4LRBA

Phosphopentomutase s154g variant soaked with 2,3-dideoxyribose 5-phosphate
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTGADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 146
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrbA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrbA01
4LR9A 5EGEA 5IJSA 5L0BA 1URAA 1ZEBA 3UNYA 2ANHA 3B5QA 4LR8A 5LQQA 4UPLA 1Y6VA 1P49A 1O98A 3M8WA 2GSUA 3NVLA 4MY4A 1KH4A 3DYCA 5L0KA 2XR9A 2IFYA 1ZEFA 5K4PA 1URBA 1SHQA 2W5SA 3TWZA 2ZKTA 2W5VA 3MK2A 3KD8A 3IGZB 4YR1A 1AJAA 3NKOA 1KHKA 4UPKA 3T01A 5DLWA 1HJKA 1ALHA 3BDHA 4MHXA 1N2LA 5INHA 4KM4A 2W5XA 2QZUA 1EQJA 3BDGB 2X98A 2GSNA 4B56A 2IUCB 2VQRA 3WAWA 3WAYA 4LRAA 3UN5A 4LREA 1ED9A 1ELXA 3WBHA 1KHLA 3M7VA 4CYRA 5L0EA 4LRCA 1EW2A 5DLVA 2GLQA 1AUKA 1K7HA 1EI6A 3T02A 3M8ZA 1EW9A 1Y7AA 3IGYB 2IUCA 1EJJA 3BDGA 4N7TA 4TN0A 1HDHA 1KH5A 4KJGA 1E3CP 2W5TA 1KHJA 5LRNA 4KAYA 1AJBA 4KAVA 3UN2A 1E33P 2GSOA 3NKQA 4QAXA 5KXAA 2W5QA 3UO0A 4CYSA 1B8JA 2W8SA 5HRTA 5IJQA 3OT9A 4LR2A 4KJDA 1AJDA 1N2KA 4GTZA 5GOVA 4GTWA 3WAXA 1ED8A 3NKMA 2W5WA 3TX0A 3M8YA 3MK0A 4UOOA 2G9YA 3BDFA 3T00A 4FDJA 5DLTA 1ANJA 3UN3A 4CXUA 3SZZA 4LQYA 3NKRA 5AJ9A 4ZG7A 1ANIA 3ED4A 1ELZA 4ZG9A 3Q3QA 5EGHA 2GA3A 1ALJA 4MIVA 2D1GA 1SHNA 3DPCA 4LR7A 4LRFA 4ZG6A 1KH7A 4ZGAA 2W5RA 3TG0A 1ALKA 4UPIA 1ELYA 4LRDA 1ALIA 3SZYA 3NKNA 1E1ZP 5GRRA 3LXQA 1O99A 4NWXA 4NWJA 5LIAA 1EW8A 3IDDA 4UORA 4CXSA 4UPHA 5C66A 1KHNA 2W8DA 3CMRA 3NKPA 4LRBA 1AJCA 4GTXA 3MK1A 3A52A 2XRGA 1E2SP 1KH9A 4CXKA 1HQAA 4UOPA 5TJ3A 1FSUA 1ZEDA 2RH6A 4FDIA 4GTYA 3WAVA 5LRMA 3E2DA
chains in the Genus database with same CATH superfamily
1YJUA 1SL0A 4NRUA 4CO1A 3P8BB 4BHQA 4YHHF 3VAHA 1JLCB 2O1PA 4F04B 4C6AA 4V19J 1O8BA 4H4KC 2RHQB 4DSJA 4H54A 3GJSB 4YEAA 3CB4A 1T7PA 2CQGA 2XI3A 4R25A 4OHZA 2VDIA 4D3HA 1HBNB 3M8WA 5CYMA 3W62A 1F9EB 3DLLQ 2CJBA 1BQNB 2VFUA 4KRWA 4LFCJ 2XGPA 4K4UA 2OJ3A 2RQMA 3IGNA 1KQKA 4G6VB 5L39A 3V6JA 5J2QB 2XR9A 3U1LA 5L0KA 5K4PA 3TUIC 2YNIB 3MCMA 1OO0B 4DG1B 5C24B 5K20B 3SV4A 1HR0F 3FMWA 1WG4A 1NPKA 1HBOB 3BQ1A 5HP1B 3MR2A 4HACB 1RT6A 2A3JA 1VQ9S 5M2PA 2UUAJ 4GVBA 4ELTA 3VGUA 1QY7A 3BDGB 1KOHA 1ZA1B 5HBMB 3DU6A 4HT7A 1PYSB 3UDVA 4B9UA 4OHXA 4IRDA 2AIRB 4DUYF 1TKDA 4DPWA 3MTJA 4JI2J 4LREA 3AJ1A 4BCAA 3JSYA 2BJ8A 1X4FA 2YWWA 3VAIA 4ECYA 1QE1B 4DR3J 1QAYA 2UUWA 5GADI 2AF6A 1HIYA 4B02A 2KHDA 1EKSA 2VG5B 1CULA 4NEZA 5FIIA 3PZPA 3A3PB 2BQRA 2R9LA 2FVRA 3UW1A 4N8NA 4JUZA 1HDHA 5J2MB 4YY3F 3BSCA 2B4UA 4WYLA 4TLRA 1VC5A 3CC7S 5AT1B 1TL3B 3T1AA 3G8SA 1FRJA 3VR1A 1GNKA 3M32A 4DQQA 2OSRA 3IR6B 4Z2XA 1XNQJ 3P49B 2EPIA 2AJ0A 1HL6A 2IM1A 4LBIA 1WC5A 2XMAA 2CQ0A 3LOUA 3ET6B 4L72B 2KHCA 1X9SA 2WSEC 4YR0A 3BN4A 4NLWA 4NA1A 4C7QA 2GJ2A 2MKCA 4CZCA 3D3CJ 1VOMA 2VIHA 5D3GA 1PJ7A 3AJ2A 3O2IA 4TVAB 3NKMA 3HI9A 1SJ1A 1T11A 1CBKA 3W2VA 4EK2A 1AUSL 2L9WA 3HXMA 1IKXB 4DL4A 3HMJG 5CXTA 3MK0A 1OY8A 2R7SA 2N3LA 3N0VA 4P2SA 4PPDA 4IG3A 4O3PA 3H40A 2R8IA 4JI0J 1VQ6S 5KG4A 1D8ZA 2B9WA 1MWQA 2WHOA 2MGZA 4BC9A 2CPZA 1IKWB 4UPLA 1E6YA 4J5OA 2PEHA 2ZHOA 3HD2A 4NLSA 4PG5A 4X4PA 2D9OA 3ZZYA 4IG0B 2XC9A 1VI7A 2VU5A 2F40A 3P45B 1Y5IB 1Q8BA 2C2OB 3IA0A 2R8KA 4O3SA 1KN6A 1LWXA 3K17A 2OGUA 3T41A 5H9EK 2DNMA 3M2VB 1SIWB 3JSBA 4U96A 2EK1A 3VZHA 2MQPA 2P5VA 2HHQA 5F3TA 2VBZA 4DV0J 1UEUA 4RWXA 2B6AA 1Q7YT 4P75A 4NYOA 1WOSA 4X84A 3E01A 3WX8A 1FK9A 1HNWF 1EP4B 1VQOS 1C1BB 4N41A 2HQDA 2E5JA 2JC1A 3VHQA 3O8WA 5IOLA 5DLGA 5C66A 2QA1A 4K2XA 4CYUA 1DTTA 2OTLS 2RNEA 4KJIA 4M5MA 2B4VA 4NLQA 1SBRA 1Q53A 4WU2A 3N79A 4DQSA 4C8OA 2C2DA 4K4SA 2JOQA 2MZQA 3V6DA 2HMIB 2MB0B 4P9SA 2V94A 4JI4F 2M70A 2NZCA 1BQNA 1NHKL 4ZVGA 5T7LA 2VDHA 8AT1B 1A0OB 4CLUA 1E6VB 2J8SA 5BR8J 2RH6A 1FVQA 3W9HA 2XCPA 2DGWA 2XQCA 3E2DA 3KUHA 4CLLA 2YNIA 4OYMA 5C24A 3AH6A 1RT3A 1JXVA 1YRTA 3MI7X 4OIXA 4K4TA 4DFPA 2AU0A 2OSQA 2VFSA 4J7CA 2VFRA 2JWNA 3OTCA 5A0YB 2ZBPA 3HVTA 4DQIA 4ZP8A 3Q8YA 4OZNA 4J90A 5HBMA 4MY4A 1QJHA 4IQMA 5HVHA 3K5MA 5DO2A 4DR5F 3GQCA 2A0FB 1BWVA 4C11B 1S9EA 3CJTA 2Y8YA 2MZ1A 4AXJA 2LEBA 3CDAA 1N5VA 3SEOA 4H4KA 5HANA 1RAAB 3KUGA 4EUVA 1QE1A 1XMBA 2QMXA 2EFQA 4Q5VA 5DGAA 3NKOA 1LK7A 5ETVA 4U67Q 5B0CA 4MHXA 2CVEA 4MMOA 3ZNUA 3UPFA 5RUBA 1U4BA 4NI2A 4NLDA 2KO1A 1RSCA 2V9KA 2JSXA 4W90B 4EO8A 2HHSA 4Y28C 2QIFA 3RAMA 5ETKA 1VCTA 4Y65A 5ITHA 2R2RA 1U1LA 2OD4A 2K7KA 3OW2R 1X9WA 1X8DA 3FSXA 4IO1A 3WBHA 3JQJA 2ZBRA 2CKWA 2W4PA 5DLVA 2GLQA 1R0AB 5F3ZA 1FHTA 3EICA 2XTJP 3KJNB 5L1KA 3NCPA 2X1BA 3IGYB 2XZTB 4KHPJ 5KT5A 5GMKa 2HHWA 3AOAA 1FJ7A 3TYTA 4PQUA 1K1SA 4QPTA 2PE8A 1N36F 4ID8A 3LP0B 4LUBA 3TX8A 5ETLA 2C2NA 4DSLA 1IVZA 1NKBA 1RTIB 2GVDA 4LFBF 3C6UA 1TL7B 5DETA 1RAEB 2XNQA 3NKQA 1IBMJ 5FD1A 5KFLA 1UVIA 2CQBA 1T9YA 1RTHB 1Y00A 2QJ3A 3H5UA 1LXJA 3QT6A 1FJEB 1VQ4S 1CVJA 1B8JA 5HRTA 2MLZA 5EWFA 5CCMA 3T5HA 4JYAJ 1RB0A 3POTB 1J5EF 1NDLA 4K5SA 1TL7A 4X4TA 1X4CA 5LSOA 1B70B 2FY8A 2BRLA 1TKTB 1TK8A 3CEDA 1HW9A 4P52A 5T7LB 2Q6CA 2DHGA 1KHVA 1K9MT 2OPSB 4OLOA 2RKIB 2XBPA 1UVKA 3M2RA 4IFVB 5JVHQ 3PFOA 4NRTA 3ETOA 2XNRA 2BDPA 2CPDA 2I8EA 1FD2A 4M5DA 1DQ8A 4ZP6A 4FS2A 1MNEA 3EPIA 2NPFA 3OVBA 2R8HA 3E2EA 5IQQA 1C1BA 3SQGA 5IT4A 1HQUA 4DL7A 2H5IB 2DNOA 3FCWA 4NXNJ 3HFVA 3L9ZA 5ETRA 4K2JA 2CZ9A 5HQ8A 3DNCA 3HHEA 4LF5F 2MTLA 1S1UB 2GNKA 3M1VA 1HHQA 5F0WA 4LFAJ 3MR3A 3IGVA 3ONQA 4P73A 4UPIA 1RGVA 5JUMA 2XYPB 2NXEA 3BGFA 4O44A 5KFHA 1LEOA 4B9NA 1AFIA 4FDIA 2ABYA 2ZH1A 4ZDNA 4WFXA 3CC2S 1U1PA 1Y3JA 4CM2A 4NWJA 2NSCA 4JV5F 4DF4A 4LMZA 3LAKA 4JOUA 4DEZA 5L1JA 4ED1A 3CTRA 3NKPA 2ASYA 3K7RA 3J80U 1XN9A 2YKPA 3R9LA 1HFEL 3V4IA 2AP6A 5CZVA 1LKZA 1TUVA 3NAHA 5I4MA 2HVIA 3G4SS 1XC9A 1T8EA 1P1TA 4X4OA 3GJRB 1HQAA 1XQIA 4JV5J 1GTEA 2QC3A 2HFVA 3L7UA 1DFDA 1U09A 2DIVA 5LRMA 2QA4G 2RS8A 2OPPB 2ZHBA 4IG3B 2HRUA 2K1RB 1TL3A 3CD0A 2K8GA 2M3DA 1YZ7A 4KFBA 1HI8A 1FEHA 4DFMA 2M9KA 3QATA 5DGBA 4OI0A 3SSQA 3BJYA 1X4GA 2LMIA 1VMBA 1HI1A 2JLEA 2CPJA 1C0UA 3AQPA 3R7SB 1PSDA 3TEHB 2RF2A 5D15A 4ZLPA 2H5EA 2GSUA 4ZVOB 4LF4J 2UV8G 1N5TA 5E5NA 1QAIA 3DI6B 2EW9A 1NJZA 1SJQA 1LFPA 1OPZA 2W4CA 3LPEA 4WFNQ 3MEEB 4M63A 4OI4A 4NCGB 3K2YA 4F3QA 3IGZB 3D1OA 1GX6A 3PDNA 4OYZA 5L9NA 3OVAA 2CJXB 4R8UA 3KK1A 2B6AB 4AUKA 2UUCJ 2ZKUA 5F8NA 3OR2A 1U49A 2R8JA 5CD4A 1NXIA 4KV8B 4LF6F 2XG8A 1UJ4A 4B3TJ 4LVOP 4MFBB 1H38A 1ZH5A 3OR1A 2VASA 2BUNA 2BMBA 2R7XA 2W2PP 5K14B 1SKSA 1R8PA 2F4VF 4JI1J 4CYRA 4I67A 4YUDA 3BSAA 3HD1A 4QR2A 3I0RB 1EI6A 2FIUA 2E9ZA 3L4BC 4EI2A 1S10A 4OV1A 3DDKA 1R8AA 3M8PB 2XHCA 1N2LA 4ZJLA 1VQKS 4IOBA 2C42A 4RW6A 2GZOA 4MK8A 4OZ1A 4AD6A 2RDJA 1G7CB 4RBTA 5LRNA 2QSWA 2VG7B 3OXLA 1IM6A 1GFWB 1S6UA 3CDUA 2VPZB 2A18A 3BKFA 1JIHA 5CABA 8RUCA 1FRIA 1Y9OA 1AA1B 1SIZA 4M5KA 3OHAA 2JEIA 4QPXA 2YX1A 2BW2A 2JHEA 1FWPA 2GVZA 2B9EA 3CCTA 3M2UA 1DBDA 2CAJA 1HBOA 2CPXA 4NWBA 2FPHX 3ITHA 3N4WA 4LSLA 5DRKA 2G0CA 4ZVRB 3UDLA 1IBKF 3TQEA 3TAQA 1T05B 4GVBB 2XO6A 4Q44A 3T5LA 2UVRA 1R0BG 1YWXA 1JLQA 3EDRB 4RL1A 4OX9F 4RUAA 1RBOB 3DOLA 2LKZA 4LQYA 2RAQA 1TL5A 4U7UD 3AA9A 2CPIA 1MWYA 1X4EA 3HFZB 3TOQA 3PW5A 2E1CA 4Q0BB 3H2VE 2KFZA 4IDKB 1PG5B 2PGCA 4TU9A 1NMEB 2MXYA 3PYGA 4X62F 5IM0B 3G86A 1UVLA 4MIVA 1RKJA 1C2PA 1UKUA 2QA2A 3ZC4A 1UP1A 5D77A 2UU9F 2I5JB 2RD5C 4DMZA 2NREA 1FXDA 2A10A 2MSTA 4CIOA 1Y0HA 3EVWA 5DM7Q 2BJDA 1VQ7S 1RYRA 4WFAQ 4DCPB 2E1MC 1SQEA 3T1HJ 2KL8A 3BPDA 4PQUB 2ZVSA 4EEYA 1YJRA 1ELOA 2AKWB 4Y6IA 3RB4A 1I94J 3KLVA 4Q8FA 2OP5A 4CLPA 1T9VA 1RTIA 2GVDB 3NG8A 2OPPA 4FN5A 5FJ4A 1X4DA 2GMHA 3CJKB 2B7BB 4J9NA 3ZO7A 3PYFA 1N36J 5KFAA 1RTDA 2FVQA 2CNKB 3DYAA 3KLGA 3EVOA 1ZM9A 1U1NA 3POTA 1WSVA 2E1AA 3HCXA 1N34F 2O3DA 5HLFB 2I6WA 5HSPA 1LWEA 1T9WA 1VQ8S 5L0BA 3OJSA 1WKLA 3M9OB 3LP2A 5CH7B 5FDLB 2DT9A 1QTNB 4NZ6A 1TVRB 4ZN1A 2W2NP 1N52B 2D3UA 4E2FB 3LPYA 1R6YA 4MYUA 4P7TA 4A8WA 2ALYB 1RE1B 3TW0A 4AXIA 4DCJB 5D0RA 1IWAA 1T9TA 1UFLA 3DC2A 1IKVB 1RAFB 3ILOA 3LW5C 4LF2A 5D4LA 4DR5J 2AYBA 3KD8A 1FK9B 4YR3A 1RT5B 2OMLA 4DHVA 3R7NB 1UCNA 4ETZA 4OZJA 2V68A 4UPKA 1NPRA 1KQGB 1YRUA 2KN4A 1JX4A 2DO4A 3QRQA 3VZIA 4CYUB 2V69A 1P9YA 1L3TA 1UW9A 2U2FA 3MPYA 3O1LA 5E3RA 5KTQA 3WZ0A 2FVCA 3HHLC 4UOGA 2J6SA 1G1XA 1RADB 2UUBJ 1IXKA 3UQSA 6AT1B 1RABB 1JXLA 1TKXB 4M5IA 3EPGA 2I9SA 3IWXA 3P96A 4ZPTR 3O44A 5L0EA 2BVZA 3ICLA 1RYSA 1N33J 1REVB 1NZ8A 3HHDA 3Q22A 2XO7A 1SL1A 3SQOP 3MECB 1BGXT 5BR8F 4DV7F 2N7CA 5GAHU 1HWKA 2KG1A 5F8IA 3IAM9 1F9HA 1VJQA 2CADA 4Y3CA 3KOAA 1M1GA 3HVRA 1U1QA 3CWJA 1EIYB 3RAQA 1SB6A 1J27A 1V3RA 1IN0A 1QAXA 2AMCB 2GSOA 1YBTA 3JB9k 1OJ4A 3UR0A 3I55S 1CJUB 2NR0A 4EMDA 1K0VA 2OEMA 3NGUA 4QYZK 3J80Y 4NLVA 5F8GA 2ZFHA 3R7BB 2IYIA 2W25A 3FUYA 1FKOA 3FBBA 5HI7A 3WIUA 5ETOA 2FZKB 4DV0F 1U26A 3LGNA 4F4XA 5AE1A 2QN6B 4B3MF 1JNRB 2IM2A 5HO4A 4RNNA 2BOPA 2CA9A 1TKZB 2X51A 1H7WA 2GW8A 2AQ4A 4B9SA 4JV2A 2GIFA 2ZD1B 3N6MA 4JB8B 4ANDA 3OL7A 1S0OA 4UOOA 2BE2B 3OQ2A 2DPJA 1IQTA 2NUHA 3AOCA 3ET6A 2X7IA 3N01A 4ZPWR 5LMUJ 4DQRA 1J5OB 4OYAA 2DR5A 2XSFA 5KG1A 1FERA 1VHIA 2PDAA 5ETQA 2DNRA 3AT1B 3CJQA 5D8HB 4TY8A 1NU4A 4PUOB 4K0KJ 1WC6A 1JWWA 1L3SA 1CQNA 1X60A 4OI6A 4AT1B 3MFHA 1K8AT 1X5PA 1FFWB 2C3YA 1Q7LB 1ZAXA 3DLEA 2UXBF 4DFJA 1F2HA 4EBCA 3MMBA 1XMQF 2POKA 4F3OA 1HA1A 1AT1B 1LW2B 2G13A 4QZVB 2CRLA 2Y1RI 1UZHA 2HNZA 1FDDA 2CXEA 2FHKA 3RBZA 3H5XA 3PR5B 2Z2LA 3DRXA 3OSPA 1FWLA 3MR5A 1XMOJ 2XYGB 3N6LA 2F1FA 3BO4A 3HX9A 4DV4F 1KFDA 2KT5A 3OTBA 2DPIA 4WXWA 1GMWD 4B3SJ 1LWEB 5F8JA 3IDDA 1PAUB 1KBRA 2APOA 3THVA 2EC0A 3CMQA 4B3RF 3X1LB 3PYDA 1K73T 1JK9B 5KFIA 2HURA 3PEHA 2E5GA 1F5CA 1S48A 2ILZA 2OEJA 3LANA 4X64F 4DSKA 3J7AN 2P9GA 1WSRA 3LF0A 1TV6B 4WFYA 4G3IA 1UVJA 4Q7AA 9ATCB 4FZVA 4WBFA 5A8RB 2DNKA 3GIMA 1YJTA 3TAPA 3FMBA 5KG3A 3I56S 4DR3F 3QAUA 4HI2A 1RTDB 1WELA 5IQ6A 2C2MB 3Q89A 1RAIB 4LBHA 3W5XA 4P72A 4ZLLA 3QZ8A 2VG6A 3BQ0A 1QSSA 2HZVA 5EGEA 1VLYA 1HPZB 4QBUA 3C15A 4KH1B 2E9TA 3MEGA 1N5YB 4IOAQ 3V5RA 1LWCA 1X5TA 1XR5A 2BM0A 2IM3A 2XMVA 4LR8A 4UW2A 4MIBA 5ETTA 2ZH4A 1T0TV 4J9MA 2YH1A 2N4DA 4DCOB 2E5LF 4DLGA 4OI3A 1JQGA 1YGYA 2NQPA 3I9ZA 2FGCA 3NAIA 1MWZA 2WK4A 3FFIB 2FLNA 2VA3A 1HR0J 3CO9A 1UA0A 2W5SA 4DLEA 2PD1A 5F9LA 3DRSB 3OLBA 2XI2A 2Q43A 2VICA 3CC4S 4UQTA 2W5VA 3GR0A 1NDPA 2E5HA 4FYVB 2Q66A 1AB8A 3T01A 1RWUA 3N5BA 4QIEA 1K1QA 2H54B 4X2BA 4JI6F 2WONB 4UT4A 1ZTTA 2C1EB 2HG4A 4O0IA 1CC8A 1UJ5A 3MUVP 1S79A 3DRSA 1VRTA 3LP1A 3WAYA 1Q16B 4X65J 2M0GB 4DR2F 2X3DA 1S1VA 1I6JA 1R3NA 2XWXA 4OYPA 2D74B 4ED7A 1WC4A 1Y10A 1A7GE 4AQYJ 2I5JA 4DSEA 1SL2A 2HHHJ 1BQMA 5DQHA 1YJVA 1ZBTA 1CJKB 3OL8A 3OUYA 5C5JA 3FEYB 3OFFA 3CW2C 1N0UA 4MKVA 4DV2J 2R4FA 3MEKA 3ZTQA 1O6XA 2A6MA 2DRDA 2EWHA 4ZVSB 4WCEQ 1RP5A 5ADZA 1NSKL 3GU0A 2WSFC 3GG1A 1E3CP 3N5FA 4QWBA 3SBMA 3DLGA 3GYGA 3HULA 2BBEA 4XDCA 5C25B 4N56A 1R0AA 4DQPA 4F7VA 3AXKA 3I96A 2W9BA 3NGRA 3IO1A 4K4XA 2EK6A 4YQWA 1T9XA 1NCLA 3VWSA 3FZBA 1L5UA 5ETPA 5IT9U 3I5BA 3DLBA 2HGMA 2Y9HA 2MGZB 4HTJA 1JLAA 3TJ9A 1HD1A 2W8SA 2E7WA 2DYAA 4RNFA 1HW8A 1WHWA 3C16B 1N5SA 3K5PA 3LP0A 1V6HA 3DFEA 1GXTA 4OJHA 5HATA 4DX5A 3Q2TC 1AJDA 2F8MA 4HR2A 3RU0A 2RB7A 3NP5A 4C0BA 1T3OA 1PILA 2P6TA 5J2NB 3V6KA 4USKA 1RHQB 5LT5A 2RRAA 4K59A 3U7JA 3HKZD 1HWJA 3A8IA 3RB6A 4KR0B 2XM3A 4F0MA 4GKJJ 3UR3C 2X1FA 1UMJA 4DF8A 5DDPC 4K0KF 1KQFB 2AWZA 2V8HA 4NXMJ 3NS7B 4ZG9A 3W60A 5AXNA 2J0QD 1VQSA 4MIAA 4RX6A 2DH9A 1NPPA 1N5YA 2E29A 3F56A 4BLGA 5LMUF 3E3XA 2FHJA 3DGPB 3FEXB 3ZZPA 2YQ0A 2PI4A 1EB0A 1X31C 3TZWA 2K2PA 4ZGAA 2EC2A 3G82B 4CLTA 1IKVA 1ZZFA 3ISNC 2IY5B 4ZG7A 3EE3A 3Q2SC 1Z2LA 2IIHA 2UUTA 3SZYA 3BGOP 2UXDJ 4NA3A 3GYNA 3MR7A 4NCBA 1JJ4A 4CI0B 2DXFA 5CQGA 2KYZA 3TZYA 4RW9A 1D9AA 2IYGA 2MQNA 1C0TA 1RK8A 3PACA 2F4FA 4USMA 2B43A 1IR2A 2MY7A 3A52A 4TLQA 2JFKA 3M6VA 4DZ6A 1WTBA 2IFXA 1TUWA 3HZGA 3MPWA 3PJXA 3K5OA 3IP0A 1Q1KA 5HL7Q 3FFIA 5KG5A 4B9LA 2B5JB 4TNOA 2F7VA 5KG2A 4ED4A 4QCLA 1RT1A 2DHAA 3QSIA 3B4MA 3C46A 4GC6A 1FE0A 1VQPS 2MKHA 4FF4A 1IKYA 2HWIA 2IJRA 3W64A 2UXBJ 5D78A 3U1MA 3ZTRA 4F36A 1X0PA 1SJ3P 3G8QA 5LQQA 3FQKA 2R2SA 3V81A 1UAWA 1Q8IA 5HMZA 2ZVIA 4M5HA 2Q1LA 2E66A 5KFPA 3VAKA 1NJXA 4F2SA 4C8ZA 1VR6A 3QJLA 4FKXA 3CMAS 1UA1A 1VS3A 2B51A 2WAQD 1IKYB 3OLAA 4KO0B 5E33A 1CPZA 1N0VC 3JXOA 1V5VA 3BEGB 1LFWA 1V3ZA 4FVMA 4R0JA 4YR1A 1WWHA 5GAGU 4FF2A 1KR4A 3HHKA 4ER8A 3NKRA 1N6QB 3K8WA 3JYTB 4QIWD 2GSNA 3M8QA 5DQIA 2E5IA 1Q8LA 3WAWA 3CJ8A 2PIIA 3BH7B 1RKIA 2M5YA 2Y1LB 2YY3A 4C3KA 3J81U 3BS9A 3GCWP 1TUGB 2HVEA 2IC3B 1XNQF 1D0EA 4PYAA 4RBVA 5DDQC 4RUCA 4IRCA 3B8HA 2FJXA 2IUCA 2IAJA 1PYTA 3OR1B 1WI6A 4I4BA 4FS1A 4WZMA 4OHVA 2ATLA 1T9UA 1U02A 2VG6B 4YY3J 2ZZNA 3ZFVA 3D68A 1YK9A 5H9FK 2LDYA 2LXUA 4MIWA 1T03A 3RBEA 2ERRA 3ISND 2XHWA 5D3GB 1NK7A 3PHEA 4P2MA 1SJFA 1C1CA 1SCJB 2A1BA 5G0RB 1NBEB 4HYKA 2J6TA 2PA8D 2CQCA 1TR0A 2EEYA 3A4TA 4IH6A 1WEYA 4PQAA 5KFSA 3KHHA 4ECQA 5DDRC 1X9MA 2M52A 1FO1A 1HQ2A 2VB6A 4LIRA 1H0HB 2WVCA 4LJMA 3KLHB 2ZH9A 1D9FA 4P2FA 3LTOA 4N5SA 5IJQA 4USVA 3HSZA 1RT5A 2BX6A 4DU7A 8ATCB 3CD5A 3WAXA 4RNMA 3WDOA 5F41A 3DDIA 1MU2B 5KFZA 2HBQB 2IBKA 1XEZA 2DY9A 3BM7A 1OMSA 1OQ3A 2ILYA 4G1QB 4ZP9A 2G9YA 3KG4A 4DX6A 4NLPA 3K89A 3W2WA 2FC8A 1RTHA 2LYVA 2YNGA 3FBFA 2OEKA 4KIAA 2RQCA 2VHGA 2N7YA 2ZDOA 2VJVA 1YTYA 4A46A 4JI7J 3MXHP 5K9FA 1MMNA 4ECTA 1LV5A 1FNMA 2C2KB 2E5LJ 1BD6A 2JVOA 4K7QA 3MM9B 1WDDA 2QTWA 3NGDA 3IRXB 3MDFA 2KXNB 2R2UA 1KH7A 2BACA 2DGUA 3D0HE 2EKNA 4M8LA 2QX0A 1WDTA 3JSRA 2XLIA 3TZZA 4HHJA 3HJVA 2H48B 3ELHA 4DG1A 5E3CA 5BXIA 2L48A 3EGWB 2YNHB 5B08A 3OTOJ 3CULA 3BGRA 2OIHA 4F4KA 2KU7A 4NMXA 2AGPA 1LWFA 4MKBA 4JP8A 2IDEA 4F26A 4QR0A 2ZOFA 4I1TA 4CO4A 5BYQA 1Q86T 1KHNA 3KK3B 1J5OA 3J81j 2DR8A 2CWKA 1OPIA 1S1UA 4ZVUB 3R2CJ 4ZPDA 1JLBA 3OSNA 2VD3A 2E9RX 2CYYA 2OH2A 3BBCA 3WC2A 4HKQA 3OTEA 1AXQA 5TJ3A 4P71A 2EFOA 4HT5A 1N32F 2XS2A 2CDQA 4FP9A 1S6OA 3NNHA 1NNDA 4DL6A 1KLNA 3KLIA 4I69A 4Y34A 1S9GB 3NEKA 5J1EA 2OPRB 3K5LA 4FXDA 4WE1A 1URAA 1A9NB 1VK8A 3RRGA 2K06A 1H74A 2FD2A 4ZPAA 2Z56B 4LQ3A 1O98A 2H1YA 3TA2A 2UV8A 3M9NB 4JI5J 4DR7F 3H8YA 1S1TB 3DYCA 1T3NA 1RZMA 2JJ4D 1Q5VA 3KWMA 3BZQA 3T9ZA 1KLMB 2CFXA 1CLFA 4P10A 2VJUA 4JI3J 2CPFA 1URBA 5CYQB 1HBUB 5DQGA 4J9LA 1U1KA 4FF1A 4TU8A 1OWXA 2HS3A 1S99A 1WUUA 3W1YC 3BR9A 3D1QA 1C0UB 2HS4A 2V4JA 1ZETA 1D8YA 3CD6S 2EI5A 1FKPA 3MAHA 4OYBA 3D7SB 2VQRA 3QSYB 2MZTA 2HQ3A 2VG7A 1BWEA 4ZPCA 4Y0FA 1NM2A 4ENOA 2Z2YB 1AUKA 1K7HA 4IG0A 1CJVB 2V2ZA 4CLWA 2L08A 1N8RT 3M8ZA 4QWAA 1KVJA 5IT9Y 4DU8A 4C2MA 3PO5A 1YLXA 3R8YA 1DLOB 3M2UB 4KV8A 1M5SA 3CXCR 1DRZA 2O66A 1S7IA 3W7BA 1SPBP 2EFGA 4ECSA 2FVSA 4LBPA 5K8NA 1MROA 2V4QA 2CUYA 4ED8A 4LSNB 1YG0A 2C3UA 2KI2A 1JLGA 2YNFA 3GYXB 4ZCKA 5K14A 4ZN3A 2KB2A 2WVEA 3R3TA 3HVWA 2AX1A 4ES2A 1ALJA 1PJ6A 3B4DA 1RT2A 4OJ1A 3TARA 5CZXA 1PYOB 3TJ8A 2ZEJA 3FZ2A 3DRYA 3SIPB 4I2QA 1YIJS 1U1OA 1N5QA 1XWLA 3M2RB 1YJNS 1RHRB 1H7XA 2V67A 1F5BA 3D9BA 3OT9A 2V8DA 2C22A 1N2KA 1R43A 4WTOB 1FTRA 4LFAF 1SV5B 2JLFA 2DNPA 1L3VA 3TX0A 1F3FA 4WFBQ 4X4VA 2D69A 1D1UA 1S7HA 2BJ1A 1RACB 2B5JA 1ZOTA 3S1TA 2IA0A 3CJ2A 4F0HA 5K8OA 3NMAA 4F67A 4YB1P 3BREA 4DS5A 1K0TA 3HP6A 2RQ4A 3D67A 3I87A 2AW0A 2DR9A 2P6SA 1RWOB 5IC4B 1URNA 3G87A 4J91A 3OJUA 2BOAA 2MJUA 3MCSA 2CPEA 2H9ZA 2LA4A 2W2OP 4NLYA 4CO2A 3A3NB 1FDBA 3GILA 2HK2A 3TUJC 1RWWB 3DPCA 3J7ZT 4QU6A 1Z2ZA 4PXCA 3HJFA 1BLUA 1J5EJ 1RISA 1S6PA 1O51A 3IBCB 3JQMA 4PG8A 1EHWA 2MKKA 2F9JA 4OJ3A 2HHXA 1KLMA 3DYAB 2FJDB 4QOTA 3KLGB 2CJKA 2RU9A 3MD1A 2KT3A 1RTJB 2KKHA 3SFGA 4DX7A 3UCUP 1B99A 1H3DA 3M6XA 1TZ0A 1FX4A 4I56A 2BABA 2H4WB 4I6YA 4ZVFA 2N82B 1N54B 3KHLA 1X0FA 3GJTB 4LFBJ 1ZTWA 1N4LA 1NH7A 1UJ6A 2DHHA 4AL7A 1AZSA 1IUJA 1EZZB 2DEIA 1FF2A 4NI2B 3ENWA 1PBAA 4ECRA 2DNQA 5IC6B 2AJFE 3KLEA 1EAYC 2QV6A 3TAMB 3NNAA 4UY8T 1JLEA 1RT7B 2VBWA 2IAJB 5LOQA 1CULB 3EGNA 4P6QA 2DNHA 3DM2B 3ZZ0A 4WJBA 2AX0A 4UOFA 2W7PA 1RUSA 1KNZA 4U6PA 2Y1JA 1RHMB 3LH2S 2BEFA 2HQFA 2LEPA 4PEOA 2WB4A 5CYJA 5A6WA 4CH7A 3FBCA 1WOOA 1JLEB 1IKWA 1RT7A 3NS6A 4W98A 4FDFA 1P49A 3CCUS 2MQOA 2G2OA 4A4JA 2UU9J 3QT7A 2PFDA 3N6NA 3J81Y 2JLGA 1CQMA 4KY3A 2V2QA 2GFFA 2QL7B 1U45A 2O01C 3DDNA 2HGLA 4NZ0A 4DJBA 2IFYA 2N4CA 3IAS9 1U1MA 5L8RC 2BR0A 3QLHB 3TNVA 2FLLA 5KT3A 2ZKTA 4LVNP 2ADCA 5DG7A 2GCFA 1BXNA 3FC9A 2HLTA 4UOHA 4CO3A 3RAXA 4I64A 3VQSA 5KFKA 4ZCLA 4WZQA 1OYDA 3G6YA 4TQRA 3PVXA 3TA0A 1TKTA 2ROEA 4CCHA 1KOOA 5LJ5Y 4IH7A 2LDIA 1OY9A 1WI8A 3NOGA 4ILRA 1FNXH 1IBKJ 2GGPB 4NOHA 5KFGA 4MKYA 1JLGB 3ULHA 4QR1A 2AEFA 1NDKA 1VDHA 1JLBB 2BANB 2OD6A 3DXBA 4OLPA 1O5JA 4RW6B 4B9MA 2QLFB 4LRCA 2FB0A 3MM9A 1TELA 4UQGA 4LT6A 5AXMA 4ZVPB 2ZH5A 1ANIA 4F0KA 2WONA 4NYPA 5KT4A 2BRKA 2CQ1A 4N76A 1N88A 3PW0A 2M8DB 1EW9A 1E6VA 5E3PA 4RLEA 3D6FB 3DLKB 3OPKA 2Z58B 4DV1F 1S0VA 1R8HA 1H73A 1RTZA 2J76E 1SJ4P 3T3FA 3MUTP 1S9GA 2QFIA 3QO9A 4ZOSA 1ZYQA 4A8XA 4TQSA 3NCQA 1BQMB 1XR6A 2WTFA 2AD9A 1I51B 2BE2A 2CNNB 2IJNA 2WVDA 3QAEA 4G1IA 2RSQA 4L76A 1X5OA 2JZ5A 3I4HX 4WXOA 3G6XA 2JEFA 1HNWJ 1MSWD 2HAFA 5LM7E 2MEWA 2V2VA 4JI1F 4TY8B 2ZBQA 3OVSA 2F4VJ 4ILLA 3HHLD 4CH1A 1G3OA 3N28A 2OMOA 1U0HA 2BXJA 3CJSA 4O23A 4DN0A 4F50A 3D4JA 4RW7A 4A8KA 4I0WA 4Q0BA 1ED8A 2DHXA 2W5WA 1S12A 1IM4A 5AE2A 4CLFA 2F8EX 1SKWA 4GKKJ 1RHKB 3CCWA 4WTYA 1M5KC 4FDJA 4RW4A 3LWLA 3LUYA 1ANJA 1Q0NA 2XMWA 5I3UB 3BF4A 3FCHA 4C3LA 2E7XA 5LXYA 4RZRA 3JSMA 2QLXA 2J0SD 3ED4A 4OX7A 4EYHB 1WF1A 2ZNYA 4OQJA 4IR1A 4Z7YA 4XPEA 2OTJS 4EFAC 1HARA 3DOKB 2HRYA 4F2RA 2LP4A 2HHUA 1SXLA 2KJVA 4TY9A 4KH0B 2B7CB 3QIDA 2HVZA 3AODA 4NX9A 5J2MA 5U47A 3C3LA 4O3RA 1S9EB 1B4SA 1FDNA 2NCKL 1TL1A 2DNYA 2RMLA 5CYQA 2DNZA 1XMOF 3CJ4A 3H7HB 3GONA 4PAAA 1R0CB 1Z4UA 1XTZA 3A1YG 4H4MB 4MK7A 2ZZMA 4XO0A 3BSOA 3TVZA 3PR4A 1CG2A 1FCAA 1RBLA 1LNQA 4K8RA 1XMQJ 1EW8A 2YPYA 3PXGa 4Q45A 4MYTA 3CMES 3G82A 4GO7X 3BGUA 2NXCA 3MTKA 4OHWA 2KG0A 1GMUA 3ETMA 3JS9A 3J7YI 3MEGB 4ECZA 5MAOA 3PG9A 4ZJOA 3SDEB 4KB7A 2DKOB 3S8SA 2HK3A 2Z2MA 3MOJB 2HNYB 4HI1A 1FRMA 1MW7A 3U1NA 1ITPA 5GAEU 1HHSA 1NSPA 2MLYA 3MMJA 2DVIA 1UWBA 2VL1A 4GMKA 1U0SA 1O0PA 4J9RA 4RNOA 1IJEB 4V1Ak 2G2YA 3G9CA 1HI0P 4ZMMA 1DTTB 3Q8QB 1T95A 3EDQB 1OIAA 7FD1A 3M9MB 2DGSA 3OD2A 2MDAA 4M5DB 3Q8SB 3H4BA 5D0EA 5L1IA 3LQVA 4ECWA 1YQHA 5J1PA 2AJQA 3CPWR 2RVJA 5E2QA 3NL0A 1IBCB 1XJWB 5B0FA 3UWTA 4UF4A 3BR8A 4I2QB 4YFUA 3HSGA 2ACYA 4USHA 3GV5B 3QIPA 5HMWA 2V0NA 4AE5A 3BQ2A 5DG9A 2DRBA 3GV8B 3H25A 4DV1J 3NWGA 4DSFA 1QUPA 2W8KA 1EP4A 2EKYA 2ACMA 2BQ3A 4OJGA 1CJKA 1XR7A 3EM1A 3WBZA 4DV7J 3HF5A 3C2PA 2VKRA 5DLWA 2FHOB 3BH6B 2ZBIA 1U7LA 1RA7A 2VOOA 1N33F 1U6BA 1EQJA 1BMQB 2IRXA 3GSDA 4MAKA 4JV0A 2WVBA 3VCDA 1JLQB 4IOCQ 2UXDF 4NA2A 3P6YC 4OX8A 3K0JA 1B64A 2FY1A 3ZTSA 3V6DB 3UN5A 2HMIA 2LA6A 1U24A 4F4YA 1CJTA 2CPHA 1ED9A 1KRPA 1HQUB 3W5YA 1H2VZ 4RO0A 1TQLA 2DNLA 3E51A 3TO8A 2C2EA 1VC6A 1RT4A 1FDAA 5JMNA 1G6BA 3BPSP 4X4QA 2WBRA 1RT3B 5BYSA 5DM6Q 2KXFA 2ZUAA 3BDPA 1IWGA 1RHJB 1RLCL 4O44B 4JI8F 2D9PA 1ZZNA 4DR4J 1TFYA 4KHPF 3GWCA 4KAVA 4J9OA 3UN2A 4QWCA 4FNIA 4NLRA 1U1RA 1URRA 1VISA 2V8PA 2W4DA 5D4OA 2W9CA 2NZ4A 1CEZA 2P9CA 2PMHA 4MH8A 2D1GA 4QIVA 1HBMB 2LQ8A 1FRLA 3FDSA 3SV3A 3PO4A 2WBMA 5FLXY 2YKOA 4ES1A 1HHTP 3FQLA 2QYCA 5B0AA 1HYSA 2JFDA 1FFSB 1UW4A 1WACA 3C8YA 2J7UA 4DOZA 4OL8A 3CDBA 2HEKA 3P5TL 2B0GA 4KPCA 3K59A 2HIQA 2RH3A 4YMEA 2W9CB 4P7VA 2V4JB 2A2DA 2CQPA 1N34J 2AYEA 2FHMA 5L46A 2XY5A 3BDFA 3QGGA 1WKJA 1MMDA 1RJJA 2LLZA 3MMBB 5L9XA 2VV5A 2RRNA 2J9DA 4NLUA 2L41A 2P8IA 2XCAA 2ZH6A 1KFSA 1HYSB 5HJXA 1FTCA 4JI8J 5KG6A 3A8KA 4WK3A 2HNZB 4CLZA 3R97A 1VGYA 2V8GA 2MKIA 3KJVB 2ASLA 4FBUA 5EGHA 2HFNA 3KLFB 4DV2F 1KC8T 3KK2B 3QGHA 4G1QA 5A2QY 3CIZA 2FVPA 1V5IB 1SHNA 4M95A 1V3SA 2DO0A 1KEKA 2J5AA 3NGKA 4OYWA 1HBNA 3DI6A 5HK4A 3Q8PB 1NK8A 5M2UA 5E3QA 2PI5A 4LQ9A 5T14A 2ZBCA 4X65F 3F41A 3US5A 5BJRA 2D3ZA 2J0XA 2BV3A 2FZGB 1R89A 2OAUA 2W2MP 1ZA2B 3D6HB 1HD0A 2M7SA 3H42A 3VQTA 2DNGA 2AV5A 3ZZZA 4URGA 2CVIA 2F9DA 5AJ3F 4A8YA 3BKUA 3T6BA 1N56A 3THPA 2IHR1 4ZVHA 4TU7A 2L9NA 3CGIA 3I5AA 1GTHA 2QG9B 5L38A 2J0WA 2BANA 3GLJA 4CDIA 5HVGA 1KQSR 1S4EA 3IWNC 1RAHB 4NL5A 3SCLE 3UFCX 4Z7CA 5CYMB 3UCGA 3PM9A 1CJTB 4EZ9A 4OX9J 2VQEJ 4OHYA 2N3OA 3MZIA 3Q8UA 3EYZA 5J2QA 4RU2A 3J7Z5 2WCXA 1FSUA 3PX0A 4UUXA 2OFHX 1HNZJ 4C4WA 2CQIA 3DOLB 1ZM3A 3QYYA 4ALZA 1VRQC 2VQFJ 4BS2A 4DPTA 3H5SA 4C8KA 2MKYA 2FC9A 5H9FJ 4QYRA 1SC1B 2DISA 4L3KA 3IM9A 4KTQA 3ZTOA 4ED6A 1UVNA 3JYTA 1IQZA 3WHIA 5F9NA 2VONA 2BJ7A 3BN7A 1EETB 3HFKA 3KJQB 2D41A 4NEYA 3UD5A 3RG6A 1FJGF 4ZKAA 1FD8A 3MCOA 4E98A 5KFFA 4RPFA 1SUQB 4X64J 6FD1A 3N9UC 1KWMA 2DGTA 4LF9J 4DN9A 2J7WA 3DXSX 3F0NA 1RT4B 4BWJA 5KFWA 4QIFA 5KFRA 2R7RA 1KHKA 4QU7A 1KVKA 4CH0S 2VG5A 4F02A 4DV4J 3IXQA 3V81B 2WOMA 3SCIE 2MZRA 3JSMB 2IMOA 5I3UA 4A8SA 3EGZA 1GMWA 2QZUA 1RU2A 1HMVB 4OZ2A 3M30A 3KLEB 3SYZA 4LRAA 3WQPA 2I2YA 4WP9A 1Q81T 1VJWA 2AJ1A 2HZAA 2NXNA 2PT0A 1AFJA 1VQMS 3CCMS 3ILLA 4LF6J 1EW2A 1DZ5A 3O6QA 5C2CA 3T02A 1YJ7A 5ETSA 3L3CA 3G71S 1IBLF 1CS4A 1LQ9A 4FYXB 3NXZA 2H65B 4H4OB 1NJIT 5KFBA 3HO1A 1WEXA 5I3PA 4TN0A 4N8OA 3T5KA 2OHDA 2V9WA 2ZITA 1NB7A 4H4MA 2H51B 3FSYA 1AYEA 1Q4RA 2YKNB 1ROFA 4JI3F 4QW9A 4DI6A 2AYMA 3QRPA 1FXRA 1NJYA 4A8MP 3UCZP 1S97A 2YX7A 1KDNA 4MKAA 1DQAA 2IC3A 4DS4A 4WWSA 2ZJQQ 1F9FA 3Q23A 4DUTA 4K5RA 1OSDA 1F0XA 4ERDA 2YNFB 4AL6A 4KHMA 2LQJA 3EGVA 3SI8A 1RWNB 4ZLNA 2FJBB 2DGXA 3BDEA 2C28A 1MG7A 5ETMA 5HP1A 3RBDA 4PZVA 2UVUA 5EX3A 2J9DE 2VQEF 2Z57B 3DGPA 5EWGA 3VAJA 4RUBA 4ED2A 2DB1A 5CA5A 3T1YF 1X4BA 4DV6J 4QAXA 1QM9A 1UFWA 4ZIWA 4FBTA 5HMXA 5EWEA 3LWMA 1RCXB 3S01A 4KT0C 1TK0A 4PXDA 1SKUB 4DPUA 1JLFA 4ID5B 4ZP7A 4YN3B 2MPUA 3H59A 3ENQA 4IFVA 2VFVA 4HDHA 4LR7A 4NE9C 1QDUB 4WPAA 3MFIA 1VHFA 2FZCB 3M8RA 1ALKA 1OQ6A 5B0BA 3LGMA 1KKHA 2KH9A 2UUBF 2WW4A 3BBFA 3EMTA 1ALIA 1ELYA 4AFFA 3U02A 4PXEA 1DJ0A 3PV8A 1RT6B 3FRYA 2J6UA 1E1ZP 4PWDB 3A8EA 1N48A 4USWA 4O3OA 2ZHAA 3M1VB 2LCWA 4L73A 3EZUA 1Y3KA 2VUGA 2WOMB 4BDPA 1U8WA 2W8DA 1H72C 2J9EA 2P2CB 1I5OB 2QLBB 3EZ5A 3R5AA 1H2UX 4UOPA 1Y11A 1UZDA 3S6EA 4DR6F 3LP1B 3UE2A 4KFBB 1JJCB 1D3WA 3EXYA 4CXKA 3TVKA 5LSRA 4LF8J 1BQXA 4Q43A 2YKQA 4WIIA 4ANCA 3PCOB 3EXCX 1LXNA 1S59A 2QMUB 2ZDPA 1CSJA 2I0XA 1WOPA 4C11A 1FEEA 1MN9A 2YWEA 1FRKA 4GRSA 2HHPA 3LGHA 4DV3F 4PG4A 3OFEA 3RB0A 5A6PA 5I42A 2DH8A 3M32B 3M6WA 3ENVA 1C4CA 1REGX 4I2PA 4J9UE 3IN5A 1QSLA 2MSSA 2ANHA 3DLGB 2W24A 1IBMF 4K4WA 2XLKA 2JVRA 3V4MA 2KXHA 3MMCB 2GX8A 1W2BR 4B9VA 4IR9A 1YJ9S 3Q86A 2G1DA 5DZ7A 3AHPA 2XMUA 1R27B 1ZEFA 4I2PB 1GT8A 5HAOA 4MTPA 3G6ES 2RIJA 4PWUA 3O3LA 2D3OR 4CLSA 4L3NA 2EBGA 2L3MA 5KFOA 1HNIA 2GAGC 3A3OB 3IWLA 4C0HA 4W92B 2XS7A 3A12A 3CDEA 4JBCA 1W25A 3HDSA 3R5GA 3TP2A 3V6HA 1I1GA 2BW7A 4KE5A 1HJKA 2ASDA 1JKHA 1PC4A 3KDNA 4EBDA 1Q8KA 5IT0A 2DD8S 4M94A 2HAIA 2L9DA 3ISZA 4N77A 3SSSA 2IPOB 1NO8A 1P1LA 4RR5A 3EZOA 2FTRA 3M7VA 3C6UB 2O67A 3PRDA 3ZTPA 4DXLA 1SH0A 3OR2B 4EZ6A 3GE9A 2RUGA 2QYGA 2MMYA 3Q24A 5GMEA 4LF8F 2F3JA 4NYZA 2BJ3A 2VOPA 1VIXA 2FLOA 3M05A 5HJYA 4K4ZA 4CQ1A 5DG8A 2QLWA 1MMLA 4KAYA 3JTPA 2KM8C 1M90T 3NBPA 2W5XA 3W8GA 5KT6A 3TUPA 2H5JB 4TYBA 5GAHI 1NUEA 3KMQA 2VH7A 1FRXA 2AJ4A 3D1HA 3MD3A 2U1AA 3BBBA 3MM8A 4P2XA 1R8CA 3QIPB 1T05A 3D3BJ 2MHNA 1VRUA 3KJFB 1NK5A 2UVVA 4DUZF 1VQYA 1RI7A 5F8HA 2NXJA 2V63A 1YI2S 3SQGB 1NK0A 1RWKB 4DDFA 4MK9A 6FDRA 3C6TB 3Q83A 1FVSA 1X5SA 2C3OA 3MUMP 1UFKA 1P8GA 1VK3A 3IS9A 3ZZOA 3CT9A 1RXOB 2VPWB 3LA0A 4HTIA 4JI4J 2VBYA 1IR1A 2VF3A 2ADBA 5DLTA 3W63A 2ZUGA 1DHMA 4DSIA 2HGNA 1R7IA 4I7FB 3T1YJ 1PIEA 3G2XA 2GA3A 1Q5YA 3CJ0A 4XAKA 3MCNA 1H6KX 1KP6A 1EETA 1B0VA 1K47A 2YQ3A 2YNHA 3GP9A 4RW4B 3PRBA 4ZITA 2XB2D 2C2ZB 2DGQA 3FNNA 5B0DA 1SC4B 2CQHA 3MMCA 2PMZD 2QRRA 1VLOA 3CJKA 4CLYA 4R5PA 3V4IB 3BYRA 3JTOA 3CCZA 2PEBA 4EWTA 4B3TF 3IG1B 3AD9C 3IBFB 4KO0A 4DR1J 2B9YA 4G1PA 4OZ0A 3VF0B 5K8PA 2MQQA 3PIPQ 3GIJA 1NKCA 3LXQA 3OV7A 4WU3A 5KFVA 5KFUA 2UUCF 5LIAA 2GA7A 2GO9A 3SXLA 4CNYA 5MLCV 2GIRA 3Q8RB 4KGKA 4YB6A 4F3MA 2X1AA 1TMMA 1D9DA 2R7QA 5EN1A 2ZM6F 4NXMF 1H98A 1P6TA 1AJCA 4A48A 2KM8B 2NXUA 2PA3A 1DAXA 3PKMA 2ZD1A 2M2BA 5B09A 5JVGQ 4UY85 1C4AA 2XRGA 3SCKE 2CNOB 4DWIA 4LF4F 1KH9A 2BM1A 1YSJA 3ENAA 4KGXB 4RJVA 3FSIA 4U95A 1RLDA 4A47A 2B4PA 4YP3A 1FJCA 2M88A 2COLA 4UZBA 4DR1F 3HSDA 4CWBA 4F4AA 1WHVA 1GQEA 2G2ZA 2RKIA 3I31A 4OFZA 2XS5A 2LQBA 3KG0A 5IJSA 4XK8C 3FEZA 2C3MA 3M8PA 1M5VC 3B78A 2VC1A 3F44A 2YKNA 2DR6A 2EFVA 5KG0A 3UNYA 3UD4P 1VQ5S 2HYIB 3S7RA 1HQEA 2B9XA 2V2KA 3I9V9 1M1HA 1JNZB 4ECVA 3ZZRA 5G0RA 3IR5B 1JLFB 4ID5A 5F8LA 1RWXB 3CIMA 3W66A 3KYLA 1BE4A 1JLCA 2Y0BB 4M5GA 2DK2A 3CF5Q 4DL5A 2H3EB 3MM5B 3CCJS 4PG7A 1ZM4A 1NSQA 1EX8A 1U6FA 2M8HA 2WVFA 4ZVTB 3DKDA 1TKXA 1AJAA 3PIOQ 4DPYA 2EXUA 3L7OA 3JTNA 4Y2IA 4ZJQA 2BA9A 4FF3A 1FNOA 4ZCIA 2ZJPQ 3OTOF 3MWBA 1GEHA 1RBAA 3RBXA 3NMRA 2GJFA 2XMMA 3NGSA 3PTWA 2YBVA 4JI2F 2VQFF 3L95X 4DR2J 3TUZC 4QYZJ 4B56A 1TV6A 1G2EA 2XMTA 4DUZJ 2JEGA 2XMJA 3CNQP 4OYXA 4QIGA 4JI6J 4LF5J 4FPRA 1NRKA 4WFZA 2UUAF 4NPOA 4AL5A 1SQGA 4NXNF 4HLBA 1JJHA 2HQGA 4DPOA 1Y7AA 1RT2B 3I6PA 3CO0P 3PYEA 3SSRA 2XY7A 1WKKA 3C15B 4HDGA 5KFQA 3D2WA 2FHJD 4HL9A 3C66A 3DRPB 4I6AA 1RA6A 4C8LA 3P4UB 2K1RA 3OFHA 1ZAWA 4PYDA 3DCAA 1QVFR 5KFEA 1WHYA 3MOZA 2DCLA 2MQ8A 3CE8A 5KOXA 3FGVA 3CD7A 3IG1A 3WIVA 2BKNA 3I4PA 3W9IA 4ECUA 4PR6A 4B17A 2FLPA 1E33P 2NPIA 1X4AA 2FYXA 5KG7A 2W5QA 3BKTA 4IH5A 5E3AA 2DXEA 4IO9Q 1LWFB 5T41A 2F8HA 2HSEB 1PBUA 5JXSA 4X66J 5A8KA 2ASJA 1QSYA 2FGOA 4YS2A 4IFYB 4IDKA 3RGIA 1M5OC 4ICLA 3CCSS 2RDDA 2YVSA 3DRRA 5CAAA 3DMJB 4PUOA 3MEEA 2K7JA 4X4SA 3RUBL 1SI9A 3QQCD 4OZ3A 3CCES 4USUA 4CTAA 2YPZA 1HNIB 3GFZA 1FKOB 2RT3A 3T9NA 2XSJB 2RHSB 2KRBA 3HHLB 1F3VA 3IFEA 4O4GA 1N6QA 2V8VA 5SUHA 2M4MA 3FVYA 4WK1A 2XMKA 5F8MA 3IC1A 4X4RA 4PXBA 3Q3QA 1Q95G 1NHVA 3QT5A 4B3RJ 2WSCC 5DDOC 2RJZA 5SZTA 3G6VA 4ZVQB 4B3SF 3VVUA 4PWWA 3MM7A 5EHHA 4NCAA 1UPMB 4H4OA 1TVRA 3K8VA 4LRFA 2LQ5A 4ZG6A 4OI2A 3C19A 2KDOA 1E6YB 1M5HA 2E1RA 3H90A 2AEMA 3U27A 4DV3J 3RR8A 2RE1A 4ELVA 5IFMA 2IRUA 3KK2A 4PRFA 2VZ9A 2WZ1A 3E8OA 4R8UB 5A2QU 5GRRA 1T03B 3G96A 4PPZA 4X4UA 2W01A 1HNVA 1WG5A 2DH7A 2GV1A 4OYIA 1UWBB 1FT8A 3TRGA 1LW2A 1BC6A 3EWGA 4DL3A 4K50A 2DIUA 4OZLA 4MFBA 2G1HA 2XYHB 3AD7C 1LW0A 2D1CA 4USIA 7AT1B 5HMYA 3K5NA 4ED0A 2BYCA 2QZ8A 3SMZA 2AJ2A 4DR6J 3CMRA 2XZWA 4C97A 1ACMB 4LRBA 1AW0A 5LMNF 4GTXA 2HBRB 2QE5A 4J9QA 4B9TA 4O3QA 3ILIA 1WC0A 3RW6A 2LU1A 1BY9A 2ZWOA 4KAIA 5GAGI 2YTCA 3C6TA 3R27A 2QEXS 1KSPA 1TK5A 5C7PA 1GXLA 4USJC 3Q8VA 5M2RA 3WC0A 1A6LA 2BJEA 4RW9B 4LF7J 1TP7A 1QLNA 2HRTA 5IXUA 3OHBA 3CCRS 2AYGA 2C3PA 5GAEI 4U7CA 5D0HA 3PNIA 2EG1A 3QFHA 2YKMB 3QLHA 5FLXU 4I7FA 3G8TA 2ZH2A 1YKWA 3MM8B 3CSKA 2YH0A 1Y6VA 2RDIA 3NWRA 2IMWP 3ZZTA 2WB1D 2ROPA 2MHEA 1R8BA 4NLOA 3QNWB 1ZPWX 3HT0A 1CJUA 4C0OC 3MURP 2MQLA 1QD1A 2WRMA 1PJ5A 1ICEB 1VQNS 4ZS6A 3PX4A 2H4YB 1LWCB 4L75A 1HNXF 4GO5X 5A0YA 2RUSA 2CJAA 2IVFB 3A8JA 2HHTA 4ICLB 3W61A 1S1VB 1FFGB 4DV5F 3LALA 1S0MA 3QGPA 4WKYA 5IV4A 3BDHA 5KT7A 3HM9A 2ZE2A 4HHHA 1VBKA 2RU3A 3DRPA 3GSIA 4OMFG 1SUQA 2HPUA 1GXUA 1S49A 5GMDA 4CNZA 2A6OA 4NLGA 1X4HA 5DZ6A 4KSEB 5I3QA 1YBAA 3BO2A 3VGSA 4NASA 2DITA 4PABA 1SJRA 3THTA 4FXVA 4LF7F 1ELXA 2IVYA 3D28A 1RWPB 1RAJA 3TA1A 5LSLA 4HACA 3MEDB 1AUDA 2CJYB 5LL6d 4C8MA 2KFYA 4ZCMA 1PAEX 3RRHA 4EYIB 3GB0A 3NGTA 5E41A 3BDGA 3DRRB 4R0EA 3B6BA 3I5CA 5I42B 1FJGJ 2Z0GA 2W9AA 3HK2A 1FXLA 3L7PA 1AROP 2BE9B 4ZPBA 1B7YB 4CTAB 1AJBA 1IKXA 1XK8A 1F2GA 1I3OB 1NKEA 4CO0A 1S1WB 4ZA1A 1HQEB 2YWFA 2R7TA 2BE7D 1HNVB 4BWMA 5DS7A 2OUGA 1R6VA 3W8PA 4BBYA 3DLHA 1XNRJ 2R7UA 5BYRA 2X3GA 1GK8A 1B0TA 2UXCJ 1NHUA 4HVZA 4USTA 4KJDA 2EFPA 5GOVA 1IR0A 5B0GA 2K3IA 3MM5A 2JX2A 1S1WA 1HBUA 2F5GA 2GMLA 2IM0A 4RKUC 5AE3A 3H2UB 1RWMB 4F4WA 3O5TB 2QL5B 3M2VA 4TXSA 5A8RA 3RTVA 3NY0A 2DJWA 4MJKA 3VGTA 5E0OA 3R6GB 2ZZTA 3ZNJ1 5J1EB 2XGQA 5D4NA 3C16A 4LF9F 3AAWB 2AZ1A 3KLHA 3R5JB 2B56A 1NSAA 7FDRA 1XBWA 1PC5A 2YWGA 3FJ2A 4KBIA 1KTVA 2CZ4A 1JB0C 2GQQA 5H1SV 4CP5A 1U2RA 1S1TA 2GHPA 2A2CA 2Y0SD 1OS5A 3H0PA 3MF5A 2BQUA 3QJJA 3DOMA 3IMQJ 3B82A 5THWA 4AQYF 2HHHF 2HWTA 1I94F 1D09B 4NLTA 1ZM2A 2MY8A 1MLAA 2KVQE 3I0SA 3T1HF 1WC1A 4FXWA 3ZXWA 4J9PA 2HW3A 3NKNA 3W2WB 1TFWA 3RYLA 1HNZF 2HS0A 3H5YA 4V19X 3KXDA 4Y2CA 4KKOB 1F60B 1Y5NB 3GTYX 1S72S 2Q3PA 4CT9A 1VRUB 2ZC4A 4C8YA 3BV8A 4X62J 3F73A 4IQXA 2ZE2B 5HVFA 3PW7A 3IRXA 3I82A 3JAMU 4ATNA 4O0NA 4YDDB 1K44A 1RQ0A 3NLCA 4W4MA 1U25A 2QA4S 4PWDA 4UTGA 1RAOA 3WX4A 3HVTB 2MKSA 2HIYA 3QMQA 5KFDA 4E8UA 3H2LA 3PHTA 4DFKA 4DL0C 1EKRA 5B7WA 4XTTA 3CJ3A 3BGRB 2FJVA 4URQU 2CJQA 4FVCA 1J2VA 4EGLA 3OUYB 1TMJA 2HBZB 2DRAA 2HKEA 1MROB 3L09A 4ZVEA 1DQ9A 1W7WA 4YHHJ 3VAGA 5CCLA 3D5MA 1WF0A 3R1HA 2QL9B 4B3OB 1WTFA 4ED3A 1QVGR 3X3UA 2JC0A 3NCRA 4C8NA 4HH0A 1M1KT 2AEJA 5IWAF 3SZ2A 2J8AA 2G0IA 4B08A 1V9OA 1B0PA 1ZPVA 2KVIA 3FBEA 4C9DA 2OFGX 4ILMA 5CHCB 1OYEA 1SVDA 1TL4A 3D54A 4FNHA 4DX8H 3SFUA 4J9VA 3QJPA 1LK5A 1WG1A 3V2UC 4B3OA 1SV5A 3TWZA 1W26A 2V4RA 3MK2A 4ZHRB 2OPRA 1VYAA 2HFUA 2ZNZA 3MAQA 3HT3A 4S0MA 3D0IE 2DXDA 3TEGA 4ECXA 3LO3A 3NKYA 3KK3A 4C48A 4DZDA 5J2NA 2ZJRQ 3FK4A 4KC5A 3VAFA 3CDWA 3IRWP 2GHVC 2CWXA 3NOCA 5F0UA 3OXGA 2NLWA 3CJRA 2ROGA 3T6JA 3KKFA 3CCVS 2GO8A 1ALHA 1EQ0A 4D3GA 2CQ3A 1UPPA 2HFOA 2LXIA 2KRRA 1F5AA 4Q2MA 2DEJA 1LOUA 4BC7A 5ETNA 5JJBA 4GC7A 4OI1A 5EGYA 3KFWX 2V50A 2ZWPA 1EQMA 3GJQB 1YBUA 4ITSA 4J37A 5E7OB 4P74A 4DL2A 2EG2A 3GIRA 4DR4F 2FJEB 3NRBA 4LF1A 4WE1B 4QW8A 5HQLA 4KJGA 3KUEA 1RDRA 4RWWA 5FDLA 5KFNA 2WW8A 4WIQA 2D3O1 5GADU 2CIMA 3PRVA 1KHWA 3MAAB 1SC3B 2KT2A 1CJVA 3IM8A 4M5NA 4OZ5A 1FESA 5B0EA 5A8WA 1WD6A 3A13A 2FJWA 2B8PA 2PFFB 2DR7A 1FRHA 4B3MJ 2D7SA 4A8QA 2BJ9A 4YB5A 3BO3A 2VPXB 1C0TB 1HKAA 1Q79A 3DHWC 3QBCA 3TAMA 2YNGB 3PY8A 1GAOA 3UDCA 2V34A 1SH2A 3OL6A 2ZH3A 3KJVA 1RU1A 2PMWA 3M8YA 3MAAA 4Y00A 9RUBA 4NMLA 2MQMA 2OLWA 3GR1A 2JH3A 5L1LA 2RILA 1S57A 2NYIA 2OKQA 1ULRA 3H20A 3AXMA 1HPZA 2CQ4A 5C2GA 5AJ9A 2FUG9 1U2FA 2W1BA 3H4DA 1Y5LB 2GS8A 3ITHB 4LSLB 3UVJB 2YKMA 4HEA9 1M5PC 1FI4A 3RB3A 3GPAA 2GIQA 2QLJB 3IS9B 3MECA 2GJIA 2CZVC 3D6MB 3R5CA 3TR5A 4KQZA 2GAHC 2P9EA 2BZ2A 1DLOA 1SH3A 5J1NA 3GG0A 1UEKA 2HFZA 2IUCB 1WC3A 3PFEA 2OI2A 3DLKA 4DPXA 3J7A1 4Y2MA 4QWEA 5IM0A 3HLUA 2Y8WA 4KHRA 4LR2A 1F1BB 1RCOB 2OPQA 2I38A 2XZDB 2Z2ZA 3MM6A 4TKTA 3P5BP 5IV3A 1O99A 3VGVA 2CNLB 2VA2A 4UORA 4CXSA 4UPHA 1P9QC 1VRTB 4IFYA 5D4PA 2GGPA 4U9RA 3QT8A 1RWVB 2O5DA 4TN2A 2W7OA 2DGVA 4OYOA 4A8OA 3MK1A 3RRKA 5H9EJ 3M8SA 2DCUB 3MPVA 3FRZA 1IJFB 4K4YA 1GX5A 1QUVA 3QGIA 5KT2A 1SKRA 1E2SP 2F63A 3KMSA 1DY3A 2QT7A 2HVHA 1F6TA 2XSJA 1DTQA 3HHLA 2UZAA 4I6WA 3DLJA 3KNGA 4O4GB 1Y4ZB 3C14B 3R5BA 4KGVB 3BYPA 1DURA 1WJ9A 1TTHB 2OELA 5AXKA 4LR9A 3AFGA 4JYAF 2AT1B 3JQKA 2YWHA 4F8RA 3UDEA 2MZJA 1ZEBA 5LJ3Y 4XIUA 1EJ7L 2R3VA 4ANEA 3KK1B 3B5QA 3MM7B 3RJMB 2KJWA 2KTQA 3W3SA 1MN7A 1FWKA 3CVKA 5EUHA 1C1CB 1JKHB 2DHSA 3TANA 2R42A 3BSNA 3R6LB 1S6PB 1NEEA 2YQ1A 2DY1A 2BKPA 2V5HG 3TI0A 1KS2A 3DM2A 1SQFA 2F65A 4IRKA 4HHUA 2SXLA 4U7UK 1SHQA 3QPIA 3M30B 2AGQA 5KFMA 5D6GA 1UWAA 2HLUA 5KFXA 3PX6A 1APSA 4FYYB 5HN0A 1ZAVA 1T94A 3AY0A 1M0SA 4FPIA 2ALZA 4DR7J 1AZSB 4KM4A 5KFJA 4RNHA 1VC0A 2BKOA 2KZMA 5DJBA 2HZCA 2MLXA 4RW8B 1KVIA 2X98A 3T5JA 2GMJA 1DARA 1CS4B 3TVYA 2JL9A 3MPDA 5LXRA 2KYXA 1B7FA 1Q82T 3K58A 1S1XA 2NS1B 3D6TB 4CT8A 1JXEA 2G9OA 4X66F 3PKYA 3OFGA 2JNJA 2HNDB 3M6UA 4C3MA 1OY6A 2PO4A 1ZS6A 1GMVA 3DOMB 5A76A 5KFCA 5EDWA 1YVFA 3W9JA 3KLFA 4M1KA 2V6AA 4CLKA 1NJWA 4ZK7M 2ZOGA 2VFTA 1Y7PA 3OTDA 1S77D 4NZ7A 2PC6A 1TAUA 4N7TA 4URSA 1KH5A 2Y3YA 1L3UA 1RT1B 4QQBA 2HNDA 2KFNA 2MZSA 1MU2A 3PJWA 3KDOA 2JRSA 3NNCA 5AXLA 1GH8A 4GKKF 3AOBA 1W2IA 2J7KA 5EX0A 5KXAA 4IYQA 2G0JA 3HSJA 3UO0A 3GV7B 3M4XA 2B8QA 2IJFA 1XERA 3UVJA 4L6V3 3AD8C 3KNAA 2OO4A 1SC6A 3BB5A 3AB2B 4GTZA 3ADAC 2XWYA 1YX2A 2IBOA 3OBIA 3DU5A 4U8YA 1S9FA 5J2PB 3EX7B 1FE4A 4K4VA 3TQ1A 4QWDA 3PEJA 1U47A 4RU9A 3T00A 4PCQA 2E44A 3UN3A 4ZLJA 2IA6A 3QZ7A 4R5PB 4JI7F 3SZZA 1UETA 3C14A 1S6QA 1YITS 2YXLA 3DMJA 4QJVA 1ELZA 3HKWA 5CD4H 1RHUB 4DV6F 2VC0A 1TAQA 1EARA 4HH1A 3MGJA 3SCJE 2W8LA 4RUHA 2CJ9A 2YWKA 2EFNA 2VPYB 1CC7A 3MEDA 3TJAA 2XLJA 2GHWA 2RRBA 1TU0B 3MMAA 4ES3A 5IZHA 2ZOMA 4OX6A 1S0NA 4YB7A 4U8VA 2C2RA 1S5ZA 1HWLA 4ZIVA 1VIOA 4Y2AA 3MR6A 2W5RA 1BUXA 3TG0A 2K3KA 2UP1A 1WNEA 1WEZA 2NUUG 2MJNA 4Q2LA 4PKDB 4ZHRA 5C25A 5KOWA 4FYDA 3VV2B 2Z30B 1RAGB 3FCVA 3GFYA 2W9BB 3UD3P 3LAMA 3MMAB 3GIKA 3D0GE 3GFXA 4Y2KA 4EBEA 5HLFA 3PW2A 3GCXP 1PGZA 1R31A 2HQIA 3RZAA 4GVLA 4M5LA 4M5JA 1HWUA 4CRJA 3CCQS 4YOEA 1L3KA 1FA0A 2IRYA 2LVWA 4RW7B 1FKPB 3RW7A 4ED5A 1QAJA 2ZM6J 2FDNA 1NZAA 4UZCA 3OXFA 4MT1A 4JV1A 2HQCA 2LEAA 4I68A 3W65A 3H98A 3QWPA 4XPCA 2PN6A 1YHQS 3OL9A 1T02A 1ZEDA 3VVTA 2Z4PA 3AQOA 3WAVA 2DGOA 3BGLA 1H2TZ 5KAKA 2R7WA 4ZPVR 2Z8QA 2DBBA 3GMGA 3CJ5A 3EVMA 1HLWA 1B3TA 1XNRF 1U2CA 1U48A 2ZC3A 4NCGA 3VTIA 4YR2A 5IS2A 4EU0A 2EVZA 2HNYA 2MYFA 4IKAA 5K5MA 4O4RA 2RS2A 2J9CA 4RW8A 3NVLA 2QMWA 2IVMA 2LU2A 1KH4A 4WKRA 1YJWS 2AZ3A 4TYAA 2R7OA 2UVWA 1S1XB 2B4OA 5DLFA 1VQLS 2QGFB 4AYBD 2Q6BA 3RR7A 2E7VA 4FYWB 2CG4A 4G65A 2LXFA 2HBYB 3ILJA 2PSZA 3QFWA 2CQ2A 3QWUA 1NK6A 4WP3A 5INHA 2QFJA 2UXCF 1KONA 1FX2A 1WORA 4N47A 1YZ6A 4WYWA 3SDEA 2OPSA 2X1GA 3AJDA 3UI3A 3PW4A 2XEXA 4UUWA 4CO5A 1VBZA 3T19A 5C42A 4DUYJ 1S6QB 4L74A 1YRXA 4KGMA 1KHLA 1X7VA 2W2QP 2LQ9A 3DHXA 3QO9B 3I32A 2VKZG 4LSZB 5HQMA 1NB2A 3NBPB 4DV5J 1Q78A 5A8KB 4C98A 1DTQB 1JMTA 2DTJA 4DBQA 2Q79A 2AGOA 4NLXA 1EJJA 2FQQB 3KLIB 1HNXJ 4YDXA 2W5TA 1KHJA 4JI0F 2OPQB 3MM6B 4LIWA 3E01B 2GVZB 2CDRB 3B54A 5J2PA 1S76D 1PCAA 2YX4A 1NH8A 2LFVA 1RTJA 3CUNA 1JJ2R 4LFCF 1XIQA 1KD1T 5AJ3J 4CYSA 1REVA 3GZ7A 3ZZUA 1QTMA 5HROA 3VAMA 2ATCB 4WP8A 2I1RA 3DGVA 3NS5A 4ETXA 4KYZA 3EJMA 4F4ZA 1UTAA 1WHXA 1PKUA 2QSFA 3TZXA 3HHNB 1UEVA 1NDCA 2B3TB 4XDDA 2LECA 4WF9Q 4GTWA 4J9SA 2RQKA 2GQ2A 4ELUA 1OSCA 2JDJA 2XY6A 1NK4A 2R2TA 2JEJA 2E1PA 5HROB 1U8SA 3M8QB 1JLAB 5GVQA 2ZH7A 2MKJA 4CXUA 3D66A 2ZH8A 1NLKL 1U0HB 1VBYA 2CG8A 4CM0A 2W7AA 2HHVA 5LMNJ 3R5DA 2KZZA 3AA8A 3HZEA 1HMVA 3J7YU 1UVMA 4GKJF 1PO6A 4KPYA 3IBWA 1BHNA 1IBLJ 2YKAA 3DN9A 1TKZA 2XULA 1FKAF 3JAMY 3GIIA 3KHGA 2FJAB 4A8FA 5D0GA 2G4BA 3QRRA 1LW0B 2Y1IA 1VFJA 4JI5F 4Q8EA 2GQCA 3EUNA 2RF2B 3HVAA 4IUFA 3R2DJ 1UL3A 2CPYA 3Q0AA 4FKYA 2GC8A 3UNGC 2VBXA 3MPUB 4KGZB 1G4CA 4LRDA 4EO6A 5K8MA 3HPOA 3P3DA 3KG1A 3AB4B 3VALA 4O3NA 3CCLS 3DOKA 4Z37A 1NK9A 2NSBA 4LSNA 3W5ZA 5KFTA 2HWHA 3PJ9A 1N32J 3DLEB 1HBMA 2QO3A 3IR7B 5A8WB 4NWXA 3KTQA 1WF2A 4OV6A 2R7VA 3GFHA 3I0SB 4PG6A 1TL1B 4UOCA 3R1LA 4J9KA 2VODA 2DNNA 1S4FA 1HWIA 3MHYA 4F25A 2EBEA 5G4DA 1Z1ZA 2R8GA 2HVDA 4KKOA 3W2VB 2CQDA 4X4NA 5C42B 2HFSA 4E0DA 3FKBA 1YDLA 4RBUA 5IWAJ 2AHOB 1U6ZA 3LP2B 5KFYA 1VBXA 1P27B 2NYHA 1KTQA 2IDLA 3KHRA 3K57A 4GTYA 1NAQA 3I0RA
chains in the Genus database with same CATH topology
4LR9A 5EGEA 5IJSA 5L0BA 1URAA 1ZEBA 3UNYA 2ANHA 3B5QA 4LR8A 5LQQA 4UPLA 1Y6VA 1P49A 1O98A 3M8WA 2GSUA 3NVLA 4MY4A 1KH4A 3DYCA 5L0KA 2XR9A 2IFYA 1ZEFA 5K4PA 1URBA 1SHQA 2W5SA 3TWZA 2ZKTA 2W5VA 3MK2A 3KD8A 3IGZB 4YR1A 1AJAA 3NKOA 1KHKA 4UPKA 3T01A 5DLWA 1HJKA 1ALHA 3BDHA 4MHXA 1N2LA 5INHA 4KM4A 2W5XA 2QZUA 1EQJA 3BDGB 2X98A 2GSNA 4B56A 2IUCB 2VQRA 3WAWA 3WAYA 4LRAA 3UN5A 4LREA 1ED9A 1ELXA 3WBHA 1KHLA 3M7VA 4CYRA 5L0EA 4LRCA 1EW2A 5DLVA 2GLQA 1AUKA 1K7HA 1EI6A 3T02A 3M8ZA 1EW9A 1Y7AA 3IGYB 2IUCA 1EJJA 3BDGA 4N7TA 4TN0A 1HDHA 1KH5A 4KJGA 1E3CP 2W5TA 1KHJA 5LRNA 4KAYA 1AJBA 4KAVA 3UN2A 1E33P 2GSOA 3NKQA 4QAXA 5KXAA 2W5QA 3UO0A 4CYSA 1B8JA 2W8SA 5HRTA 5IJQA 3OT9A 4LR2A 4KJDA 1AJDA 1N2KA 4GTZA 5GOVA 4GTWA 3WAXA 1ED8A 3NKMA 2W5WA 3TX0A 3M8YA 3MK0A 4UOOA 2G9YA 3BDFA 3T00A 4FDJA 5DLTA 1ANJA 3UN3A 4CXUA 3SZZA 4LQYA 3NKRA 5AJ9A 4ZG7A 1ANIA 3ED4A 1ELZA 4ZG9A 3Q3QA 5EGHA 2GA3A 1ALJA 4MIVA 2D1GA 1SHNA 3DPCA 4LR7A 4LRFA 4ZG6A 1KH7A 4ZGAA 2W5RA 3TG0A 1ALKA 4UPIA 1ELYA 4LRDA 1ALIA 3SZYA 3NKNA 1E1ZP 5GRRA 3LXQA 1O99A 4NWXA 4NWJA 5LIAA 1EW8A 3IDDA 4UORA 4CXSA 4UPHA 5C66A 1KHNA 2W8DA 3CMRA 3NKPA 4LRBA 1AJCA 4GTXA 3MK1A 3A52A 2XRGA 1E2SP 1KH9A 4CXKA 1HQAA 4UOPA 5TJ3A 1FSUA 1ZEDA 2RH6A 4FDIA 4GTYA 3WAVA 5LRMA 3E2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LR9 A;  5EGE A;  5IJS A;  5L0B A;  1URA A;  1ZEB A;  3UNY A;  2ANH A;  3B5Q A;  4LR8 A;  5LQQ A;  4UPL A;  1Y6V A;  1P49 A;  1O98 A;  3M8W A;  2GSU A;  3NVL A;  4MY4 A;  1KH4 A;  3DYC A;  5L0K A;  2XR9 A;  2IFY A;  1ZEF A;  5K4P A;  1URB A;  1SHQ A;  2W5S A;  3TWZ A;  2ZKT A;  2W5V A;  3MK2 A;  3KD8 A;  3IGZ B;  4YR1 A;  1AJA A;  3NKO A;  1KHK A;  4UPK A;  3T01 A;  5DLW A;  1HJK A;  1ALH A;  3BDH A;  4MHX A;  1N2L A;  5INH A;  4KM4 A;  2W5X A;  2QZU A;  1EQJ A;  3BDG B;  2X98 A;  2GSN A;  4B56 A;  2IUC B;  2VQR A;  3WAW A;  3WAY A;  4LRA A;  3UN5 A;  4LRE A;  1ED9 A;  1ELX A;  3WBH A;  1KHL A;  3M7V A;  4CYR A;  5L0E A;  4LRC A;  1EW2 A;  5DLV A;  2GLQ A;  1AUK A;  1K7H A;  1EI6 A;  3T02 A;  3M8Z A;  1EW9 A;  1Y7A A;  3IGY B;  2IUC A;  1EJJ A;  3BDG A;  4N7T A;  4TN0 A;  1HDH A;  1KH5 A;  4KJG A;  1E3C P;  2W5T A;  1KHJ A;  5LRN A;  4KAY A;  1AJB A;  4KAV A;  3UN2 A;  1E33 P;  2GSO A;  3NKQ A;  4QAX A;  5KXA A;  2W5Q A;  3UO0 A;  4CYS A;  1B8J A;  2W8S A;  5HRT A;  5IJQ A;  3OT9 A;  4LR2 A;  4KJD A;  1AJD A;  1N2K A;  4GTZ A;  5GOV A;  4GTW A;  3WAX A;  1ED8 A;  3NKM A;  2W5W A;  3TX0 A;  3M8Y A;  3MK0 A;  4UOO A;  2G9Y A;  3BDF A;  3T00 A;  4FDJ A;  5DLT A;  1ANJ A;  3UN3 A;  4CXU A;  3SZZ A;  4LQY A;  3NKR A;  5AJ9 A;  4ZG7 A;  1ANI A;  3ED4 A;  1ELZ A;  4ZG9 A;  3Q3Q A;  5EGH A;  2GA3 A;  1ALJ A;  4MIV A;  2D1G A;  1SHN A;  3DPC A;  4LR7 A;  4LRF A;  4ZG6 A;  1KH7 A;  4ZGA A;  2W5R A;  3TG0 A;  1ALK A;  4UPI A;  1ELY A;  4LRD A;  1ALI A;  3SZY A;  3NKN A;  1E1Z P;  5GRR A;  3LXQ A;  1O99 A;  4NWX A;  4NWJ A;  5LIA A;  1EW8 A;  3IDD A;  4UOR A;  4CXS A;  4UPH A;  5C66 A;  1KHN A;  2W8D A;  3CMR A;  3NKP A;  4LRB A;  1AJC A;  4GTX A;  3MK1 A;  3A52 A;  2XRG A;  1E2S P;  1KH9 A;  4CXK A;  1HQA A;  4UOP A;  5TJ3 A;  1FSU A;  1ZED A;  2RH6 A;  4FDI A;  4GTY A;  3WAV A;  5LRM A;  3E2D A; 
#chains in the Genus database with same CATH topology
 1YJU A;  1SL0 A;  4NRU A;  4CO1 A;  3P8B B;  4BHQ A;  4YHH F;  3VAH A;  1JLC B;  2O1P A;  4F04 B;  4C6A A;  4V19 J;  1O8B A;  4H4K C;  2RHQ B;  4DSJ A;  4H54 A;  3GJS B;  4YEA A;  3CB4 A;  1T7P A;  2CQG A;  2XI3 A;  4R25 A;  4OHZ A;  2VDI A;  4D3H A;  1HBN B;  3M8W A;  5CYM A;  3W62 A;  1F9E B;  3DLL Q;  2CJB A;  1BQN B;  2VFU A;  4KRW A;  4LFC J;  2XGP A;  4K4U A;  2OJ3 A;  2RQM A;  3IGN A;  1KQK A;  4G6V B;  5L39 A;  3V6J A;  5J2Q B;  2XR9 A;  3U1L A;  5L0K A;  5K4P A;  3TUI C;  2YNI B;  3MCM A;  1OO0 B;  4DG1 B;  5C24 B;  5K20 B;  3SV4 A;  1HR0 F;  3FMW A;  1WG4 A;  1NPK A;  1HBO B;  3BQ1 A;  5HP1 B;  3MR2 A;  4HAC B;  1RT6 A;  2A3J A;  1VQ9 S;  5M2P A;  2UUA J;  4GVB A;  4ELT A;  3VGU A;  1QY7 A;  3BDG B;  1KOH A;  1ZA1 B;  5HBM B;  3DU6 A;  4HT7 A;  1PYS B;  3UDV A;  4B9U A;  4OHX A;  4IRD A;  2AIR B;  4DUY F;  1TKD A;  4DPW A;  3MTJ A;  4JI2 J;  4LRE A;  3AJ1 A;  4BCA A;  3JSY A;  2BJ8 A;  1X4F A;  2YWW A;  3VAI A;  4ECY A;  1QE1 B;  4DR3 J;  1QAY A;  2UUW A;  5GAD I;  2AF6 A;  1HIY A;  4B02 A;  2KHD A;  1EKS A;  2VG5 B;  1CUL A;  4NEZ A;  5FII A;  3PZP A;  3A3P B;  2BQR A;  2R9L A;  2FVR A;  3UW1 A;  4N8N A;  4JUZ A;  1HDH A;  5J2M B;  4YY3 F;  3BSC A;  2B4U A;  4WYL A;  4TLR A;  1VC5 A;  3CC7 S;  5AT1 B;  1TL3 B;  3T1A A;  3G8S A;  1FRJ A;  3VR1 A;  1GNK A;  3M32 A;  4DQQ A;  2OSR A;  3IR6 B;  4Z2X A;  1XNQ J;  3P49 B;  2EPI A;  2AJ0 A;  1HL6 A;  2IM1 A;  4LBI A;  1WC5 A;  2XMA A;  2CQ0 A;  3LOU A;  3ET6 B;  4L72 B;  2KHC A;  1X9S A;  2WSE C;  4YR0 A;  3BN4 A;  4NLW A;  4NA1 A;  4C7Q A;  2GJ2 A;  2MKC A;  4CZC A;  3D3C J;  1VOM A;  2VIH A;  5D3G A;  1PJ7 A;  3AJ2 A;  3O2I A;  4TVA B;  3NKM A;  3HI9 A;  1SJ1 A;  1T11 A;  1CBK A;  3W2V A;  4EK2 A;  1AUS L;  2L9W A;  3HXM A;  1IKX B;  4DL4 A;  3HMJ G;  5CXT A;  3MK0 A;  1OY8 A;  2R7S A;  2N3L A;  3N0V A;  4P2S A;  4PPD A;  4IG3 A;  4O3P A;  3H40 A;  2R8I A;  4JI0 J;  1VQ6 S;  5KG4 A;  1D8Z A;  2B9W A;  1MWQ A;  2WHO A;  2MGZ A;  4BC9 A;  2CPZ A;  1IKW B;  4UPL A;  1E6Y A;  4J5O A;  2PEH A;  2ZHO A;  3HD2 A;  4NLS A;  4PG5 A;  4X4P A;  2D9O A;  3ZZY A;  4IG0 B;  2XC9 A;  1VI7 A;  2VU5 A;  2F40 A;  3P45 B;  1Y5I B;  1Q8B A;  2C2O B;  3IA0 A;  2R8K A;  4O3S A;  1KN6 A;  1LWX A;  3K17 A;  2OGU A;  3T41 A;  5H9E K;  2DNM A;  3M2V B;  1SIW B;  3JSB A;  4U96 A;  2EK1 A;  3VZH A;  2MQP A;  2P5V A;  2HHQ A;  5F3T A;  2VBZ A;  4DV0 J;  1UEU A;  4RWX A;  2B6A A;  1Q7Y T;  4P75 A;  4NYO A;  1WOS A;  4X84 A;  3E01 A;  3WX8 A;  1FK9 A;  1HNW F;  1EP4 B;  1VQO S;  1C1B B;  4N41 A;  2HQD A;  2E5J A;  2JC1 A;  3VHQ A;  3O8W A;  5IOL A;  5DLG A;  5C66 A;  2QA1 A;  4K2X A;  4CYU A;  1DTT A;  2OTL S;  2RNE A;  4KJI A;  4M5M A;  2B4V A;  4NLQ A;  1SBR A;  1Q53 A;  4WU2 A;  3N79 A;  4DQS A;  4C8O A;  2C2D A;  4K4S A;  2JOQ A;  2MZQ A;  3V6D A;  2HMI B;  2MB0 B;  4P9S A;  2V94 A;  4JI4 F;  2M70 A;  2NZC A;  1BQN A;  1NHK L;  4ZVG A;  5T7L A;  2VDH A;  8AT1 B;  1A0O B;  4CLU A;  1E6V B;  2J8S A;  5BR8 J;  2RH6 A;  1FVQ A;  3W9H A;  2XCP A;  2DGW A;  2XQC A;  3E2D A;  3KUH A;  4CLL A;  2YNI A;  4OYM A;  5C24 A;  3AH6 A;  1RT3 A;  1JXV A;  1YRT A;  3MI7 X;  4OIX A;  4K4T A;  4DFP A;  2AU0 A;  2OSQ A;  2VFS A;  4J7C A;  2VFR A;  2JWN A;  3OTC A;  5A0Y B;  2ZBP A;  3HVT A;  4DQI A;  4ZP8 A;  3Q8Y A;  4OZN A;  4J90 A;  5HBM A;  4MY4 A;  1QJH A;  4IQM A;  5HVH A;  3K5M A;  5DO2 A;  4DR5 F;  3GQC A;  2A0F B;  1BWV A;  4C11 B;  1S9E A;  3CJT A;  2Y8Y A;  2MZ1 A;  4AXJ A;  2LEB A;  3CDA A;  1N5V A;  3SEO A;  4H4K A;  5HAN A;  1RAA B;  3KUG A;  4EUV A;  1QE1 A;  1XMB A;  2QMX A;  2EFQ A;  4Q5V A;  5DGA A;  3NKO A;  1LK7 A;  5ETV A;  4U67 Q;  5B0C A;  4MHX A;  2CVE A;  4MMO A;  3ZNU A;  3UPF A;  5RUB A;  1U4B A;  4NI2 A;  4NLD A;  2KO1 A;  1RSC A;  2V9K A;  2JSX A;  4W90 B;  4EO8 A;  2HHS A;  4Y28 C;  2QIF A;  3RAM A;  5ETK A;  1VCT A;  4Y65 A;  5ITH A;  2R2R A;  1U1L A;  2OD4 A;  2K7K A;  3OW2 R;  1X9W A;  1X8D A;  3FSX A;  4IO1 A;  3WBH A;  3JQJ A;  2ZBR A;  2CKW A;  2W4P A;  5DLV A;  2GLQ A;  1R0A B;  5F3Z A;  1FHT A;  3EIC A;  2XTJ P;  3KJN B;  5L1K A;  3NCP A;  2X1B A;  3IGY B;  2XZT B;  4KHP J;  5KT5 A;  5GMK a;  2HHW A;  3AOA A;  1FJ7 A;  3TYT A;  4PQU A;  1K1S A;  4QPT A;  2PE8 A;  1N36 F;  4ID8 A;  3LP0 B;  4LUB A;  3TX8 A;  5ETL A;  2C2N A;  4DSL A;  1IVZ A;  1NKB A;  1RTI B;  2GVD A;  4LFB F;  3C6U A;  1TL7 B;  5DET A;  1RAE B;  2XNQ A;  3NKQ A;  1IBM J;  5FD1 A;  5KFL A;  1UVI A;  2CQB A;  1T9Y A;  1RTH B;  1Y00 A;  2QJ3 A;  3H5U A;  1LXJ A;  3QT6 A;  1FJE B;  1VQ4 S;  1CVJ A;  1B8J A;  5HRT A;  2MLZ A;  5EWF A;  5CCM A;  3T5H A;  4JYA J;  1RB0 A;  3POT B;  1J5E F;  1NDL A;  4K5S A;  1TL7 A;  4X4T A;  1X4C A;  5LSO A;  1B70 B;  2FY8 A;  2BRL A;  1TKT B;  1TK8 A;  3CED A;  1HW9 A;  4P52 A;  5T7L B;  2Q6C A;  2DHG A;  1KHV A;  1K9M T;  2OPS B;  4OLO A;  2RKI B;  2XBP A;  1UVK A;  3M2R A;  4IFV B;  5JVH Q;  3PFO A;  4NRT A;  3ETO A;  2XNR A;  2BDP A;  2CPD A;  2I8E A;  1FD2 A;  4M5D A;  1DQ8 A;  4ZP6 A;  4FS2 A;  1MNE A;  3EPI A;  2NPF A;  3OVB A;  2R8H A;  3E2E A;  5IQQ A;  1C1B A;  3SQG A;  5IT4 A;  1HQU A;  4DL7 A;  2H5I B;  2DNO A;  3FCW A;  4NXN J;  3HFV A;  3L9Z A;  5ETR A;  4K2J A;  2CZ9 A;  5HQ8 A;  3DNC A;  3HHE A;  4LF5 F;  2MTL A;  1S1U B;  2GNK A;  3M1V A;  1HHQ A;  5F0W A;  4LFA J;  3MR3 A;  3IGV A;  3ONQ A;  4P73 A;  4UPI A;  1RGV A;  5JUM A;  2XYP B;  2NXE A;  3BGF A;  4O44 A;  5KFH A;  1LEO A;  4B9N A;  1AFI A;  4FDI A;  2ABY A;  2ZH1 A;  4ZDN A;  4WFX A;  3CC2 S;  1U1P A;  1Y3J A;  4CM2 A;  4NWJ A;  2NSC A;  4JV5 F;  4DF4 A;  4LMZ A;  3LAK A;  4JOU A;  4DEZ A;  5L1J A;  4ED1 A;  3CTR A;  3NKP A;  2ASY A;  3K7R A;  3J80 U;  1XN9 A;  2YKP A;  3R9L A;  1HFE L;  3V4I A;  2AP6 A;  5CZV A;  1LKZ A;  1TUV A;  3NAH A;  5I4M A;  2HVI A;  3G4S S;  1XC9 A;  1T8E A;  1P1T A;  4X4O A;  3GJR B;  1HQA A;  1XQI A;  4JV5 J;  1GTE A;  2QC3 A;  2HFV A;  3L7U A;  1DFD A;  1U09 A;  2DIV A;  5LRM A;  2QA4 G;  2RS8 A;  2OPP B;  2ZHB A;  4IG3 B;  2HRU A;  2K1R B;  1TL3 A;  3CD0 A;  2K8G A;  2M3D A;  1YZ7 A;  4KFB A;  1HI8 A;  1FEH A;  4DFM A;  2M9K A;  3QAT A;  5DGB A;  4OI0 A;  3SSQ A;  3BJY A;  1X4G A;  2LMI A;  1VMB A;  1HI1 A;  2JLE A;  2CPJ A;  1C0U A;  3AQP A;  3R7S B;  1PSD A;  3TEH B;  2RF2 A;  5D15 A;  4ZLP A;  2H5E A;  2GSU A;  4ZVO B;  4LF4 J;  2UV8 G;  1N5T A;  5E5N A;  1QAI A;  3DI6 B;  2EW9 A;  1NJZ A;  1SJQ A;  1LFP A;  1OPZ A;  2W4C A;  3LPE A;  4WFN Q;  3MEE B;  4M63 A;  4OI4 A;  4NCG B;  3K2Y A;  4F3Q A;  3IGZ B;  3D1O A;  1GX6 A;  3PDN A;  4OYZ A;  5L9N A;  3OVA A;  2CJX B;  4R8U A;  3KK1 A;  2B6A B;  4AUK A;  2UUC J;  2ZKU A;  5F8N A;  3OR2 A;  1U49 A;  2R8J A;  5CD4 A;  1NXI A;  4KV8 B;  4LF6 F;  2XG8 A;  1UJ4 A;  4B3T J;  4LVO P;  4MFB B;  1H38 A;  1ZH5 A;  3OR1 A;  2VAS A;  2BUN A;  2BMB A;  2R7X A;  2W2P P;  5K14 B;  1SKS A;  1R8P A;  2F4V F;  4JI1 J;  4CYR A;  4I67 A;  4YUD A;  3BSA A;  3HD1 A;  4QR2 A;  3I0R B;  1EI6 A;  2FIU A;  2E9Z A;  3L4B C;  4EI2 A;  1S10 A;  4OV1 A;  3DDK A;  1R8A A;  3M8P B;  2XHC A;  1N2L A;  4ZJL A;  1VQK S;  4IOB A;  2C42 A;  4RW6 A;  2GZO A;  4MK8 A;  4OZ1 A;  4AD6 A;  2RDJ A;  1G7C B;  4RBT A;  5LRN A;  2QSW A;  2VG7 B;  3OXL A;  1IM6 A;  1GFW B;  1S6U A;  3CDU A;  2VPZ B;  2A18 A;  3BKF A;  1JIH A;  5CAB A;  8RUC A;  1FRI A;  1Y9O A;  1AA1 B;  1SIZ A;  4M5K A;  3OHA A;  2JEI A;  4QPX A;  2YX1 A;  2BW2 A;  2JHE A;  1FWP A;  2GVZ A;  2B9E A;  3CCT A;  3M2U A;  1DBD A;  2CAJ A;  1HBO A;  2CPX A;  4NWB A;  2FPH X;  3ITH A;  3N4W A;  4LSL A;  5DRK A;  2G0C A;  4ZVR B;  3UDL A;  1IBK F;  3TQE A;  3TAQ A;  1T05 B;  4GVB B;  2XO6 A;  4Q44 A;  3T5L A;  2UVR A;  1R0B G;  1YWX A;  1JLQ A;  3EDR B;  4RL1 A;  4OX9 F;  4RUA A;  1RBO B;  3DOL A;  2LKZ A;  4LQY A;  2RAQ A;  1TL5 A;  4U7U D;  3AA9 A;  2CPI A;  1MWY A;  1X4E A;  3HFZ B;  3TOQ A;  3PW5 A;  2E1C A;  4Q0B B;  3H2V E;  2KFZ A;  4IDK B;  1PG5 B;  2PGC A;  4TU9 A;  1NME B;  2MXY A;  3PYG A;  4X62 F;  5IM0 B;  3G86 A;  1UVL A;  4MIV A;  1RKJ A;  1C2P A;  1UKU A;  2QA2 A;  3ZC4 A;  1UP1 A;  5D77 A;  2UU9 F;  2I5J B;  2RD5 C;  4DMZ A;  2NRE A;  1FXD A;  2A10 A;  2MST A;  4CIO A;  1Y0H A;  3EVW A;  5DM7 Q;  2BJD A;  1VQ7 S;  1RYR A;  4WFA Q;  4DCP B;  2E1M C;  1SQE A;  3T1H J;  2KL8 A;  3BPD A;  4PQU B;  2ZVS A;  4EEY A;  1YJR A;  1ELO A;  2AKW B;  4Y6I A;  3RB4 A;  1I94 J;  3KLV A;  4Q8F A;  2OP5 A;  4CLP A;  1T9V A;  1RTI A;  2GVD B;  3NG8 A;  2OPP A;  4FN5 A;  5FJ4 A;  1X4D A;  2GMH A;  3CJK B;  2B7B B;  4J9N A;  3ZO7 A;  3PYF A;  1N36 J;  5KFA A;  1RTD A;  2FVQ A;  2CNK B;  3DYA A;  3KLG A;  3EVO A;  1ZM9 A;  1U1N A;  3POT A;  1WSV A;  2E1A A;  3HCX A;  1N34 F;  2O3D A;  5HLF B;  2I6W A;  5HSP A;  1LWE A;  1T9W A;  1VQ8 S;  5L0B A;  3OJS A;  1WKL A;  3M9O B;  3LP2 A;  5CH7 B;  5FDL B;  2DT9 A;  1QTN B;  4NZ6 A;  1TVR B;  4ZN1 A;  2W2N P;  1N52 B;  2D3U A;  4E2F B;  3LPY A;  1R6Y A;  4MYU A;  4P7T A;  4A8W A;  2ALY B;  1RE1 B;  3TW0 A;  4AXI A;  4DCJ B;  5D0R A;  1IWA A;  1T9T A;  1UFL A;  3DC2 A;  1IKV B;  1RAF B;  3ILO A;  3LW5 C;  4LF2 A;  5D4L A;  4DR5 J;  2AYB A;  3KD8 A;  1FK9 B;  4YR3 A;  1RT5 B;  2OML A;  4DHV A;  3R7N B;  1UCN A;  4ETZ A;  4OZJ A;  2V68 A;  4UPK A;  1NPR A;  1KQG B;  1YRU A;  2KN4 A;  1JX4 A;  2DO4 A;  3QRQ A;  3VZI A;  4CYU B;  2V69 A;  1P9Y A;  1L3T A;  1UW9 A;  2U2F A;  3MPY A;  3O1L A;  5E3R A;  5KTQ A;  3WZ0 A;  2FVC A;  3HHL C;  4UOG A;  2J6S A;  1G1X A;  1RAD B;  2UUB J;  1IXK A;  3UQS A;  6AT1 B;  1RAB B;  1JXL A;  1TKX B;  4M5I A;  3EPG A;  2I9S A;  3IWX A;  3P96 A;  4ZPT R;  3O44 A;  5L0E A;  2BVZ A;  3ICL A;  1RYS A;  1N33 J;  1REV B;  1NZ8 A;  3HHD A;  3Q22 A;  2XO7 A;  1SL1 A;  3SQO P;  3MEC B;  1BGX T;  5BR8 F;  4DV7 F;  2N7C A;  5GAH U;  1HWK A;  2KG1 A;  5F8I A;  3IAM 9;  1F9H A;  1VJQ A;  2CAD A;  4Y3C A;  3KOA A;  1M1G A;  3HVR A;  1U1Q A;  3CWJ A;  1EIY B;  3RAQ A;  1SB6 A;  1J27 A;  1V3R A;  1IN0 A;  1QAX A;  2AMC B;  2GSO A;  1YBT A;  3JB9 k;  1OJ4 A;  3UR0 A;  3I55 S;  1CJU B;  2NR0 A;  4EMD A;  1K0V A;  2OEM A;  3NGU A;  4QYZ K;  3J80 Y;  4NLV A;  5F8G A;  2ZFH A;  3R7B B;  2IYI A;  2W25 A;  3FUY A;  1FKO A;  3FBB A;  5HI7 A;  3WIU A;  5ETO A;  2FZK B;  4DV0 F;  1U26 A;  3LGN A;  4F4X A;  5AE1 A;  2QN6 B;  4B3M F;  1JNR B;  2IM2 A;  5HO4 A;  4RNN A;  2BOP A;  2CA9 A;  1TKZ B;  2X51 A;  1H7W A;  2GW8 A;  2AQ4 A;  4B9S A;  4JV2 A;  2GIF A;  2ZD1 B;  3N6M A;  4JB8 B;  4AND A;  3OL7 A;  1S0O A;  4UOO A;  2BE2 B;  3OQ2 A;  2DPJ A;  1IQT A;  2NUH A;  3AOC A;  3ET6 A;  2X7I A;  3N01 A;  4ZPW R;  5LMU J;  4DQR A;  1J5O B;  4OYA A;  2DR5 A;  2XSF A;  5KG1 A;  1FER A;  1VHI A;  2PDA A;  5ETQ A;  2DNR A;  3AT1 B;  3CJQ A;  5D8H B;  4TY8 A;  1NU4 A;  4PUO B;  4K0K J;  1WC6 A;  1JWW A;  1L3S A;  1CQN A;  1X60 A;  4OI6 A;  4AT1 B;  3MFH A;  1K8A T;  1X5P A;  1FFW B;  2C3Y A;  1Q7L B;  1ZAX A;  3DLE A;  2UXB F;  4DFJ A;  1F2H A;  4EBC A;  3MMB A;  1XMQ F;  2POK A;  4F3O A;  1HA1 A;  1AT1 B;  1LW2 B;  2G13 A;  4QZV B;  2CRL A;  2Y1R I;  1UZH A;  2HNZ A;  1FDD A;  2CXE A;  2FHK A;  3RBZ A;  3H5X A;  3PR5 B;  2Z2L A;  3DRX A;  3OSP A;  1FWL A;  3MR5 A;  1XMO J;  2XYG B;  3N6L A;  2F1F A;  3BO4 A;  3HX9 A;  4DV4 F;  1KFD A;  2KT5 A;  3OTB A;  2DPI A;  4WXW A;  1GMW D;  4B3S J;  1LWE B;  5F8J A;  3IDD A;  1PAU B;  1KBR A;  2APO A;  3THV A;  2EC0 A;  3CMQ A;  4B3R F;  3X1L B;  3PYD A;  1K73 T;  1JK9 B;  5KFI A;  2HUR A;  3PEH A;  2E5G A;  1F5C A;  1S48 A;  2ILZ A;  2OEJ A;  3LAN A;  4X64 F;  4DSK A;  3J7A N;  2P9G A;  1WSR A;  3LF0 A;  1TV6 B;  4WFY A;  4G3I A;  1UVJ A;  4Q7A A;  9ATC B;  4FZV A;  4WBF A;  5A8R B;  2DNK A;  3GIM A;  1YJT A;  3TAP A;  3FMB A;  5KG3 A;  3I56 S;  4DR3 F;  3QAU A;  4HI2 A;  1RTD B;  1WEL A;  5IQ6 A;  2C2M B;  3Q89 A;  1RAI B;  4LBH A;  3W5X A;  4P72 A;  4ZLL A;  3QZ8 A;  2VG6 A;  3BQ0 A;  1QSS A;  2HZV A;  5EGE A;  1VLY A;  1HPZ B;  4QBU A;  3C15 A;  4KH1 B;  2E9T A;  3MEG A;  1N5Y B;  4IOA Q;  3V5R A;  1LWC A;  1X5T A;  1XR5 A;  2BM0 A;  2IM3 A;  2XMV A;  4LR8 A;  4UW2 A;  4MIB A;  5ETT A;  2ZH4 A;  1T0T V;  4J9M A;  2YH1 A;  2N4D A;  4DCO B;  2E5L F;  4DLG A;  4OI3 A;  1JQG A;  1YGY A;  2NQP A;  3I9Z A;  2FGC A;  3NAI A;  1MWZ A;  2WK4 A;  3FFI B;  2FLN A;  2VA3 A;  1HR0 J;  3CO9 A;  1UA0 A;  2W5S A;  4DLE A;  2PD1 A;  5F9L A;  3DRS B;  3OLB A;  2XI2 A;  2Q43 A;  2VIC A;  3CC4 S;  4UQT A;  2W5V A;  3GR0 A;  1NDP A;  2E5H A;  4FYV B;  2Q66 A;  1AB8 A;  3T01 A;  1RWU A;  3N5B A;  4QIE A;  1K1Q A;  2H54 B;  4X2B A;  4JI6 F;  2WON B;  4UT4 A;  1ZTT A;  2C1E B;  2HG4 A;  4O0I A;  1CC8 A;  1UJ5 A;  3MUV P;  1S79 A;  3DRS A;  1VRT A;  3LP1 A;  3WAY A;  1Q16 B;  4X65 J;  2M0G B;  4DR2 F;  2X3D A;  1S1V A;  1I6J A;  1R3N A;  2XWX A;  4OYP A;  2D74 B;  4ED7 A;  1WC4 A;  1Y10 A;  1A7G E;  4AQY J;  2I5J A;  4DSE A;  1SL2 A;  2HHH J;  1BQM A;  5DQH A;  1YJV A;  1ZBT A;  1CJK B;  3OL8 A;  3OUY A;  5C5J A;  3FEY B;  3OFF A;  3CW2 C;  1N0U A;  4MKV A;  4DV2 J;  2R4F A;  3MEK A;  3ZTQ A;  1O6X A;  2A6M A;  2DRD A;  2EWH A;  4ZVS B;  4WCE Q;  1RP5 A;  5ADZ A;  1NSK L;  3GU0 A;  2WSF C;  3GG1 A;  1E3C P;  3N5F A;  4QWB A;  3SBM A;  3DLG A;  3GYG A;  3HUL A;  2BBE A;  4XDC A;  5C25 B;  4N56 A;  1R0A A;  4DQP A;  4F7V A;  3AXK A;  3I96 A;  2W9B A;  3NGR A;  3IO1 A;  4K4X A;  2EK6 A;  4YQW A;  1T9X A;  1NCL A;  3VWS A;  3FZB A;  1L5U A;  5ETP A;  5IT9 U;  3I5B A;  3DLB A;  2HGM A;  2Y9H A;  2MGZ B;  4HTJ A;  1JLA A;  3TJ9 A;  1HD1 A;  2W8S A;  2E7W A;  2DYA A;  4RNF A;  1HW8 A;  1WHW A;  3C16 B;  1N5S A;  3K5P A;  3LP0 A;  1V6H A;  3DFE A;  1GXT A;  4OJH A;  5HAT A;  4DX5 A;  3Q2T C;  1AJD A;  2F8M A;  4HR2 A;  3RU0 A;  2RB7 A;  3NP5 A;  4C0B A;  1T3O A;  1PIL A;  2P6T A;  5J2N B;  3V6K A;  4USK A;  1RHQ B;  5LT5 A;  2RRA A;  4K59 A;  3U7J A;  3HKZ D;  1HWJ A;  3A8I A;  3RB6 A;  4KR0 B;  2XM3 A;  4F0M A;  4GKJ J;  3UR3 C;  2X1F A;  1UMJ A;  4DF8 A;  5DDP C;  4K0K F;  1KQF B;  2AWZ A;  2V8H A;  4NXM J;  3NS7 B;  4ZG9 A;  3W60 A;  5AXN A;  2J0Q D;  1VQS A;  4MIA A;  4RX6 A;  2DH9 A;  1NPP A;  1N5Y A;  2E29 A;  3F56 A;  4BLG A;  5LMU F;  3E3X A;  2FHJ A;  3DGP B;  3FEX B;  3ZZP A;  2YQ0 A;  2PI4 A;  1EB0 A;  1X31 C;  3TZW A;  2K2P A;  4ZGA A;  2EC2 A;  3G82 B;  4CLT A;  1IKV A;  1ZZF A;  3ISN C;  2IY5 B;  4ZG7 A;  3EE3 A;  3Q2S C;  1Z2L A;  2IIH A;  2UUT A;  3SZY A;  3BGO P;  2UXD J;  4NA3 A;  3GYN A;  3MR7 A;  4NCB A;  1JJ4 A;  4CI0 B;  2DXF A;  5CQG A;  2KYZ A;  3TZY A;  4RW9 A;  1D9A A;  2IYG A;  2MQN A;  1C0T A;  1RK8 A;  3PAC A;  2F4F A;  4USM A;  2B43 A;  1IR2 A;  2MY7 A;  3A52 A;  4TLQ A;  2JFK A;  3M6V A;  4DZ6 A;  1WTB A;  2IFX A;  1TUW A;  3HZG A;  3MPW A;  3PJX A;  3K5O A;  3IP0 A;  1Q1K A;  5HL7 Q;  3FFI A;  5KG5 A;  4B9L A;  2B5J B;  4TNO A;  2F7V A;  5KG2 A;  4ED4 A;  4QCL A;  1RT1 A;  2DHA A;  3QSI A;  3B4M A;  3C46 A;  4GC6 A;  1FE0 A;  1VQP S;  2MKH A;  4FF4 A;  1IKY A;  2HWI A;  2IJR A;  3W64 A;  2UXB J;  5D78 A;  3U1M A;  3ZTR A;  4F36 A;  1X0P A;  1SJ3 P;  3G8Q A;  5LQQ A;  3FQK A;  2R2S A;  3V81 A;  1UAW A;  1Q8I A;  5HMZ A;  2ZVI A;  4M5H A;  2Q1L A;  2E66 A;  5KFP A;  3VAK A;  1NJX A;  4F2S A;  4C8Z A;  1VR6 A;  3QJL A;  4FKX A;  3CMA S;  1UA1 A;  1VS3 A;  2B51 A;  2WAQ D;  1IKY B;  3OLA A;  4KO0 B;  5E33 A;  1CPZ A;  1N0V C;  3JXO A;  1V5V A;  3BEG B;  1LFW A;  1V3Z A;  4FVM A;  4R0J A;  4YR1 A;  1WWH A;  5GAG U;  4FF2 A;  1KR4 A;  3HHK A;  4ER8 A;  3NKR A;  1N6Q B;  3K8W A;  3JYT B;  4QIW D;  2GSN A;  3M8Q A;  5DQI A;  2E5I A;  1Q8L A;  3WAW A;  3CJ8 A;  2PII A;  3BH7 B;  1RKI A;  2M5Y A;  2Y1L B;  2YY3 A;  4C3K A;  3J81 U;  3BS9 A;  3GCW P;  1TUG B;  2HVE A;  2IC3 B;  1XNQ F;  1D0E A;  4PYA A;  4RBV A;  5DDQ C;  4RUC A;  4IRC A;  3B8H A;  2FJX A;  2IUC A;  2IAJ A;  1PYT A;  3OR1 B;  1WI6 A;  4I4B A;  4FS1 A;  4WZM A;  4OHV A;  2ATL A;  1T9U A;  1U02 A;  2VG6 B;  4YY3 J;  2ZZN A;  3ZFV A;  3D68 A;  1YK9 A;  5H9F K;  2LDY A;  2LXU A;  4MIW A;  1T03 A;  3RBE A;  2ERR A;  3ISN D;  2XHW A;  5D3G B;  1NK7 A;  3PHE A;  4P2M A;  1SJF A;  1C1C A;  1SCJ B;  2A1B A;  5G0R B;  1NBE B;  4HYK A;  2J6T A;  2PA8 D;  2CQC A;  1TR0 A;  2EEY A;  3A4T A;  4IH6 A;  1WEY A;  4PQA A;  5KFS A;  3KHH A;  4ECQ A;  5DDR C;  1X9M A;  2M52 A;  1FO1 A;  1HQ2 A;  2VB6 A;  4LIR A;  1H0H B;  2WVC A;  4LJM A;  3KLH B;  2ZH9 A;  1D9F A;  4P2F A;  3LTO A;  4N5S A;  5IJQ A;  4USV A;  3HSZ A;  1RT5 A;  2BX6 A;  4DU7 A;  8ATC B;  3CD5 A;  3WAX A;  4RNM A;  3WDO A;  5F41 A;  3DDI A;  1MU2 B;  5KFZ A;  2HBQ B;  2IBK A;  1XEZ A;  2DY9 A;  3BM7 A;  1OMS A;  1OQ3 A;  2ILY A;  4G1Q B;  4ZP9 A;  2G9Y A;  3KG4 A;  4DX6 A;  4NLP A;  3K89 A;  3W2W A;  2FC8 A;  1RTH A;  2LYV A;  2YNG A;  3FBF A;  2OEK A;  4KIA A;  2RQC A;  2VHG A;  2N7Y A;  2ZDO A;  2VJV A;  1YTY A;  4A46 A;  4JI7 J;  3MXH P;  5K9F A;  1MMN A;  4ECT A;  1LV5 A;  1FNM A;  2C2K B;  2E5L J;  1BD6 A;  2JVO A;  4K7Q A;  3MM9 B;  1WDD A;  2QTW A;  3NGD A;  3IRX B;  3MDF A;  2KXN B;  2R2U A;  1KH7 A;  2BAC A;  2DGU A;  3D0H E;  2EKN A;  4M8L A;  2QX0 A;  1WDT A;  3JSR A;  2XLI A;  3TZZ A;  4HHJ A;  3HJV A;  2H48 B;  3ELH A;  4DG1 A;  5E3C A;  5BXI A;  2L48 A;  3EGW B;  2YNH B;  5B08 A;  3OTO J;  3CUL A;  3BGR A;  2OIH A;  4F4K A;  2KU7 A;  4NMX A;  2AGP A;  1LWF A;  4MKB A;  4JP8 A;  2IDE A;  4F26 A;  4QR0 A;  2ZOF A;  4I1T A;  4CO4 A;  5BYQ A;  1Q86 T;  1KHN A;  3KK3 B;  1J5O A;  3J81 j;  2DR8 A;  2CWK A;  1OPI A;  1S1U A;  4ZVU B;  3R2C J;  4ZPD A;  1JLB A;  3OSN A;  2VD3 A;  2E9R X;  2CYY A;  2OH2 A;  3BBC A;  3WC2 A;  4HKQ A;  3OTE A;  1AXQ A;  5TJ3 A;  4P71 A;  2EFO A;  4HT5 A;  1N32 F;  2XS2 A;  2CDQ A;  4FP9 A;  1S6O A;  3NNH A;  1NND A;  4DL6 A;  1KLN A;  3KLI A;  4I69 A;  4Y34 A;  1S9G B;  3NEK A;  5J1E A;  2OPR B;  3K5L A;  4FXD A;  4WE1 A;  1URA A;  1A9N B;  1VK8 A;  3RRG A;  2K06 A;  1H74 A;  2FD2 A;  4ZPA A;  2Z56 B;  4LQ3 A;  1O98 A;  2H1Y A;  3TA2 A;  2UV8 A;  3M9N B;  4JI5 J;  4DR7 F;  3H8Y A;  1S1T B;  3DYC A;  1T3N A;  1RZM A;  2JJ4 D;  1Q5V A;  3KWM A;  3BZQ A;  3T9Z A;  1KLM B;  2CFX A;  1CLF A;  4P10 A;  2VJU A;  4JI3 J;  2CPF A;  1URB A;  5CYQ B;  1HBU B;  5DQG A;  4J9L A;  1U1K A;  4FF1 A;  4TU8 A;  1OWX A;  2HS3 A;  1S99 A;  1WUU A;  3W1Y C;  3BR9 A;  3D1Q A;  1C0U B;  2HS4 A;  2V4J A;  1ZET A;  1D8Y A;  3CD6 S;  2EI5 A;  1FKP A;  3MAH A;  4OYB A;  3D7S B;  2VQR A;  3QSY B;  2MZT A;  2HQ3 A;  2VG7 A;  1BWE A;  4ZPC A;  4Y0F A;  1NM2 A;  4ENO A;  2Z2Y B;  1AUK A;  1K7H A;  4IG0 A;  1CJV B;  2V2Z A;  4CLW A;  2L08 A;  1N8R T;  3M8Z A;  4QWA A;  1KVJ A;  5IT9 Y;  4DU8 A;  4C2M A;  3PO5 A;  1YLX A;  3R8Y A;  1DLO B;  3M2U B;  4KV8 A;  1M5S A;  3CXC R;  1DRZ A;  2O66 A;  1S7I A;  3W7B A;  1SPB P;  2EFG A;  4ECS A;  2FVS A;  4LBP A;  5K8N A;  1MRO A;  2V4Q A;  2CUY A;  4ED8 A;  4LSN B;  1YG0 A;  2C3U A;  2KI2 A;  1JLG A;  2YNF A;  3GYX B;  4ZCK A;  5K14 A;  4ZN3 A;  2KB2 A;  2WVE A;  3R3T A;  3HVW A;  2AX1 A;  4ES2 A;  1ALJ A;  1PJ6 A;  3B4D A;  1RT2 A;  4OJ1 A;  3TAR A;  5CZX A;  1PYO B;  3TJ8 A;  2ZEJ A;  3FZ2 A;  3DRY A;  3SIP B;  4I2Q A;  1YIJ S;  1U1O A;  1N5Q A;  1XWL A;  3M2R B;  1YJN S;  1RHR B;  1H7X A;  2V67 A;  1F5B A;  3D9B A;  3OT9 A;  2V8D A;  2C22 A;  1N2K A;  1R43 A;  4WTO B;  1FTR A;  4LFA F;  1SV5 B;  2JLF A;  2DNP A;  1L3V A;  3TX0 A;  1F3F A;  4WFB Q;  4X4V A;  2D69 A;  1D1U A;  1S7H A;  2BJ1 A;  1RAC B;  2B5J A;  1ZOT A;  3S1T A;  2IA0 A;  3CJ2 A;  4F0H A;  5K8O A;  3NMA A;  4F67 A;  4YB1 P;  3BRE A;  4DS5 A;  1K0T A;  3HP6 A;  2RQ4 A;  3D67 A;  3I87 A;  2AW0 A;  2DR9 A;  2P6S A;  1RWO B;  5IC4 B;  1URN A;  3G87 A;  4J91 A;  3OJU A;  2BOA A;  2MJU A;  3MCS A;  2CPE A;  2H9Z A;  2LA4 A;  2W2O P;  4NLY A;  4CO2 A;  3A3N B;  1FDB A;  3GIL A;  2HK2 A;  3TUJ C;  1RWW B;  3DPC A;  3J7Z T;  4QU6 A;  1Z2Z A;  4PXC A;  3HJF A;  1BLU A;  1J5E J;  1RIS A;  1S6P A;  1O51 A;  3IBC B;  3JQM A;  4PG8 A;  1EHW A;  2MKK A;  2F9J A;  4OJ3 A;  2HHX A;  1KLM A;  3DYA B;  2FJD B;  4QOT A;  3KLG B;  2CJK A;  2RU9 A;  3MD1 A;  2KT3 A;  1RTJ B;  2KKH A;  3SFG A;  4DX7 A;  3UCU P;  1B99 A;  1H3D A;  3M6X A;  1TZ0 A;  1FX4 A;  4I56 A;  2BAB A;  2H4W B;  4I6Y A;  4ZVF A;  2N82 B;  1N54 B;  3KHL A;  1X0F A;  3GJT B;  4LFB J;  1ZTW A;  1N4L A;  1NH7 A;  1UJ6 A;  2DHH A;  4AL7 A;  1AZS A;  1IUJ A;  1EZZ B;  2DEI A;  1FF2 A;  4NI2 B;  3ENW A;  1PBA A;  4ECR A;  2DNQ A;  5IC6 B;  2AJF E;  3KLE A;  1EAY C;  2QV6 A;  3TAM B;  3NNA A;  4UY8 T;  1JLE A;  1RT7 B;  2VBW A;  2IAJ B;  5LOQ A;  1CUL B;  3EGN A;  4P6Q A;  2DNH A;  3DM2 B;  3ZZ0 A;  4WJB A;  2AX0 A;  4UOF A;  2W7P A;  1RUS A;  1KNZ A;  4U6P A;  2Y1J A;  1RHM B;  3LH2 S;  2BEF A;  2HQF A;  2LEP A;  4PEO A;  2WB4 A;  5CYJ A;  5A6W A;  4CH7 A;  3FBC A;  1WOO A;  1JLE B;  1IKW A;  1RT7 A;  3NS6 A;  4W98 A;  4FDF A;  1P49 A;  3CCU S;  2MQO A;  2G2O A;  4A4J A;  2UU9 J;  3QT7 A;  2PFD A;  3N6N A;  3J81 Y;  2JLG A;  1CQM A;  4KY3 A;  2V2Q A;  2GFF A;  2QL7 B;  1U45 A;  2O01 C;  3DDN A;  2HGL A;  4NZ0 A;  4DJB A;  2IFY A;  2N4C A;  3IAS 9;  1U1M A;  5L8R C;  2BR0 A;  3QLH B;  3TNV A;  2FLL A;  5KT3 A;  2ZKT A;  4LVN P;  2ADC A;  5DG7 A;  2GCF A;  1BXN A;  3FC9 A;  2HLT A;  4UOH A;  4CO3 A;  3RAX A;  4I64 A;  3VQS A;  5KFK A;  4ZCL A;  4WZQ A;  1OYD A;  3G6Y A;  4TQR A;  3PVX A;  3TA0 A;  1TKT A;  2ROE A;  4CCH A;  1KOO A;  5LJ5 Y;  4IH7 A;  2LDI A;  1OY9 A;  1WI8 A;  3NOG A;  4ILR A;  1FNX H;  1IBK J;  2GGP B;  4NOH A;  5KFG A;  4MKY A;  1JLG B;  3ULH A;  4QR1 A;  2AEF A;  1NDK A;  1VDH A;  1JLB B;  2BAN B;  2OD6 A;  3DXB A;  4OLP A;  1O5J A;  4RW6 B;  4B9M A;  2QLF B;  4LRC A;  2FB0 A;  3MM9 A;  1TEL A;  4UQG A;  4LT6 A;  5AXM A;  4ZVP B;  2ZH5 A;  1ANI A;  4F0K A;  2WON A;  4NYP A;  5KT4 A;  2BRK A;  2CQ1 A;  4N76 A;  1N88 A;  3PW0 A;  2M8D B;  1EW9 A;  1E6V A;  5E3P A;  4RLE A;  3D6F B;  3DLK B;  3OPK A;  2Z58 B;  4DV1 F;  1S0V A;  1R8H A;  1H73 A;  1RTZ A;  2J76 E;  1SJ4 P;  3T3F A;  3MUT P;  1S9G A;  2QFI A;  3QO9 A;  4ZOS A;  1ZYQ A;  4A8X A;  4TQS A;  3NCQ A;  1BQM B;  1XR6 A;  2WTF A;  2AD9 A;  1I51 B;  2BE2 A;  2CNN B;  2IJN A;  2WVD A;  3QAE A;  4G1I A;  2RSQ A;  4L76 A;  1X5O A;  2JZ5 A;  3I4H X;  4WXO A;  3G6X A;  2JEF A;  1HNW J;  1MSW D;  2HAF A;  5LM7 E;  2MEW A;  2V2V A;  4JI1 F;  4TY8 B;  2ZBQ A;  3OVS A;  2F4V J;  4ILL A;  3HHL D;  4CH1 A;  1G3O A;  3N28 A;  2OMO A;  1U0H A;  2BXJ A;  3CJS A;  4O23 A;  4DN0 A;  4F50 A;  3D4J A;  4RW7 A;  4A8K A;  4I0W A;  4Q0B A;  1ED8 A;  2DHX A;  2W5W A;  1S12 A;  1IM4 A;  5AE2 A;  4CLF A;  2F8E X;  1SKW A;  4GKK J;  1RHK B;  3CCW A;  4WTY A;  1M5K C;  4FDJ A;  4RW4 A;  3LWL A;  3LUY A;  1ANJ A;  1Q0N A;  2XMW A;  5I3U B;  3BF4 A;  3FCH A;  4C3L A;  2E7X A;  5LXY A;  4RZR A;  3JSM A;  2QLX A;  2J0S D;  3ED4 A;  4OX7 A;  4EYH B;  1WF1 A;  2ZNY A;  4OQJ A;  4IR1 A;  4Z7Y A;  4XPE A;  2OTJ S;  4EFA C;  1HAR A;  3DOK B;  2HRY A;  4F2R A;  2LP4 A;  2HHU A;  1SXL A;  2KJV A;  4TY9 A;  4KH0 B;  2B7C B;  3QID A;  2HVZ A;  3AOD A;  4NX9 A;  5J2M A;  5U47 A;  3C3L A;  4O3R A;  1S9E B;  1B4S A;  1FDN A;  2NCK L;  1TL1 A;  2DNY A;  2RML A;  5CYQ A;  2DNZ A;  1XMO F;  3CJ4 A;  3H7H B;  3GON A;  4PAA A;  1R0C B;  1Z4U A;  1XTZ A;  3A1Y G;  4H4M B;  4MK7 A;  2ZZM A;  4XO0 A;  3BSO A;  3TVZ A;  3PR4 A;  1CG2 A;  1FCA A;  1RBL A;  1LNQ A;  4K8R A;  1XMQ J;  1EW8 A;  2YPY A;  3PXG a;  4Q45 A;  4MYT A;  3CME S;  3G82 A;  4GO7 X;  3BGU A;  2NXC A;  3MTK A;  4OHW A;  2KG0 A;  1GMU A;  3ETM A;  3JS9 A;  3J7Y I;  3MEG B;  4ECZ A;  5MAO A;  3PG9 A;  4ZJO A;  3SDE B;  4KB7 A;  2DKO B;  3S8S A;  2HK3 A;  2Z2M A;  3MOJ B;  2HNY B;  4HI1 A;  1FRM A;  1MW7 A;  3U1N A;  1ITP A;  5GAE U;  1HHS A;  1NSP A;  2MLY A;  3MMJ A;  2DVI A;  1UWB A;  2VL1 A;  4GMK A;  1U0S A;  1O0P A;  4J9R A;  4RNO A;  1IJE B;  4V1A k;  2G2Y A;  3G9C A;  1HI0 P;  4ZMM A;  1DTT B;  3Q8Q B;  1T95 A;  3EDQ B;  1OIA A;  7FD1 A;  3M9M B;  2DGS A;  3OD2 A;  2MDA A;  4M5D B;  3Q8S B;  3H4B A;  5D0E A;  5L1I A;  3LQV A;  4ECW A;  1YQH A;  5J1P A;  2AJQ A;  3CPW R;  2RVJ A;  5E2Q A;  3NL0 A;  1IBC B;  1XJW B;  5B0F A;  3UWT A;  4UF4 A;  3BR8 A;  4I2Q B;  4YFU A;  3HSG A;  2ACY A;  4USH A;  3GV5 B;  3QIP A;  5HMW A;  2V0N A;  4AE5 A;  3BQ2 A;  5DG9 A;  2DRB A;  3GV8 B;  3H25 A;  4DV1 J;  3NWG A;  4DSF A;  1QUP A;  2W8K A;  1EP4 A;  2EKY A;  2ACM A;  2BQ3 A;  4OJG A;  1CJK A;  1XR7 A;  3EM1 A;  3WBZ A;  4DV7 J;  3HF5 A;  3C2P A;  2VKR A;  5DLW A;  2FHO B;  3BH6 B;  2ZBI A;  1U7L A;  1RA7 A;  2VOO A;  1N33 F;  1U6B A;  1EQJ A;  1BMQ B;  2IRX A;  3GSD A;  4MAK A;  4JV0 A;  2WVB A;  3VCD A;  1JLQ B;  4IOC Q;  2UXD F;  4NA2 A;  3P6Y C;  4OX8 A;  3K0J A;  1B64 A;  2FY1 A;  3ZTS A;  3V6D B;  3UN5 A;  2HMI A;  2LA6 A;  1U24 A;  4F4Y A;  1CJT A;  2CPH A;  1ED9 A;  1KRP A;  1HQU B;  3W5Y A;  1H2V Z;  4RO0 A;  1TQL A;  2DNL A;  3E51 A;  3TO8 A;  2C2E A;  1VC6 A;  1RT4 A;  1FDA A;  5JMN A;  1G6B A;  3BPS P;  4X4Q A;  2WBR A;  1RT3 B;  5BYS A;  5DM6 Q;  2KXF A;  2ZUA A;  3BDP A;  1IWG A;  1RHJ B;  1RLC L;  4O44 B;  4JI8 F;  2D9P A;  1ZZN A;  4DR4 J;  1TFY A;  4KHP F;  3GWC A;  4KAV A;  4J9O A;  3UN2 A;  4QWC A;  4FNI A;  4NLR A;  1U1R A;  1URR A;  1VIS A;  2V8P A;  2W4D A;  5D4O A;  2W9C A;  2NZ4 A;  1CEZ A;  2P9C A;  2PMH A;  4MH8 A;  2D1G A;  4QIV A;  1HBM B;  2LQ8 A;  1FRL A;  3FDS A;  3SV3 A;  3PO4 A;  2WBM A;  5FLX Y;  2YKO A;  4ES1 A;  1HHT P;  3FQL A;  2QYC A;  5B0A A;  1HYS A;  2JFD A;  1FFS B;  1UW4 A;  1WAC A;  3C8Y A;  2J7U A;  4DOZ A;  4OL8 A;  3CDB A;  2HEK A;  3P5T L;  2B0G A;  4KPC A;  3K59 A;  2HIQ A;  2RH3 A;  4YME A;  2W9C B;  4P7V A;  2V4J B;  2A2D A;  2CQP A;  1N34 J;  2AYE A;  2FHM A;  5L46 A;  2XY5 A;  3BDF A;  3QGG A;  1WKJ A;  1MMD A;  1RJJ A;  2LLZ A;  3MMB B;  5L9X A;  2VV5 A;  2RRN A;  2J9D A;  4NLU A;  2L41 A;  2P8I A;  2XCA A;  2ZH6 A;  1KFS A;  1HYS B;  5HJX A;  1FTC A;  4JI8 J;  5KG6 A;  3A8K A;  4WK3 A;  2HNZ B;  4CLZ A;  3R97 A;  1VGY A;  2V8G A;  2MKI A;  3KJV B;  2ASL A;  4FBU A;  5EGH A;  2HFN A;  3KLF B;  4DV2 F;  1KC8 T;  3KK2 B;  3QGH A;  4G1Q A;  5A2Q Y;  3CIZ A;  2FVP A;  1V5I B;  1SHN A;  4M95 A;  1V3S A;  2DO0 A;  1KEK A;  2J5A A;  3NGK A;  4OYW A;  1HBN A;  3DI6 A;  5HK4 A;  3Q8P B;  1NK8 A;  5M2U A;  5E3Q A;  2PI5 A;  4LQ9 A;  5T14 A;  2ZBC A;  4X65 F;  3F41 A;  3US5 A;  5BJR A;  2D3Z A;  2J0X A;  2BV3 A;  2FZG B;  1R89 A;  2OAU A;  2W2M P;  1ZA2 B;  3D6H B;  1HD0 A;  2M7S A;  3H42 A;  3VQT A;  2DNG A;  2AV5 A;  3ZZZ A;  4URG A;  2CVI A;  2F9D A;  5AJ3 F;  4A8Y A;  3BKU A;  3T6B A;  1N56 A;  3THP A;  2IHR 1;  4ZVH A;  4TU7 A;  2L9N A;  3CGI A;  3I5A A;  1GTH A;  2QG9 B;  5L38 A;  2J0W A;  2BAN A;  3GLJ A;  4CDI A;  5HVG A;  1KQS R;  1S4E A;  3IWN C;  1RAH B;  4NL5 A;  3SCL E;  3UFC X;  4Z7C A;  5CYM B;  3UCG A;  3PM9 A;  1CJT B;  4EZ9 A;  4OX9 J;  2VQE J;  4OHY A;  2N3O A;  3MZI A;  3Q8U A;  3EYZ A;  5J2Q A;  4RU2 A;  3J7Z 5;  2WCX A;  1FSU A;  3PX0 A;  4UUX A;  2OFH X;  1HNZ J;  4C4W A;  2CQI A;  3DOL B;  1ZM3 A;  3QYY A;  4ALZ A;  1VRQ C;  2VQF J;  4BS2 A;  4DPT A;  3H5S A;  4C8K A;  2MKY A;  2FC9 A;  5H9F J;  4QYR A;  1SC1 B;  2DIS A;  4L3K A;  3IM9 A;  4KTQ A;  3ZTO A;  4ED6 A;  1UVN A;  3JYT A;  1IQZ A;  3WHI A;  5F9N A;  2VON A;  2BJ7 A;  3BN7 A;  1EET B;  3HFK A;  3KJQ B;  2D41 A;  4NEY A;  3UD5 A;  3RG6 A;  1FJG F;  4ZKA A;  1FD8 A;  3MCO A;  4E98 A;  5KFF A;  4RPF A;  1SUQ B;  4X64 J;  6FD1 A;  3N9U C;  1KWM A;  2DGT A;  4LF9 J;  4DN9 A;  2J7W A;  3DXS X;  3F0N A;  1RT4 B;  4BWJ A;  5KFW A;  4QIF A;  5KFR A;  2R7R A;  1KHK A;  4QU7 A;  1KVK A;  4CH0 S;  2VG5 A;  4F02 A;  4DV4 J;  3IXQ A;  3V81 B;  2WOM A;  3SCI E;  2MZR A;  3JSM B;  2IMO A;  5I3U A;  4A8S A;  3EGZ A;  1GMW A;  2QZU A;  1RU2 A;  1HMV B;  4OZ2 A;  3M30 A;  3KLE B;  3SYZ A;  4LRA A;  3WQP A;  2I2Y A;  4WP9 A;  1Q81 T;  1VJW A;  2AJ1 A;  2HZA A;  2NXN A;  2PT0 A;  1AFJ A;  1VQM S;  3CCM S;  3ILL A;  4LF6 J;  1EW2 A;  1DZ5 A;  3O6Q A;  5C2C A;  3T02 A;  1YJ7 A;  5ETS A;  3L3C A;  3G71 S;  1IBL F;  1CS4 A;  1LQ9 A;  4FYX B;  3NXZ A;  2H65 B;  4H4O B;  1NJI T;  5KFB A;  3HO1 A;  1WEX A;  5I3P A;  4TN0 A;  4N8O A;  3T5K A;  2OHD A;  2V9W A;  2ZIT A;  1NB7 A;  4H4M A;  2H51 B;  3FSY A;  1AYE A;  1Q4R A;  2YKN B;  1ROF A;  4JI3 F;  4QW9 A;  4DI6 A;  2AYM A;  3QRP A;  1FXR A;  1NJY A;  4A8M P;  3UCZ P;  1S97 A;  2YX7 A;  1KDN A;  4MKA A;  1DQA A;  2IC3 A;  4DS4 A;  4WWS A;  2ZJQ Q;  1F9F A;  3Q23 A;  4DUT A;  4K5R A;  1OSD A;  1F0X A;  4ERD A;  2YNF B;  4AL6 A;  4KHM A;  2LQJ A;  3EGV A;  3SI8 A;  1RWN B;  4ZLN A;  2FJB B;  2DGX A;  3BDE A;  2C28 A;  1MG7 A;  5ETM A;  5HP1 A;  3RBD A;  4PZV A;  2UVU A;  5EX3 A;  2J9D E;  2VQE F;  2Z57 B;  3DGP A;  5EWG A;  3VAJ A;  4RUB A;  4ED2 A;  2DB1 A;  5CA5 A;  3T1Y F;  1X4B A;  4DV6 J;  4QAX A;  1QM9 A;  1UFW A;  4ZIW A;  4FBT A;  5HMX A;  5EWE A;  3LWM A;  1RCX B;  3S01 A;  4KT0 C;  1TK0 A;  4PXD A;  1SKU B;  4DPU A;  1JLF A;  4ID5 B;  4ZP7 A;  4YN3 B;  2MPU A;  3H59 A;  3ENQ A;  4IFV A;  2VFV A;  4HDH A;  4LR7 A;  4NE9 C;  1QDU B;  4WPA A;  3MFI A;  1VHF A;  2FZC B;  3M8R A;  1ALK A;  1OQ6 A;  5B0B A;  3LGM A;  1KKH A;  2KH9 A;  2UUB F;  2WW4 A;  3BBF A;  3EMT A;  1ALI A;  1ELY A;  4AFF A;  3U02 A;  4PXE A;  1DJ0 A;  3PV8 A;  1RT6 B;  3FRY A;  2J6U A;  1E1Z P;  4PWD B;  3A8E A;  1N48 A;  4USW A;  4O3O A;  2ZHA A;  3M1V B;  2LCW A;  4L73 A;  3EZU A;  1Y3K A;  2VUG A;  2WOM B;  4BDP A;  1U8W A;  2W8D A;  1H72 C;  2J9E A;  2P2C B;  1I5O B;  2QLB B;  3EZ5 A;  3R5A A;  1H2U X;  4UOP A;  1Y11 A;  1UZD A;  3S6E A;  4DR6 F;  3LP1 B;  3UE2 A;  4KFB B;  1JJC B;  1D3W A;  3EXY A;  4CXK A;  3TVK A;  5LSR A;  4LF8 J;  1BQX A;  4Q43 A;  2YKQ A;  4WII A;  4ANC A;  3PCO B;  3EXC X;  1LXN A;  1S59 A;  2QMU B;  2ZDP A;  1CSJ A;  2I0X A;  1WOP A;  4C11 A;  1FEE A;  1MN9 A;  2YWE A;  1FRK A;  4GRS A;  2HHP A;  3LGH A;  4DV3 F;  4PG4 A;  3OFE A;  3RB0 A;  5A6P A;  5I42 A;  2DH8 A;  3M32 B;  3M6W A;  3ENV A;  1C4C A;  1REG X;  4I2P A;  4J9U E;  3IN5 A;  1QSL A;  2MSS A;  2ANH A;  3DLG B;  2W24 A;  1IBM F;  4K4W A;  2XLK A;  2JVR A;  3V4M A;  2KXH A;  3MMC B;  2GX8 A;  1W2B R;  4B9V A;  4IR9 A;  1YJ9 S;  3Q86 A;  2G1D A;  5DZ7 A;  3AHP A;  2XMU A;  1R27 B;  1ZEF A;  4I2P B;  1GT8 A;  5HAO A;  4MTP A;  3G6E S;  2RIJ A;  4PWU A;  3O3L A;  2D3O R;  4CLS A;  4L3N A;  2EBG A;  2L3M A;  5KFO A;  1HNI A;  2GAG C;  3A3O B;  3IWL A;  4C0H A;  4W92 B;  2XS7 A;  3A12 A;  3CDE A;  4JBC A;  1W25 A;  3HDS A;  3R5G A;  3TP2 A;  3V6H A;  1I1G A;  2BW7 A;  4KE5 A;  1HJK A;  2ASD A;  1JKH A;  1PC4 A;  3KDN A;  4EBD A;  1Q8K A;  5IT0 A;  2DD8 S;  4M94 A;  2HAI A;  2L9D A;  3ISZ A;  4N77 A;  3SSS A;  2IPO B;  1NO8 A;  1P1L A;  4RR5 A;  3EZO A;  2FTR A;  3M7V A;  3C6U B;  2O67 A;  3PRD A;  3ZTP A;  4DXL A;  1SH0 A;  3OR2 B;  4EZ6 A;  3GE9 A;  2RUG A;  2QYG A;  2MMY A;  3Q24 A;  5GME A;  4LF8 F;  2F3J A;  4NYZ A;  2BJ3 A;  2VOP A;  1VIX A;  2FLO A;  3M05 A;  5HJY A;  4K4Z A;  4CQ1 A;  5DG8 A;  2QLW A;  1MML A;  4KAY A;  3JTP A;  2KM8 C;  1M90 T;  3NBP A;  2W5X A;  3W8G A;  5KT6 A;  3TUP A;  2H5J B;  4TYB A;  5GAH I;  1NUE A;  3KMQ A;  2VH7 A;  1FRX A;  2AJ4 A;  3D1H A;  3MD3 A;  2U1A A;  3BBB A;  3MM8 A;  4P2X A;  1R8C A;  3QIP B;  1T05 A;  3D3B J;  2MHN A;  1VRU A;  3KJF B;  1NK5 A;  2UVV A;  4DUZ F;  1VQY A;  1RI7 A;  5F8H A;  2NXJ A;  2V63 A;  1YI2 S;  3SQG B;  1NK0 A;  1RWK B;  4DDF A;  4MK9 A;  6FDR A;  3C6T B;  3Q83 A;  1FVS A;  1X5S A;  2C3O A;  3MUM P;  1UFK A;  1P8G A;  1VK3 A;  3IS9 A;  3ZZO A;  3CT9 A;  1RXO B;  2VPW B;  3LA0 A;  4HTI A;  4JI4 J;  2VBY A;  1IR1 A;  2VF3 A;  2ADB A;  5DLT A;  3W63 A;  2ZUG A;  1DHM A;  4DSI A;  2HGN A;  1R7I A;  4I7F B;  3T1Y J;  1PIE A;  3G2X A;  2GA3 A;  1Q5Y A;  3CJ0 A;  4XAK A;  3MCN A;  1H6K X;  1KP6 A;  1EET A;  1B0V A;  1K47 A;  2YQ3 A;  2YNH A;  3GP9 A;  4RW4 B;  3PRB A;  4ZIT A;  2XB2 D;  2C2Z B;  2DGQ A;  3FNN A;  5B0D A;  1SC4 B;  2CQH A;  3MMC A;  2PMZ D;  2QRR A;  1VLO A;  3CJK A;  4CLY A;  4R5P A;  3V4I B;  3BYR A;  3JTO A;  3CCZ A;  2PEB A;  4EWT A;  4B3T F;  3IG1 B;  3AD9 C;  3IBF B;  4KO0 A;  4DR1 J;  2B9Y A;  4G1P A;  4OZ0 A;  3VF0 B;  5K8P A;  2MQQ A;  3PIP Q;  3GIJ A;  1NKC A;  3LXQ A;  3OV7 A;  4WU3 A;  5KFV A;  5KFU A;  2UUC F;  5LIA A;  2GA7 A;  2GO9 A;  3SXL A;  4CNY A;  5MLC V;  2GIR A;  3Q8R B;  4KGK A;  4YB6 A;  4F3M A;  2X1A A;  1TMM A;  1D9D A;  2R7Q A;  5EN1 A;  2ZM6 F;  4NXM F;  1H98 A;  1P6T A;  1AJC A;  4A48 A;  2KM8 B;  2NXU A;  2PA3 A;  1DAX A;  3PKM A;  2ZD1 A;  2M2B A;  5B09 A;  5JVG Q;  4UY8 5;  1C4A A;  2XRG A;  3SCK E;  2CNO B;  4DWI A;  4LF4 F;  1KH9 A;  2BM1 A;  1YSJ A;  3ENA A;  4KGX B;  4RJV A;  3FSI A;  4U95 A;  1RLD A;  4A47 A;  2B4P A;  4YP3 A;  1FJC A;  2M88 A;  2COL A;  4UZB A;  4DR1 F;  3HSD A;  4CWB A;  4F4A A;  1WHV A;  1GQE A;  2G2Z A;  2RKI A;  3I31 A;  4OFZ A;  2XS5 A;  2LQB A;  3KG0 A;  5IJS A;  4XK8 C;  3FEZ A;  2C3M A;  3M8P A;  1M5V C;  3B78 A;  2VC1 A;  3F44 A;  2YKN A;  2DR6 A;  2EFV A;  5KG0 A;  3UNY A;  3UD4 P;  1VQ5 S;  2HYI B;  3S7R A;  1HQE A;  2B9X A;  2V2K A;  3I9V 9;  1M1H A;  1JNZ B;  4ECV A;  3ZZR A;  5G0R A;  3IR5 B;  1JLF B;  4ID5 A;  5F8L A;  1RWX B;  3CIM A;  3W66 A;  3KYL A;  1BE4 A;  1JLC A;  2Y0B B;  4M5G A;  2DK2 A;  3CF5 Q;  4DL5 A;  2H3E B;  3MM5 B;  3CCJ S;  4PG7 A;  1ZM4 A;  1NSQ A;  1EX8 A;  1U6F A;  2M8H A;  2WVF A;  4ZVT B;  3DKD A;  1TKX A;  1AJA A;  3PIO Q;  4DPY A;  2EXU A;  3L7O A;  3JTN A;  4Y2I A;  4ZJQ A;  2BA9 A;  4FF3 A;  1FNO A;  4ZCI A;  2ZJP Q;  3OTO F;  3MWB A;  1GEH A;  1RBA A;  3RBX A;  3NMR A;  2GJF A;  2XMM A;  3NGS A;  3PTW A;  2YBV A;  4JI2 F;  2VQF F;  3L95 X;  4DR2 J;  3TUZ C;  4QYZ J;  4B56 A;  1TV6 A;  1G2E A;  2XMT A;  4DUZ J;  2JEG A;  2XMJ A;  3CNQ P;  4OYX A;  4QIG A;  4JI6 J;  4LF5 J;  4FPR A;  1NRK A;  4WFZ A;  2UUA F;  4NPO A;  4AL5 A;  1SQG A;  4NXN F;  4HLB A;  1JJH A;  2HQG A;  4DPO A;  1Y7A A;  1RT2 B;  3I6P A;  3CO0 P;  3PYE A;  3SSR A;  2XY7 A;  1WKK A;  3C15 B;  4HDG A;  5KFQ A;  3D2W A;  2FHJ D;  4HL9 A;  3C66 A;  3DRP B;  4I6A A;  1RA6 A;  4C8L A;  3P4U B;  2K1R A;  3OFH A;  1ZAW A;  4PYD A;  3DCA A;  1QVF R;  5KFE A;  1WHY A;  3MOZ A;  2DCL A;  2MQ8 A;  3CE8 A;  5KOX A;  3FGV A;  3CD7 A;  3IG1 A;  3WIV A;  2BKN A;  3I4P A;  3W9I A;  4ECU A;  4PR6 A;  4B17 A;  2FLP A;  1E33 P;  2NPI A;  1X4A A;  2FYX A;  5KG7 A;  2W5Q A;  3BKT A;  4IH5 A;  5E3A A;  2DXE A;  4IO9 Q;  1LWF B;  5T41 A;  2F8H A;  2HSE B;  1PBU A;  5JXS A;  4X66 J;  5A8K A;  2ASJ A;  1QSY A;  2FGO A;  4YS2 A;  4IFY B;  4IDK A;  3RGI A;  1M5O C;  4ICL A;  3CCS S;  2RDD A;  2YVS A;  3DRR A;  5CAA A;  3DMJ B;  4PUO A;  3MEE A;  2K7J A;  4X4S A;  3RUB L;  1SI9 A;  3QQC D;  4OZ3 A;  3CCE S;  4USU A;  4CTA A;  2YPZ A;  1HNI B;  3GFZ A;  1FKO B;  2RT3 A;  3T9N A;  2XSJ B;  2RHS B;  2KRB A;  3HHL B;  1F3V A;  3IFE A;  4O4G A;  1N6Q A;  2V8V A;  5SUH A;  2M4M A;  3FVY A;  4WK1 A;  2XMK A;  5F8M A;  3IC1 A;  4X4R A;  4PXB A;  3Q3Q A;  1Q95 G;  1NHV A;  3QT5 A;  4B3R J;  2WSC C;  5DDO C;  2RJZ A;  5SZT A;  3G6V A;  4ZVQ B;  4B3S F;  3VVU A;  4PWW A;  3MM7 A;  5EHH A;  4NCA A;  1UPM B;  4H4O A;  1TVR A;  3K8V A;  4LRF A;  2LQ5 A;  4ZG6 A;  4OI2 A;  3C19 A;  2KDO A;  1E6Y B;  1M5H A;  2E1R A;  3H90 A;  2AEM A;  3U27 A;  4DV3 J;  3RR8 A;  2RE1 A;  4ELV A;  5IFM A;  2IRU A;  3KK2 A;  4PRF A;  2VZ9 A;  2WZ1 A;  3E8O A;  4R8U B;  5A2Q U;  5GRR A;  1T03 B;  3G96 A;  4PPZ A;  4X4U A;  2W01 A;  1HNV A;  1WG5 A;  2DH7 A;  2GV1 A;  4OYI A;  1UWB B;  1FT8 A;  3TRG A;  1LW2 A;  1BC6 A;  3EWG A;  4DL3 A;  4K50 A;  2DIU A;  4OZL A;  4MFB A;  2G1H A;  2XYH B;  3AD7 C;  1LW0 A;  2D1C A;  4USI A;  7AT1 B;  5HMY A;  3K5N A;  4ED0 A;  2BYC A;  2QZ8 A;  3SMZ A;  2AJ2 A;  4DR6 J;  3CMR A;  2XZW A;  4C97 A;  1ACM B;  4LRB A;  1AW0 A;  5LMN F;  4GTX A;  2HBR B;  2QE5 A;  4J9Q A;  4B9T A;  4O3Q A;  3ILI A;  1WC0 A;  3RW6 A;  2LU1 A;  1BY9 A;  2ZWO A;  4KAI A;  5GAG I;  2YTC A;  3C6T A;  3R27 A;  2QEX S;  1KSP A;  1TK5 A;  5C7P A;  1GXL A;  4USJ C;  3Q8V A;  5M2R A;  3WC0 A;  1A6L A;  2BJE A;  4RW9 B;  4LF7 J;  1TP7 A;  1QLN A;  2HRT A;  5IXU A;  3OHB A;  3CCR S;  2AYG A;  2C3P A;  5GAE I;  4U7C A;  5D0H A;  3PNI A;  2EG1 A;  3QFH A;  2YKM B;  3QLH A;  5FLX U;  4I7F A;  3G8T A;  2ZH2 A;  1YKW A;  3MM8 B;  3CSK A;  2YH0 A;  1Y6V A;  2RDI A;  3NWR A;  2IMW P;  3ZZT A;  2WB1 D;  2ROP A;  2MHE A;  1R8B A;  4NLO A;  3QNW B;  1ZPW X;  3HT0 A;  1CJU A;  4C0O C;  3MUR P;  2MQL A;  1QD1 A;  2WRM A;  1PJ5 A;  1ICE B;  1VQN S;  4ZS6 A;  3PX4 A;  2H4Y B;  1LWC B;  4L75 A;  1HNX F;  4GO5 X;  5A0Y A;  2RUS A;  2CJA A;  2IVF B;  3A8J A;  2HHT A;  4ICL B;  3W61 A;  1S1V B;  1FFG B;  4DV5 F;  3LAL A;  1S0M A;  3QGP A;  4WKY A;  5IV4 A;  3BDH A;  5KT7 A;  3HM9 A;  2ZE2 A;  4HHH A;  1VBK A;  2RU3 A;  3DRP A;  3GSI A;  4OMF G;  1SUQ A;  2HPU A;  1GXU A;  1S49 A;  5GMD A;  4CNZ A;  2A6O A;  4NLG A;  1X4H A;  5DZ6 A;  4KSE B;  5I3Q A;  1YBA A;  3BO2 A;  3VGS A;  4NAS A;  2DIT A;  4PAB A;  1SJR A;  3THT A;  4FXV A;  4LF7 F;  1ELX A;  2IVY A;  3D28 A;  1RWP B;  1RAJ A;  3TA1 A;  5LSL A;  4HAC A;  3MED B;  1AUD A;  2CJY B;  5LL6 d;  4C8M A;  2KFY A;  4ZCM A;  1PAE X;  3RRH A;  4EYI B;  3GB0 A;  3NGT A;  5E41 A;  3BDG A;  3DRR B;  4R0E A;  3B6B A;  3I5C A;  5I42 B;  1FJG J;  2Z0G A;  2W9A A;  3HK2 A;  1FXL A;  3L7P A;  1ARO P;  2BE9 B;  4ZPB A;  1B7Y B;  4CTA B;  1AJB A;  1IKX A;  1XK8 A;  1F2G A;  1I3O B;  1NKE A;  4CO0 A;  1S1W B;  4ZA1 A;  1HQE B;  2YWF A;  2R7T A;  2BE7 D;  1HNV B;  4BWM A;  5DS7 A;  2OUG A;  1R6V A;  3W8P A;  4BBY A;  3DLH A;  1XNR J;  2R7U A;  5BYR A;  2X3G A;  1GK8 A;  1B0T A;  2UXC J;  1NHU A;  4HVZ A;  4UST A;  4KJD A;  2EFP A;  5GOV A;  1IR0 A;  5B0G A;  2K3I A;  3MM5 A;  2JX2 A;  1S1W A;  1HBU A;  2F5G A;  2GML A;  2IM0 A;  4RKU C;  5AE3 A;  3H2U B;  1RWM B;  4F4W A;  3O5T B;  2QL5 B;  3M2V A;  4TXS A;  5A8R A;  3RTV A;  3NY0 A;  2DJW A;  4MJK A;  3VGT A;  5E0O A;  3R6G B;  2ZZT A;  3ZNJ 1;  5J1E B;  2XGQ A;  5D4N A;  3C16 A;  4LF9 F;  3AAW B;  2AZ1 A;  3KLH A;  3R5J B;  2B56 A;  1NSA A;  7FDR A;  1XBW A;  1PC5 A;  2YWG A;  3FJ2 A;  4KBI A;  1KTV A;  2CZ4 A;  1JB0 C;  2GQQ A;  5H1S V;  4CP5 A;  1U2R A;  1S1T A;  2GHP A;  2A2C A;  2Y0S D;  1OS5 A;  3H0P A;  3MF5 A;  2BQU A;  3QJJ A;  3DOM A;  3IMQ J;  3B82 A;  5THW A;  4AQY F;  2HHH F;  2HWT A;  1I94 F;  1D09 B;  4NLT A;  1ZM2 A;  2MY8 A;  1MLA A;  2KVQ E;  3I0S A;  3T1H F;  1WC1 A;  4FXW A;  3ZXW A;  4J9P A;  2HW3 A;  3NKN A;  3W2W B;  1TFW A;  3RYL A;  1HNZ F;  2HS0 A;  3H5Y A;  4V19 X;  3KXD A;  4Y2C A;  4KKO B;  1F60 B;  1Y5N B;  3GTY X;  1S72 S;  2Q3P A;  4CT9 A;  1VRU B;  2ZC4 A;  4C8Y A;  3BV8 A;  4X62 J;  3F73 A;  4IQX A;  2ZE2 B;  5HVF A;  3PW7 A;  3IRX A;  3I82 A;  3JAM U;  4ATN A;  4O0N A;  4YDD B;  1K44 A;  1RQ0 A;  3NLC A;  4W4M A;  1U25 A;  2QA4 S;  4PWD A;  4UTG A;  1RAO A;  3WX4 A;  3HVT B;  2MKS A;  2HIY A;  3QMQ A;  5KFD A;  4E8U A;  3H2L A;  3PHT A;  4DFK A;  4DL0 C;  1EKR A;  5B7W A;  4XTT A;  3CJ3 A;  3BGR B;  2FJV A;  4URQ U;  2CJQ A;  4FVC A;  1J2V A;  4EGL A;  3OUY B;  1TMJ A;  2HBZ B;  2DRA A;  2HKE A;  1MRO B;  3L09 A;  4ZVE A;  1DQ9 A;  1W7W A;  4YHH J;  3VAG A;  5CCL A;  3D5M A;  1WF0 A;  3R1H A;  2QL9 B;  4B3O B;  1WTF A;  4ED3 A;  1QVG R;  3X3U A;  2JC0 A;  3NCR A;  4C8N A;  4HH0 A;  1M1K T;  2AEJ A;  5IWA F;  3SZ2 A;  2J8A A;  2G0I A;  4B08 A;  1V9O A;  1B0P A;  1ZPV A;  2KVI A;  3FBE A;  4C9D A;  2OFG X;  4ILM A;  5CHC B;  1OYE A;  1SVD A;  1TL4 A;  3D54 A;  4FNH A;  4DX8 H;  3SFU A;  4J9V A;  3QJP A;  1LK5 A;  1WG1 A;  3V2U C;  4B3O A;  1SV5 A;  3TWZ A;  1W26 A;  2V4R A;  3MK2 A;  4ZHR B;  2OPR A;  1VYA A;  2HFU A;  2ZNZ A;  3MAQ A;  3HT3 A;  4S0M A;  3D0I E;  2DXD A;  3TEG A;  4ECX A;  3LO3 A;  3NKY A;  3KK3 A;  4C48 A;  4DZD A;  5J2N A;  2ZJR Q;  3FK4 A;  4KC5 A;  3VAF A;  3CDW A;  3IRW P;  2GHV C;  2CWX A;  3NOC A;  5F0U A;  3OXG A;  2NLW A;  3CJR A;  2ROG A;  3T6J A;  3KKF A;  3CCV S;  2GO8 A;  1ALH A;  1EQ0 A;  4D3G A;  2CQ3 A;  1UPP A;  2HFO A;  2LXI A;  2KRR A;  1F5A A;  4Q2M A;  2DEJ A;  1LOU A;  4BC7 A;  5ETN A;  5JJB A;  4GC7 A;  4OI1 A;  5EGY A;  3KFW X;  2V50 A;  2ZWP A;  1EQM A;  3GJQ B;  1YBU A;  4ITS A;  4J37 A;  5E7O B;  4P74 A;  4DL2 A;  2EG2 A;  3GIR A;  4DR4 F;  2FJE B;  3NRB A;  4LF1 A;  4WE1 B;  4QW8 A;  5HQL A;  4KJG A;  3KUE A;  1RDR A;  4RWW A;  5FDL A;  5KFN A;  2WW8 A;  4WIQ A;  2D3O 1;  5GAD U;  2CIM A;  3PRV A;  1KHW A;  3MAA B;  1SC3 B;  2KT2 A;  1CJV A;  3IM8 A;  4M5N A;  4OZ5 A;  1FES A;  5B0E A;  5A8W A;  1WD6 A;  3A13 A;  2FJW A;  2B8P A;  2PFF B;  2DR7 A;  1FRH A;  4B3M J;  2D7S A;  4A8Q A;  2BJ9 A;  4YB5 A;  3BO3 A;  2VPX B;  1C0T B;  1HKA A;  1Q79 A;  3DHW C;  3QBC A;  3TAM A;  2YNG B;  3PY8 A;  1GAO A;  3UDC A;  2V34 A;  1SH2 A;  3OL6 A;  2ZH3 A;  3KJV A;  1RU1 A;  2PMW A;  3M8Y A;  3MAA A;  4Y00 A;  9RUB A;  4NML A;  2MQM A;  2OLW A;  3GR1 A;  2JH3 A;  5L1L A;  2RIL A;  1S57 A;  2NYI A;  2OKQ A;  1ULR A;  3H20 A;  3AXM A;  1HPZ A;  2CQ4 A;  5C2G A;  5AJ9 A;  2FUG 9;  1U2F A;  2W1B A;  3H4D A;  1Y5L B;  2GS8 A;  3ITH B;  4LSL B;  3UVJ B;  2YKM A;  4HEA 9;  1M5P C;  1FI4 A;  3RB3 A;  3GPA A;  2GIQ A;  2QLJ B;  3IS9 B;  3MEC A;  2GJI A;  2CZV C;  3D6M B;  3R5C A;  3TR5 A;  4KQZ A;  2GAH C;  2P9E A;  2BZ2 A;  1DLO A;  1SH3 A;  5J1N A;  3GG0 A;  1UEK A;  2HFZ A;  2IUC B;  1WC3 A;  3PFE A;  2OI2 A;  3DLK A;  4DPX A;  3J7A 1;  4Y2M A;  4QWE A;  5IM0 A;  3HLU A;  2Y8W A;  4KHR A;  4LR2 A;  1F1B B;  1RCO B;  2OPQ A;  2I38 A;  2XZD B;  2Z2Z A;  3MM6 A;  4TKT A;  3P5B P;  5IV3 A;  1O99 A;  3VGV A;  2CNL B;  2VA2 A;  4UOR A;  4CXS A;  4UPH A;  1P9Q C;  1VRT B;  4IFY A;  5D4P A;  2GGP A;  4U9R A;  3QT8 A;  1RWV B;  2O5D A;  4TN2 A;  2W7O A;  2DGV A;  4OYO A;  4A8O A;  3MK1 A;  3RRK A;  5H9E J;  3M8S A;  2DCU B;  3MPV A;  3FRZ A;  1IJF B;  4K4Y A;  1GX5 A;  1QUV A;  3QGI A;  5KT2 A;  1SKR A;  1E2S P;  2F63 A;  3KMS A;  1DY3 A;  2QT7 A;  2HVH A;  1F6T A;  2XSJ A;  1DTQ A;  3HHL A;  2UZA A;  4I6W A;  3DLJ A;  3KNG A;  4O4G B;  1Y4Z B;  3C14 B;  3R5B A;  4KGV B;  3BYP A;  1DUR A;  1WJ9 A;  1TTH B;  2OEL A;  5AXK A;  4LR9 A;  3AFG A;  4JYA F;  2AT1 B;  3JQK A;  2YWH A;  4F8R A;  3UDE A;  2MZJ A;  1ZEB A;  5LJ3 Y;  4XIU A;  1EJ7 L;  2R3V A;  4ANE A;  3KK1 B;  3B5Q A;  3MM7 B;  3RJM B;  2KJW A;  2KTQ A;  3W3S A;  1MN7 A;  1FWK A;  3CVK A;  5EUH A;  1C1C B;  1JKH B;  2DHS A;  3TAN A;  2R42 A;  3BSN A;  3R6L B;  1S6P B;  1NEE A;  2YQ1 A;  2DY1 A;  2BKP A;  2V5H G;  3TI0 A;  1KS2 A;  3DM2 A;  1SQF A;  2F65 A;  4IRK A;  4HHU A;  2SXL A;  4U7U K;  1SHQ A;  3QPI A;  3M30 B;  2AGQ A;  5KFM A;  5D6G A;  1UWA A;  2HLU A;  5KFX A;  3PX6 A;  1APS A;  4FYY B;  5HN0 A;  1ZAV A;  1T94 A;  3AY0 A;  1M0S A;  4FPI A;  2ALZ A;  4DR7 J;  1AZS B;  4KM4 A;  5KFJ A;  4RNH A;  1VC0 A;  2BKO A;  2KZM A;  5DJB A;  2HZC A;  2MLX A;  4RW8 B;  1KVI A;  2X98 A;  3T5J A;  2GMJ A;  1DAR A;  1CS4 B;  3TVY A;  2JL9 A;  3MPD A;  5LXR A;  2KYX A;  1B7F A;  1Q82 T;  3K58 A;  1S1X A;  2NS1 B;  3D6T B;  4CT8 A;  1JXE A;  2G9O A;  4X66 F;  3PKY A;  3OFG A;  2JNJ A;  2HND B;  3M6U A;  4C3M A;  1OY6 A;  2PO4 A;  1ZS6 A;  1GMV A;  3DOM B;  5A76 A;  5KFC A;  5EDW A;  1YVF A;  3W9J A;  3KLF A;  4M1K A;  2V6A A;  4CLK A;  1NJW A;  4ZK7 M;  2ZOG A;  2VFT A;  1Y7P A;  3OTD A;  1S77 D;  4NZ7 A;  2PC6 A;  1TAU A;  4N7T A;  4URS A;  1KH5 A;  2Y3Y A;  1L3U A;  1RT1 B;  4QQB A;  2HND A;  2KFN A;  2MZS A;  1MU2 A;  3PJW A;  3KDO A;  2JRS A;  3NNC A;  5AXL A;  1GH8 A;  4GKK F;  3AOB A;  1W2I A;  2J7K A;  5EX0 A;  5KXA A;  4IYQ A;  2G0J A;  3HSJ A;  3UO0 A;  3GV7 B;  3M4X A;  2B8Q A;  2IJF A;  1XER A;  3UVJ A;  4L6V 3;  3AD8 C;  3KNA A;  2OO4 A;  1SC6 A;  3BB5 A;  3AB2 B;  4GTZ A;  3ADA C;  2XWY A;  1YX2 A;  2IBO A;  3OBI A;  3DU5 A;  4U8Y A;  1S9F A;  5J2P B;  3EX7 B;  1FE4 A;  4K4V A;  3TQ1 A;  4QWD A;  3PEJ A;  1U47 A;  4RU9 A;  3T00 A;  4PCQ A;  2E44 A;  3UN3 A;  4ZLJ A;  2IA6 A;  3QZ7 A;  4R5P B;  4JI7 F;  3SZZ A;  1UET A;  3C14 A;  1S6Q A;  1YIT S;  2YXL A;  3DMJ A;  4QJV A;  1ELZ A;  3HKW A;  5CD4 H;  1RHU B;  4DV6 F;  2VC0 A;  1TAQ A;  1EAR A;  4HH1 A;  3MGJ A;  3SCJ E;  2W8L A;  4RUH A;  2CJ9 A;  2YWK A;  2EFN A;  2VPY B;  1CC7 A;  3MED A;  3TJA A;  2XLJ A;  2GHW A;  2RRB A;  1TU0 B;  3MMA A;  4ES3 A;  5IZH A;  2ZOM A;  4OX6 A;  1S0N A;  4YB7 A;  4U8V A;  2C2R A;  1S5Z A;  1HWL A;  4ZIV A;  1VIO A;  4Y2A A;  3MR6 A;  2W5R A;  1BUX A;  3TG0 A;  2K3K A;  2UP1 A;  1WNE A;  1WEZ A;  2NUU G;  2MJN A;  4Q2L A;  4PKD B;  4ZHR A;  5C25 A;  5KOW A;  4FYD A;  3VV2 B;  2Z30 B;  1RAG B;  3FCV A;  3GFY A;  2W9B B;  3UD3 P;  3LAM A;  3MMA B;  3GIK A;  3D0G E;  3GFX A;  4Y2K A;  4EBE A;  5HLF A;  3PW2 A;  3GCX P;  1PGZ A;  1R31 A;  2HQI A;  3RZA A;  4GVL A;  4M5L A;  4M5J A;  1HWU A;  4CRJ A;  3CCQ S;  4YOE A;  1L3K A;  1FA0 A;  2IRY A;  2LVW A;  4RW7 B;  1FKP B;  3RW7 A;  4ED5 A;  1QAJ A;  2ZM6 J;  2FDN A;  1NZA A;  4UZC A;  3OXF A;  4MT1 A;  4JV1 A;  2HQC A;  2LEA A;  4I68 A;  3W65 A;  3H98 A;  3QWP A;  4XPC A;  2PN6 A;  1YHQ S;  3OL9 A;  1T02 A;  1ZED A;  3VVT A;  2Z4P A;  3AQO A;  3WAV A;  2DGO A;  3BGL A;  1H2T Z;  5KAK A;  2R7W A;  4ZPV R;  2Z8Q A;  2DBB A;  3GMG A;  3CJ5 A;  3EVM A;  1HLW A;  1B3T A;  1XNR F;  1U2C A;  1U48 A;  2ZC3 A;  4NCG A;  3VTI A;  4YR2 A;  5IS2 A;  4EU0 A;  2EVZ A;  2HNY A;  2MYF A;  4IKA A;  5K5M A;  4O4R A;  2RS2 A;  2J9C A;  4RW8 A;  3NVL A;  2QMW A;  2IVM A;  2LU2 A;  1KH4 A;  4WKR A;  1YJW S;  2AZ3 A;  4TYA A;  2R7O A;  2UVW A;  1S1X B;  2B4O A;  5DLF A;  1VQL S;  2QGF B;  4AYB D;  2Q6B A;  3RR7 A;  2E7V A;  4FYW B;  2CG4 A;  4G65 A;  2LXF A;  2HBY B;  3ILJ A;  2PSZ A;  3QFW A;  2CQ2 A;  3QWU A;  1NK6 A;  4WP3 A;  5INH A;  2QFJ A;  2UXC F;  1KON A;  1FX2 A;  1WOR A;  4N47 A;  1YZ6 A;  4WYW A;  3SDE A;  2OPS A;  2X1G A;  3AJD A;  3UI3 A;  3PW4 A;  2XEX A;  4UUW A;  4CO5 A;  1VBZ A;  3T19 A;  5C42 A;  4DUY J;  1S6Q B;  4L74 A;  1YRX A;  4KGM A;  1KHL A;  1X7V A;  2W2Q P;  2LQ9 A;  3DHX A;  3QO9 B;  3I32 A;  2VKZ G;  4LSZ B;  5HQM A;  1NB2 A;  3NBP B;  4DV5 J;  1Q78 A;  5A8K B;  4C98 A;  1DTQ B;  1JMT A;  2DTJ A;  4DBQ A;  2Q79 A;  2AGO A;  4NLX A;  1EJJ A;  2FQQ B;  3KLI B;  1HNX J;  4YDX A;  2W5T A;  1KHJ A;  4JI0 F;  2OPQ B;  3MM6 B;  4LIW A;  3E01 B;  2GVZ B;  2CDR B;  3B54 A;  5J2P A;  1S76 D;  1PCA A;  2YX4 A;  1NH8 A;  2LFV A;  1RTJ A;  3CUN A;  1JJ2 R;  4LFC F;  1XIQ A;  1KD1 T;  5AJ3 J;  4CYS A;  1REV A;  3GZ7 A;  3ZZU A;  1QTM A;  5HRO A;  3VAM A;  2ATC B;  4WP8 A;  2I1R A;  3DGV A;  3NS5 A;  4ETX A;  4KYZ A;  3EJM A;  4F4Z A;  1UTA A;  1WHX A;  1PKU A;  2QSF A;  3TZX A;  3HHN B;  1UEV A;  1NDC A;  2B3T B;  4XDD A;  2LEC A;  4WF9 Q;  4GTW A;  4J9S A;  2RQK A;  2GQ2 A;  4ELU A;  1OSC A;  2JDJ A;  2XY6 A;  1NK4 A;  2R2T A;  2JEJ A;  2E1P A;  5HRO B;  1U8S A;  3M8Q B;  1JLA B;  5GVQ A;  2ZH7 A;  2MKJ A;  4CXU A;  3D66 A;  2ZH8 A;  1NLK L;  1U0H B;  1VBY A;  2CG8 A;  4CM0 A;  2W7A A;  2HHV A;  5LMN J;  3R5D A;  2KZZ A;  3AA8 A;  3HZE A;  1HMV A;  3J7Y U;  1UVM A;  4GKJ F;  1PO6 A;  4KPY A;  3IBW A;  1BHN A;  1IBL J;  2YKA A;  3DN9 A;  1TKZ A;  2XUL A;  1FKA F;  3JAM Y;  3GII A;  3KHG A;  2FJA B;  4A8F A;  5D0G A;  2G4B A;  3QRR A;  1LW0 B;  2Y1I A;  1VFJ A;  4JI5 F;  4Q8E A;  2GQC A;  3EUN A;  2RF2 B;  3HVA A;  4IUF A;  3R2D J;  1UL3 A;  2CPY A;  3Q0A A;  4FKY A;  2GC8 A;  3UNG C;  2VBX A;  3MPU B;  4KGZ B;  1G4C A;  4LRD A;  4EO6 A;  5K8M A;  3HPO A;  3P3D A;  3KG1 A;  3AB4 B;  3VAL A;  4O3N A;  3CCL S;  3DOK A;  4Z37 A;  1NK9 A;  2NSB A;  4LSN A;  3W5Z A;  5KFT A;  2HWH A;  3PJ9 A;  1N32 J;  3DLE B;  1HBM A;  2QO3 A;  3IR7 B;  5A8W B;  4NWX A;  3KTQ A;  1WF2 A;  4OV6 A;  2R7V A;  3GFH A;  3I0S B;  4PG6 A;  1TL1 B;  4UOC A;  3R1L A;  4J9K A;  2VOD A;  2DNN A;  1S4F A;  1HWI A;  3MHY A;  4F25 A;  2EBE A;  5G4D A;  1Z1Z A;  2R8G A;  2HVD A;  4KKO A;  3W2V B;  2CQD A;  4X4N A;  5C42 B;  2HFS A;  4E0D A;  3FKB A;  1YDL A;  4RBU A;  5IWA J;  2AHO B;  1U6Z A;  3LP2 B;  5KFY A;  1VBX A;  1P27 B;  2NYH A;  1KTQ A;  2IDL A;  3KHR A;  3K57 A;  4GTY A;  1NAQ A;  3I0R A; 
#chains in the Genus database with same CATH homology
 4LR9 A;  5EGE A;  5IJS A;  5L0B A;  1URA A;  1ZEB A;  3UNY A;  2ANH A;  3B5Q A;  4LR8 A;  5LQQ A;  4UPL A;  1Y6V A;  1P49 A;  1O98 A;  3M8W A;  2GSU A;  3NVL A;  4MY4 A;  1KH4 A;  3DYC A;  5L0K A;  2XR9 A;  2IFY A;  1ZEF A;  5K4P A;  1URB A;  1SHQ A;  2W5S A;  3TWZ A;  2ZKT A;  2W5V A;  3MK2 A;  3KD8 A;  3IGZ B;  4YR1 A;  1AJA A;  3NKO A;  1KHK A;  4UPK A;  3T01 A;  5DLW A;  1HJK A;  1ALH A;  3BDH A;  4MHX A;  1N2L A;  5INH A;  4KM4 A;  2W5X A;  2QZU A;  1EQJ A;  3BDG B;  2X98 A;  2GSN A;  4B56 A;  2IUC B;  2VQR A;  3WAW A;  3WAY A;  4LRA A;  3UN5 A;  4LRE A;  1ED9 A;  1ELX A;  3WBH A;  1KHL A;  3M7V A;  4CYR A;  5L0E A;  4LRC A;  1EW2 A;  5DLV A;  2GLQ A;  1AUK A;  1K7H A;  1EI6 A;  3T02 A;  3M8Z A;  1EW9 A;  1Y7A A;  3IGY B;  2IUC A;  1EJJ A;  3BDG A;  4N7T A;  4TN0 A;  1HDH A;  1KH5 A;  4KJG A;  1E3C P;  2W5T A;  1KHJ A;  5LRN A;  4KAY A;  1AJB A;  4KAV A;  3UN2 A;  1E33 P;  2GSO A;  3NKQ A;  4QAX A;  5KXA A;  2W5Q A;  3UO0 A;  4CYS A;  1B8J A;  2W8S A;  5HRT A;  5IJQ A;  3OT9 A;  4LR2 A;  4KJD A;  1AJD A;  1N2K A;  4GTZ A;  5GOV A;  4GTW A;  3WAX A;  1ED8 A;  3NKM A;  2W5W A;  3TX0 A;  3M8Y A;  3MK0 A;  4UOO A;  2G9Y A;  3BDF A;  3T00 A;  4FDJ A;  5DLT A;  1ANJ A;  3UN3 A;  4CXU A;  3SZZ A;  4LQY A;  3NKR A;  5AJ9 A;  4ZG7 A;  1ANI A;  3ED4 A;  1ELZ A;  4ZG9 A;  3Q3Q A;  5EGH A;  2GA3 A;  1ALJ A;  4MIV A;  2D1G A;  1SHN A;  3DPC A;  4LR7 A;  4LRF A;  4ZG6 A;  1KH7 A;  4ZGA A;  2W5R A;  3TG0 A;  1ALK A;  4UPI A;  1ELY A;  4LRD A;  1ALI A;  3SZY A;  3NKN A;  1E1Z P;  5GRR A;  3LXQ A;  1O99 A;  4NWX A;  4NWJ A;  5LIA A;  1EW8 A;  3IDD A;  4UOR A;  4CXS A;  4UPH A;  5C66 A;  1KHN A;  2W8D A;  3CMR A;  3NKP A;  4LRB A;  1AJC A;  4GTX A;  3MK1 A;  3A52 A;  2XRG A;  1E2S P;  1KH9 A;  4CXK A;  1HQA A;  4UOP A;  5TJ3 A;  1FSU A;  1ZED A;  2RH6 A;  4FDI A;  4GTY A;  3WAV A;  5LRM A;  3E2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...