3ETO A;  2CAJ A;  1UFW A;  3OTO J;  2KFZ A;  4DR5 F;  1TL1 B;  3DFE A;  2BRL A;  4NLR A;  5BYR A;  2MXY A;  3OL7 A;  2ZZN A;  2QJ3 A;  2XUL A;  2B8Q A;  2QLF B;  3AOB A;  3T6J A;  4WBF A;  3W8P A;  1VQN S;  1U1Q A;  2PEH A;  1RQ0 A;  2EPI A;  3HHL A;  2RDD A;  5KFV A;  4Q2L A;  5ETM A;  2F7V A;  3T6B A;  3M9O B;  4QWC A;  3JQK A;  4B3O B;  3KDO A;  2CQ3 A;  5EWF A;  2NRE A;  3O8W A;  3THT A;  2IHR 1;  4IOC Q;  5LJ5 Y;  3LUY A;  4DSF A;  2RKI A;  1U1O A;  3PKY A;  1FHT A;  3KK2 B;  3C6T B;  1UVK A;  1LEO A;  2XGQ A;  2QSW A;  4I0W A;  5DDO C;  5ETP A;  1TUG B;  2ZJQ Q;  4KM4 A;  4DR1 F;  4O0I A;  3EGW B;  1DTT B;  1S99 A;  5LM7 E;  4MY4 A;  2FIU A;  4RWW A;  3MPV A;  1FDB A;  1OJ4 A;  2FYX A;  3C8Y A;  4BDP A;  5CYQ B;  3HVR A;  4U8Y A;  5I3Q A;  4OX8 A;  4Z7C A;  3PIO Q;  2WB1 D;  3N6N A;  1TUW A;  1NK7 A;  1Q0N A;  3BBC A;  1E6Y B;  1HPZ A;  5L1L A;  4Y34 A;  3VAG A;  1ITP A;  3Q2T C;  4FS2 A;  3BYP A;  2QLX A;  4CLK A;  2NPI A;  1UKU A;  1RBO B;  2KJV A;  3W2V B;  4OHY A;  1D09 B;  2J5A A;  2M4M A;  3BM7 A;  3FQK A;  3LP0 A;  3M8Q A;  4OZN A;  1RA6 A;  2BA9 A;  3HVT B;  4HDH A;  4V1A k;  4C0H A;  5K8M A;  5CYM B;  1G3O A;  5K8N A;  1B0P A;  3MMB B;  2KXH A;  3GCX P;  5KFM A;  4CNZ A;  5D4L A;  4X66 J;  1QTN B;  2XC9 A;  2MZ1 A;  4ED0 A;  3IGY B;  5LL6 d;  4DX6 A;  4ILL A;  3LP1 B;  1EP4 A;  2E1M C;  1RT2 B;  3POT A;  2F65 A;  3HT3 A;  3GV8 B;  1HW8 A;  1ZPV A;  2C2D A;  4FBU A;  5MAO A;  4YY3 F;  3AA8 A;  4QR1 A;  4WKR A;  2H9Z A;  3MEE B;  4GC7 A;  1KH4 A;  4ZVT B;  1KLM B;  3HDS A;  4NEY A;  1X60 A;  1ZAW A;  4J9R A;  1N34 F;  5D6G A;  3QJP A;  2PII A;  3CW2 C;  1JLG B;  2WRM A;  2Q66 A;  2WOM A;  1FRK A;  3K7R A;  4ZIW A;  2V5H G;  2KRR A;  4EYH B;  1NJW A;  4KPY A;  3KKF A;  2X1F A;  4G65 A;  4TKT A;  5IOL A;  4U7U D;  4OJG A;  4PUO B;  2RQM A;  2I0X A;  2HWI A;  3OD2 A;  2ZH7 A;  2JNJ A;  5H1S V;  3GV5 B;  1N33 J;  4CO4 A;  1KEK A;  1TQL A;  1S10 A;  2FVP A;  5CYJ A;  5CAB A;  3NOG A;  2U2F A;  5D4O A;  1UA0 A;  3HHL C;  4C9D A;  5IS2 A;  4MK7 A;  4WXW A;  5E0O A;  1FI4 A;  3TAP A;  1TKD A;  2GJ2 A;  2AWZ A;  2CXE A;  2M7S A;  4HAC B;  4EBD A;  2MQL A;  2WBR A;  3ICL A;  1H98 A;  4LSN A;  4DWI A;  1Q5V A;  3AY0 A;  1ACM B;  3ZXW A;  4WZM A;  2AMC B;  1RTI A;  4WII A;  3IO1 A;  5E3C A;  2VFU A;  4OI1 A;  2F4V F;  3G71 S;  1N33 F;  1KH5 A;  1TKX B;  2CZV C;  2AJQ A;  1GX6 A;  4NWJ A;  5IJQ A;  3M8Z A;  5C25 B;  2Z2Z A;  2VG5 A;  3K89 A;  1O0P A;  2LP4 A;  1VBY A;  2G13 A;  2KL8 A;  2LU2 A;  4C3L A;  3H4D A;  2FVQ A;  4LF9 F;  1OY8 A;  4YOE A;  4P7V A;  4ERD A;  4YR3 A;  5GME A;  1VRU A;  1LWF B;  1VRU B;  2K7K A;  4J9P A;  3Q8R B;  1EIY B;  2JEG A;  4JI5 F;  2MJN A;  2RQK A;  5GAG U;  3EUN A;  2BBE A;  2O01 C;  3HSD A;  2RQC A;  4NYZ A;  3RAX A;  2RNE A;  5IWA F;  2OEJ A;  3BR9 A;  3GV7 B;  1E2S P;  1U09 A;  4OYO A;  4F3Q A;  2V4J B;  5I3U B;  4ZPT R;  4YEA A;  3TP2 A;  3CNQ P;  1X0F A;  3MR6 A;  3U1L A;  2VQE F;  1TP7 A;  3QLH B;  1I3O B;  4Y2K A;  3HHN B;  4GC6 A;  3O3L A;  1UCN A;  1IR2 A;  2F9D A;  1HW9 A;  4L72 B;  3POT B;  4IDK A;  3CCT A;  1OS5 A;  4LR8 A;  3T9N A;  1CSJ A;  5HSP A;  3PJ9 A;  5LSO A;  2FTR A;  3PVX A;  2RSQ A;  2GNK A;  2GCF A;  1ULR A;  2A6O A;  3PHE A;  3MM9 A;  3FQL A;  2MDA A;  3BH7 B;  3AAW B;  3H7H B;  4JI8 J;  4QIE A;  3W1Y C;  4J9M A;  5L1I A;  4YME A;  2AEM A;  1FE0 A;  1NK8 A;  1KTV A;  4ZP6 A;  5KFN A;  3H40 A;  1VLY A;  1Z4U A;  3GG1 A;  1JLC A;  1DUR A;  2WOM B;  4TY8 A;  1S1V B;  1S6O A;  2Y8W A;  2XR9 A;  5LMN F;  3NNA A;  1RHR B;  1ZBT A;  3JSB A;  1WC3 A;  2MY7 A;  3MEG A;  5KTQ A;  1U1L A;  2XB2 D;  1M5H A;  1WEZ A;  3MR7 A;  4KHR A;  5D4P A;  2FJX A;  3NGD A;  2I9S A;  2ZWP A;  3ONQ A;  4LF2 A;  2NZ4 A;  1XMQ F;  3DLG B;  1HQA A;  2HQG A;  2ZKT A;  2YKP A;  3CCL S;  1FRL A;  1NME B;  3CED A;  1F6T A;  5CYM A;  3BGO P;  5IQQ A;  2DPI A;  3H5X A;  5CCL A;  4B3S J;  2DNP A;  2WSF C;  3UD4 P;  4GO5 X;  4ED1 A;  1O98 A;  3HVW A;  4HTI A;  4LF1 A;  3BDF A;  4H4M B;  2AHO B;  2GS8 A;  1IKW B;  3CDE A;  2MB0 B;  2GHW A;  2UP1 A;  4KTQ A;  4LIW A;  3EZ5 A;  4JYA J;  3ZZU A;  2EEY A;  2V2K A;  3OTC A;  3VV2 B;  1S6U A;  3LF0 A;  4U95 A;  2E5J A;  1NK4 A;  4UPI A;  3GU0 A;  4DL5 A;  3HT0 A;  2AX1 A;  4WFN Q;  4Z2X A;  2QL9 B;  3BO3 A;  4WKY A;  3V6K A;  1D1U A;  2B4O A;  2XTJ P;  4M5H A;  3D1Q A;  1JX4 A;  2HMI A;  3DRR A;  1TAQ A;  4F4Z A;  3CXC R;  3MM6 B;  4UT4 A;  2J9D E;  4BBY A;  1UL3 A;  2N4C A;  2YNI B;  3CCU S;  1Q79 A;  2CJX B;  3PNI A;  2CQ2 A;  3SYZ A;  2C2Z B;  1KFD A;  1WEY A;  3UCG A;  2CQH A;  2N7C A;  3RZA A;  1KHW A;  2BAN B;  4ZLN A;  1XBW A;  3A1Y G;  2HLT A;  3E3X A;  4PPZ A;  4NXN F;  2E9Z A;  3KD8 A;  4LBH A;  1PIL A;  4ECV A;  1BQM A;  2ZBC A;  1REV B;  2AX0 A;  2IM1 A;  5C2C A;  5B0B A;  2OIH A;  4OYW A;  2BJE A;  2OJ3 A;  4Y2M A;  4K0K F;  2UXC F;  3Q8P B;  1S9F A;  2O1P A;  5C42 A;  1IBL F;  4P2S A;  1QAY A;  4A48 A;  1FEE A;  1Y10 A;  1GXT A;  1M5K C;  4GVB A;  1VJW A;  3NCQ A;  1D9A A;  2ZOM A;  5EN1 A;  2W5Q A;  2QX0 A;  2H5J B;  3QIP A;  3WZ0 A;  2AGP A;  2WTF A;  1UWA A;  3C2P A;  1OSC A;  3LAN A;  1PAE X;  1TV6 B;  1YGY A;  4K8R A;  1E1Z P;  4DDF A;  1NJZ A;  1M5O C;  3NKQ A;  5HJX A;  1C1B A;  1WC4 A;  3GE9 A;  1U49 A;  5JUM A;  5C66 A;  1HNI A;  5IC6 B;  4WF9 Q;  1NCL A;  1SVD A;  2AGQ A;  4OZ2 A;  3H5Y A;  3VVT A;  1GTH A;  1F9E B;  1HYS A;  1U45 A;  2DKO B;  2E5H A;  3LO3 A;  3IFE A;  2CQI A;  3D0G E;  2ZNZ A;  3ITH B;  4ZVQ B;  4F0H A;  1NB7 A;  1FKA F;  3NAI A;  1R27 B;  2IRX A;  3EXC X;  2EFN A;  2CKW A;  1CJK A;  2QL5 B;  3D4J A;  2APO A;  3I0S A;  3OSP A;  3HO1 A;  1R8A A;  5KG3 A;  2W8S A;  4L73 A;  3T1Y F;  4KJD A;  2XM3 A;  4WWS A;  2UUA F;  5J1E B;  2GAG C;  1GMW D;  2DR7 A;  3VCD A;  1CJU A;  5K20 B;  3MEK A;  2XI2 A;  2J7W A;  3SDE B;  1HQE B;  4MFB B;  1FRJ A;  1RT3 B;  2A2D A;  2DBB A;  3SV3 A;  4Q7A A;  2FC8 A;  2ZE2 A;  4N5S A;  3KK3 A;  3PJW A;  4CI0 B;  1ZYQ A;  4DS5 A;  2WSE C;  5E5N A;  2C2O B;  5I42 B;  2MTL A;  4U96 A;  3PY8 A;  3RAQ A;  1FNO A;  1S1T B;  4ZHR B;  2CQ0 A;  4ELU A;  4F3O A;  2DHH A;  1U25 A;  3MMJ A;  1VQK S;  4NZ7 A;  4IR1 A;  2IPO B;  3ILL A;  1H2U X;  4CXS A;  4USH A;  2ACY A;  4DF4 A;  2J0Q D;  3E2D A;  4JI0 F;  5CXT A;  1WKK A;  2WW8 A;  1CPZ A;  3NGR A;  2XSF A;  3RYL A;  2KVI A;  4NE9 C;  3QT6 A;  2ZBI A;  1U26 A;  1SUQ B;  2ZD1 A;  4I68 A;  4DZ6 A;  4CDI A;  2MQO A;  2BAB A;  4A8O A;  3BH6 B;  3M6V A;  2BEF A;  1NU4 A;  3I0R A;  3I0R B;  3IBF B;  5AE3 A;  4DV7 J;  4DFM A;  3IG1 A;  1HR0 F;  3Q3Q A;  2ZD1 B;  3LH2 S;  3DOK A;  4ICL B;  1K47 A;  1WD6 A;  1CLF A;  2EFP A;  1RAC B;  2D3Z A;  2K7J A;  4JV5 J;  3IGZ B;  3KK1 A;  2M52 A;  3IR6 B;  1EKS A;  3LQV A;  1FSU A;  4NLY A;  4Q44 A;  3CCW A;  4WFX A;  2W01 A;  4BCA A;  2IIH A;  3J7Z T;  1N6Q B;  4OZ1 A;  1B4S A;  1S49 A;  4YS2 A;  2WVE A;  3AD8 C;  1S1T A;  4QQB A;  3SCJ E;  1SL2 A;  1KKH A;  2F9J A;  1VQ4 S;  3DLB A;  1GMU A;  5K4P A;  1DY3 A;  3QT5 A;  2X3G A;  2HQI A;  3CJK A;  5KG1 A;  2RT3 A;  3D6T B;  1ED9 A;  1QSS A;  2RD5 C;  3AQO A;  4PQA A;  1R8H A;  1KH7 A;  5EX0 A;  1S7H A;  3GFX A;  1EAY C;  4ZK7 M;  2IFY A;  3FFI B;  4M5N A;  2XS2 A;  3G8Q A;  1RAO A;  3BGU A;  4LFA J;  3UWT A;  3TUP A;  2VA3 A;  4X4U A;  1TR0 A;  3HVA A;  4JI5 J;  4M8L A;  2ZH3 A;  4QWD A;  1Y3K A;  3ITH A;  3HHK A;  4R25 A;  4BWJ A;  1R8C A;  1U8S A;  3D28 A;  4DL7 A;  3QJJ A;  4K7Q A;  4FYY B;  3VGS A;  1QAI A;  4DR1 J;  3CJR A;  3B8H A;  2OEL A;  2RAQ A;  2HZC A;  2ALY B;  4OX9 F;  2YTC A;  3G82 A;  1WF0 A;  1A6L A;  3D68 A;  4OV1 A;  2W2O P;  3TYT A;  4C0B A;  2FVC A;  4USM A;  2XHW A;  5J1P A;  1U0S A;  1JNZ B;  3UN5 A;  3WX4 A;  2W5R A;  3IXQ A;  1KD1 T;  4B9N A;  1HI8 A;  4OZJ A;  1UMJ A;  3SQO P;  4DXL A;  2ADB A;  1XJW B;  4NXM F;  1B99 A;  2ZZT A;  2JH3 A;  3EE3 A;  1HL6 A;  5DLT A;  5C24 A;  3T5L A;  1L3K A;  3LA0 A;  3T41 A;  1VS3 A;  5A8R A;  1SJR A;  2VPY B;  2Z57 B;  4XK8 C;  4PKD B;  3MUT P;  1QJH A;  1B70 B;  3AXM A;  4ZPD A;  2MKC A;  2MEW A;  5A0Y B;  1RCO B;  1DQ8 A;  2Y0S D;  3KFW X;  4CM0 A;  2GVD A;  3R2D J;  1N5T A;  3ZZZ A;  2FJW A;  1ZAX A;  4OJ3 A;  2C28 A;  5ETQ A;  2CWX A;  2BUN A;  3R27 A;  2OPQ B;  2GAH C;  5DZ7 A;  3OQ2 A;  3SSS A;  1BQM B;  4EU0 A;  1KNZ A;  2KI2 A;  3T1H J;  3F0N A;  6AT1 B;  2DCU B;  2HS4 A;  5BYQ A;  1RT2 A;  4CCH A;  3M2V A;  5LSL A;  2QMU B;  2IAJ A;  4ANE A;  3SFU A;  5GAG I;  1ROF A;  1SHQ A;  3W5X A;  1OQ6 A;  2CPD A;  2Y9H A;  4NI2 A;  2MLX A;  3ZC4 A;  3KLI A;  5GRR A;  1FK9 A;  1TTH B;  3AA9 A;  2CVE A;  4IRC A;  1WG4 A;  2I5J B;  2JDJ A;  1AXQ A;  5KT5 A;  4X4S A;  1HWU A;  3CJ2 A;  3FC9 A;  1I51 B;  2E29 A;  3BJY A;  2MQM A;  3DNC A;  4P9S A;  2E5G A;  2W7P A;  1RWM B;  5T14 A;  1W7W A;  4F4K A;  4E98 A;  2HHU A;  1JJH A;  1X4C A;  1QDU B;  5KFH A;  3UD3 P;  4KPC A;  4FF3 A;  4QR2 A;  3OHA A;  4UOR A;  5KFP A;  2IFX A;  5SZT A;  3MWB A;  3E01 B;  1QLN A;  4NA2 A;  2HS0 A;  1YSJ A;  1ZZF A;  2QN6 B;  4NAS A;  4Y6I A;  2B4P A;  4HDG A;  2XZW A;  3DGP B;  1KH9 A;  4RU2 A;  2PI5 A;  1Q95 G;  1NUE A;  4HHH A;  3NMR A;  2YVS A;  1YIT S;  3TVY A;  4Z37 A;  1D8Z A;  3DRS B;  4JI6 F;  4B9M A;  3IBW A;  2R7X A;  4WP3 A;  1AUS L;  4RW9 A;  2ZJR Q;  3D1O A;  3MAQ A;  1KR4 A;  1WTF A;  4DSI A;  4J90 A;  4OI4 A;  2PA8 D;  3P45 B;  3GQC A;  5HP1 A;  2ROP A;  2DXF A;  2P5V A;  4LFC J;  1RGV A;  1FWP A;  2BMB A;  2HND B;  2RUS A;  4ZA1 A;  3KLH B;  4HVZ A;  1ICE B;  4EWT A;  1ZET A;  1S0M A;  2NQP A;  2HVD A;  1SL1 A;  1UEK A;  2BJ9 A;  2D74 B;  5IT0 A;  2L9D A;  4BWM A;  2B4U A;  1T9V A;  1YHQ S;  3I5B A;  2NXN A;  3MI7 X;  4KV8 A;  2PA3 A;  4CH1 A;  2WB4 A;  1U4B A;  2FY8 A;  3WHI A;  5FLX U;  3HJF A;  3MEC A;  5E3A A;  3G6E S;  5A8W A;  4B3R F;  4P10 A;  3F73 A;  4B3S F;  4DR6 F;  2EK1 A;  4FKY A;  2DGU A;  1S6Q A;  1Q8L A;  2KO1 A;  3HSG A;  2Z2L A;  5CCM A;  1PGZ A;  4PPD A;  4IUF A;  1FDA A;  2HW3 A;  2V50 A;  4L74 A;  2G1D A;  2PMZ D;  3UPF A;  2GQQ A;  4JV0 A;  4F2S A;  2W5X A;  3ENW A;  2ROE A;  3OL9 A;  2UXD J;  3M2V B;  4LR2 A;  3KWM A;  1FE4 A;  2CPF A;  4IYQ A;  4IR9 A;  2V2Q A;  2SXL A;  3MK0 A;  2XEX A;  2ZJP Q;  1JQG A;  2QYG A;  3W2W A;  1RWP B;  1TVR A;  1WHV A;  3M30 B;  4M5L A;  6FD1 A;  1T94 A;  5HQM A;  1UAW A;  4TQR A;  3I4H X;  3HFV A;  3HHD A;  3JSR A;  2IJN A;  4R0J A;  2C2K B;  2OGU A;  1GNK A;  4LFB J;  3I96 A;  4X64 J;  2CWK A;  3MD3 A;  3PFO A;  1VCT A;  2R2R A;  2D3O 1;  2ZUG A;  4A8Q A;  3DKD A;  5IM0 A;  4ED5 A;  3KJV A;  4K4S A;  3EM1 A;  3MPU B;  4B3T F;  1DTQ B;  2DNR A;  5KG5 A;  1EHW A;  1JJC B;  4YR2 A;  2OO4 A;  1X9W A;  3TJ8 A;  3UDC A;  2IBK A;  1OSD A;  1IKV A;  3AB2 B;  1ANI A;  1RZM A;  4ECR A;  1IBK F;  3BSO A;  4F2R A;  2CNN B;  1ARO P;  4M5M A;  1T3N A;  3M1V B;  1CVJ A;  2VQR A;  2Y3Y A;  1FD2 A;  1S9E A;  1TKZ A;  3OXG A;  3VZH A;  4U6P A;  3RU0 A;  2VH7 A;  5JVG Q;  2ILY A;  3A8I A;  1MN9 A;  1O5J A;  1RWU A;  3GYG A;  4NLS A;  4NML A;  1H6K X;  1S1U B;  2WON A;  2YY3 A;  4IFY B;  4ZCM A;  1L3U A;  1XNQ F;  2QZU A;  3QPI A;  5LJ3 Y;  2B6A B;  4ZCL A;  3TZW A;  2OPP B;  4ZMM A;  2H54 B;  3ISN C;  5LMU F;  2NPF A;  3PYD A;  2PC6 A;  4GKK F;  3FZ2 A;  5CD4 H;  4RO0 A;  4ELT A;  4F8R A;  3OFE A;  2FC9 A;  4P2X A;  2R7T A;  1NSA A;  3FBB A;  3K8W A;  4UY8 5;  4RNO A;  3SV4 A;  3MK1 A;  2BQR A;  2UZA A;  5KG6 A;  2GVZ A;  1ZPW X;  5IC4 B;  4LR7 A;  4F4A A;  2ZFH A;  1R8B A;  3EZO A;  3BGR A;  2VQF F;  4OHW A;  1EQJ A;  3D67 A;  1ALJ A;  1L3S A;  2ZBR A;  2XSJ A;  4IRK A;  3WIU A;  2EFO A;  2W8K A;  3US5 A;  2K8G A;  4FDF A;  1SI9 A;  4CWB A;  2W4P A;  2UU9 F;  5AE1 A;  2JLE A;  5AT1 B;  3LP2 B;  3O6Q A;  3TG0 A;  3BDP A;  1DAR A;  5J2Q B;  3L7U A;  4USV A;  1Q8B A;  2OI2 A;  1XMO J;  3KNA A;  3SZY A;  1HAR A;  1R0B G;  1XK8 A;  3EVM A;  4I6Y A;  3R2C J;  3NWR A;  2UV8 A;  3HVT A;  2Z56 B;  2R2T A;  4KKO B;  1MWY A;  4YR1 A;  3Q8S B;  2W2Q P;  3W2V A;  1TAU A;  1NDK A;  4I4B A;  3NKO A;  4F7V A;  1YLX A;  4NYO A;  1FWL A;  1KVK A;  2LYV A;  4JI3 F;  1I94 J;  2CNL B;  2VB6 A;  4OLP A;  2NZC A;  5J2M B;  4KBI A;  1QD1 A;  1XNR F;  4P2M A;  2J8S A;  4JI4 J;  1VQY A;  1PYT A;  4DUZ F;  3GJR B;  2IYG A;  3DRP A;  5KFI A;  2CJY B;  5KT3 A;  4EO8 A;  2MGZ B;  2LQ8 A;  2HND A;  3DHX A;  4QWB A;  4ZHR A;  2DCL A;  2M70 A;  3MCN A;  3W64 A;  4F0M A;  1KBR A;  3N5F A;  4NLT A;  4LIR A;  2ZHB A;  5GAE U;  2RKI B;  3CCS S;  2EFV A;  4ECT A;  4X65 J;  2LXU A;  1HWI A;  2BQU A;  3HFK A;  4RW7 A;  3TNV A;  1VQP S;  3VHQ A;  4WYL A;  4NWB A;  3TAM B;  3KJN B;  2VDI A;  3C66 A;  4HLB A;  3WX8 A;  4DCO B;  4X4R A;  3GYN A;  4RL1 A;  1BE4 A;  1Y9O A;  4QWE A;  3IN5 A;  1E33 P;  4CT9 A;  3HFZ B;  4IG0 B;  4IG0 A;  3MUR P;  3O2I A;  5FLX Y;  1HJK A;  1QVG R;  1FFW B;  1CJK B;  3W9J A;  1G1X A;  3I5C A;  4AT1 B;  2FHJ D;  1LW0 B;  4C2M A;  2Y1I A;  1JXE A;  3HZG A;  5IV4 A;  4X4Q A;  4GTZ A;  2DXD A;  1U0H A;  4R8U B;  3RBD A;  2E1R A;  4O4R A;  1EW8 A;  1YBT A;  2AJ1 A;  4ZG9 A;  5L0E A;  3THP A;  1S1W A;  2HQ3 A;  1TEL A;  3N28 A;  2Z0G A;  4AYB D;  8AT1 B;  5HRO A;  1Y4Z B;  5KFC A;  4RUA A;  1W2B R;  2KT5 A;  3UCZ P;  2C42 A;  2KKH A;  3VAJ A;  3JYT B;  4R5P B;  5DG7 A;  4WU2 A;  5HMX A;  4NLX A;  4JI6 J;  3OTD A;  1S97 A;  5KXA A;  4TN2 A;  2MZJ A;  2HZV A;  2G4B A;  3ZTS A;  1T95 A;  1AJC A;  3R7B B;  4QAX A;  2LA4 A;  4URS A;  4J7C A;  4OI3 A;  3DLK A;  4B9U A;  2R7R A;  2QLW A;  1RTH A;  1SJQ A;  1XMB A;  2CPX A;  4ECX A;  1VIS A;  1R6V A;  2ROG A;  1Q53 A;  3BSN A;  1WC1 A;  2B4V A;  1NRK A;  3B6B A;  4CO3 A;  5AXN A;  3I9Z A;  1LW0 A;  3L7O A;  4C0O C;  2HHH J;  1GMW A;  1YRT A;  2F40 A;  2YKM A;  5A0Y A;  1BQX A;  1JMT A;  1VC0 A;  2Z30 B;  1KSP A;  3NVL A;  8ATC B;  4DG1 A;  1WOP A;  4B02 A;  4ZIT A;  2DNN A;  4ZCI A;  3M9N B;  4ECY A;  3VAI A;  1VJQ A;  2VPX B;  4YUD A;  2K1R A;  1BC6 A;  3ETM A;  4WXO A;  2H5E A;  2D41 A;  2KXF A;  1SQF A;  2FGC A;  1QUP A;  2VFS A;  3Q83 A;  3H90 A;  5A6P A;  3TZX A;  4OZ5 A;  3MR3 A;  3CUN A;  4ES2 A;  3MM8 B;  4GKJ J;  3W62 A;  3B5Q A;  2MLY A;  2DGT A;  3UDE A;  3DHW C;  1CS4 A;  1ZS6 A;  4X4O A;  1NK6 A;  4DFP A;  2HEK A;  3ILI A;  4LF5 J;  2CQD A;  4G1P A;  4OIX A;  5KFW A;  2FHO B;  5B0A A;  3N6M A;  3P3D A;  4UW2 A;  1Q7Y T;  2FB0 A;  5M2R A;  1S1V A;  1N36 J;  3V81 A;  1H7W A;  2GQ2 A;  5E33 A;  4CLU A;  2NLW A;  3NKR A;  2B56 A;  4QYR A;  4UF4 A;  3LAK A;  1MWZ A;  2EBE A;  1VOM A;  3A3O B;  3D6M B;  4IFY A;  1JKH A;  2BE2 B;  2LEB A;  3PM9 A;  1MSW D;  3BBB A;  3DU5 A;  2JLF A;  4IH6 A;  2OAU A;  1FCA A;  3T5H A;  1VC6 A;  4LF4 J;  4DFK A;  4QIG A;  2KG0 A;  1HFE L;  2VDH A;  3QRQ A;  3MM9 B;  5D15 A;  3G86 A;  3VVU A;  5F9L A;  1XMQ J;  3RB3 A;  3P5T L;  2GMJ A;  1FDN A;  1FF2 A;  1NK5 A;  1DRZ A;  2J6U A;  1X4H A;  4QPX A;  1YI2 S;  1FTR A;  1YG0 A;  4K5S A;  2DHA A;  4RUC A;  4LF7 J;  4L75 A;  3QAE A;  4KHM A;  3Q24 A;  2CPE A;  3S1T A;  4KRW A;  2DRD A;  2IUC A;  1S6P A;  4ZKA A;  1RT1 A;  2GVZ B;  2M9K A;  1P8G A;  2XY7 A;  3C19 A;  1J5O B;  3CC7 S;  4TY8 B;  1ZTW A;  3MFI A;  2DD8 S;  2IM0 A;  2JC1 A;  1IJE B;  2UUB F;  4DPT A;  4K0K J;  2A18 A;  2LQ5 A;  1KWM A;  1E6V A;  1BHN A;  1KP6 A;  4IG3 B;  4N7T A;  4KAV A;  1N0V C;  2IJR A;  1KQG B;  2OD4 A;  5AE2 A;  4DR2 F;  4UUW A;  1HA1 A;  1DFD A;  1Q7L B;  1F3F A;  1RDR A;  4DL0 C;  3GYX B;  4O23 A;  2XMT A;  4PXB A;  2OFG X;  4RUB A;  4D3G A;  1NH8 A;  1CG2 A;  1FD8 A;  1S4F A;  1Y11 A;  2HRT A;  2OPP A;  1NH7 A;  1K8A T;  1R0C B;  4FF2 A;  2VBX A;  2OEM A;  2V4Q A;  2Y1R I;  4IDK B;  1RTI B;  5F3Z A;  3TAQ A;  1S1U A;  2QZ8 A;  2WON B;  5FDL B;  1M5S A;  3ZTO A;  3VQT A;  3HP6 A;  3PKM A;  4LSN B;  3CD0 A;  1TK0 A;  2AEJ A;  3HKZ D;  2R8I A;  3HUL A;  4PR6 A;  3RJM B;  2RB7 A;  2BM0 A;  2CQ1 A;  3CMA S;  5DLF A;  2W5T A;  4DV7 F;  3NNH A;  4HTJ A;  4LT6 A;  2YNG B;  2QLB B;  3ISN D;  1UEU A;  3DLJ A;  3PRD A;  4I7F A;  5K14 B;  1RT4 A;  2LCW A;  1H7X A;  2F8M A;  3ZZ0 A;  2ZZM A;  1LWE B;  3SDE A;  2PD1 A;  2XMW A;  2MZQ A;  2YQ0 A;  1IKV B;  2D7S A;  3THV A;  3OLA A;  2AD9 A;  2XMM A;  1V5V A;  3PR4 A;  1RYS A;  2V9K A;  3GTY X;  4JI3 J;  1HBM B;  1I5O B;  1Z1Z A;  2B43 A;  2P9C A;  4IH5 A;  4DN0 A;  3HXM A;  1ANJ A;  1RWN B;  3CGI A;  4I2Q A;  1KHL A;  4MHX A;  2J9D A;  1SIW B;  1JLG A;  1WSR A;  3FGV A;  1NKE A;  3IGV A;  2QMX A;  4LVO P;  4DV4 J;  4DZD A;  3RUB L;  2ZH2 A;  5GAH U;  1SH2 A;  4NEZ A;  1HYS B;  1URA A;  2GZO A;  3DGP A;  1T3O A;  3BB5 A;  4BHQ A;  2NS1 B;  2Z2Y B;  3IR7 B;  4GRS A;  1N32 J;  3GPA A;  4UTG A;  5FD1 A;  3TO8 A;  3GIM A;  5I4M A;  4DSJ A;  1J2V A;  3BKT A;  3MDF A;  3UQS A;  2CPH A;  2EXU A;  5HMY A;  4V19 X;  1X5O A;  3WBH A;  2AYB A;  2RML A;  2IY5 B;  5FJ4 A;  2DIS A;  3T19 A;  3OXF A;  4M5I A;  2W25 A;  1DZ5 A;  2MHE A;  1F3V A;  1UET A;  3D1H A;  4UZB A;  2XGP A;  4E8U A;  2UVV A;  3DC2 A;  1P6T A;  3R5D A;  1C1C B;  4NX9 A;  3PYE A;  1JNR B;  1SB6 A;  2DNQ A;  1VBX A;  3Q8Q B;  3PW7 A;  1PCA A;  2BJ3 A;  4ZVG A;  3OTO F;  4OQJ A;  1R0A A;  3DOM B;  4TYA A;  2ZBQ A;  4Y65 A;  1B3T A;  3LPY A;  4DHV A;  3H25 A;  4Q8E A;  1RLD A;  2KYX A;  4WE1 A;  1RT5 A;  3Q86 A;  4K4Y A;  3MMA B;  1ZEB A;  3M32 B;  1NK9 A;  2MKI A;  4DN9 A;  2IC3 B;  4DF8 A;  5L38 A;  1CJV A;  4YDD B;  5L8R C;  4CM2 A;  3ZTQ A;  4LQ3 A;  3DLK B;  5EGH A;  4FVC A;  4ZOS A;  3IWN C;  2NYH A;  3WBZ A;  3FCV A;  1ALI A;  1X7V A;  3DRS A;  4JI4 F;  2AZ3 A;  3MMB A;  4CO1 A;  4Q5V A;  1U1R A;  4ZDN A;  5B0C A;  4WTO B;  3M8Q B;  3K5M A;  1D0E A;  1T9Y A;  2CQG A;  2CZ4 A;  2GV1 A;  1WG5 A;  2BYC A;  2MPU A;  2QG9 B;  4UQT A;  3EPI A;  2BXJ A;  1A0O B;  3QT7 A;  4BC9 A;  1RAE B;  1U24 A;  1QTM A;  1P1T A;  4FPI A;  5D77 A;  3MPW A;  1HHT P;  3CJT A;  4U9R A;  1SQE A;  3LGH A;  1NDC A;  2PMW A;  4UQG A;  3FEY B;  1H2V Z;  4I2P A;  2OTL S;  2VPZ B;  2E44 A;  2DPJ A;  1E3C P;  3V6J A;  4DCP B;  2A3J A;  2DY9 A;  2LMI A;  1DTT A;  2GO8 A;  3R9L A;  3PIP Q;  1ZA2 B;  2W4D A;  3BF4 A;  3NBP A;  5AXK A;  4C7Q A;  1KC8 T;  4DPO A;  1M1H A;  2CDR B;  2GIR A;  3C6T A;  4I56 A;  5EX3 A;  3W8G A;  3PW2 A;  1ZH5 A;  4DR4 J;  1T9W A;  4GTW A;  1B64 A;  3DOL B;  1GEH A;  1LW2 A;  1LWX A;  1SQG A;  4Y2A A;  2R7S A;  3CMR A;  1R89 A;  3QSY B;  4ED3 A;  2YXL A;  2OML A;  3FRZ A;  1PO6 A;  3DLG A;  1RLC L;  3B82 A;  5EWE A;  4JV2 A;  2GA3 A;  1RI7 A;  2MY8 A;  1UVM A;  2DTJ A;  4I67 A;  3DDN A;  5KOX A;  4J9K A;  1S48 A;  4DV3 F;  3H42 A;  4UOO A;  1M1K T;  2AEF A;  1C0U B;  3R6G B;  5DET A;  2OPQ A;  4DSK A;  2JVO A;  4ZCK A;  1TL1 A;  2DK2 A;  4GKK J;  1JLB A;  4O3S A;  5GAE I;  3M8P A;  5BR8 F;  2HFO A;  4FNI A;  4EUV A;  2X1B A;  2V63 A;  2DGS A;  4KIA A;  2F1F A;  3W9H A;  1VI7 A;  1VIX A;  3BQ0 A;  3BQ1 A;  1K7H A;  1C1C A;  2VOO A;  1UW9 A;  2BW7 A;  2CPZ A;  2CQP A;  2XY6 A;  2XMA A;  3R7S B;  3SFG A;  3K8V A;  1GH8 A;  2J6T A;  3EVW A;  4O3N A;  1FX4 A;  4B3M F;  1UJ6 A;  1UWB B;  5G4D A;  5HN0 A;  3EZU A;  4MKB A;  3LOU A;  2DNO A;  4OI0 A;  5AJ3 J;  2K3K A;  3FCW A;  4EEY A;  4JV5 F;  5KFA A;  3EVO A;  4G1Q A;  4QW9 A;  1BLU A;  2Q6C A;  2X51 A;  3IBC B;  4ED7 A;  1S1X B;  4JI7 J;  1URN A;  2GHP A;  2KH9 A;  2E7V A;  1NKB A;  1D9F A;  5CA5 A;  2XSJ B;  2RRB A;  1RXO B;  1UVI A;  4ZG7 A;  3KTQ A;  4N47 A;  3QAU A;  2J9C A;  4ILM A;  2H65 B;  4L3N A;  2U1A A;  4A8F A;  2W5W A;  5JJB A;  5IFM A;  3IGN A;  1N52 B;  2RU9 A;  4NLW A;  1ZED A;  3M8W A;  1F5C A;  1U6F A;  2YWG A;  3KHH A;  1JK9 B;  1URB A;  2FLO A;  4C98 A;  1RJJ A;  2K2P A;  3AXK A;  3HHE A;  2A0F B;  1T7P A;  3OTE A;  3OUY A;  4DV2 F;  1LOU A;  4PYD A;  5CHC B;  4ECZ A;  5KFL A;  1AJA A;  2EC2 A;  1JLE A;  2HUR A;  1PKU A;  4ZVU B;  3FMW A;  2AYE A;  4N76 A;  3QGI A;  2FVS A;  1RT4 B;  1PYS B;  3AD9 C;  3NMA A;  3Q89 A;  2J0W A;  4MFB A;  5JVH Q;  3UR3 C;  1RAG B;  3GMG A;  1ZM9 A;  2GIF A;  1CUL A;  2PN6 A;  3TX8 A;  3G9C A;  4P2F A;  2W9B B;  2GHV C;  2BE2 A;  2HRU A;  4DU7 A;  1VK3 A;  3T9Z A;  1HBN B;  2ZH4 A;  3QO9 A;  3NOC A;  4PQU B;  3VGV A;  2GQC A;  2J0X A;  2G0C A;  3MTK A;  5GAD I;  1SC3 B;  3CC4 S;  3D0I E;  1P27 B;  1PYO B;  3W5Y A;  5ITH A;  2F5G A;  3SXL A;  2KXN B;  3IR5 B;  4X4P A;  2ZH1 A;  1T05 B;  4NCA A;  3IG1 B;  1JLQ B;  3V5R A;  2XLI A;  1Y5N B;  2JZ5 A;  2ASL A;  3CCJ S;  4JI1 F;  3JS9 A;  2XBP A;  1KRP A;  3EGN A;  3H0P A;  5K8O A;  5HVF A;  4DBQ A;  2AV5 A;  5KFY A;  1N5V A;  2QSF A;  2QE5 A;  3MM8 A;  4PRF A;  3RRG A;  2V9W A;  5LXR A;  1FO1 A;  2CNO B;  2X1A A;  3GIK A;  2FVR A;  3NKN A;  1UWB A;  1CEZ A;  1SV5 B;  4N8O A;  3TVZ A;  2CFX A;  4AFF A;  3QJL A;  2F8H A;  3RB4 A;  4PWD A;  2K1R B;  1FER A;  3FK4 A;  4ECQ A;  4RZR A;  1B0V A;  3E2E A;  3IWX A;  1FJC A;  3IAM 9;  4YHH J;  5I42 A;  2GSN A;  4DR7 F;  1HWL A;  2B7C B;  2JOQ A;  3FSY A;  4C4W A;  2ZE2 B;  1ZOT A;  4PCQ A;  3UVJ A;  2YKO A;  4CLS A;  1JLA A;  5F41 A;  2G0I A;  2HFS A;  2K3I A;  4U8V A;  2XMV A;  3J80 Y;  4DL4 A;  3CT9 A;  4MT1 A;  3UD5 A;  2DH7 A;  3H4B A;  1Q4R A;  1RA7 A;  3PRV A;  3J7A 1;  4LFB F;  4U7C A;  3IRX B;  5A8W B;  1JKH B;  3KUH A;  1KTQ A;  1RTH B;  2RS8 A;  3FNN A;  2XRG A;  5GOV A;  5B0D A;  5LRM A;  4Q43 A;  2VFR A;  3L09 A;  3TEG A;  3GSD A;  5KG2 A;  1YX2 A;  5HQ8 A;  2YWW A;  2R7O A;  1ZM2 A;  4DPW A;  3T5J A;  2UU9 J;  3PX4 A;  1X4F A;  2ZH9 A;  2W2N P;  4O44 A;  2HQC A;  4FXV A;  3IS9 B;  1W2I A;  1C0T A;  2HBR B;  3H20 A;  2VC1 A;  3GR0 A;  4URQ U;  4OI2 A;  3OL8 A;  3KLH A;  3VAM A;  4J9Q A;  5GAD U;  5HP1 B;  3QSI A;  3KJF B;  4ED4 A;  4HEA 9;  3QMQ A;  4KGK A;  2FZC B;  3TUJ C;  2VL1 A;  3KYL A;  2YPY A;  1JJ4 A;  3A52 A;  3ZZT A;  3CDW A;  4KJG A;  4LF4 F;  3AOC A;  2HHH F;  2DR6 A;  4H54 A;  4MKV A;  4OHX A;  2HK3 A;  4KO0 A;  1HQU B;  2VF3 A;  4LBP A;  3SMZ A;  3TR5 A;  1RAB B;  1YJ7 A;  2CJA A;  5A8K A;  4YB1 P;  2WK4 A;  3LWM A;  2ZM6 J;  4B9L A;  2M0G B;  3MED B;  3NS7 B;  5CH7 B;  5F8J A;  1N0U A;  4F02 A;  3W66 A;  2VBZ A;  1Q82 T;  1HI1 A;  3GCW P;  3MCM A;  2Y1J A;  2VBY A;  2J0S D;  3TAM A;  5ETL A;  2E9T A;  4TYB A;  4OZ3 A;  2F4V J;  2BAC A;  4WFA Q;  4MK9 A;  1LQ9 A;  2V2Z A;  4NLV A;  2A2C A;  1REV A;  5CZX A;  1IR0 A;  4AL6 A;  4ID8 A;  2IA0 A;  2D1G A;  1VYA A;  4QIF A;  4OZ0 A;  5L46 A;  3HX9 A;  3J81 Y;  3SIP B;  1WC5 A;  2OH2 A;  2OPS A;  2HIY A;  1HBO B;  3HI9 A;  5D0H A;  1H74 A;  3FEX B;  1IM4 A;  1Y5L B;  4JI2 F;  5J2N A;  2UVU A;  3RB0 A;  1EJ7 L;  1FK9 B;  4NA3 A;  1O8B A;  4DV1 F;  4FXW A;  2N82 B;  3JYT A;  2JEJ A;  4C8M A;  3EXY A;  1WOR A;  2DNL A;  2HMI B;  4USU A;  1VQ8 S;  4G3I A;  5ETS A;  2LDY A;  3AJ1 A;  2VAS A;  1WKJ A;  4F3M A;  1S1W B;  2YNH B;  3FZB A;  1V9O A;  3C14 B;  4K4Z A;  3IRX A;  1I6J A;  3JQM A;  2EWH A;  1YK9 A;  3BYR A;  2E5I A;  4U67 Q;  2KFN A;  1WWH A;  2GVD B;  3JAM U;  3GLJ A;  5RUB A;  3MCO A;  3ZTP A;  5GMD A;  1T11 A;  1LWC B;  3UVJ B;  3K0J A;  4O3P A;  3RAM A;  2VG7 B;  2DGW A;  3DXB A;  3UNG C;  3IMQ J;  4FXD A;  2L3M A;  2NYI A;  3UFC X;  3R5G A;  5DDQ C;  2M8H A;  2V8G A;  4WJB A;  5HVG A;  1WC0 A;  1EX8 A;  2X3D A;  4UOC A;  5K9F A;  4MIW A;  3N4W A;  3PXG a;  5I3U A;  2HIQ A;  3C3L A;  2DNZ A;  5F8L A;  3OFG A;  2CVI A;  3CCZ A;  4DR3 J;  2LEP A;  1Y0H A;  2FJB B;  3AB4 B;  3K17 A;  4OYZ A;  5F8M A;  3B78 A;  2BJ7 A;  5L9N A;  2XHC A;  3U02 A;  4E0D A;  3KG0 A;  3VAH A;  1PG5 B;  1NXI A;  4LRF A;  2OHD A;  3PEH A;  3SCK E;  1WG1 A;  2A10 A;  3DRP B;  4AUK A;  2WVF A;  2MGZ A;  1NSK L;  1LWE A;  3G96 A;  2W1B A;  3NLC A;  2VIH A;  5L1K A;  1BUX A;  1HR0 J;  1U2F A;  4LSL B;  5K14 A;  3K5N A;  1TKX A;  2FJA B;  1IKX B;  4F4W A;  2D9P A;  2BJ8 A;  4EZ6 A;  1EQM A;  1HBN A;  3IRW P;  1TFY A;  2EC0 A;  2UXC J;  4ZVP B;  1F9F A;  2DGV A;  1RT7 A;  2WZ1 A;  3UDL A;  4ID5 A;  9ATC B;  1FT8 A;  1XNQ J;  2I8E A;  3AD7 C;  4FYX B;  1Q81 T;  2CPI A;  1NJX A;  4HAC A;  2I2Y A;  3UNY A;  5EGE A;  4M5D B;  1H72 C;  4X65 F;  4X4N A;  1M90 T;  2HWH A;  4CLZ A;  5IT9 Y;  1RAJ A;  5DQI A;  1S4E A;  4DR4 F;  3G6X A;  1CBK A;  4UOG A;  4ZN3 A;  1RHM B;  2E1C A;  2LLZ A;  4Q45 A;  2VQF J;  4DFJ A;  4ZVR B;  1SXL A;  3O5T B;  2OLW A;  1TK5 A;  2FJV A;  3J7Y U;  1B7Y B;  1OY9 A;  2XCA A;  4C8Z A;  1EQ0 A;  2RS2 A;  3G2X A;  3MPY A;  4ZPB A;  1FVQ A;  3H5S A;  5DM6 Q;  3PW5 A;  1S6P B;  3A13 A;  1ZM4 A;  3RTV A;  1KLN A;  1RAF B;  5INH A;  1N5Q A;  1BQN A;  1LWF A;  3WAY A;  3RBX A;  3C15 A;  2B3T B;  2IA6 A;  1K0V A;  1MWQ A;  4PXE A;  4MKA A;  4NXN J;  1AFJ A;  1HDH A;  2QLJ B;  4YP3 A;  2ZDO A;  4O4G A;  2V6A A;  4K4W A;  2HKE A;  2DEI A;  4HHU A;  4M5D A;  5E3P A;  5F3T A;  3UDV A;  3D7S B;  3QBC A;  1F5B A;  4OZL A;  3G8T A;  3T01 A;  2HVH A;  1RWV B;  4YY3 J;  3PW0 A;  2MKS A;  2MQN A;  1HLW A;  3NL0 A;  4TLQ A;  5HRT A;  1KS2 A;  5KG7 A;  2H5I B;  3H2V E;  2M3D A;  2VFV A;  5D0R A;  4A8S A;  3JXO A;  5HVH A;  4DR2 J;  4M94 A;  4IO1 A;  1IKY B;  3ET6 A;  4YDX A;  3KLG B;  2DXE A;  3GFZ A;  1XEZ A;  4OX6 A;  1LK5 A;  1S9G B;  4G1I A;  2ZH6 A;  3MFH A;  5GMK a;  3LPE A;  3FDS A;  2ANH A;  3LXQ A;  3GJT B;  2KB2 A;  3E51 A;  1JLE B;  1X9M A;  1C0U A;  1CS4 B;  1ZM3 A;  4Y0F A;  5J1E A;  4MAK A;  3PR5 B;  3CO9 A;  3KJV B;  5IM0 B;  2GX8 A;  3KK2 A;  4IO9 Q;  1S7I A;  4WK3 A;  2QO3 A;  5KT4 A;  1SJ4 P;  3S7R A;  2P9E A;  3QNW B;  4CLL A;  2B8P A;  4DV5 J;  2IRU A;  1IUJ A;  2DIT A;  2PDA A;  3BV8 A;  4F67 A;  7AT1 B;  3DLH A;  2HNZ A;  2BZ2 A;  1TL7 B;  1KLM A;  4OJ1 A;  4P72 A;  1VQS A;  1BXN A;  1WC6 A;  1H0H B;  3N79 A;  3DOL A;  5D3G B;  4UOP A;  5TJ3 A;  2E1P A;  2D3O R;  1S59 A;  1CJT A;  1HNV B;  2YWF A;  3ENQ A;  5L1J A;  1BD6 A;  4LFC F;  2HHV A;  1WOO A;  2HGL A;  4PG7 A;  3JTP A;  2FJE B;  2XG8 A;  2HZA A;  2JLG A;  4KGV B;  3TJ9 A;  2BQ3 A;  2YKM B;  3LGN A;  5HMZ A;  1HNW J;  2N3O A;  3EJM A;  3J80 U;  2X7I A;  1RHU B;  4RUH A;  2OPR A;  3TRG A;  1P9Q C;  5THW A;  2QFJ A;  5HLF B;  2B9X A;  4DLG A;  2CQC A;  1T03 B;  3TW0 A;  2HFN A;  4X84 A;  4A47 A;  4DS4 A;  1B0T A;  2BOP A;  4QYZ K;  3IP0 A;  2C2M B;  2YBV A;  3DRX A;  1M5V C;  4KHP J;  4QYZ J;  1IVZ A;  2B9W A;  4DEZ A;  3OJU A;  5E3Q A;  3W63 A;  1VK8 A;  3ILO A;  1X5S A;  4O3O A;  1HNZ F;  1APS A;  1DAX A;  3H5U A;  5T7L A;  3V6D A;  1QSY A;  2N3L A;  1WHY A;  1ELY A;  2HGM A;  2RIJ A;  4B9V A;  1VMB A;  3BN7 A;  1RTJ B;  4L76 A;  3AHP A;  2PGC A;  2ZKU A;  4IFV A;  1SBR A;  4TY9 A;  1HNV A;  5LIA A;  2HVZ A;  3O1L A;  3PEJ A;  2ZH8 A;  2IC3 A;  3BDE A;  1S77 D;  3VWS A;  4X66 F;  1U2C A;  3SCI E;  4WZQ A;  1FDD A;  1RYR A;  1RT5 B;  2FD2 A;  1VHI A;  2I1R A;  2KVQ E;  2YNI A;  4WE1 B;  1KHJ A;  1HQ2 A;  5E7O B;  2DNG A;  2VJV A;  1XQI A;  2VUG A;  5ETK A;  2GMH A;  4HYK A;  3BKF A;  1O99 A;  5F9N A;  3WAV A;  1SC1 B;  2UUW A;  4M5G A;  2GJF A;  5BYS A;  3OPK A;  5F8H A;  2V8D A;  1ELO A;  3I9V 9;  3PX0 A;  5KAK A;  3TI0 A;  4V19 J;  4XAK A;  3EGV A;  1UP1 A;  4CYU B;  1HNX F;  1R6Y A;  3D6H B;  5C2G A;  4NXM J;  1MG7 A;  4DX5 A;  1IKY A;  3ET6 B;  1WEX A;  4BC7 A;  3CF5 Q;  2PI4 A;  1WNE A;  4ETX A;  2HYI B;  1VRQ C;  1VFJ A;  1IKW A;  1QVF R;  1X0P A;  2YH0 A;  4CNY A;  2VOP A;  2OTJ S;  2JFD A;  4TU7 A;  2P6S A;  4ZP8 A;  2VQE J;  2FGO A;  1C4C A;  1OIA A;  2HAI A;  3JSY A;  4F4Y A;  2XLJ A;  3PX6 A;  4J9L A;  1X4D A;  1TL7 A;  3AOA A;  2CNK B;  3W60 A;  2YWK A;  5ADZ A;  3HM9 A;  2EG1 A;  2L48 A;  2R2S A;  4F26 A;  2IM2 A;  3HD2 A;  4O4G B;  4F0K A;  4N8N A;  2AYG A;  4RKU C;  4ALZ A;  4JOU A;  2UVR A;  2O3D A;  2KN4 A;  2HK2 A;  5LXY A;  3BS9 A;  4HL9 A;  3DI6 B;  1JJ2 R;  2F63 A;  2P6T A;  2FZK B;  2XMJ A;  4PG5 A;  3MEG B;  3UI3 A;  2W7A A;  1S0O A;  3L7P A;  2ILZ A;  1HNZ J;  2JX2 A;  4DUT A;  4FYD A;  2E1A A;  3Q8Y A;  1S9G A;  3S6E A;  2RHS B;  3EWG A;  3LW5 C;  4CIO A;  2LDI A;  2FUG 9;  4P74 A;  5KFB A;  1K0T A;  5BXI A;  3K5O A;  3JTN A;  4ZIV A;  2DYA A;  2FDN A;  4OYI A;  4Y3C A;  5CAA A;  2N7Y A;  1L5U A;  1H73 A;  1RAH B;  3M6U A;  3HPO A;  3AFG A;  3PDN A;  4DV3 J;  1SV5 A;  2R42 A;  1SJF A;  3LAM A;  1D3W A;  4DG1 B;  4ZPC A;  1O51 A;  3GII A;  4MTP A;  4DLE A;  3DDI A;  2GA7 A;  2YH1 A;  4DQI A;  3KNG A;  2QA4 G;  5JMN A;  3VQS A;  1B7F A;  3DLE A;  1EET A;  1AZS B;  1DJ0 A;  1MRO A;  4KGM A;  4KT0 C;  2PSZ A;  2ALZ A;  4RX6 A;  3FBF A;  4FYV B;  4Q2M A;  4UPL A;  3HSJ A;  2RQ4 A;  1BQN B;  2IJF A;  4IG3 A;  5J1N A;  1SIZ A;  2DHX A;  1CQN A;  3VZI A;  3I6P A;  2B7B B;  1BMQ B;  4OJH A;  5IT9 U;  5B09 A;  3DRY A;  1IKX A;  1XNR J;  5F0W A;  2JJ4 D;  5IXU A;  4FBT A;  2NR0 A;  2B6A A;  3M8Y A;  2YWH A;  1IN0 A;  1U6Z A;  3GB0 A;  3QO9 B;  4C11 B;  1IBM J;  1WTB A;  1T0T V;  2HFV A;  4NLP A;  2RHQ B;  2GW8 A;  3R5J B;  4KFB B;  1XC9 A;  4X64 F;  4B9T A;  2ATC B;  4YR0 A;  3LGM A;  3CMQ A;  2DR8 A;  3QGG A;  5DDP C;  4TQS A;  4JI7 F;  3MUM P;  3HK2 A;  3FMB A;  3D3C J;  4I64 A;  3HCX A;  5ETR A;  3KG4 A;  2ZOF A;  3JAM Y;  2OSR A;  3MUV P;  4GKJ F;  3ZZO A;  2YNG A;  1RT3 A;  4I7F B;  1NHU A;  2UV8 G;  3KHG A;  2YQ1 A;  1L3T A;  3DGV A;  2DVI A;  4RNH A;  4LQ9 A;  5DJB A;  1K1S A;  4RBT A;  2AT1 B;  1X5T A;  5KG4 A;  2CYY A;  2D1C A;  4LJM A;  1DQA A;  5KFF A;  3ZNJ 1;  3QFH A;  3J7Y I;  1N6Q A;  2UUA J;  1F0X A;  1HIY A;  4D3H A;  5HQL A;  3SSR A;  3K5L A;  2LEC A;  4FF4 A;  3DXS X;  1RKI A;  2CJB A;  3TA0 A;  3QAT A;  2VC0 A;  1CC8 A;  2P8I A;  5G0R A;  5HBM A;  4F25 A;  1AJB A;  1BGX T;  3KG1 A;  1YIJ S;  2RDJ A;  2AP6 A;  3WC0 A;  3VAF A;  1LFW A;  1HKA A;  4XDC A;  2BKO A;  2F8E X;  3KHL A;  2B9Y A;  2YNH A;  2YPZ A;  1HNI B;  4OI6 A;  1UTA A;  1E6V B;  1HHQ A;  4FDI A;  1MMD A;  4EI2 A;  3JQJ A;  2AGO A;  3BKU A;  5LQQ A;  2RDI A;  2GGP B;  2QEX S;  1YKW A;  3V6H A;  2KG1 A;  3PYG A;  9RUB A;  1MMN A;  2LXI A;  4PWD B;  2RVJ A;  3BQ2 A;  1FRM A;  1WHX A;  1K1Q A;  4NCG A;  3V4M A;  3OVA A;  4CYS A;  2PT0 A;  2W2P P;  5AJ3 F;  3NGU A;  1DHM A;  3HKW A;  3TOQ A;  4RWX A;  4K50 A;  3GON A;  2DIV A;  3TZZ A;  1HNW F;  3Q8V A;  3R7N B;  2GSO A;  2EFG A;  2P9G A;  3H59 A;  3QZ7 A;  2BE7 D;  4OLO A;  4DR5 J;  3CCV S;  2WVB A;  1HQE A;  4OYM A;  1S5Z A;  2HHP A;  4DX7 A;  2OD6 A;  4DL3 A;  2M2B A;  1RWK B;  2YX4 A;  3J81 U;  3DI6 A;  4AND A;  5KFX A;  1L3V A;  1AUK A;  3CJQ A;  4X62 F;  2MLZ A;  1RWW B;  2Y8Y A;  5KFE A;  1QE1 A;  2BAN A;  4QZV B;  4CO2 A;  5F0U A;  4IKA A;  4KO0 B;  4ENO A;  4DR3 F;  1IBL J;  2YKN B;  4RW6 A;  2EI5 A;  1V3S A;  3P4U B;  3PYF A;  1WDD A;  2Q79 A;  3MM6 A;  1YJN S;  1N34 J;  3J7A N;  1FKO A;  1HWK A;  2XZD B;  5T41 A;  3K57 A;  1VRT A;  3CJ0 A;  4EK2 A;  4OFZ A;  4RBV A;  4K4X A;  2M8D B;  1UZD A;  3QYY A;  4DUZ J;  3U7J A;  2UUC F;  4QW8 A;  4DPU A;  4ETZ A;  3CJ5 A;  4B3M J;  4DV0 J;  1U1N A;  4CP5 A;  2PEB A;  4P73 A;  1JWW A;  1EJJ A;  1VRT B;  2CA9 A;  4DU8 A;  5IWA J;  3SQG A;  1NDP A;  3GJQ B;  2XLK A;  2HRY A;  3Q2S C;  4WP8 A;  3OFF A;  4I2P B;  3QT8 A;  1NZA A;  3F56 A;  3QIP B;  4X2B A;  1QM9 A;  2HBQ B;  4FPR A;  4B3O A;  2GIQ A;  1Y3J A;  1UA1 A;  4QU6 A;  1YZ7 A;  3QQC D;  4LR9 A;  2MST A;  3ZNU A;  1IWA A;  4LF6 J;  2DNH A;  3OR2 A;  3SEO A;  1VLO A;  5GAH I;  3TJA A;  2DO0 A;  4AE5 A;  2EVZ A;  3L95 X;  4U7U K;  4DQR A;  2C1E B;  1T9T A;  2KFY A;  2CG8 A;  3KLI B;  3OT9 A;  2RF2 A;  5DGB A;  1ED8 A;  4NL5 A;  4B9S A;  4J9N A;  1SC6 A;  4E2F B;  4XDD A;  5AJ9 A;  4JBC A;  3ELH A;  2IMW P;  1RKJ A;  4H4K C;  3P96 A;  4CT8 A;  3TA2 A;  1RHK B;  2P2C B;  5KFD A;  4DPX A;  1CJV B;  1RTZ A;  1YRX A;  2F3J A;  2AJ4 A;  5HK4 A;  4Y28 C;  5D0E A;  1WI8 A;  3U1M A;  4A46 A;  3GR1 A;  5IJS A;  1VHF A;  2CAD A;  2J9E A;  1G7C B;  4ZPW R;  1XR7 A;  4URG A;  4ZLJ A;  4ECW A;  2XNQ A;  3MOJ B;  2LQJ A;  5KFG A;  4CH7 A;  4WPA A;  3I55 S;  3MZI A;  5KOW A;  1GX5 A;  1Q5Y A;  3N6L A;  1LNQ A;  4OV6 A;  2C3Y A;  3MR2 A;  3OTB A;  3CJ8 A;  1YQH A;  3SBM A;  4JI1 J;  4DQS A;  1TZ0 A;  4PXD A;  1U0H B;  2IVY A;  4R8U A;  1N5Y B;  1WKL A;  2IM3 A;  2E7W A;  4RW4 B;  3FRY A;  1SKR A;  4LUB A;  3QRP A;  4DV6 F;  2POK A;  2R2U A;  4IRD A;  5B7W A;  2MQP A;  4C48 A;  4CLY A;  1FXL A;  1F1B B;  4F04 B;  2ZOG A;  2I6W A;  4N56 A;  3DMJ A;  4OYX A;  4A8X A;  2C22 A;  1PSD A;  1CJT B;  1SJ1 A;  2FJD B;  2FLL A;  3OVB A;  3W5Z A;  2HHS A;  4JV1 A;  1Q86 T;  3C46 A;  5I3P A;  1CUL B;  1NZ8 A;  5D3G A;  4HHJ A;  3RG6 A;  3QGH A;  3DYA A;  1IR1 A;  3PFE A;  3NGK A;  3VAL A;  4RW7 B;  1JLF A;  3WDO A;  1N32 F;  1UW4 A;  1TL4 A;  2QL7 B;  1W26 A;  2MYF A;  1WHW A;  2O66 A;  3G4S S;  1U2R A;  2VIC A;  1H2T Z;  2H48 B;  2QYC A;  1FJE B;  2NXU A;  3TUZ C;  1HWJ A;  4DL6 A;  2DGO A;  2QIF A;  1X4G A;  3R3T A;  1IBM F;  3CWJ A;  2CDQ A;  1SKS A;  2C3U A;  3DLL Q;  1X5P A;  2CZ9 A;  7FD1 A;  3CDA A;  5EGY A;  4P52 A;  3CUL A;  2W5V A;  5KT6 A;  5B0F A;  3IDD A;  3MK2 A;  2DIU A;  4ZPV R;  1RT6 A;  3P8B B;  4KGZ B;  5B0G A;  1FFS B;  2W2M P;  1PC4 A;  2XYP B;  3OHB A;  4IQX A;  1MNE A;  2V4R A;  1S1X A;  2OUG A;  4CYR A;  2YKQ A;  1AZS A;  1GQE A;  2Y1L B;  5DQG A;  2J7U A;  2AW0 A;  2V0N A;  3RR7 A;  3D6F B;  4NLQ A;  1TKZ B;  5LT5 A;  1S9E B;  3ENV A;  4ZP9 A;  2UXB J;  4W90 B;  3LP2 A;  2KHD A;  3SSQ A;  1JIH A;  1KVI A;  3M2R A;  4M5K A;  2Q1L A;  1EZZ B;  2DY1 A;  3MD1 A;  1NK0 A;  2HHQ A;  3DYC A;  3EMT A;  3L9Z A;  3TWZ A;  5IZH A;  3K59 A;  5HO4 A;  3BO4 A;  4K4T A;  3QLH A;  3H98 A;  3PAC A;  8RUC A;  1G4C A;  1SUQ A;  2L08 A;  3JSM A;  2RRA A;  4MKY A;  3FVY A;  2CIM A;  2V4J A;  2VG6 A;  3MPD A;  4MIV A;  2NUU G;  4N41 A;  3D0H E;  1UJ4 A;  4LF8 F;  1RAI B;  4USJ C;  1ZA1 B;  3CCR S;  4O3R A;  4YFU A;  1NHV A;  1NPP A;  2QA4 S;  2D9O A;  2VG6 B;  3M8P B;  5IQ6 A;  2AKW B;  2R7V A;  3M30 A;  4A4J A;  4J9S A;  1YBA A;  4GTY A;  3FSX A;  2J76 E;  4QU7 A;  3RRH A;  4W4M A;  1RHJ B;  1YBU A;  3N9U C;  1LXN A;  3R8Y A;  5EHH A;  2C2E A;  3QWP A;  1AT1 B;  2MSS A;  3FCH A;  3TA1 A;  1N36 F;  1GT8 A;  4CXU A;  2W4C A;  1MU2 A;  2VG5 B;  3M7V A;  4GMK A;  4FS1 A;  2XNR A;  4XTT A;  1GK8 A;  1NSQ A;  3GIR A;  3DYA B;  2AJ0 A;  3P5B P;  1XR6 A;  4N77 A;  3PZP A;  3NKM A;  3AJD A;  1S6Q B;  4WP9 A;  3FBC A;  4RNM A;  2XO7 A;  2KDO A;  5M2U A;  5KFR A;  2WBM A;  4IOB A;  3ZZY A;  3DMJ B;  1UVJ A;  2HHX A;  1OPZ A;  1OWX A;  4QJV A;  2VJU A;  2NXE A;  1LFP A;  1UPM B;  4ED6 A;  3GWC A;  1S0N A;  4Q0B B;  2XYH B;  4ATN A;  3UO0 A;  3V81 B;  3DM2 B;  2DH9 A;  2GC8 A;  5LSR A;  2G1H A;  2NCK L;  3G8S A;  1IBK J;  4HKQ A;  3M2U A;  2W9C A;  3T5K A;  1JLB B;  1RTD B;  2HBZ B;  1ELZ A;  1KON A;  2HVE A;  2IYI A;  2J6S A;  3HZE A;  4L3K A;  3CD5 A;  2YKA A;  2OMO A;  1WSV A;  4AXI A;  3EDR B;  3A8K A;  3MAA A;  2MKJ A;  3R5C A;  5L0B A;  1VR6 A;  3QWU A;  1R8P A;  3CVK A;  2EG2 A;  4NRT A;  4RW9 B;  5AXL A;  2HLU A;  3HF5 A;  4ZLP A;  2GJI A;  3I56 S;  4J9O A;  4KY3 A;  1BY9 A;  3TQ1 A;  5F8G A;  1U1K A;  1HI0 P;  4QBU A;  1TVR B;  3SCL E;  3CCE S;  3TAN A;  3NS5 A;  4K2J A;  5D78 A;  1DLO A;  2QRR A;  2VON A;  3NKY A;  1SPB P;  3H8Y A;  4DR6 J;  2IDL A;  2KU7 A;  4DV0 F;  4GVB B;  4HR2 A;  1KN6 A;  1Y5I B;  4KB7 A;  3OLB A;  6FDR A;  3L3C A;  3M32 A;  2VG7 A;  3BSC A;  3F44 A;  3MMA A;  4HH0 A;  4MH8 A;  3T3F A;  4ZVO B;  3V6D B;  1VQ6 S;  2AIR B;  3VGT A;  4KR0 B;  2RF2 B;  1HNX J;  4QPT A;  3MM7 A;  1FWK A;  3OR1 A;  3LP0 B;  3KLF B;  3PHT A;  3N0V A;  3PRB A;  3G6V A;  2AZ1 A;  3Q23 A;  1YJU A;  3N5B A;  1UJ5 A;  4NYP A;  1PC5 A;  3MEC B;  4P7T A;  4JYA F;  1IM6 A;  1NAQ A;  2ZUA A;  4NLG A;  3MF5 A;  4HT7 A;  3FSI A;  2J7K A;  2M5Y A;  2Q6B A;  2OPR B;  1XIQ A;  1QAX A;  1VIO A;  4NLD A;  4QWA A;  3SQG B;  3NS6 A;  4DQP A;  1HBO A;  2XI3 A;  2OPS B;  5J2N B;  4DI6 A;  5ETT A;  2DH8 A;  5A6W A;  2IAJ B;  3FBE A;  2BRK A;  1LK7 A;  3C6U B;  3EDQ B;  2B51 A;  3MMC B;  2QA2 A;  2Q43 A;  1FEH A;  2DNM A;  2KJW A;  4OMF G;  3HMJ G;  4NMX A;  3MOZ A;  1JB0 C;  1EAR A;  1RHQ B;  4HT5 A;  4J9U E;  2YKN A;  4RW6 B;  2G2Z A;  1RSC A;  1RAD B;  3DOM A;  3OV7 A;  2DRA A;  2G2O A;  2BVZ A;  1X4E A;  1YRU A;  4YN3 B;  4NCB A;  3G87 A;  1D9D A;  1W25 A;  1R43 A;  1XER A;  1YVF A;  2X1G A;  4NLO A;  3RBE A;  5CQG A;  3U1N A;  3KLE A;  3E01 A;  1YJT A;  4KGX B;  4CTA B;  1AYE A;  2RU3 A;  1VC5 A;  3BDG A;  1RU1 A;  2W9C B;  3M2U B;  2HAF A;  3BRE A;  4J5O A;  3VGU A;  3KLG A;  5MLC V;  1AFI A;  2MZR A;  2L9W A;  4S0M A;  2XZT B;  1VDH A;  2VBW A;  5HI7 A;  5C5J A;  2AYM A;  3KJQ B;  1KHN A;  2E66 A;  2W5S A;  4TN0 A;  2ZNY A;  4TNO A;  4QR0 A;  1M0S A;  3LWL A;  1OYD A;  3TZY A;  2F4F A;  5FDL A;  4PWU A;  3UN3 A;  2COL A;  1S0V A;  1SH3 A;  4NCG B;  2IDE A;  3QRR A;  1FTC A;  1BWV A;  2V2V A;  3B4M A;  7FDR A;  2M88 A;  3NEK A;  5J2M A;  1RWX B;  2AQ4 A;  4XO0 A;  1HMV A;  5KFJ A;  2UUC J;  4PG4 A;  4XPE A;  3NCP A;  3NWG A;  4CQ1 A;  5DZ6 A;  1T8E A;  2HBY B;  1KHV A;  1QE1 B;  1RAA B;  4MIB A;  2ZH5 A;  1N48 A;  2ZHA A;  2LU1 A;  2YNF B;  5ETV A;  2R7W A;  5DGA A;  3C15 B;  1EW9 A;  3FFI A;  2DT9 A;  4OYP A;  4QOT A;  4DV2 J;  4KH0 B;  3MTJ A;  3JB9 k;  4ZVE A;  5DRK A;  1XN9 A;  1JLA B;  3IC1 A;  4NOH A;  2VKZ G;  5G0R B;  5HBM B;  5J2Q A;  2NXC A;  2LVW A;  4WYW A;  1RUS A;  1J5O A;  3KDN A;  3MGJ A;  4I69 A;  2XYG B;  3BEG B;  4YHH F;  3T02 A;  2HFZ A;  2O5D A;  4FZV A;  4O0N A;  2E7X A;  3JSM B;  5DLV A;  3EYZ A;  5J2P B;  3MR5 A;  3U27 A;  1P1L A;  2DGQ A;  3DCA A;  3OW2 R;  5E2Q A;  5U47 A;  4B17 A;  3SI8 A;  1Y7P A;  2MKY A;  2G0J A;  1WAC A;  2QGF B;  4LVN P;  4DX8 H;  1Q1K A;  2DO4 A;  3AH6 A;  3PJX A;  5E41 A;  1YWX A;  4KH1 B;  3WAW A;  1Q16 B;  5KFS A;  1VBK A;  4KSE B;  3TQE A;  3G82 B;  3DOK B;  4DOZ A;  1AW0 A;  4BS2 A;  2GSU A;  4OX7 A;  1X4B A;  1HHS A;  4LFA F;  1UPP A;  4ZLL A;  4IQM A;  4J9V A;  2YNF A;  2IMO A;  4CZC A;  3RW7 A;  1FX2 A;  5DDR C;  3KMQ A;  1TL3 B;  2VFT A;  3RB6 A;  1PBA A;  1LXJ A;  2KRB A;  2RE1 A;  1N2L A;  1YDL A;  4PQU A;  2DEJ A;  1PAU B;  1OYE A;  1FXD A;  1FRX A;  1RT1 B;  3P49 B;  2HSE B;  2VKR A;  4PWW A;  4EGL A;  3M8R A;  1IJF B;  3VF0 B;  4ELV A; 
#chains in the Genus database with same CATH homology
 1EI6 A;  4NWX A;  1ANI A;  3WBH A;  3UN5 A;  1KHK A;  4CXK A;  4FDJ A;  2VQR A;  5L0K A;  3BDG B;  3SZZ A;  3NVL A;  5DLT A;  4LRE A;  2W5Q A;  1ZEF A;  4B56 A;  2QZU A;  4LRA A;  3NKQ A;  3T02 A;  1KH5 A;  4NWJ A;  1P49 A;  3M8Z A;  1AJB A;  1EW2 A;  2W8D A;  5IJQ A;  3B5Q A;  1ZEB A;  1E1Z P;  1ELY A;  4LRC A;  1N2K A;  3T00 A;  1ALK A;  5C66 A;  1B8J A;  4FDI A;  4LRF A;  5LIA A;  5LQQ A;  5EGH A;  1SHQ A;  2G9Y A;  1ALI A;  1KHJ A;  1Y6V A;  3MK1 A;  1E2S P;  1ELX A;  2W5V A;  3NKN A;  3NKR A;  5GRR A;  1O99 A;  4LR7 A;  2W8S A;  3IDD A;  3MK2 A;  4CYS A;  1EQJ A;  4KJD A;  2RH6 A;  3BDH A;  1ALJ A;  2GLQ A;  2GSN A;  4LR8 A;  4UPK A;  2GSO A;  4CYR A;  5EGE A;  3UNY A;  3BDG A;  3TG0 A;  1E3C P;  3SZY A;  5K4P A;  4UOR A;  4YR1 A;  3TWZ A;  1KHN A;  1ALH A;  1AUK A;  2W5S A;  4TN0 A;  2XRG A;  5GOV A;  5LRM A;  3NKO A;  4GTW A;  3UN3 A;  3NKP A;  4ZGA A;  4GTX A;  1KH9 A;  4MIV A;  2IUC A;  4CXS A;  3CMR A;  4LRD A;  2XR9 A;  2GA3 A;  5INH A;  4GTY A;  4ZG6 A;  5LRN A;  3WAY A;  4N7T A;  4KAY A;  4KAV A;  4KM4 A;  1EW9 A;  4UOO A;  1EJJ A;  4CXU A;  3Q3Q A;  5IJS A;  1HDH A;  3A52 A;  3M7V A;  4MY4 A;  1HQA A;  2ZKT A;  3IGZ B;  4KJG A;  1FSU A;  4ZG7 A;  3T01 A;  2IUC B;  1AJD A;  3NKM A;  3WAV A;  1K7H A;  4LQY A;  5DLV A;  4LR9 A;  1E33 P;  1O98 A;  3DYC A;  2X98 A;  3BDF A;  4LRB A;  3UN2 A;  1HJK A;  2W5R A;  5DLW A;  5HRT A;  1ED8 A;  3DPC A;  2W5T A;  3OT9 A;  3UO0 A;  2W5X A;  1SHN A;  4UPH A;  3WAW A;  1ED9 A;  3IGY B;  3ED4 A;  2ANH A;  3LXQ A;  4GTZ A;  5AJ9 A;  1ELZ A;  1KH7 A;  2D1G A;  2GSU A;  4UPI A;  4ZG9 A;  1EW8 A;  5L0E A;  4LR2 A;  2IFY A;  4UPL A;  3WAX A;  3MK0 A;  1ANJ A;  1KHL A;  4MHX A;  1KH4 A;  5L0B A;  1Y7A A;  2W5W A;  3E2D A;  1N2L A;  3TX0 A;  5KXA A;  1ZED A;  3M8Y A;  3M8W A;  1URB A;  1AJC A;  1URA A;  4QAX A;  1AJA A;  4UOP A;  5TJ3 A;  3KD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...