4LRBA

Phosphopentomutase s154g variant soaked with 2,3-dideoxyribose 5-phosphate
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTGADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 146
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrbA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrbA01
3TX0A 4LRDA 1B8JA 1AUKA 1ZEFA 2ANHA 2IUCB 3WAYA 4B56A 1AJBA 1EI6A 3IDDA 3MK1A 1KH7A 4QAXA 1ALHA 3B5QA 1O98A 1EQJA 5GRRA 2W5TA 5DLWA 2IUCA 3NKNA 1E3CP 4LR7A 5LIAA 4LREA 2W5WA 3NKMA 4LRAA 5DLTA 1KH4A 4NWJA 4LR8A 4UPIA 5C66A 5LQQA 3ED4A 3A52A 1SHNA 4UPLA 3TG0A 1EW9A 5AJ9A 3UN3A 2GSNA 1AJCA 5INHA 2W5RA 5L0BA 3NKOA 3UN2A 2GSOA 5IJSA 2QZUA 4CYRA 1URBA 4GTYA 5HRTA 1HDHA 4GTXA 2W8DA 5EGEA 4LQYA 3BDGA 3UO0A 3UNYA 1HJKA 3DYCA 5L0EA 4CXSA 1EJJA 1FSUA 3SZZA 3CMRA 2D1GA 1E1ZP 3M8WA 2GSUA 3WAXA 3WAVA 4ZG9A 4YR1A 4CXKA 3IGZB 5LRNA 3T01A 4ZG6A 4LRBA 1SHQA 4UPHA 1ELXA 4NWXA 2W5SA 1EW2A 3UN5A 2XRGA 5LRMA 1HQAA 1E33P 1N2LA 2W5QA 3KD8A 1P49A 3SZYA 4ZG7A 1ANIA 4N7TA 4KAVA 1K7HA 4CXUA 4KAYA 3M8YA 4KM4A 1EW8A 1AJAA 4GTWA 4FDIA 3NKQA 1ALKA 4TN0A 1KHJA 3LXQA 4UPKA 3T00A 3M7VA 1E2SP 1ED9A 2GA3A 1KHLA 2RH6A 4GTZA 1ZEBA 4MIVA 2X98A 1ALJA 2VQRA 3WBHA 3MK2A 1ALIA 2GLQA 2IFYA 3OT9A 5IJQA 4LR9A 1ELZA 5K4PA 1KH9A 1N2KA 5L0KA 1O99A 2W5XA 5TJ3A 1ZEDA 3NVLA 3M8ZA 4UOPA 2ZKTA 3TWZA 3NKRA 1Y6VA 4KJGA 1URAA 3Q3QA 4KJDA 4MHXA 5EGHA 1ED8A 1AJDA 1Y7AA 1KH5A 3BDFA 4CYSA 3IGYB 3E2DA 3BDGB 1ELYA 4LR2A 4UOOA 1KHKA 2XR9A 4ZGAA 5DLVA 1ANJA 4LRFA 5KXAA 3NKPA 1KHNA 2W5VA 5GOVA 3DPCA 3MK0A 2G9YA 3WAWA 3T02A 4MY4A 2W8SA 4FDJA 3BDHA 4LRCA 4UORA
chains in the Genus database with same CATH superfamily
1O8BA 1N6QB 2KXHA 2LXFA 3FCWA 3DRXA 3MK1A 1WWHA 1TKXA 4F50A 4G65A 1ALHA 1DARA 4KV8A 4KQZA 3A13A 3V2UC 3IR7B 3ZZ0A 1LOUA 5A76A 1XMOF 3MF5A 4J9NA 2VASA 2FVPA 2CXEA 2KVIA 4X4UA 5LSOA 3KHRA 4DV5J 2JX2A 1BD6A 2W8KA 1X0FA 2YNFA 4IR9A 3L9ZA 3Q89A 3OFHA 4UPIA 1HWUA 2MQNA 5B0GA 1XNRJ 1JLEA 1T03B 1HNIA 1SHNA 5EUHA 4YHHF 3L3CA 5HAOA 2RJZA 1VOMA 4I6YA 4IG0A 4Z37A 3LPYA 3ONQA 2LA6A 2B43A 3LP2B 4DU8A 1Q8IA 2ABYA 3CVKA 3MPYA 5L0BA 5F8IA 3KMSA 2C2MB 2MKSA 2W5SA 3AQPA 3MXHP 4FVCA 4ZITA 3UPFA 3ET6B 1CQMA 5IT4A 4FXDA 2QYGA 3GR1A 1T02A 4LQYA 3GJRB 4ZVHA 3BDGA 1I1GA 1UPPA 3L7UA 3UNYA 4Q44A 1N0VC 4C8OA 3V6HA 1NO8A 1RTDB 1KRPA 2FVCA 1JNZB 4DV1F 2HFSA 1S57A 3PRDA 3PW7A 2VDIA 2DR7A 4TYAA 3KJFB 3TANA 2WVEA 4DQRA 2ILYA 5CZXA 1FEHA 2HFZA 4OJ3A 2CG8A 4J9MA 2J7KA 4F2SA 2CPFA 5LRNA 1GXUA 4NLGA 3CJQA 1K0VA 4UOHA 2HZAA 3TJAA 1SHQA 4CO2A 1OO0B 2YX4A 3LO3A 2UXCJ 2IJNA 1RU1A 3UN5A 2F63A 2JWNA 3A12A 3E01B 3FBBA 4I64A 2GQQA 1TL3A 3RGIA 2M52A 3ZO7A 5BYSA 2CZVC 3GQCA 1G2EA 4CI0B 2R42A 3QBCA 3MI7X 1NEEA 2LA4A 2XEXA 1PJ7A 2HFOA 4LIWA 2MLXA 1D0EA 1WF1A 3G8TA 1UJ4A 2O5DA 1DTQB 5D0HA 4MKAA 3BGRB 2V69A 3IS9B 3DN9A 4IH7A 4LVOP 2RNEA 2DNZA 1BQNA 4Z7CA 2H9ZA 2BE7D 4MKBA 4DR3F 3RR8A 2V2ZA 3JSMB 1UPMB 3DCAA 2VG5A 2FLNA 1HMVB 3EPGA 1AYEA 1N4LA 1RHKB 4H4MA 4G1QB 1VHIA 3BGRA 3U1NA 5CHCB 2H48B 4YDDB 4C8LA 5FIIA 1KHJA 2A0FB 3T1YJ 1AW0A 3CDWA 3MMCB 2KB2A 1N5YA 1RT6B 4B3RJ 1N33F 3TEGA 3OVAA 5KG6A 4HKQA 4NCGB 4NYOA 2FY8A 1ZEBA 2HNZA 3THVA 3QAUA 5L1IA 5DGAA 2E7VA 4TXSA 1ZZFA 2CADA 2BE9B 3IA0A 5D15A 1HR0F 1UVLA 3TNVA 3DLKB 4ES2A 2DH9A 4LSZB 3HP6A 3EJMA 3GP9A 5KFUA 3CJ0A 2BKPA 3TO8A 1IBLF 5D3GB 3DRSB 1ZM3A 4ERDA 2WBMA 1S9FA 1M1GA 1U0HB 4PAAA 3PIPQ 3NAIA 2IMOA 1E6YA 1PYTA 3OD2A 3Q23A 1TL7A 5HJXA 4FYDA 3CDEA 2VONA 2M8DB 3GILA 3MHYA 3Q2SC 1ZPWX 2D3ZA 3BDGB 1HBUB 4LFAJ 4OHZA 2WB1D 2VG7A 1XNRF 3T9ZA 4IOAQ 2QJ3A 1RI7A 4USTA 2Z58B 3O1LA 1HQEB 2GX8A 3TAMA 1KP6A 3NY0A 2CQIA 4YB7A 3MAQA 3NKYA 4ZS6A 4K4ZA 2ZWOA 4IOBA 4U67Q 1FRJA 1VBKA 2W2QP 2XQCA 3H5YA 2R7RA 4DV0F 4I2QB 4NLQA 4X4OA 3J7Z5 1TKDA 1U1NA 1SV5A 4JI5F 4DQSA 4PQUA 5KFDA 2DISA 4QOTA 3ZZZA 1S48A 1U0HA 3IO1A 5C2CA 2XWXA 2VQFF 5A0YB 2DTJA 5KFPA 2GC8A 3W2VA 3VAGA 1HFEL 3SIPB 1T94A 1NKBA 5L9XA 3TW0A 4DUTA 1JLFA 2KXFA 2HQGA 2FJDB 4NLPA 2HBRB 2COLA 1SIZA 3H42A 4ES3A 4LR7A 3CD7A 2K06A 3HHLA 4WTOB 2FLPA 4WYWA 4YY3F 1KC8T 4H4OB 1RWMB 4F7VA 4Q8EA 3ED4A 2B0GA 2PN6A 2DGWA 1VQLS 1NDKA 5K5MA 3DXSX 3C2PA 1TV6B 2AGOA 1N5YB 3NNAA 4A8WA 1IKXA 4B9NA 1CPZA 5CD4H 2KU7A 3RB4A 2HS0A 3I6PA 2CQHA 1SI9A 3JYTB 2JHEA 2AIRB 4M8LA 3A8EA 3SSRA 2DK2A 2B9EA 3UI3A 5FLXU 1RCOB 2DJWA 3NGRA 3TZXA 4ANDA 3MPWA 4I69A 4KGVB 2ZFHA 4KGMA 1LV5A 3HVAA 1NH8A 3R9LA 4N76A 1EJJA 1IKWA 3JTPA 5EX3A 1Q1KA 4PABA 1K44A 2L48A 3KK2B 3BSNA 4DV6J 1UA1A 4ED3A 3FZBA 4OYZA 1WI6A 4ER8A 2W9CB 1RYRA 2B4PA 3G8QA 3QZ8A 4ZCKA 3QSYB 4A48A 5KFJA 3BM7A 4KHRA 5F0UA 1MW7A 2D69A 3C6UA 1U8WA 4TLRA 1XBWA 2MQ8A 3MPDA 3R5BA 4FYYB 2IVFB 3O3LA 3CDAA 3TUIC 1S0MA 4OYPA 2UVWA 2V8HA 1E33P 2BE2B 1R43A 3BSAA 3DXBA 4NRTA 3NWRA 1LXJA 2IAJB 2Z2MA 5HQ8A 1ANIA 2V8VA 1S1WB 2K1RA 1X0PA 3M8PB 3BKTA 4EI2A 5F9NA 3K89A 3GR0A 1YJ7A 2GVDB 3F73A 4J9RA 4HYKA 1IKVA 1OY8A 1YQHA 2VFVA 4DCJB 2PEBA 1N36F 1T9XA 2M7SA 2M9KA 1WC6A 1LWCA 2G13A 2DHAA 3CULA 2GIFA 4KO0A 4YEAA 4QBUA 5FJ4A 2KYZA 3D3BJ 3RW7A 2RUSA 2CJKA 5CZVA 4QYZJ 2VJVA 4CTAA 1FXDA 1F2HA 4RW7B 4EFAC 5DDOC 2VQEJ 2Z0GA 1CJVA 2XWYA 2PT0A 4JI5J 4IO9Q 1FVSA 2CJ9A 1VC6A 3IBFB 4N77A 4AL5A 1DQ9A 1Q53A 2V0NA 3J80Y 3V4MA 1T3OA 2UUCJ 2FJXA 2W2MP 4KH0B 3NP5A 1FRMA 1HNZF 4RZRA 1XR5A 4DV4F 1H0HB 1RAAB 4WP9A 2E29A 3L7OA 4WPAA 3UCZP 1URAA 1Y7AA 3CE8A 4DWIA 1KH5A 4NLRA 4NA1A 4Y28C 3ENWA 2WK4A 4ZCLA 2YKQA 3VTIA 2CQ1A 4DPYA 1SJ3P 3HO1A 1MMDA 3C6UB 2XHCA 2F9JA 3KLEA 2B4VA 1ANJA 2WVFA 3X3UA 2W4CA 1Q95G 1CVJA 1WHWA 3M2RA 5HP1B 5HMWA 2X1FA 3MMAB 4ED0A 3FKBA 2KXNB 1NK4A 4Q8FA 4OI6A 5C42B 1NH7A 4Y6IA 2YH1A 2GJ2A 2RE1A 1OWXA 1WG5A 2DNPA 3R5JB 1YITS 1JLCB 4Y0FA 2YNHA 5GAEU 2CWXA 2XLJA 5DLFA 3CCTA 2HAFA 1IKWB 2LQ8A 4WWSA 4JV1A 2K7JA 1B8JA 1YK9A 1IQZA 1X5TA 4OX6A 3W9JA 4CLLA 2YWGA 2DXFA 2V9KA 4DV7F 1VQNS 3F41A 5DGBA 3PKYA 5A6PA 3DRRA 4I6AA 3LALA 2R2UA 3WX8A 2FVQA 1GEHA 2F7VA 3Q83A 4LREA 2LQ5A 2MPUA 2XI3A 2MZTA 2Y0SD 3KDOA 3MEDA 4IG3B 3RB6A 1EW8A 2HK2A 5H9EK 2VPZB 4C8KA 1KH4A 2WSEC 1HWIA 4X4NA 2UV8A 4JI8F 4MK9A 4O3NA 4LFBF 2KFZA 3RBXA 4OHWA 4HACA 5E3PA 2HHHF 3I4PA 1U45A 1NK8A 2IA6A 3M30B 4FF1A 1WC3A 1HBMA 2HVZA 4DPXA 2J8SA 1RHJB 3ILOA 3R1HA 1HNVB 1R6VA 2NR0A 4RNMA 2E1CA 1KQKA 3T3FA 1LK5A 2RB7A 3I5AA 4R8UA 2BQRA 2RILA 1AROP 3CDUA 4R0EA 1N8RT 2DNNA 3T5KA 3BEGB 1TAQA 1PC5A 3CMRA 1VISA 4QIGA 1CULA 1RBAA 3MAAB 4AQYF 2CAJA 2EBGA 1VRUB 3M6VA 2XGQA 1RT5A 3UR3C 1N54B 5SZTA 2XTJP 2VQEF 4O4GA 3E8OA 2FJBB 3D1QA 4DSJA 1OY6A 3EDQB 1RCXB 4QIVA 4DR1F 2C3MA 2F8EX 5HVGA 3AAWB 2R7TA 2XO7A 1VI7A 2XYGB 2DR8A 2XRGA 4KKOB 2MLZA 5A8WA 2W2PP 2X7IA 4ZVEA 2LDYA 2ALYB 3PM9A 3W66A 5U47A 4CNZA 3IAS9 1LWFA 3LANA 4N7TA 3ISNC 3EXCX 1H2UX 3ISND 4V1Ak 2CDQA 1WKJA 2MZSA 3EDRB 5IZHA 3JAMY 4GVBB 3OTOJ 2DVIA 2JLGA 1PAEX 1REVA 1SIWB 3FCVA 4OZ2A 3C46A 2R7WA 1SXLA 4USKA 2HVEA 4P2XA 4OYMA 3TQ1A 2GHPA 2RAQA 2AD9A 4ZMMA 2ZD1A 3Q86A 1TKTB 3AT1B 4DR4J 1DLOB 1EKSA 3FRYA 2VIHA 2BRLA 3W9HA 1N48A 4M5IA 2VQRA 3CJ5A 4QJVA 2UUBJ 1HQEA 4OZJA 5MLCV 2O66A 2G9OA 1ZAXA 2RSQA 3AY0A 8AT1B 2FZKB 4WFBQ 3OL9A 4KHPF 1F3VA 3TAMB 4B3MJ 2AJFE 3GSIA 1X4HA 4UW2A 1QLNA 3PJWA 1M0SA 4A8XA 1Y6VA 3L95X 2DEJA 5H9FJ 4BBYA 3BDEA 2AYMA 5AE2A 1H72C 5J1EB 4J90A 2BE2A 3RG6A 1YBAA 3D54A 2GAGC 5D77A 3VHQA 2R8GA 2UUAF 1OPIA 1H2VZ 3C6TB 3HX9A 4QWEA 1SH0A 1ICEB 3T1YF 3E2DA 2ZHAA 3BS9A 1YRTA 3NGKA 5LMNJ 4YHHJ 3PKMA 2X51A 4OV6A 4CWBA 4ECQA 1TUWA 3EVOA 2BA9A 4LRFA 5LOQA 3Q8UA 3WZ0A 4F4XA 1XQIA 3IMQJ 2WOMB 4FZVA 5IQQA 4DR5F 1NCLA 2H5JB 1TVRA 3TUPA 2EI5A 4TNOA 3BF4A 3MCNA 4CM0A 2IM2A 4K50A 2P2CB 3GONA 2HQDA 3PX6A 2A6OA 1RKJA 4ZN1A 4LVNP 1U1OA 4PXBA 1B64A 2HRTA 1N5VA 2FYXA 3GG0A 3GV8B 1REGX 3QT8A 5KFCA 2RT3A 5AJ3J 1I3OB 2LXIA 1ZA1B 2CQBA 2GJIA 3FEYB 2WTFA 3GIMA 1NK6A 1U25A 3RB0A 2QYCA 4BWMA 4L75A 5KAKA 5F8MA 4AQYJ 1SC4B 5AXNA 1T8EA 4Y00A 5F3ZA 3CIMA 1GAOA 3HZEA 3I82A 2EK6A 3IS9A 4OJ1A 4R25A 1BC6A 2V4QA 4QPTA 2FC9A 2LYVA 3N4WA 3CCRS 2XY5A 2W5WA 4LRAA 3KKFA 1ZAWA 2HHXA 2MJNA 1LKZA 4O3RA 1PBUA 3AA8A 5EGYA 5KT6A 4YP3A 4HEA9 4QWBA 4ICLA 5A2QY 1Y7PA 1XERA 1FRHA 3FJ2A 3KJQB 5GMEA 4U7UK 3KLHA 2X1AA 2BW7A 5HROB 3MOZA 4HT5A 2MQLA 3UCUP 2F40A 5HP1A 3IR5B 1C4AA 5HQMA 4DJBA 3KYLA 1K8AT 2AYGA 1UJ6A 5J2QA 1VQ7S 1FRIA 3G82A 1S6OA 2Q3PA 2HRYA 3PRVA 3TQEA 2JRSA 3SDEB 4ZLJA 2W8DA 1U49A 4ZVRB 3UO0A 4JI1F 2VKRA 4RUAA 3TEHB 1M1KT 1F5BA 1LFWA 1WHVA 2MKCA 4D3HA 1FJEB 2N3OA 1FNXH 4YDXA 3TA1A 1BHNA 4WTYA 2VBXA 5KFQA 3D0GE 1IM6A 4WXOA 5GAHU 5K14A 3OV7A 1NK0A 3U27A 4ZN3A 1UFKA 4X2BA 1HHQA 1HWKA 3MTKA 4KKOA 4P74A 5A8WB 2MXYA 4DR4F 4RBVA 2GHWA 3H4BA 3R27A 4EK2A 3MUMP 4MJKA 3U1MA 2KFYA 1AXQA 2BKNA 2XBPA 2ZDPA 2VBYA 3MMJA 1XR7A 4L76A 1UZDA 3FGVA 3SFGA 5GAHI 3D2WA 5KFMA 1S97A 4B9UA 4B9TA 2AKWB 3EGNA 3H5UA 3NGSA 1U7LA 1P8GA 2Y1RI 4OZ3A 1HKAA 4OV1A 1V3RA 1PJ5A 2DRDA 2MQOA 3QRPA 2QL5B 2MSSA 3CIZA 4Y2KA 4RW4B 2GHVC 1S12A 1KHWA 3MOJB 4DV6F 2R7OA 1Q5VA 2VFSA 4NZ7A 4LFAF 2D1CA 2R8JA 1BUXA 3K5NA 1NKEA 1TK5A 1SB6A 1HNVA 4MTPA 3J81Y 3D5MA 1HI0P 1AB8A 2CYYA 3LGHA 3ZTPA 2YNIB 4KPYA 4UUXA 2VUGA 4ZLLA 1HQ2A 3KLGB 1SL0A 4UPHA 2PSZA 2QV6A 3CXCR 1CJTA 4DUYF 4IDKB 4CT9A 3VV2B 4MMOA 1UVJA 2WW8A 3AODA 5CD4A 4X4SA 1PYOB 1QSYA 4MIVA 4KT0C 3MK2A 4X4PA 1CJUB 1GTHA 4MKVA 5CYQB 4ETZA 3KLGA 1P6TA 4WKYA 4LSNA 1MMLA 3BPDA 3NCPA 4DQIA 3ZNJ1 1UP1A 1TP7A 4HLBA 4Y2MA 5D8HB 1S1VA 3AOAA 3NRBA 3N5BA 5HLFA 2HVIA 2KT2A 4ED4A 5HQLA 1CS4A 3PR5B 3HVTB 1RTJA 3DLEA 3N6LA 1QVGR 3NOGA 4LF4F 2BJDA 4M5KA 2DIUA 4R8UB 3H4DA 3D6FB 3K0JA 1IQTA 1S1VB 3HSZA 2G0CA 1U0SA 2V67A 2X98A 3EMTA 1X8DA 2FGOA 2QSFA 5K8PA 1NPRA 3FSXA 4DCOB 5J2PA 2J9DE 3HULA 6AT1B 2V68A 2ZOFA 3ILLA 1S9GB 1WF2A 3SQGA 2D7SA 4Q43A 2XM3A 4DUZJ 4R0JA 3RRGA 1E1ZP 3QGIA 4K5SA 1RK8A 2DT9A 4FDFA 2AMCB 4JV5F 3MEDB 2ZM6F 2E5IA 2A2CA 4P6QA 7FD1A 4YR2A 2ZJQQ 4CYUA 4DQQA 2Y8WA 4Q0BB 3NG8A 4DV4J 2VG6A 3D4JA 2GIQA 1M1HA 2AV5A 4UORA 2UXDJ 2HQ3A 4IFVB 4FN5A 3BREA 1S4FA 4KTQA 3UDVA 4PYDA 2EEYA 1FX4A 3IM8A 3R5DA 5HBMA 4W98A 4FPRA 2JFDA 2WSFC 2F9DA 1R89A 3VF0B 2MQPA 2CQ0A 4Y3CA 3TP2A 3BKFA 3PZPA 5GMDA 4ZHRA 1V6HA 3P4UB 3WDOA 2U2FA 4KB7A 2NLWA 4EO8A 3GV5B 1XNQJ 1H2TZ 1RLDA 2LEAA 4KGKA 1FFSB 2RU9A 3UE2A 4ZA1A 1L3TA 1OYDA 3ETMA 5JUMA 2ZBQA 1GMUA 1F9FA 2YWFA 4TY8A 2YKPA 3Q8VA 1S79A 1VJWA 1Q79A 4LF7J 2HBQB 3CEDA 4KO0B 3PW0A 3NNHA 4WF9Q 5DG8A 3R7SB 1HBOB 1T9VA 2KJWA 3HHDA 2JLFA 2ZUGA 2W9BB 4A8FA 2C2EA 1GX5A 3KUEA 4RW6A 5LJ5Y 3S1TA 1RAFB 1RT2B 3R7BB 3MECA 1VQ8S 1HWJA 1XMOJ 1GMWD 3D9BA 4CXSA 2MKIA 4FXVA 1OPZA 4URGA 1YWXA 3I5BA 2HIYA 2IAJA 4HR2A 5C2GA 3D3CJ 1E6YB 5CCLA 2VBZA 3LOUA 4TN2A 1VQPS 1FO1A 2NS1B 1YBUA 3H90A 3M4XA 3DFEA 4KAIA 4C8ZA 2MZJA 2VZ9A 4WK1A 3N6MA 4EBCA 5KFNA 4JI8J 3R97A 2XHWA 3G9CA 4PXEA 3MWBA 2LU1A 3DLKA 2HQFA 2AZ3A 2M4MA 4DL2A 4IRKA 3POTA 4NWXA 4RW7A 2RUGA 2DGVA 1RT1B 3DGVA 2EG1A 3PCOB 4GC7A 3V6DB 1KD1T 1FK9B 3EVMA 4I2PB 2IY5B 2IM3A 2FHJA 2Y1IA 4DSLA 4ZG7A 1LK7A 4OYAA 1SL2A 1TZ0A 1YJ9S 2JVRA 3PTWA 2HLTA 2KJVA 2C2OB 3HHLC 1DFDA 3DOLB 2A18A 3L09A 4H54A 2PA3A 1NAQA 2M0GB 3SSSA 3KTQA 4TKTA 2AJ1A 1G4CA 2OSQA 5CA5A 2BANB 3W64A 2ZEJA 4ENOA 3CCSS 4LF6J 4JYAF 1CLFA 3NKQA 4LBIA 1N88A 1U2CA 4FP9A 5FD1A 3I0SB 2UVVA 2Q1LA 2XCAA 3HK2A 2MKHA 3DOKA 1HD1A 3NXZA 4EYIB 2YNIA 1T9UA 1TL3B 4QIEA 4NLVA 5DO2A 2HYIB 4ZIWA 2CQGA 1W7WA 3RZAA 4HL9A 2GGPA 4I4BA 4LR9A 1ZTWA 3EUNA 4CLTA 4DV3F 1BQMA 2NZCA 3AJ1A 1F5AA 3MEGB 2ZBRA 3HD2A 3QSIA 3KK3A 1Y5NB 5D4LA 4A8KA 3C6TA 2XMTA 3GJTB 3EPIA 3KMQA 2LQBA 1AZSA 1Q16B 2QA4G 4CH1A 2NXNA 1FXRA 2GNKA 3BH7B 4FF3A 2AYBA 4USUA 4OX9F 3MDFA 3QQCD 3GYNA 5I3UB 2BJEA 2CQCA 1FNMA 3M2VB 3NNCA 4NYZA 2W7OA 1KFSA 3G6ES 2CQ3A 3S6EA 1TMJA 1XMQJ 5D0EA 4HDGA 3HZGA 3MK0A 1NB7A 4XIUA 2FUG9 4CZCA 3T02A 1SCJB 2JEFA 3M2VA 1WDTA 5K9FA 3JB9k 1WNEA 4K4YA 4M94A 2DNGA 4KR0B 1TL7B 2ZH3A 2XMVA 3GMGA 1GMWA 2CPHA 3K8WA 2UU9F 4WFZA 3TJ9A 1JXVA 1LNQA 3IRWP 5J2QB 1YHQS 2IUCB 2JEGA 1Q8BA 1FE4A 2D9PA 4QAXA 1R3NA 3TA0A 3OR2B 3R2DJ 3VALA 1K0TA 4U8VA 1JJHA 4K4TA 4ED2A 3NKNA 3FC9A 1T05B 1JIHA 3MM8A 2BACA 4NCGA 4TU9A 4F0MA 3SV3A 1APSA 2OUGA 4OZ5A 4PG7A 1X5OA 2F3JA 3CCLS 5DG7A 4OI0A 1KOHA 2HFNA 4J91A 3UN3A 1EX8A 4B3OA 1F9HA 2VKZG 2I0XA 5KFSA 1ZM9A 5HATA 4DPWA 1N33J 2W25A 1NDLA 3MR2A 3V4IB 3TAPA 1H3DA 2G2OA 3CGIA 1VHFA 3UN2A 3TARA 5IJSA 2B4OA 3N0VA 4RW9A 4JI3F 4K0KJ 2M70A 2QL9B 2XCPA 3SI8A 3GFHA 4TQSA 3J7A1 2KDOA 1U24A 2RKIA 1VRUA 3X1LB 5E33A 3OLAA 4L73A 3K5MA 1VJQA 3V5RA 3KLIA 2W1BA 1KKHA 3ZZOA 4F4KA 2ZE2B 1B0TA 2LEPA 3D7SB 5B08A 4LMZA 1UWBB 4MFBA 5HANA 1FKAF 1RTJB 4RW8A 3M8WA 1NSPA 2J9CA 3POTB 3RBDA 2KL8A 5LMUF 3T41A 5B0EA 1S9EA 2G1HA 3V6DA 1WUUA 3NGUA 2PI5A 1QUVA 2CFXA 2GGPB 2WZ1A 2XMJA 3K5OA 5ETLA 3RAMA 4X62F 4JI4J 4ELVA 3HHKA 5KFLA 4LRBA 4CP5A 5B0BA 4DR7J 3C8YA 1C0TA 1SVDA 3I56S 4ECSA 1T9TA 1O6XA 4J9OA 3TAQA 3HLUA 2DGXA 1B7YB 3QWPA 2YH0A 3VQTA 3CCMS 4IR1A 1OY9A 4B17A 2VFTA 4I1TA 1HMVA 4NYPA 3M8RA 1S1TA 5ETNA 1U48A 3QRQA 2K2PA 1HBOA 5LMNF 2UP1A 1P9QC 4QZVB 2E1MC 2I2YA 4GTWA 3ZTSA 2ZNYA 2ZVSA 1Q81T 2DXDA 2K3IA 2J7WA 5HJYA 4CNYA 3BV8A 4OLOA 1U1KA 4AFFA 2DR9A 4UT4A 1JLEB 5AE1A 4P7VA 4QPXA 2NCKL 1T03A 5E5NA 1KLMA 3DYAB 1KHLA 2FZCB 1DRZA 2ZOMA 1W25A 4FNHA 4DL7A 2CZ9A 4LUBA 1QSLA 1Q5YA 2YNFB 2DO4A 5B0FA 2HS3A 3BQ0A 2H4YB 2BV3A 3MMBB 4HHHA 4BCAA 2GMJA 4FBTA 2C2KB 3IWLA 2E5JA 1PCAA 2PFFB 3G8SA 4BS2A 1HR0J 4XTTA 5GADI 2E1AA 1LXNA 5ETTA 4ZVOB 1Q4RA 3RBEA 5J2NA 3N79A 3MM5B 1NDPA 2UUWA 3M2UA 5IC6B 3KHLA 1NPPA 4NLTA 4GKJJ 2DXEA 3LTOA 1K47A 2XS7A 5J2NB 4KFBA 4YB6A 3H7HB 1P1TA 4O23A 3CCJS 4NI2A 2YNGA 2BDPA 2XR9A 2DNLA 4IFYA 1XR6A 1LFPA 2PMWA 3HFZB 2M8HA 3DPCA 3JS9A 3LP0B 4B3SJ 3IG1B 4CCHA 3FSYA 1QVFR 5H9FK 3BBCA 3S7RA 3BQ2A 4JI3J 1WI8A 1IBMF 3Q8SB 3B6BA 3TVYA 4DR6F 3PW2A 3Q8QB 1JLBA 1VLYA 4DL4A 4U8YA 3RU0A 4BC9A 5K8NA 5KTQA 5HBMB 3KK2A 4ZOSA 3OL6A 2OD4A 3OVBA 2RF2B 4WCEQ 4YQWA 1VYAA 1RZMA 2OSRA 1NDCA 5D4NA 2E5GA 2BJ3A 4FNIA 3S8SA 4UY85 3HJVA 2AF6A 2WONA 4NE9C 3VAMA 1H98A 2ZZNA 2ZJPQ 5M2UA 2YX7A 1AUDA 2HHQA 2HQCA 1EQ0A 5KFIA 3LWMA 3FFIA 2SXLA 4Z2XA 2MQMA 1NMEB 2ROPA 1GX6A 2QG9B 3DMJA 4RKUC 1OYEA 4C0OC 1SL1A 4HVZA 1KTQA 2AW0A 1EQMA 4Y2AA 1KS2A 1R7IA 2DHHA 3U1LA 1S6QA 1SH2A 3QPIA 2HWIA 3MGJA 1D9AA 2HGNA 3BGUA 5D78A 1WSVA 4AL7A 1F2GA 1URBA 2C3OA 4HTIA 3EGWB 2BRKA 2EC0A 2Z4PA 5KT2A 4NCAA 2AP6A 2DNYA 1ZYQA 1RT3A 9ATCB 2XS5A 3Q2TC 2E66A 2YQ0A 3EM1A 2UUCF 1RHRB 3FEXB 3DYCA 2MGZB 4QWDA 3QWUA 4QWAA 2D74B 2C2DA 1KOOA 1S7HA 2L3MA 2V94A 3MCSA 2OEKA 3QATA 4I0WA 1TAUA 1KVJA 2CDRB 2UVRA 3W63A 1C0UB 1ZZNA 4DHVA 3LP0A 2LMIA 1N56A 2YKNB 1C1BB 5E3RA 2RS8A 4L3NA 4NEZA 2RQMA 3CCVS 2P5VA 3PO4A 4GKKF 2AHOB 1SJ1A 3EVWA 2NYHA 2F4VJ 3THTA 1HYSA 3NKPA 4YOEA 2JLEA 1EW2A 2IIHA 3KNGA 2L41A 1X60A 1SH3A 5F8NA 3IAM9 1MWQA 1N0UA 3W60A 5T41A 4E98A 2ASDA 4OHYA 4PG8A 3NWGA 3GIRA 4A8QA 1H6KX 4WZQA 1M5HA 1JLFB 3B82A 2OPSB 2RH3A 1S4EA 3DM2A 1YJTA 3UDCA 2W7PA 1QDUB 2P6TA 1K7HA 4EBEA 3T1HF 4KAYA 3CNQP 1VQOS 2FJEB 5A0YA 3JAMU 4IOCQ 3IC1A 1YIJS 2YQ3A 3H2UB 2VH7A 4FDIA 2OPSA 5LSRA 1CJVB 2B7CB 4DR1J 3DDNA 5ETQA 5HROA 4UPKA 3PVXA 2N4DA 4B3SF 4OYWA 1UEUA 4Y2CA 4B9MA 1U8SA 1B4SA 3NMRA 1MWZA 3CO0P 3R1LA 4AL6A 2QMWA 3M9OB 1J5OB 2GLQA 1FI4A 4F3MA 1KWMA 4M5HA 1RHQB 2GFFA 2YY3A 2OEJA 1FD2A 1AT1B 4LSLA 1VGYA 4L72B 4P2MA 4Q5VA 2HHHJ 2JEJA 2VA2A 1RTHB 3PYFA 1VK3A 1C1BA 2CUYA 1RT7A 2YX1A 1C0UA 1EKRA 1RADB 2MSTA 3GG1A 3GB0A 4RBTA 2ATCB 1HNZJ 1AJDA 3AJDA 3CCES 2Q66A 2P6SA 1UW9A 4L6V3 1XJWB 3SDEA 5A8KA 2RHSB 5B7WA 2CJXB 2WB4A 1VQ5S 1R0AA 3DLLQ 1DURA 1ELYA 4DX6A 4CO5A 2LEBA 5KXAA 2ALZA 5H1SV 5HL7Q 4LF9F 4WFNQ 3M30A 3ELHA 5I42B 2VPWB 4ED1A 2BJ7A 2W9CA 1FTRA 5DDQC 2NPIA 2ZNZA 1XC9A 1ROFA 3WAWA 5JMNA 3IM9A 3BSOA 3QFWA 4IQMA 1KSPA 3NBPB 2IRUA 3BYPA 4OX7A 4FS1A 4YN3B 8RUCA 1ZAVA 2I5JB 1C1CB 4UQGA 2HBZB 3GZ7A 5EWFA 1J27A 4X64F 4DS5A 2EPIA 2V2QA 2DR5A 2EFGA 2VG5B 2F5GA 1GK8A 1ZEFA 1X7VA 1V5VA 3QLHA 1U1MA 2ZH1A 2KO1A 3MPVA 4RW6B 3IDDA 1RAIB 5HVHA 4X4QA 2DNOA 2CNKB 1M5SA 4EZ6A 2I38A 2HZVA 4F02A 1L3KA 3HJFA 4CO0A 1E3CP 1RJJA 2FLOA 3FBEA 3FBCA 1PO6A 1TKTA 5KG4A 4F4YA 4FS2A 2JVOA 4NWJA 1YBTA 2Y1JA 1JLCA 1DTTB 4C48A 4DX5A 1S72S 2ZZMA 5L1KA 5G4DA 1V3ZA 1WACA 2CKWA 4ED5A 1SKSA 2IM1A 4QR2A 3MR5A 3D6MB 5CYMB 2DCLA 2GZOA 1F9EB 3I5CA 2OJ3A 4LFBJ 1GQEA 2W5RA 2NXEA 3T6BA 1TUVA 2FDNA 4F4WA 3LGNA 2LECA 2NXCA 4KV8B 4GVBA 4ZJLA 3I96A 4W4MA 1UZHA 2ZC4A 3HI9A 3IFEA 2R2RA 3WBZA 2B5JB 1ZTTA 2IYIA 2LCWA 3W3SA 2DNMA 2WRMA 2PIIA 2GO8A 1CBKA 1MN7A 2AEMA 2WVCA 3BBBA 3IXQA 3M2UB 4ATNA 1RAJA 2YWKA 1KEKA 3VAJA 1WTBA 1RT2A 4ECRA 1F3FA 1IUJA 2FLLA 1EIYB 2HHSA 4PG6A 2KRRA 3BGOP 3AJ2A 4QW9A 2QLBB 4TY8B 1DQ8A 3P6YC 4QYZK 1JB0C 5KG5A 5B09A 3V81A 2HAIA 1QUPA 3HVWA 4FF2A 2BM1A 3TZWA 4C3LA 5LRMA 1X4BA 1HQAA 4DV0J 4C2MA 4DR5J 4Q45A 3MAHA 3DYAA 1B0PA 3BO2A 3SZYA 5IT9Y 2KI2A 3LH2S 1TKXB 2H3EB 1FERA 1BQMB 2V8DA 1CJKB 3OR1A 2ROEA 2CG4A 3P8BB 4R5PB 2Y1LB 5F8LA 4CLFA 5KG2A 5E2QA 2EFQA 3ZZPA 5SUHA 2IJFA 4UOPA 1MSWD 2AWZA 2DHSA 3J7YI 3U7JA 4ZIVA 4X62J 4DV2J 2FJWA 4JI4F 3LXQA 3DU5A 1D3WA 3QT7A 5KFEA 1SBRA 3OUYA 2G4BA 1AJAA 3M7VA 4FPIA 1UKUA 3GU0A 2W24A 2QA1A 3VAIA 2AJ4A 1ALIA 1J5EF 3D1OA 1QM9A 3PFEA 2NXJA 2MZRA 3LAMA 5IWAF 2IBKA 1QE1B 3D66A 2DNRA 3SBMA 1B99A 3WQPA 2E9TA 1KH9A 1IBCB 1I5OB 4TU8A 3CMQA 4ZVPB 3CUNA 5H9EJ 4C6AA 4F0KA 3R3TA 1HHTP 1LW0A 3UDLA 4KJDA 2GMHA 1FJCA 5G0RA 5KFBA 1MG7A 4CLPA 1RT3B 3A8KA 1VQ9S 4CYSA 1CC8A 2GV1A 2ZBIA 5D0GA 4P7TA 1HNXJ 1PKUA 4F4ZA 1XEZA 2FHKA 3MMAA 1RWNB 1YDLA 1JXEA 5GMKa 3HFVA 1PGZA 2EVZA 2R9LA 4A46A 1RTZA 5IXUA 2C28A 4P9SA 3CJKA 1KHNA 3IBWA 1WOOA 4KIAA 5IT0A 2VU5A 2KHDA 2J9DA 4ZLNA 5IV4A 5KFHA 2NYIA 5DJBA 3PX4A 1YJRA 3DI6A 4K0KF 1ZS6A 3OSNA 3R6LB 2K7KA 2UV8G 5BYRA 1K1SA 2GVZA 4USVA 1OSDA 4K7QA 4WBFA 2FD2A 5J1PA 3VQSA 4ZPAA 1VQMS 2XSJA 3E3XA 2JC0A 1S5ZA 1VC5A 2RQCA 1TUGB 2MKYA 2BJ1A 4IH5A 4CO1A 1NZ8A 2ZHBA 1CEZA 5L1JA 4YR3A 5LMUJ 1SKRA 3EE3A 4RLEA 1YI2S 1W26A 3OL7A 3KJVA 3DHXA 4HTJA 4ECYA 2P9CA 4NLSA 5I4MA 3M1VB 3VGTA 4KGXB 3KOAA 2IUCA 1HPZB 1W2IA 2EWHA 3QGPA 2UXBJ 5LIAA 2AJ2A 4OZNA 3RRKA 4PQAA 4ZP9A 1UWAA 3ZNUA 2RDJA 1RYSA 4WYLA 4C11A 3H8YA 2KH9A 3DKDA 4C4WA 1RP5A 2LFVA 4UPLA 4ZHRB 5LT5A 4DG1A 1FFWB 3E51A 3W5XA 1PIEA 2NREA 1A7GE 1I51B 2AJQA 2UXDF 4JI7F 4QR1A 4JUZA 3AB2B 2MKJA 3VWSA 3EX7B 3T9NA 4IRDA 1GNKA 1WD6A 2FPHX 5I3UA 3KHHA 2P8IA 1HBUA 5K14B 3ADAC 2JL9A 3O2IA 4JI6F 1TFWA 1S1TB 1XTZA 4HI2A 4C97A 2QRRA 2APOA 1VLOA 4DU7A 4DR2J 3DI6B 5GAGI 1U09A 2NQPA 3BH6B 3LA0A 1CSJA 4M5DB 4FYXB 4CDIA 1KN6A 1A6LA 3QRRA 2HWTA 3D0HE 1FDBA 4ZLPA 3AFGA 2G0JA 1RAHB 4CLWA 4FKYA 1FE0A 3EICA 4DFKA 4CXKA 4DFMA 1RTIB 4WXWA 1GH8A 1QAXA 1R27B 1T11A 3DRPB 5D4OA 4AYBD 1WC4A 4U6PA 2R7XA 1SC3B 3CCZA 4C3KA 3OLBA 2J0SD 3PXGa 2IRYA 1IM4A 3HVTA 4ZVFA 3U02A 4X65J 3PHEA 1U4BA 2YVSA 5BJRA 2P9GA 3AH6A 2B9YA 2JC1A 3AD9C 2ZH7A 4M95A 1S0VA 3UCGA 3HVRA 1R8AA 1EHWA 1FDAA 3C66A 5LL6d 3FCHA 5IFMA 1T3NA 4ZP6A 4DMZA 4F04B 2W4DA 1TMMA 5F0WA 3PW4A 3NS7B 2JNJA 2HKEA 3MM9A 3TVKA 2Z8QA 3HHLD 3M8SA 2IFXA 4YS2A 1GFWB 1R6YA 2OPRB 4NRUA 4GKKJ 1IKXB 5KFAA 1J5OA 1KFDA 3CSKA 4O4RA 3Q0AA 3BDPA 2GA3A 3GFZA 2D41A 2I5JA 2Y3YA 3IBCB 4AXIA 4LF2A 3W62A 3H5SA 1WORA 3K5PA 2ASYA 2E7XA 4ZPTR 2OTJS 3UR0A 5DM6Q 4RNHA 4PRFA 2HRUA 2KZMA 1FESA 1KR4A 3WIVA 3HT3A 2PD1A 2ZVIA 3W2VB 1REVB 3RTVA 1YJNS 1N2KA 2W5XA 2LU2A 1YTYA 1NSAA 2KKHA 3OR2A 1NHVA 1GXTA 4WU2A 3PR4A 4DZ6A 2YXLA 1R0AB 3HHEA 4I68A 4A47A 5RUBA 3EZOA 1RXOB 4RU9A 1JLAB 4GRSA 4HHUA 4FYVB 2QSWA 4NLWA 2ZH6A 2VJUA 1RT7B 1VK8A 4RPFA 3DDIA 3GFXA 2C3PA 4UOCA 2HBYB 4J9VA 2DEIA 5KFGA 3OTEA 1T7PA 2HMIA 4B3OB 2FZGB 2OTLS 1RAEB 3RRHA 3QZ7A 1SPBP 3PJXA 3OPKA 3W9IA 4XDDA 2WCXA 3CO9A 3HHLB 3OFFA 1JKHA 2BXJA 2P9EA 3VZHA 2W8SA 3PDNA 2JDJA 4O3QA 2ASLA 1WKKA 3ILIA 4I56A 3BO4A 1AZSB 3KFWX 3OJSA 4JV5J 3C15A 3PACA 3H2LA 1HBNA 1RHUB 4WU3A 1HPZA 4B56A 1PG5B 1KNZA 1KTVA 1P27B 4A8OA 3ZTOA 2C2RA 3KNAA 3LP1B 2V63A 2VHGA 2B3TB 3QFHA 1KDNA 3GIIA 5D3GA 1O98A 2XMKA 1JJCB 1HBMB 1X9SA 5KFWA 1RGVA 3M6XA 3NCQA 3P3DA 4ICLB 3MM7A 1XMQF 1NBEB 1NJWA 3RBZA 2QE5A 3ULHA 1VS3A 2W2OP 2DNKA 1Y5IB 2XNRA 5DLTA 4DS4A 1MROB 4LR8A 2K3KA 1L3SA 1ZA2B 1JX4A 2PC6A 4RO0A 3RUBL 5CXTA 1KVIA 4DF8A 1BQXA 5F41A 1WELA 3NS5A 4YB1P 3QAEA 3MMCA 2HHWA 3HKWA 3OHBA 4X64J 4DPUA 1X9MA 2L08A 3BPSP 1NK5A 4IUFA 5CH7B 2HNDA 2G2ZA 5L0EA 3M32A 4TYBA 3G6VA 1HA1A 1IXKA 1LWEB 1Y3KA 3KUGA 4PWWA 4P2SA 3R5CA 3JSRA 3WHIA 2IA0A 1NJYA 1JLAA 4PCQA 1I94J 1NNDA 1WC1A 4B3MF 1RT5B 2R4FA 1FTCA 1SUQB 2G2YA 2E7WA 3PFOA 1LQ9A 4CH7A 1VCTA 5DQIA 2XMAA 1FK9A 5IQ6A 4UUWA 1YVFA 4TQRA 2QLFB 3UD3P 1S6UA 1F6TA 4BLGA 2PO4A 3PO5A 3M8QB 2XULA 2OLWA 4AT1B 2X1GA 4ZG9A 3SV4A 2DY1A 1RACB 2WVBA 3ITHA 5GVQA 2CJYB 4LBHA 5K20B 4PPZA 1YLXA 3DRYA 2VPXB 5KT4A 5ETVA 1BY9A 1FWKA 1GT8A 2CPXA 4NLYA 2QL7B 2FVRA 3SFUA 1V3SA 4IFYB 1MU2A 2FQQB 4UQTA 3N6NA 1VC0A 5I3QA 2OPRA 2G1DA 3I32A 3US5A 5E3QA 1YJUA 1FKPA 4ZVSB 4CLSA 4NCBA 4KGZB 5J2MB 1S1XB 5B0DA 3LW5C 2E5HA 4UZCA 3Q8RB 4KAVA 4M5NA 2EFNA 3CJ2A 2N7YA 4KBIA 1FKOB 2X1BA 2EG2A 5ETRA 3W65A 1XIQA 9RUBA 4XO0A 4C0HA 3ET6A 5ETMA 4EU0A 2OGUA 3MR6A 2R7QA 2Q6CA 4CLZA 4DLEA 2RF2A 2XZTB 3JSYA 3JXOA 4DR7F 5KFFA 1UL3A 4BDPA 4JYAJ 1QAIA 1MN9A 1NU4A 3QNWB 3D6HB 3W8PA 2EKNA 4AE5A 5K8OA 2HHUA 1FEEA 1F5CA 2BW2A 2QTWA 1RAGB 2L9NA 4GVLA 3KHGA 2RHQB 2D9OA 3G87A 3WBHA 3HKZD 3B54A 4P73A 1RDRA 5JVHQ 2IFYA 4XAKA 1QTNB 3G2XA 2ZH8A 4HI1A 1FDDA 2MLYA 3K58A 2LLZA 2JZ5A 1JLGA 4OYXA 4WJBA 3ENAA 5TJ3A 4G1IA 4QQBA 3M8ZA 4CT8A 2AJ0A 3ENQA 3KJVB 3TWZA 4ZP8A 2LQ9A 1HNWJ 1R31A 1VQYA 3Q3QA 1TK0A 4MHXA 3P96A 4CYUB 1ED8A 4OFZA 1VQKS 2IVMA 4ECWA 1FA0A 4DL6A 2O01C 1MNEA 2XSJB 1A0OB 1S9GA 3SQGB 5DG9A 1ULRA 4LR2A 1WEYA 4J9QA 4UTGA 2R8KA 4KE5A 4ZP7A 3B4MA 3GWCA 3OQ2A 4DX7A 3I0RB 4TY9A 4EZ9A 1VFJA 2RRNA 2XLIA 2JSXA 2AZ1A 2QLJB 3FDSA 4RJVA 3DLGB 2E1RA 2YKNA 3W2WA 4XPEA 3G6XA 3M05A 3D28A 3T6JA 4DX8H 1TQLA 2XMWA 3CJ8A 3CJ3A 5KFTA 5A2QU 1K9MT 3R7NB 5KG1A 5L46A 1QSSA 2BBEA 3F0NA 4OZ1A 2O3DA 3BDHA 1TKZA 3OTCA 3I87A 4LRCA 2C22A 1TL4A 1X4AA 2AT1B 1KLNA 4FXWA 2AQ4A 1MMNA 4HH1A 3TX0A 5CAAA 2XGPA 4GKJF 1YRUA 4JI0J 3WAYA 3FQLA 4X4RA 1VBZA 1S6QB 2XB2D 2VOOA 1JWWA 4K4UA 3ZC4A 1IKVB 5HN0A 4ECTA 4GO5X 4DSEA 3T5HA 1FKOA 2W5TA 3H40A 3CD5A 1FRKA 5DLWA 1B0VA 1K73T 7AT1B 1WF0A 3VGVA 2IBOA 5DETA 5EWGA 3G4SS 1RT4A 1RWKB 2HNYA 4MYTA 2W2NP 4MIWA 1MU2B 3BN7A 3DOMB 4RNFA 2ZH4A 5MAOA 5KFKA 5DM7Q 4CRJA 4B3TJ 5LXRA 4LF5F 5AT1B 1NHKL 2AEJA 3OUYB 5EHHA 1QTMA 2GSNA 2X3DA 4C9DA 1IBLJ 5E3AA 3ITHB 4PR6A 4JI2F 7FDRA 3CCWA 4U95A 1KVKA 1H7XA 3VAKA 1LWXA 2GSOA 1RISA 2QFJA 3UW1A 4GTYA 2CQPA 2FHMA 3GYXB 3JTOA 3M8QA 4I7FB 2YKMB 1UWBA 3LP1A 4MFBB 2XO6A 1WC5A 4KH1B 3AOBA 4OX8A 2DGTA 2CA9A 3OSPA 2UUTA 4N56A 1N5QA 5DQHA 3PHTA 5D6GA 2V34A 2MMYA 1P9YA 3C15B 5GAEI 1PC4A 4TLQA 2RQ4A 1X4EA 1F60B 2OEMA 3FZ2A 3SCJE 4X66J 1U1RA 1B7FA 1SUQA 3HM9A 3V81B 1S77D 2XG8A 2B6AA 3M2RB 2ACMA 4RU2A 2MY8A 3ZZTA 2FJAB 3RR7A 4LFCJ 1HHSA 3CCUS 5CYQA 4O3PA 2CQ2A 4ZG6A 1Q8KA 1VRTB 2GO9A 4A8MP 1IBKJ 2M3DA 4NMXA 3QGHA 3L4BC 2HMIB 2EW9A 3H25A 3TYTA 1MROA 1RAOA 4C98A 4MK8A 1IJFB 4M63A 3AD7C 1CC7A 4OYIA 4WIQA 3SCKE 4CLYA 2VQFJ 4DUZF 3KD8A 3MM5A 1Q86T 3ETOA 2R7VA 1Y5LB 2YWWA 1N5TA 1X31C 5DS7A 3CB4A 3AB4B 2DH8A 1SQGA 2JH3A 3CC4S 1WG1A 4NLDA 1SJQA 2B51A 1E6VA 3NGTA 3VVUA 1HNXF 1QY7A 4KY3A 1RLCL 4N5SA 4UF4A 2B8PA 2DCUB 3UWTA 4ED7A 3IGNA 1RUSA 2U1AA 3M8YA 4OI2A 1RHMB 3UVJA 4BHQA 2HGMA 1UW4A 3ZZYA 4DL5A 2ADCA 3TOQA 1J2VA 1U47A 1E6VB 3JQMA 4Y65A 2F4VF 2CPDA 2BZ2A 2QN6B 2F4FA 2J76E 2M5YA 3IP0A 3MEKA 2H4WB 3OXGA 4USJC 1M5OC 2Z2ZA 4MH8A 2D3O1 4PWDB 4YR0A 1S7IA 3OT9A 4I67A 2RD5C 2VFUA 1O51A 3DNCA 3SQOP 4OZLA 6FD1A 2MY7A 3BN4A 4X65F 3MR3A 3IGVA 3Q8YA 2N4CA 2YQ1A 3VZIA 3CJRA 2VBWA 4U7UD 1AFIA 2PI4A 2WAQD 1JJ4A 3N9UC 2B6AB 5ETPA 1S1UA 1TL1A 1QAJA 5AXKA 1Z1ZA 1R0CB 1SC1B 1AA1B 2CPEA 2IVYA 1FKPB 1RBLA 1DBDA 3BR9A 3MAAA 2BUNA 4NZ0A 5C24A 4F0HA 1AFJA 2CWKA 3BDFA 4CQ1A 3DRSA 2GAHC 2ADBA 4GMKA 4ZCMA 2Z2LA 1U02A 4Q2LA 1Y9OA 1XN9A 2VICA 2AX1A 4DXLA 4K59A 4UOGA 4WE1B 2DGSA 1EAYC 2LVWA 2QA2A 4Z7YA 5B0CA 5CABA 5L9NA 2KVQE 4DPOA 2OPPA 3KLHB 4DI6A 2HIQA 3TA2A 4DSFA 4F3OA 2VOPA 5KFZA 4K4VA 4J7CA 2EC2A 3H0PA 4LT6A 5KOWA 2HW3A 5JJBA 1D09B 3TX8A 1S6PA 5HMZA 1SJFA 1NLKL 2H65B 3WX4A 5DDRC 1NSKL 1T0TV 2W9AA 1TELA 3CW2C 1T9YA 3D6TB 3FEZA 2QFIA 3NCRA 1FNOA 5HSPA 4OYOA 3PYEA 4PKDB 1LWEA 1SJRA 3ZXWA 3V6JA 2BANA 1AUKA 2LDIA 4V19X 2CNOB 1OS5A 1DTQA 1UA0A 4J9KA 4DQPA 1HW8A 4YY3J 4NLOA 1BQNB 5GRRA 1HI1A 4NPOA 3A8IA 4WK3A 1V5IB 3I55S 1JK9B 1ITPA 3T01A 4K2JA 4RWWA 2HHVA 4KM4A 4FYWB 3FMWA 4NX9A 1X4GA 3NBPA 4U9RA 5L8RC 5KT5A 1RT1A 1U1LA 4ES1A 5C66A 2OPQB 4OHXA 3E2EA 3IWNC 1PJ6A 3TZZA 4PWUA 3MCOA 4J9UE 4G6VB 4ZVGA 4RNNA 1YG0A 2QT7A 4AD6A 5THWA 5INHA 4ILRA 1FXLA 3W2WB 2A10A 3EGVA 2JJ4D 2VB6A 4CYRA 2E5LF 1QJHA 5IC4B 4O3SA 1EETA 3QIPA 4Y2IA 1X4DA 1FF2A 1KONA 1U2FA 1YZ7A 4M5DA 4DCPB 4L74A 4O0IA 5EGEA 2RDIA 2OFHX 2R8HA 2XNQA 2XC9A 1T05A 4G1PA 1R8PA 3BB5A 3LPEA 2HHPA 1NRKA 4NXMF 1BE4A 3GYGA 3WAVA 3RYLA 4ILLA 4QU7A 2CRLA 2W4PA 1KQFB 2B9XA 4B02A 3MTJA 3QIDA 4F4AA 3OHAA 4URSA 1BWEA 2DH7A 4DG1B 2VG7B 2Q43A 4P71A 2CNNB 2O1PA 1GXLA 3MPUB 1Q0NA 2WW4A 4OJHA 2C2ZB 2BYCA 2L9DA 2ZD1B 4M5JA 2KFNA 5D4PA 3J80U 1UMJA 3QT6A 1HNIB 2VDHA 3RJMB 5HMYA 4TVAB 3K59A 1CULB 2DRAA 4WKRA 3ZFVA 1RWWB 4D3GA 4GO7X 3TUJC 1PAUB 1UETA 2YTCA 4F25A 3UFCX 4ZVUB 1SC6A 2DYAA 1JQGA 4FVMA 4DEZA 1JNRB 5HO4A 2JFKA 3K17A 3LF0A 4O0NA 2EXUA 1RBOB 2DHXA 2O67A 4RUBA 1CQNA 1HI8A 4KYZA 2KRBA 1BGXT 3OBIA 3DLHA 3G96A 2GVDA 1EARA 2OELA 4CIOA 3MEEA 3C19A 5I42A 2CPYA 1BWVA 3I9V9 4EEYA 3FQKA 4QIWD 2HSEB 1G1XA 4YUDA 2RH6A 2CVEA 4NLXA 3A3OB 3O6QA 5HI7A 3HMJG 2A1BA 5E41A 1DY3A 5FDLA 2ZITA 2BMBA 4IG3A 2KT3A 3BKUA 3FFIB 5KFRA 5KG7A 3I31A 3GIKA 2DKOB 2RRAA 3OFGA 3THPA 1RKIA 4DZDA 5IV3A 5L39A 5J2PB 4H4KC 4ANCA 4ZJOA 1ZEDA 3NVLA 2R2SA 1X4FA 5EX0A 2AU0A 3OR1B 4NZ6A 1S9EB 4HHJA 3UQSA 4R5PA 5JVGQ 2V4JB 2VL1A 1TKZB 1FCAA 1TL5A 3DHWC 4NL5A 4EWTA 3BQ1A 4YB5A 4ZPCA 4EO6A 4DV2F 3PW5A 3WIUA 1UVIA 5C25A 2OMOA 2Y0BB 4RW4A 3SMZA 2YNHB 3DGPB 5BXIA 1GTEA 4M1KA 4ZVTB 4DOZA 1LW0B 2YBVA 4LIRA 3HT0A 2ZUAA 2CJAA 4G3IA 4LSNB 1H7WA 1WHXA 1ZM2A 4QR0A 2FY1A 4P2FA 5F3TA 1SKUB 3G71S 3UDEA 2QMUB 2EK1A 1SQFA 3NLCA 1U6FA 5A6WA 1RWXB 2J9EA 4DSKA 4LF9J 1CJTB 4ECZA 1U1PA 1I94F 4ID5B 1WG4A 2MHNA 2PA8D 3SEOA 1KBRA 3D0IE 1TU0B 4FDJA 4ZK7M 1RB0A 2J7UA 5IM0B 3EZUA 1VQSA 2AGQA 1IJEB 4JV0A 4MAKA 3CJSA 4WIIA 4KC5A 4YR1A 2QO3A 3K2YA 3LGMA 4ALZA 3ZZRA 2BOAA 4YMEA 3MM7B 2UZAA 2GW8A 1YZ6A 1JLGB 3N28A 6FDRA 5HMXA 2KG0A 3MFIA 2DGUA 3PY8A 4NXMJ 3HF5A 4EGLA 3F56A 3CWJA 2R3VA 4F26A 1IWAA 1FWLA 3MM6B 4DLGA 2NSCA 3PEHA 2ZOGA 2Z2YB 2PFDA 4XK8C 3WC0A 5M2PA 4F67A 2PEHA 5C5JA 1OMSA 3ENVA 3MMBA 3FBFA 4IO1A 4CTAB 1RWOB 1RQ0A 3MURP 4C8MA 4QYRA 4DV1J 5IT9U 2B56A 3M9MB 2UUBF 3IG1A 3NAHA 4NA2A 4B9LA 1L5UA 3TG0A 2OI2A 1UFWA 5CYJA 1KLMB 2V4RA 3I0RA 5IS2A 3BBFA 2LP4A 2ZJRQ 4ECVA 5KFXA 3MFHA 4NASA 4E2FB 3IR6B 1J5EJ 1RA6A 4ZKAA 4NWBA 1C4CA 1LEOA 2GIRA 1WSRA 5DLGA 1S1XA 3O44A 2CPIA 1X5PA 5BYQA 1WKLA 2OH2A 4Q0BA 1HJKA 4PYAA 4P10A 4WZMA 1FSUA 4P75A 3TZYA 1ZH5A 4LF8F 1S59A 3KDNA 1C0TB 4C7QA 3KXDA 3C14B 3CD0A 1XK8A 1EZZB 1HW9A 3IGZB 2J5AA 3JQKA 4PXDA 4DL0C 5BR8F 2D3UA 2DPJA 2FGCA 1S76D 3CD6S 2GSUA 4DSIA 1FJ7A 1ALJA 2IC3B 3W5YA 4IQXA 4WP8A 1RSCA 4NXNJ 1Q82T 1OQ6A 1S0NA 1HNWF 2VC1A 2HNZB 5FLXY 2W5QA 3AXMA 2OPQA 3KLIB 2E1PA 2V8GA 3D1HA 1T9WA 1D8ZA 1Q7LB 1TTHB 1EP4A 1LW2B 1YKWA 2HVDA 3BYRA 3FVYA 3KG1A 3MR7A 3OTBA 5T7LA 4MT1A 1I6JA 1R0BG 1U6ZA 2Z30B 3LUYA 4G1QA 4J37A 2KM8C 3JYTA 1QE1A 2F8MA 4USHA 4ECUA 3GIJA 4NA3A 3H5XA 1S1WA 2EFPA 2K1RB 2GCFA 1RABB 3M8PA 1HQUA 3R6GB 5FDLB 1NPKA 2XYHB 1R8CA 3VVTA 4QWCA 5AXMA 5F9LA 1D9FA 4LQ3A 3T1HJ 3T00A 3B78A 4MKYA 2LQJA 4PG5A 1TV6A 1E2SP 1ED9A 2B4UA 2ACYA 4GTZA 3GSDA 2YPZA 3MM8B 5HVFA 3PX0A 4FKXA 1URRA 2IMWP 2ROGA 1TR0A 2OPPB 3OJUA 2BVZA 1DHMA 2CNLB 2GS8A 1TVRB 2J0XA 2V6AA 4WE1A 3J7YU 1CJKA 2BM0A 1NXIA 3K7RA 3OVSA 4PUOB 1U26A 4AUKA 2EBEA 5IWAJ 4BWJA 2UUAJ 1UJ5A 3KK1B 2IPOB 3DM2B 3NKRA 2ZE2A 1DQAA 2YKOA 2CQDA 2XY6A 1JKHB 4L3KA 2R7UA 2XMMA 5L1LA 3K57A 3MECB 5J1EA 3CMAS 1TL1B 4UOOA 3P5TL 3F44A 4QCLA 4CLUA 3H20A 3HCXA 4OQJA 1T95A 3IRXA 1ZM4A 4USWA 3UNGC 2DNHA 4O44B 3VAHA 4FBUA 4K4SA 5GOVA 2HFUA 3EWGA 3M6UA 4F36A 3BGFA 5IOLA 2ZH2A 4OI4A 3PJ9A 4RNOA 1D1UA 2G9YA 1NJIT 1VIOA 2GA7A 4H4OA 4PEOA 1PYSB 1V9OA 3HDSA 3S01A 1VMBA 1FJGF 1RE1B 1D9DA 3KUHA 5ETKA 4C11B 2DIVA 2RMLA 2FHJD 1KQSR 2R8IA 5KT7A 1G7CB 3KK3B 1NJZA 4LF8J 1EI6A 5GADU 1KH7A 3AHPA 1Y0HA 1HBNB 2OHDA 3I9ZA 4CM2A 2DD8S 2WBRA 2FVSA 2BJ8A 1VR6A 4OI3A 4NMLA 2KG1A 3NEKA 3TI0A 2DB1A 2E44A 4DBQA 5AXLA 3NKMA 1U2RA 1VDHA 3CPWR 3CC7S 4K5RA 4DN9A 5LQQA 2V5HG 3BR8A 3IWXA 2PMHA 4KHMA 2EFOA 4PUOA 3DOKB 3RAXA 1VRTA 2CZ4A 2OIHA 2IM0A 3LWLA 1HARA 1AJCA 2ZH5A 1WEXA 3RB3A 3HHNB 3PYDA 3C3LA 1A9NB 4NLUA 2QZUA 2DGOA 3HFKA 5HRTA 3W8GA 4EUVA 4DN0A 2JEIA 1WEZA 2OD6A 4OJGA 4F3QA 2B7BB 2MJUA 1Y4ZB 3FK4A 1ZBTA 3KWMA 1JLQB 5ETOA 2V9WA 5B0AA 3GE9A 4I2PA 4CLKA 2IYGA 4QIFA 2H1YA 3SZZA 3GLJA 3KK1A 5G0RB 4N47A 3QYYA 1X5SA 1CS4B 3WAXA 2FC8A 3ILJA 3CF5Q 2M2BA 1NB2A 3QO9B 5KOXA 3PV8A 1G6BA 4UOFA 2GJFA 2ASJA 5E0OA 3WC2A 2OAUA 1H38A 2ZH9A 4MK7A 4DFPA 1IR2A 3BGLA 2ZM6J 1S10A 2Q79A 1ELXA 5HK4A 3TJ8A 4KRWA 2I8EA 3FSIA 1N2LA 3J7AN 2BX6A 3G86A 1U1QA 1JMTA 2C3YA 4IDKA 3Q24A 4DF4A 5DZ6A 1HQUB 3QGGA 2LKZA 3OL8A 1DZ5A 4B9SA 2Y9HA 1RA7A 1YRXA 2PGCA 3CT9A 2HS4A 4ELTA 4USMA 4I6WA 3CJ4A 4AXJA 2QX0A 2YWEA 2C1EB 2V8PA 4K4XA 1ZOTA 2J0QD 1ACMB 4RR5A 2DPIA 4DUYJ 2Z56B 3GJSB 3HSDA 2CQ4A 4IG0B 2FIUA 2A6MA 5I3PA 4J9SA 2BOPA 1ALKA 2OFGX 3LP2A 1FT8A 4ZPDA 3R2CJ 1FFGB 2ZWPA 3PRBA 1H74A 2ATLA 1OJ4A 3TVZA 4EMDA 3PG9A 5KT3A 1C2PA 2BJ9A 3AOCA 1FD8A 4Q2MA 2J6SA 4ANEA 2HWHA 2N3LA 2YKAA 2I6WA 5GAGU 1FJGJ 2QC3A 5T14A 4S0MA 3BZQA 1UEKA 3GFYA 2GQ2A 4CO3A 5IJQA 5K8MA 4PPDA 4YFUA 3P45B 4PXCA 2YNGB 4ITSA 2GQCA 4N8OA 3ZTQA 3KLEB 1ELZA 4PG4A 1N6QA 2MQQA 2NSBA 2FB0A 5ETSA 3NMAA 2UXCF 1N32J 1Y3JA 1NM2A 2OMLA 1RWVB 2VG6B 3GPAA 1IR1A 2VFRA 4K8RA 1NSQA 3EXYA 4CO4A 5IM0A 3HXMA 3QJJA 5EGHA 4A4JA 3JQJA 4IRCA 3DLJA 4M5LA 1BLUA 2DGQA 5M2RA 3V6KA 1BMQB 4W90B 1WDDA 1M5VC 3IGYB 2K8GA 2QLWA 2UVUA 2B5JA 3A3PB 1Z4UA 2VODA 5EN1A 1HYSB 4DR3J 3QIPB 4X4VA 4U96A 2VD3A 5DDPC 4ED8A 2HVHA 1MLAA 3NS6A 1O0PA 4DV5F 2HURA 2W5VA 4LF1A 1X4CA 2PDAA 4MIBA 2XI2A 3AA9A 4B3RF 1HWLA 3Q22A 3KLFB 1WC0A 4ZPBA 4C8NA 3DLEB 1YJWS 4RX6A 3A3NB 1S99A 3VCDA 1DJ0A 1SQEA 3RW6A 5LXYA 2GMLA 1UAWA 3MM6A 4DDFA 3J7ZT 2ZKUA 4LRDA 3G6YA 1YX2A 2ANHA 1LWCB 2FHOB 3C16A 1NK7A 3CMES 4JB8B 3B5QA 4RW9B 2OKQA 4IYQA 1EQJA 1EB0A 3LQVA 3TRGA 2F1FA 2MEWA 3AQOA 1IR0A 1KQGB 2ZBCA 2DY9A 2H54B 4OL8A 1CJUA 2RRBA 4IH6A 3SSQA 2G0IA 5E3CA 4ELUA 1URNA 3T5JA 4RWXA 1C1CA 1NZAA 2QGFB 3D68A 3FRZA 3PIOQ 3J81j 1TFYA 1M90T 3AXKA 4N41A 3MUVP 3DRRB 4XPCA 3VAFA 4OYBA 1EW9A 2AX0A 3W7BA 3O5TB 3MD1A 3MEEB 3MZIA 4OIXA 2J6UA 5J1NA 1O5JA 2WOMA 2NUUG 2MHEA 1Y00A 4C3MA 3DU6A 3EYZA 3B4DA 4UZBA 2RS2A 1GMVA 2HQIA 3A1YG 4QW8A 5DZ7A 4JI1J 1HDHA 4C0BA 4Y34A 2VPYB 4K4WA 4J5OA 3BJYA 2V4JA 3OXFA 4F2RA 1IVZA 1H73A 3T5LA 2D3OR 3CJTA 1SJ4P 2H5EA 2XY7A 2ZZTA 1UTAA 4JI6J 2X3GA 3JSBA 2RKIB 1SV5B 1Q8LA 5JXSA 4RUHA 5E7OB 3V4IA 1EJ7L 2F65A 3AD8C 2E9ZA 1PSDA 4OLPA 1OSCA 2HPUA 3VGUA 3Q8PB 4KFBB 3IRXB 3T1AA 2Z57B 1NHUA 4FF4A 5ITHA 2LXUA 2RIJA 2MB0B 1IKYB 3VGSA 3M9NB 4URQU 3GV7B 3CC2S 3KLVA 1W2BR 1L3UA 1N32F 2RDDA 3W1YC 2M88A 2KYXA 2YPYA 4NOHA 1UCNA 5LSLA 3JTNA 2VC0A 4RUCA 2BEFA 2CIMA 1RU2A 1M5KC 3J81U 4CXUA 1F0XA 2A3JA 3G82B 3MCMA 4Q7AA 3KG4A 2ZDOA 3O8WA 2V50A 2HLUA 2MZQA 4ZVQB 3NGDA 2A2DA 4N8NA 4JI0F 2CJBA 4TN0A 5BR8J 3OW2R 2CVIA 4B08A 2KZZA 1DTTA 2C3UA 3NOCA 1HLWA 2WHOA 3MUTP 1JJ2R 4I2QA 2KHCA 2OO4A 2UXBF 1QD1A 3PEJA 4JV2A 1N5SA 3ISZA 1CG2A 4DV3J 4PQUB 2I1RA 4EBDA 2CJQA 4EYHB 2AEFA 2E5LJ 2EKYA 4GC6A 2IDEA 3I0SA 1VBXA 1G3OA 5K4PA 2HZCA 2XZDB 4P52A 2IHR1 5KFVA 4LBPA 3QLHB 4O44A 3MM9B 4E8UA 1FX2A 5KG0A 4JI7J 3DC2A 2IDLA 4OI1A 3HPOA 4LF4J 4NEYA 4KJGA 4JI2J 5F8JA 2YWHA 2XS2A 1HL6A 1NUEA 4ZCIA 1EP4B 1EETB 3PYGA 5AJ3F 2MGZA 1Z2LA 3R5GA 2AYEA 1F1BB 3OTDA 3CDBA 3SYZA 4DR2F 4RBUA 1TK8A 1FVQA 1S6PB 2QMXA 1ZETA 1KHKA 5DLVA 1N36J 3DRPA 5CYMA 4X66F 4ZPVR 1AUSL 2CPJA 1HD0A 3MEGA 3QO9A 4WFAQ 3M6WA 2F8HA 1FWPA 5C7PA 3BO3A 2MKKA 3GCXP 1SKWA 4RW8B 4IKAA 4HH0A 3ZZUA 1RT6A 4B9VA 1PBAA 1ELOA 3GCWP 3DMJB 3UD5A 4CH0S 1DAXA 4WP3A 3DLBA 4C8YA 5C24B 4XDCA 3SXLA 1IBKF 2Y8YA 4WFYA 2IRXA 4PWDA 3FUYA 4ZDNA 3W5ZA 1RTDA 2VA3A 2ERRA 2BABA 4E0DA 1X9WA 1VQ6S 3JSMA 2HFVA 3DOLA 2MYFA 3FMBA 4LSLB 1AJBA 3M32B 1WHYA 1FRXA 3HSGA 3L7PA 5T7LB 2XMUA 2L9WA 2XYPB 1Z2ZA 1YSJA 1YJVA 2C42A 1LW2A 3FNNA 3H98A 4MYUA 5D0RA 3R8YA 1FDNA 8ATCB 2W9BA 1XNQF 4H4KA 5LM7E 4ED6A 1DLOA 2MTLA 1S0OA 2HG4A 1XMBA 3E01A 1KHVA 4NXNF 2KT5A 2KM8B 3TUZC 5EDWA 1N34F 3A52A 3NKOA 2JOQA 4MIAA 3KLFA 1JXLA 3BSCA 5C42A 5F8GA 4LF7F 5AJ9A 3LAKA 2QIFA 4X4TA 4UY8T 1IWGA 2OP5A 2IC3A 4B3TF 4LF5J 2I9SA 1NKCA 2POKA 3DLGA 3QJLA 4M5GA 4ZJQA 1FHTA 1L3VA 4RL1A 1VRQC 3UVJB 1RWPB 5DRKA 3SCLE 4M5MA 3TR5A 4U7CA 2QEXS 4GTXA 5A8KB 2W01A 1K1QA 5CCMA 3C14A 2WSCC 2HEKA 4J9LA 1VBYA 3GTYX 3HD1A 3H59A 4LF6F 1IKYA 1S1UB 2RQKA 2FJVA 3K8VA 2RU3A 3SZ2A 1RTHA 4JBCA 5EWEA 2D1GA 1VIXA 1WOPA 2H51B 2DNQA 2WVDA 3GJQB 4USIA 4ILMA 4DV7J 1MWYA 4ID5A 4K2XA 2ILZA 1PILA 3A8JA 3K5LA 3UD4P 1HIYA 2BQ3A 4LFCF 4KPCA 3ZTRA 4W92B 1IBMJ 4OZ0A 2VF3A 2XSFA 4O4GB 2DRBA 2Q6BA 1YGYA 3QT5A 4HDHA 4F8RA 3QJPA 1P1LA 1P49A 3OFEA 2C2NA 4V19J 1IN0A 5C25B 1VQ4S 4OMFG 3P49B 1RWUA 3M1VA 3QMQA 4ETXA 2XLKA 2KTQA 2PE8A 3CTRA 3R5AA 2DR6A 2ZHOA 4ID8A 4IFVA 3N01A 4LJMA 4I7FA 4LQ9A 5KFOA 3CCQS 3RAQA 1LWFB 1ZPVA 2R7SA 2FTRA 4KJIA 2NZ4A 1BXNA 1WJ9A 2QLXA 1Q78A 4P72A 2E9RX 4PZVA 3KJNB 2BKOA 3SCIE 4BC7A 2EFVA 1UFLA 4ZPWR 5A8RB 2BR0A 1QAYA 2ZBPA 1UVKA 3P5BP 2H5IB 5J2MA 1NK9A 2DHGA 2GVZB 4DPTA 2J8AA 3DOMA 4A8YA 4H4MB 4KHPJ 2HK3A 2WONB 3PNIA 3A4TA 4DL3A 1RT4B 2HNYB 5A8RA 1NJXA 2HHTA 3B8HA 2V2KA 3W61A 2ZC3A 5KFYA 3EZ5A 3VR1A 4KSEB 3IN5A 2B8QA 2W8LA 1UVNA 3C16B 3I4HX 3CJKB 2KN4A 3HSJA 5L0KA 2QA4S 1O99A 3DGPA 1M5PC 1FRLA 2RVJA 4J9PA 2B9WA 2J0WA 2ZKTA 3N5FA 1S49A 5CQGA 5ADZA 2N7CA 2DITA 4A8SA 2R2TA 2HGLA 1N52B 1UVMA 2CPZA 1UEVA 5KG3A 4OX9J 2XZWA 2PMZD 2V2VA 2YKMA 1R8BA 4HT7A 4O3OA 1JLBB 3DDKA 4DFJA 1WTFA 3OXLA 3T19A 1OIAA 3MD3A 1JLQA 5LJ3Y 1B3TA 1RTIA 5HLFB 1XWLA 3H2VE 1N34J 3NL0A 4ZGAA 1OQ3A 4JOUA 5F8HA 3OTOF 1B70B 2MDAA 5DQGA 3ICLA 4HACB 3D67A 4QU6A 1D8YA 1R8HA 5AE3A 2HNDB 4JP8A 4X84A 1Y10A 2N82B 2J6TA 4TU7A 3EGZA 2MZ1A 1U6BA 4NI2B 4OHVA 4MY4A 2IJRA 1WOSA 4WFXA 2UU9J 2BQUA 1Q7YT 2NUHA 4ECXA 4DR6J 2DBBA 2VV5A 1Y11A 2W7AA 2DO0A 2NXUA 2QZ8A 2NPFA 5L38A 3KG0A 2AGPA
chains in the Genus database with same CATH topology
3TX0A 4LRDA 1B8JA 1AUKA 1ZEFA 2ANHA 2IUCB 3WAYA 4B56A 1AJBA 1EI6A 3IDDA 3MK1A 1KH7A 4QAXA 1ALHA 3B5QA 1O98A 1EQJA 5GRRA 2W5TA 5DLWA 2IUCA 3NKNA 1E3CP 4LR7A 5LIAA 4LREA 2W5WA 3NKMA 4LRAA 5DLTA 1KH4A 4NWJA 4LR8A 4UPIA 5C66A 5LQQA 3ED4A 3A52A 1SHNA 4UPLA 3TG0A 1EW9A 5AJ9A 3UN3A 2GSNA 1AJCA 5INHA 2W5RA 5L0BA 3NKOA 3UN2A 2GSOA 5IJSA 2QZUA 4CYRA 1URBA 4GTYA 5HRTA 1HDHA 4GTXA 2W8DA 5EGEA 4LQYA 3BDGA 3UO0A 3UNYA 1HJKA 3DYCA 5L0EA 4CXSA 1EJJA 1FSUA 3SZZA 3CMRA 2D1GA 1E1ZP 3M8WA 2GSUA 3WAXA 3WAVA 4ZG9A 4YR1A 4CXKA 3IGZB 5LRNA 3T01A 4ZG6A 4LRBA 1SHQA 4UPHA 1ELXA 4NWXA 2W5SA 1EW2A 3UN5A 2XRGA 5LRMA 1HQAA 1E33P 1N2LA 2W5QA 3KD8A 1P49A 3SZYA 4ZG7A 1ANIA 4N7TA 4KAVA 1K7HA 4CXUA 4KAYA 3M8YA 4KM4A 1EW8A 1AJAA 4GTWA 4FDIA 3NKQA 1ALKA 4TN0A 1KHJA 3LXQA 4UPKA 3T00A 3M7VA 1E2SP 1ED9A 2GA3A 1KHLA 2RH6A 4GTZA 1ZEBA 4MIVA 2X98A 1ALJA 2VQRA 3WBHA 3MK2A 1ALIA 2GLQA 2IFYA 3OT9A 5IJQA 4LR9A 1ELZA 5K4PA 1KH9A 1N2KA 5L0KA 1O99A 2W5XA 5TJ3A 1ZEDA 3NVLA 3M8ZA 4UOPA 2ZKTA 3TWZA 3NKRA 1Y6VA 4KJGA 1URAA 3Q3QA 4KJDA 4MHXA 5EGHA 1ED8A 1AJDA 1Y7AA 1KH5A 3BDFA 4CYSA 3IGYB 3E2DA 3BDGB 1ELYA 4LR2A 4UOOA 1KHKA 2XR9A 4ZGAA 5DLVA 1ANJA 4LRFA 5KXAA 3NKPA 1KHNA 2W5VA 5GOVA 3DPCA 3MK0A 2G9YA 3WAWA 3T02A 4MY4A 2W8SA 4FDJA 3BDHA 4LRCA 4UORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TX0 A;  4LRD A;  1B8J A;  1AUK A;  1ZEF A;  2ANH A;  2IUC B;  3WAY A;  4B56 A;  1AJB A;  1EI6 A;  3IDD A;  3MK1 A;  1KH7 A;  4QAX A;  1ALH A;  3B5Q A;  1O98 A;  1EQJ A;  5GRR A;  2W5T A;  5DLW A;  2IUC A;  3NKN A;  1E3C P;  4LR7 A;  5LIA A;  4LRE A;  2W5W A;  3NKM A;  4LRA A;  5DLT A;  1KH4 A;  4NWJ A;  4LR8 A;  4UPI A;  5C66 A;  5LQQ A;  3ED4 A;  3A52 A;  1SHN A;  4UPL A;  3TG0 A;  1EW9 A;  5AJ9 A;  3UN3 A;  2GSN A;  1AJC A;  5INH A;  2W5R A;  5L0B A;  3NKO A;  3UN2 A;  2GSO A;  5IJS A;  2QZU A;  4CYR A;  1URB A;  4GTY A;  5HRT A;  1HDH A;  4GTX A;  2W8D A;  5EGE A;  4LQY A;  3BDG A;  3UO0 A;  3UNY A;  1HJK A;  3DYC A;  5L0E A;  4CXS A;  1EJJ A;  1FSU A;  3SZZ A;  3CMR A;  2D1G A;  1E1Z P;  3M8W A;  2GSU A;  3WAX A;  3WAV A;  4ZG9 A;  4YR1 A;  4CXK A;  3IGZ B;  5LRN A;  3T01 A;  4ZG6 A;  4LRB A;  1SHQ A;  4UPH A;  1ELX A;  4NWX A;  2W5S A;  1EW2 A;  3UN5 A;  2XRG A;  5LRM A;  1HQA A;  1E33 P;  1N2L A;  2W5Q A;  3KD8 A;  1P49 A;  3SZY A;  4ZG7 A;  1ANI A;  4N7T A;  4KAV A;  1K7H A;  4CXU A;  4KAY A;  3M8Y A;  4KM4 A;  1EW8 A;  1AJA A;  4GTW A;  4FDI A;  3NKQ A;  1ALK A;  4TN0 A;  1KHJ A;  3LXQ A;  4UPK A;  3T00 A;  3M7V A;  1E2S P;  1ED9 A;  2GA3 A;  1KHL A;  2RH6 A;  4GTZ A;  1ZEB A;  4MIV A;  2X98 A;  1ALJ A;  2VQR A;  3WBH A;  3MK2 A;  1ALI A;  2GLQ A;  2IFY A;  3OT9 A;  5IJQ A;  4LR9 A;  1ELZ A;  5K4P A;  1KH9 A;  1N2K A;  5L0K A;  1O99 A;  2W5X A;  5TJ3 A;  1ZED A;  3NVL A;  3M8Z A;  4UOP A;  2ZKT A;  3TWZ A;  3NKR A;  1Y6V A;  4KJG A;  1URA A;  3Q3Q A;  4KJD A;  4MHX A;  5EGH A;  1ED8 A;  1AJD A;  1Y7A A;  1KH5 A;  3BDF A;  4CYS A;  3IGY B;  3E2D A;  3BDG B;  1ELY A;  4LR2 A;  4UOO A;  1KHK A;  2XR9 A;  4ZGA A;  5DLV A;  1ANJ A;  4LRF A;  5KXA A;  3NKP A;  1KHN A;  2W5V A;  5GOV A;  3DPC A;  3MK0 A;  2G9Y A;  3WAW A;  3T02 A;  4MY4 A;  2W8S A;  4FDJ A;  3BDH A;  4LRC A;  4UOR A; 
#chains in the Genus database with same CATH topology
 1O8B A;  1N6Q B;  2KXH A;  2LXF A;  3FCW A;  3DRX A;  3MK1 A;  1WWH A;  1TKX A;  4F50 A;  4G65 A;  1ALH A;  1DAR A;  4KV8 A;  4KQZ A;  3A13 A;  3V2U C;  3IR7 B;  3ZZ0 A;  1LOU A;  5A76 A;  1XMO F;  3MF5 A;  4J9N A;  2VAS A;  2FVP A;  2CXE A;  2KVI A;  4X4U A;  5LSO A;  3KHR A;  4DV5 J;  2JX2 A;  1BD6 A;  2W8K A;  1X0F A;  2YNF A;  4IR9 A;  3L9Z A;  3Q89 A;  3OFH A;  4UPI A;  1HWU A;  2MQN A;  5B0G A;  1XNR J;  1JLE A;  1T03 B;  1HNI A;  1SHN A;  5EUH A;  4YHH F;  3L3C A;  5HAO A;  2RJZ A;  1VOM A;  4I6Y A;  4IG0 A;  4Z37 A;  3LPY A;  3ONQ A;  2LA6 A;  2B43 A;  3LP2 B;  4DU8 A;  1Q8I A;  2ABY A;  3CVK A;  3MPY A;  5L0B A;  5F8I A;  3KMS A;  2C2M B;  2MKS A;  2W5S A;  3AQP A;  3MXH P;  4FVC A;  4ZIT A;  3UPF A;  3ET6 B;  1CQM A;  5IT4 A;  4FXD A;  2QYG A;  3GR1 A;  1T02 A;  4LQY A;  3GJR B;  4ZVH A;  3BDG A;  1I1G A;  1UPP A;  3L7U A;  3UNY A;  4Q44 A;  1N0V C;  4C8O A;  3V6H A;  1NO8 A;  1RTD B;  1KRP A;  2FVC A;  1JNZ B;  4DV1 F;  2HFS A;  1S57 A;  3PRD A;  3PW7 A;  2VDI A;  2DR7 A;  4TYA A;  3KJF B;  3TAN A;  2WVE A;  4DQR A;  2ILY A;  5CZX A;  1FEH A;  2HFZ A;  4OJ3 A;  2CG8 A;  4J9M A;  2J7K A;  4F2S A;  2CPF A;  5LRN A;  1GXU A;  4NLG A;  3CJQ A;  1K0V A;  4UOH A;  2HZA A;  3TJA A;  1SHQ A;  4CO2 A;  1OO0 B;  2YX4 A;  3LO3 A;  2UXC J;  2IJN A;  1RU1 A;  3UN5 A;  2F63 A;  2JWN A;  3A12 A;  3E01 B;  3FBB A;  4I64 A;  2GQQ A;  1TL3 A;  3RGI A;  2M52 A;  3ZO7 A;  5BYS A;  2CZV C;  3GQC A;  1G2E A;  4CI0 B;  2R42 A;  3QBC A;  3MI7 X;  1NEE A;  2LA4 A;  2XEX A;  1PJ7 A;  2HFO A;  4LIW A;  2MLX A;  1D0E A;  1WF1 A;  3G8T A;  1UJ4 A;  2O5D A;  1DTQ B;  5D0H A;  4MKA A;  3BGR B;  2V69 A;  3IS9 B;  3DN9 A;  4IH7 A;  4LVO P;  2RNE A;  2DNZ A;  1BQN A;  4Z7C A;  2H9Z A;  2BE7 D;  4MKB A;  4DR3 F;  3RR8 A;  2V2Z A;  3JSM B;  1UPM B;  3DCA A;  2VG5 A;  2FLN A;  1HMV B;  3EPG A;  1AYE A;  1N4L A;  1RHK B;  4H4M A;  4G1Q B;  1VHI A;  3BGR A;  3U1N A;  5CHC B;  2H48 B;  4YDD B;  4C8L A;  5FII A;  1KHJ A;  2A0F B;  3T1Y J;  1AW0 A;  3CDW A;  3MMC B;  2KB2 A;  1N5Y A;  1RT6 B;  4B3R J;  1N33 F;  3TEG A;  3OVA A;  5KG6 A;  4HKQ A;  4NCG B;  4NYO A;  2FY8 A;  1ZEB A;  2HNZ A;  3THV A;  3QAU A;  5L1I A;  5DGA A;  2E7V A;  4TXS A;  1ZZF A;  2CAD A;  2BE9 B;  3IA0 A;  5D15 A;  1HR0 F;  1UVL A;  3TNV A;  3DLK B;  4ES2 A;  2DH9 A;  4LSZ B;  3HP6 A;  3EJM A;  3GP9 A;  5KFU A;  3CJ0 A;  2BKP A;  3TO8 A;  1IBL F;  5D3G B;  3DRS B;  1ZM3 A;  4ERD A;  2WBM A;  1S9F A;  1M1G A;  1U0H B;  4PAA A;  3PIP Q;  3NAI A;  2IMO A;  1E6Y A;  1PYT A;  3OD2 A;  3Q23 A;  1TL7 A;  5HJX A;  4FYD A;  3CDE A;  2VON A;  2M8D B;  3GIL A;  3MHY A;  3Q2S C;  1ZPW X;  2D3Z A;  3BDG B;  1HBU B;  4LFA J;  4OHZ A;  2WB1 D;  2VG7 A;  1XNR F;  3T9Z A;  4IOA Q;  2QJ3 A;  1RI7 A;  4UST A;  2Z58 B;  3O1L A;  1HQE B;  2GX8 A;  3TAM A;  1KP6 A;  3NY0 A;  2CQI A;  4YB7 A;  3MAQ A;  3NKY A;  4ZS6 A;  4K4Z A;  2ZWO A;  4IOB A;  4U67 Q;  1FRJ A;  1VBK A;  2W2Q P;  2XQC A;  3H5Y A;  2R7R A;  4DV0 F;  4I2Q B;  4NLQ A;  4X4O A;  3J7Z 5;  1TKD A;  1U1N A;  1SV5 A;  4JI5 F;  4DQS A;  4PQU A;  5KFD A;  2DIS A;  4QOT A;  3ZZZ A;  1S48 A;  1U0H A;  3IO1 A;  5C2C A;  2XWX A;  2VQF F;  5A0Y B;  2DTJ A;  5KFP A;  2GC8 A;  3W2V A;  3VAG A;  1HFE L;  3SIP B;  1T94 A;  1NKB A;  5L9X A;  3TW0 A;  4DUT A;  1JLF A;  2KXF A;  2HQG A;  2FJD B;  4NLP A;  2HBR B;  2COL A;  1SIZ A;  3H42 A;  4ES3 A;  4LR7 A;  3CD7 A;  2K06 A;  3HHL A;  4WTO B;  2FLP A;  4WYW A;  4YY3 F;  1KC8 T;  4H4O B;  1RWM B;  4F7V A;  4Q8E A;  3ED4 A;  2B0G A;  2PN6 A;  2DGW A;  1VQL S;  1NDK A;  5K5M A;  3DXS X;  3C2P A;  1TV6 B;  2AGO A;  1N5Y B;  3NNA A;  4A8W A;  1IKX A;  4B9N A;  1CPZ A;  5CD4 H;  2KU7 A;  3RB4 A;  2HS0 A;  3I6P A;  2CQH A;  1SI9 A;  3JYT B;  2JHE A;  2AIR B;  4M8L A;  3A8E A;  3SSR A;  2DK2 A;  2B9E A;  3UI3 A;  5FLX U;  1RCO B;  2DJW A;  3NGR A;  3TZX A;  4AND A;  3MPW A;  4I69 A;  4KGV B;  2ZFH A;  4KGM A;  1LV5 A;  3HVA A;  1NH8 A;  3R9L A;  4N76 A;  1EJJ A;  1IKW A;  3JTP A;  5EX3 A;  1Q1K A;  4PAB A;  1K44 A;  2L48 A;  3KK2 B;  3BSN A;  4DV6 J;  1UA1 A;  4ED3 A;  3FZB A;  4OYZ A;  1WI6 A;  4ER8 A;  2W9C B;  1RYR A;  2B4P A;  3G8Q A;  3QZ8 A;  4ZCK A;  3QSY B;  4A48 A;  5KFJ A;  3BM7 A;  4KHR A;  5F0U A;  1MW7 A;  2D69 A;  3C6U A;  1U8W A;  4TLR A;  1XBW A;  2MQ8 A;  3MPD A;  3R5B A;  4FYY B;  2IVF B;  3O3L A;  3CDA A;  3TUI C;  1S0M A;  4OYP A;  2UVW A;  2V8H A;  1E33 P;  2BE2 B;  1R43 A;  3BSA A;  3DXB A;  4NRT A;  3NWR A;  1LXJ A;  2IAJ B;  2Z2M A;  5HQ8 A;  1ANI A;  2V8V A;  1S1W B;  2K1R A;  1X0P A;  3M8P B;  3BKT A;  4EI2 A;  5F9N A;  3K89 A;  3GR0 A;  1YJ7 A;  2GVD B;  3F73 A;  4J9R A;  4HYK A;  1IKV A;  1OY8 A;  1YQH A;  2VFV A;  4DCJ B;  2PEB A;  1N36 F;  1T9X A;  2M7S A;  2M9K A;  1WC6 A;  1LWC A;  2G13 A;  2DHA A;  3CUL A;  2GIF A;  4KO0 A;  4YEA A;  4QBU A;  5FJ4 A;  2KYZ A;  3D3B J;  3RW7 A;  2RUS A;  2CJK A;  5CZV A;  4QYZ J;  2VJV A;  4CTA A;  1FXD A;  1F2H A;  4RW7 B;  4EFA C;  5DDO C;  2VQE J;  2Z0G A;  1CJV A;  2XWY A;  2PT0 A;  4JI5 J;  4IO9 Q;  1FVS A;  2CJ9 A;  1VC6 A;  3IBF B;  4N77 A;  4AL5 A;  1DQ9 A;  1Q53 A;  2V0N A;  3J80 Y;  3V4M A;  1T3O A;  2UUC J;  2FJX A;  2W2M P;  4KH0 B;  3NP5 A;  1FRM A;  1HNZ F;  4RZR A;  1XR5 A;  4DV4 F;  1H0H B;  1RAA B;  4WP9 A;  2E29 A;  3L7O A;  4WPA A;  3UCZ P;  1URA A;  1Y7A A;  3CE8 A;  4DWI A;  1KH5 A;  4NLR A;  4NA1 A;  4Y28 C;  3ENW A;  2WK4 A;  4ZCL A;  2YKQ A;  3VTI A;  2CQ1 A;  4DPY A;  1SJ3 P;  3HO1 A;  1MMD A;  3C6U B;  2XHC A;  2F9J A;  3KLE A;  2B4V A;  1ANJ A;  2WVF A;  3X3U A;  2W4C A;  1Q95 G;  1CVJ A;  1WHW A;  3M2R A;  5HP1 B;  5HMW A;  2X1F A;  3MMA B;  4ED0 A;  3FKB A;  2KXN B;  1NK4 A;  4Q8F A;  4OI6 A;  5C42 B;  1NH7 A;  4Y6I A;  2YH1 A;  2GJ2 A;  2RE1 A;  1OWX A;  1WG5 A;  2DNP A;  3R5J B;  1YIT S;  1JLC B;  4Y0F A;  2YNH A;  5GAE U;  2CWX A;  2XLJ A;  5DLF A;  3CCT A;  2HAF A;  1IKW B;  2LQ8 A;  4WWS A;  4JV1 A;  2K7J A;  1B8J A;  1YK9 A;  1IQZ A;  1X5T A;  4OX6 A;  3W9J A;  4CLL A;  2YWG A;  2DXF A;  2V9K A;  4DV7 F;  1VQN S;  3F41 A;  5DGB A;  3PKY A;  5A6P A;  3DRR A;  4I6A A;  3LAL A;  2R2U A;  3WX8 A;  2FVQ A;  1GEH A;  2F7V A;  3Q83 A;  4LRE A;  2LQ5 A;  2MPU A;  2XI3 A;  2MZT A;  2Y0S D;  3KDO A;  3MED A;  4IG3 B;  3RB6 A;  1EW8 A;  2HK2 A;  5H9E K;  2VPZ B;  4C8K A;  1KH4 A;  2WSE C;  1HWI A;  4X4N A;  2UV8 A;  4JI8 F;  4MK9 A;  4O3N A;  4LFB F;  2KFZ A;  3RBX A;  4OHW A;  4HAC A;  5E3P A;  2HHH F;  3I4P A;  1U45 A;  1NK8 A;  2IA6 A;  3M30 B;  4FF1 A;  1WC3 A;  1HBM A;  2HVZ A;  4DPX A;  2J8S A;  1RHJ B;  3ILO A;  3R1H A;  1HNV B;  1R6V A;  2NR0 A;  4RNM A;  2E1C A;  1KQK A;  3T3F A;  1LK5 A;  2RB7 A;  3I5A A;  4R8U A;  2BQR A;  2RIL A;  1ARO P;  3CDU A;  4R0E A;  1N8R T;  2DNN A;  3T5K A;  3BEG B;  1TAQ A;  1PC5 A;  3CMR A;  1VIS A;  4QIG A;  1CUL A;  1RBA A;  3MAA B;  4AQY F;  2CAJ A;  2EBG A;  1VRU B;  3M6V A;  2XGQ A;  1RT5 A;  3UR3 C;  1N54 B;  5SZT A;  2XTJ P;  2VQE F;  4O4G A;  3E8O A;  2FJB B;  3D1Q A;  4DSJ A;  1OY6 A;  3EDQ B;  1RCX B;  4QIV A;  4DR1 F;  2C3M A;  2F8E X;  5HVG A;  3AAW B;  2R7T A;  2XO7 A;  1VI7 A;  2XYG B;  2DR8 A;  2XRG A;  4KKO B;  2MLZ A;  5A8W A;  2W2P P;  2X7I A;  4ZVE A;  2LDY A;  2ALY B;  3PM9 A;  3W66 A;  5U47 A;  4CNZ A;  3IAS 9;  1LWF A;  3LAN A;  4N7T A;  3ISN C;  3EXC X;  1H2U X;  3ISN D;  4V1A k;  2CDQ A;  1WKJ A;  2MZS A;  3EDR B;  5IZH A;  3JAM Y;  4GVB B;  3OTO J;  2DVI A;  2JLG A;  1PAE X;  1REV A;  1SIW B;  3FCV A;  4OZ2 A;  3C46 A;  2R7W A;  1SXL A;  4USK A;  2HVE A;  4P2X A;  4OYM A;  3TQ1 A;  2GHP A;  2RAQ A;  2AD9 A;  4ZMM A;  2ZD1 A;  3Q86 A;  1TKT B;  3AT1 B;  4DR4 J;  1DLO B;  1EKS A;  3FRY A;  2VIH A;  2BRL A;  3W9H A;  1N48 A;  4M5I A;  2VQR A;  3CJ5 A;  4QJV A;  2UUB J;  1HQE A;  4OZJ A;  5MLC V;  2O66 A;  2G9O A;  1ZAX A;  2RSQ A;  3AY0 A;  8AT1 B;  2FZK B;  4WFB Q;  3OL9 A;  4KHP F;  1F3V A;  3TAM B;  4B3M J;  2AJF E;  3GSI A;  1X4H A;  4UW2 A;  1QLN A;  3PJW A;  1M0S A;  4A8X A;  1Y6V A;  3L95 X;  2DEJ A;  5H9F J;  4BBY A;  3BDE A;  2AYM A;  5AE2 A;  1H72 C;  5J1E B;  4J90 A;  2BE2 A;  3RG6 A;  1YBA A;  3D54 A;  2GAG C;  5D77 A;  3VHQ A;  2R8G A;  2UUA F;  1OPI A;  1H2V Z;  3C6T B;  3HX9 A;  4QWE A;  1SH0 A;  1ICE B;  3T1Y F;  3E2D A;  2ZHA A;  3BS9 A;  1YRT A;  3NGK A;  5LMN J;  4YHH J;  3PKM A;  2X51 A;  4OV6 A;  4CWB A;  4ECQ A;  1TUW A;  3EVO A;  2BA9 A;  4LRF A;  5LOQ A;  3Q8U A;  3WZ0 A;  4F4X A;  1XQI A;  3IMQ J;  2WOM B;  4FZV A;  5IQQ A;  4DR5 F;  1NCL A;  2H5J B;  1TVR A;  3TUP A;  2EI5 A;  4TNO A;  3BF4 A;  3MCN A;  4CM0 A;  2IM2 A;  4K50 A;  2P2C B;  3GON A;  2HQD A;  3PX6 A;  2A6O A;  1RKJ A;  4ZN1 A;  4LVN P;  1U1O A;  4PXB A;  1B64 A;  2HRT A;  1N5V A;  2FYX A;  3GG0 A;  3GV8 B;  1REG X;  3QT8 A;  5KFC A;  2RT3 A;  5AJ3 J;  1I3O B;  2LXI A;  1ZA1 B;  2CQB A;  2GJI A;  3FEY B;  2WTF A;  3GIM A;  1NK6 A;  1U25 A;  3RB0 A;  2QYC A;  4BWM A;  4L75 A;  5KAK A;  5F8M A;  4AQY J;  1SC4 B;  5AXN A;  1T8E A;  4Y00 A;  5F3Z A;  3CIM A;  1GAO A;  3HZE A;  3I82 A;  2EK6 A;  3IS9 A;  4OJ1 A;  4R25 A;  1BC6 A;  2V4Q A;  4QPT A;  2FC9 A;  2LYV A;  3N4W A;  3CCR S;  2XY5 A;  2W5W A;  4LRA A;  3KKF A;  1ZAW A;  2HHX A;  2MJN A;  1LKZ A;  4O3R A;  1PBU A;  3AA8 A;  5EGY A;  5KT6 A;  4YP3 A;  4HEA 9;  4QWB A;  4ICL A;  5A2Q Y;  1Y7P A;  1XER A;  1FRH A;  3FJ2 A;  3KJQ B;  5GME A;  4U7U K;  3KLH A;  2X1A A;  2BW7 A;  5HRO B;  3MOZ A;  4HT5 A;  2MQL A;  3UCU P;  2F40 A;  5HP1 A;  3IR5 B;  1C4A A;  5HQM A;  4DJB A;  3KYL A;  1K8A T;  2AYG A;  1UJ6 A;  5J2Q A;  1VQ7 S;  1FRI A;  3G82 A;  1S6O A;  2Q3P A;  2HRY A;  3PRV A;  3TQE A;  2JRS A;  3SDE B;  4ZLJ A;  2W8D A;  1U49 A;  4ZVR B;  3UO0 A;  4JI1 F;  2VKR A;  4RUA A;  3TEH B;  1M1K T;  1F5B A;  1LFW A;  1WHV A;  2MKC A;  4D3H A;  1FJE B;  2N3O A;  1FNX H;  4YDX A;  3TA1 A;  1BHN A;  4WTY A;  2VBX A;  5KFQ A;  3D0G E;  1IM6 A;  4WXO A;  5GAH U;  5K14 A;  3OV7 A;  1NK0 A;  3U27 A;  4ZN3 A;  1UFK A;  4X2B A;  1HHQ A;  1HWK A;  3MTK A;  4KKO A;  4P74 A;  5A8W B;  2MXY A;  4DR4 F;  4RBV A;  2GHW A;  3H4B A;  3R27 A;  4EK2 A;  3MUM P;  4MJK A;  3U1M A;  2KFY A;  1AXQ A;  2BKN A;  2XBP A;  2ZDP A;  2VBY A;  3MMJ A;  1XR7 A;  4L76 A;  1UZD A;  3FGV A;  3SFG A;  5GAH I;  3D2W A;  5KFM A;  1S97 A;  4B9U A;  4B9T A;  2AKW B;  3EGN A;  3H5U A;  3NGS A;  1U7L A;  1P8G A;  2Y1R I;  4OZ3 A;  1HKA A;  4OV1 A;  1V3R A;  1PJ5 A;  2DRD A;  2MQO A;  3QRP A;  2QL5 B;  2MSS A;  3CIZ A;  4Y2K A;  4RW4 B;  2GHV C;  1S12 A;  1KHW A;  3MOJ B;  4DV6 F;  2R7O A;  1Q5V A;  2VFS A;  4NZ7 A;  4LFA F;  2D1C A;  2R8J A;  1BUX A;  3K5N A;  1NKE A;  1TK5 A;  1SB6 A;  1HNV A;  4MTP A;  3J81 Y;  3D5M A;  1HI0 P;  1AB8 A;  2CYY A;  3LGH A;  3ZTP A;  2YNI B;  4KPY A;  4UUX A;  2VUG A;  4ZLL A;  1HQ2 A;  3KLG B;  1SL0 A;  4UPH A;  2PSZ A;  2QV6 A;  3CXC R;  1CJT A;  4DUY F;  4IDK B;  4CT9 A;  3VV2 B;  4MMO A;  1UVJ A;  2WW8 A;  3AOD A;  5CD4 A;  4X4S A;  1PYO B;  1QSY A;  4MIV A;  4KT0 C;  3MK2 A;  4X4P A;  1CJU B;  1GTH A;  4MKV A;  5CYQ B;  4ETZ A;  3KLG A;  1P6T A;  4WKY A;  4LSN A;  1MML A;  3BPD A;  3NCP A;  4DQI A;  3ZNJ 1;  1UP1 A;  1TP7 A;  4HLB A;  4Y2M A;  5D8H B;  1S1V A;  3AOA A;  3NRB A;  3N5B A;  5HLF A;  2HVI A;  2KT2 A;  4ED4 A;  5HQL A;  1CS4 A;  3PR5 B;  3HVT B;  1RTJ A;  3DLE A;  3N6L A;  1QVG R;  3NOG A;  4LF4 F;  2BJD A;  4M5K A;  2DIU A;  4R8U B;  3H4D A;  3D6F B;  3K0J A;  1IQT A;  1S1V B;  3HSZ A;  2G0C A;  1U0S A;  2V67 A;  2X98 A;  3EMT A;  1X8D A;  2FGO A;  2QSF A;  5K8P A;  1NPR A;  3FSX A;  4DCO B;  5J2P A;  2J9D E;  3HUL A;  6AT1 B;  2V68 A;  2ZOF A;  3ILL A;  1S9G B;  1WF2 A;  3SQG A;  2D7S A;  4Q43 A;  2XM3 A;  4DUZ J;  4R0J A;  3RRG A;  1E1Z P;  3QGI A;  4K5S A;  1RK8 A;  2DT9 A;  4FDF A;  2AMC B;  4JV5 F;  3MED B;  2ZM6 F;  2E5I A;  2A2C A;  4P6Q A;  7FD1 A;  4YR2 A;  2ZJQ Q;  4CYU A;  4DQQ A;  2Y8W A;  4Q0B B;  3NG8 A;  4DV4 J;  2VG6 A;  3D4J A;  2GIQ A;  1M1H A;  2AV5 A;  4UOR A;  2UXD J;  2HQ3 A;  4IFV B;  4FN5 A;  3BRE A;  1S4F A;  4KTQ A;  3UDV A;  4PYD A;  2EEY A;  1FX4 A;  3IM8 A;  3R5D A;  5HBM A;  4W98 A;  4FPR A;  2JFD A;  2WSF C;  2F9D A;  1R89 A;  3VF0 B;  2MQP A;  2CQ0 A;  4Y3C A;  3TP2 A;  3BKF A;  3PZP A;  5GMD A;  4ZHR A;  1V6H A;  3P4U B;  3WDO A;  2U2F A;  4KB7 A;  2NLW A;  4EO8 A;  3GV5 B;  1XNQ J;  1H2T Z;  1RLD A;  2LEA A;  4KGK A;  1FFS B;  2RU9 A;  3UE2 A;  4ZA1 A;  1L3T A;  1OYD A;  3ETM A;  5JUM A;  2ZBQ A;  1GMU A;  1F9F A;  2YWF A;  4TY8 A;  2YKP A;  3Q8V A;  1S79 A;  1VJW A;  1Q79 A;  4LF7 J;  2HBQ B;  3CED A;  4KO0 B;  3PW0 A;  3NNH A;  4WF9 Q;  5DG8 A;  3R7S B;  1HBO B;  1T9V A;  2KJW A;  3HHD A;  2JLF A;  2ZUG A;  2W9B B;  4A8F A;  2C2E A;  1GX5 A;  3KUE A;  4RW6 A;  5LJ5 Y;  3S1T A;  1RAF B;  1RT2 B;  3R7B B;  3MEC A;  1VQ8 S;  1HWJ A;  1XMO J;  1GMW D;  3D9B A;  4CXS A;  2MKI A;  4FXV A;  1OPZ A;  4URG A;  1YWX A;  3I5B A;  2HIY A;  2IAJ A;  4HR2 A;  5C2G A;  3D3C J;  1E6Y B;  5CCL A;  2VBZ A;  3LOU A;  4TN2 A;  1VQP S;  1FO1 A;  2NS1 B;  1YBU A;  3H90 A;  3M4X A;  3DFE A;  4KAI A;  4C8Z A;  2MZJ A;  2VZ9 A;  4WK1 A;  3N6M A;  4EBC A;  5KFN A;  4JI8 J;  3R97 A;  2XHW A;  3G9C A;  4PXE A;  3MWB A;  2LU1 A;  3DLK A;  2HQF A;  2AZ3 A;  2M4M A;  4DL2 A;  4IRK A;  3POT A;  4NWX A;  4RW7 A;  2RUG A;  2DGV A;  1RT1 B;  3DGV A;  2EG1 A;  3PCO B;  4GC7 A;  3V6D B;  1KD1 T;  1FK9 B;  3EVM A;  4I2P B;  2IY5 B;  2IM3 A;  2FHJ A;  2Y1I A;  4DSL A;  4ZG7 A;  1LK7 A;  4OYA A;  1SL2 A;  1TZ0 A;  1YJ9 S;  2JVR A;  3PTW A;  2HLT A;  2KJV A;  2C2O B;  3HHL C;  1DFD A;  3DOL B;  2A18 A;  3L09 A;  4H54 A;  2PA3 A;  1NAQ A;  2M0G B;  3SSS A;  3KTQ A;  4TKT A;  2AJ1 A;  1G4C A;  2OSQ A;  5CA5 A;  2BAN B;  3W64 A;  2ZEJ A;  4ENO A;  3CCS S;  4LF6 J;  4JYA F;  1CLF A;  3NKQ A;  4LBI A;  1N88 A;  1U2C A;  4FP9 A;  5FD1 A;  3I0S B;  2UVV A;  2Q1L A;  2XCA A;  3HK2 A;  2MKH A;  3DOK A;  1HD1 A;  3NXZ A;  4EYI B;  2YNI A;  1T9U A;  1TL3 B;  4QIE A;  4NLV A;  5DO2 A;  2HYI B;  4ZIW A;  2CQG A;  1W7W A;  3RZA A;  4HL9 A;  2GGP A;  4I4B A;  4LR9 A;  1ZTW A;  3EUN A;  4CLT A;  4DV3 F;  1BQM A;  2NZC A;  3AJ1 A;  1F5A A;  3MEG B;  2ZBR A;  3HD2 A;  3QSI A;  3KK3 A;  1Y5N B;  5D4L A;  4A8K A;  3C6T A;  2XMT A;  3GJT B;  3EPI A;  3KMQ A;  2LQB A;  1AZS A;  1Q16 B;  2QA4 G;  4CH1 A;  2NXN A;  1FXR A;  2GNK A;  3BH7 B;  4FF3 A;  2AYB A;  4USU A;  4OX9 F;  3MDF A;  3QQC D;  3GYN A;  5I3U B;  2BJE A;  2CQC A;  1FNM A;  3M2V B;  3NNC A;  4NYZ A;  2W7O A;  1KFS A;  3G6E S;  2CQ3 A;  3S6E A;  1TMJ A;  1XMQ J;  5D0E A;  4HDG A;  3HZG A;  3MK0 A;  1NB7 A;  4XIU A;  2FUG 9;  4CZC A;  3T02 A;  1SCJ B;  2JEF A;  3M2V A;  1WDT A;  5K9F A;  3JB9 k;  1WNE A;  4K4Y A;  4M94 A;  2DNG A;  4KR0 B;  1TL7 B;  2ZH3 A;  2XMV A;  3GMG A;  1GMW A;  2CPH A;  3K8W A;  2UU9 F;  4WFZ A;  3TJ9 A;  1JXV A;  1LNQ A;  3IRW P;  5J2Q B;  1YHQ S;  2IUC B;  2JEG A;  1Q8B A;  1FE4 A;  2D9P A;  4QAX A;  1R3N A;  3TA0 A;  3OR2 B;  3R2D J;  3VAL A;  1K0T A;  4U8V A;  1JJH A;  4K4T A;  4ED2 A;  3NKN A;  3FC9 A;  1T05 B;  1JIH A;  3MM8 A;  2BAC A;  4NCG A;  4TU9 A;  4F0M A;  3SV3 A;  1APS A;  2OUG A;  4OZ5 A;  4PG7 A;  1X5O A;  2F3J A;  3CCL S;  5DG7 A;  4OI0 A;  1KOH A;  2HFN A;  4J91 A;  3UN3 A;  1EX8 A;  4B3O A;  1F9H A;  2VKZ G;  2I0X A;  5KFS A;  1ZM9 A;  5HAT A;  4DPW A;  1N33 J;  2W25 A;  1NDL A;  3MR2 A;  3V4I B;  3TAP A;  1H3D A;  2G2O A;  3CGI A;  1VHF A;  3UN2 A;  3TAR A;  5IJS A;  2B4O A;  3N0V A;  4RW9 A;  4JI3 F;  4K0K J;  2M70 A;  2QL9 B;  2XCP A;  3SI8 A;  3GFH A;  4TQS A;  3J7A 1;  2KDO A;  1U24 A;  2RKI A;  1VRU A;  3X1L B;  5E33 A;  3OLA A;  4L73 A;  3K5M A;  1VJQ A;  3V5R A;  3KLI A;  2W1B A;  1KKH A;  3ZZO A;  4F4K A;  2ZE2 B;  1B0T A;  2LEP A;  3D7S B;  5B08 A;  4LMZ A;  1UWB B;  4MFB A;  5HAN A;  1FKA F;  1RTJ B;  4RW8 A;  3M8W A;  1NSP A;  2J9C A;  3POT B;  3RBD A;  2KL8 A;  5LMU F;  3T41 A;  5B0E A;  1S9E A;  2G1H A;  3V6D A;  1WUU A;  3NGU A;  2PI5 A;  1QUV A;  2CFX A;  2GGP B;  2WZ1 A;  2XMJ A;  3K5O A;  5ETL A;  3RAM A;  4X62 F;  4JI4 J;  4ELV A;  3HHK A;  5KFL A;  4LRB A;  4CP5 A;  5B0B A;  4DR7 J;  3C8Y A;  1C0T A;  1SVD A;  3I56 S;  4ECS A;  1T9T A;  1O6X A;  4J9O A;  3TAQ A;  3HLU A;  2DGX A;  1B7Y B;  3QWP A;  2YH0 A;  3VQT A;  3CCM S;  4IR1 A;  1OY9 A;  4B17 A;  2VFT A;  4I1T A;  1HMV A;  4NYP A;  3M8R A;  1S1T A;  5ETN A;  1U48 A;  3QRQ A;  2K2P A;  1HBO A;  5LMN F;  2UP1 A;  1P9Q C;  4QZV B;  2E1M C;  2I2Y A;  4GTW A;  3ZTS A;  2ZNY A;  2ZVS A;  1Q81 T;  2DXD A;  2K3I A;  2J7W A;  5HJY A;  4CNY A;  3BV8 A;  4OLO A;  1U1K A;  4AFF A;  2DR9 A;  4UT4 A;  1JLE B;  5AE1 A;  4P7V A;  4QPX A;  2NCK L;  1T03 A;  5E5N A;  1KLM A;  3DYA B;  1KHL A;  2FZC B;  1DRZ A;  2ZOM A;  1W25 A;  4FNH A;  4DL7 A;  2CZ9 A;  4LUB A;  1QSL A;  1Q5Y A;  2YNF B;  2DO4 A;  5B0F A;  2HS3 A;  3BQ0 A;  2H4Y B;  2BV3 A;  3MMB B;  4HHH A;  4BCA A;  2GMJ A;  4FBT A;  2C2K B;  3IWL A;  2E5J A;  1PCA A;  2PFF B;  3G8S A;  4BS2 A;  1HR0 J;  4XTT A;  5GAD I;  2E1A A;  1LXN A;  5ETT A;  4ZVO B;  1Q4R A;  3RBE A;  5J2N A;  3N79 A;  3MM5 B;  1NDP A;  2UUW A;  3M2U A;  5IC6 B;  3KHL A;  1NPP A;  4NLT A;  4GKJ J;  2DXE A;  3LTO A;  1K47 A;  2XS7 A;  5J2N B;  4KFB A;  4YB6 A;  3H7H B;  1P1T A;  4O23 A;  3CCJ S;  4NI2 A;  2YNG A;  2BDP A;  2XR9 A;  2DNL A;  4IFY A;  1XR6 A;  1LFP A;  2PMW A;  3HFZ B;  2M8H A;  3DPC A;  3JS9 A;  3LP0 B;  4B3S J;  3IG1 B;  4CCH A;  3FSY A;  1QVF R;  5H9F K;  3BBC A;  3S7R A;  3BQ2 A;  4JI3 J;  1WI8 A;  1IBM F;  3Q8S B;  3B6B A;  3TVY A;  4DR6 F;  3PW2 A;  3Q8Q B;  1JLB A;  1VLY A;  4DL4 A;  4U8Y A;  3RU0 A;  4BC9 A;  5K8N A;  5KTQ A;  5HBM B;  3KK2 A;  4ZOS A;  3OL6 A;  2OD4 A;  3OVB A;  2RF2 B;  4WCE Q;  4YQW A;  1VYA A;  1RZM A;  2OSR A;  1NDC A;  5D4N A;  2E5G A;  2BJ3 A;  4FNI A;  3S8S A;  4UY8 5;  3HJV A;  2AF6 A;  2WON A;  4NE9 C;  3VAM A;  1H98 A;  2ZZN A;  2ZJP Q;  5M2U A;  2YX7 A;  1AUD A;  2HHQ A;  2HQC A;  1EQ0 A;  5KFI A;  3LWM A;  3FFI A;  2SXL A;  4Z2X A;  2MQM A;  1NME B;  2ROP A;  1GX6 A;  2QG9 B;  3DMJ A;  4RKU C;  1OYE A;  4C0O C;  1SL1 A;  4HVZ A;  1KTQ A;  2AW0 A;  1EQM A;  4Y2A A;  1KS2 A;  1R7I A;  2DHH A;  3U1L A;  1S6Q A;  1SH2 A;  3QPI A;  2HWI A;  3MGJ A;  1D9A A;  2HGN A;  3BGU A;  5D78 A;  1WSV A;  4AL7 A;  1F2G A;  1URB A;  2C3O A;  4HTI A;  3EGW B;  2BRK A;  2EC0 A;  2Z4P A;  5KT2 A;  4NCA A;  2AP6 A;  2DNY A;  1ZYQ A;  1RT3 A;  9ATC B;  2XS5 A;  3Q2T C;  2E66 A;  2YQ0 A;  3EM1 A;  2UUC F;  1RHR B;  3FEX B;  3DYC A;  2MGZ B;  4QWD A;  3QWU A;  4QWA A;  2D74 B;  2C2D A;  1KOO A;  1S7H A;  2L3M A;  2V94 A;  3MCS A;  2OEK A;  3QAT A;  4I0W A;  1TAU A;  1KVJ A;  2CDR B;  2UVR A;  3W63 A;  1C0U B;  1ZZN A;  4DHV A;  3LP0 A;  2LMI A;  1N56 A;  2YKN B;  1C1B B;  5E3R A;  2RS8 A;  4L3N A;  4NEZ A;  2RQM A;  3CCV S;  2P5V A;  3PO4 A;  4GKK F;  2AHO B;  1SJ1 A;  3EVW A;  2NYH A;  2F4V J;  3THT A;  1HYS A;  3NKP A;  4YOE A;  2JLE A;  1EW2 A;  2IIH A;  3KNG A;  2L41 A;  1X60 A;  1SH3 A;  5F8N A;  3IAM 9;  1MWQ A;  1N0U A;  3W60 A;  5T41 A;  4E98 A;  2ASD A;  4OHY A;  4PG8 A;  3NWG A;  3GIR A;  4A8Q A;  1H6K X;  4WZQ A;  1M5H A;  1JLF B;  3B82 A;  2OPS B;  2RH3 A;  1S4E A;  3DM2 A;  1YJT A;  3UDC A;  2W7P A;  1QDU B;  2P6T A;  1K7H A;  4EBE A;  3T1H F;  4KAY A;  3CNQ P;  1VQO S;  2FJE B;  5A0Y A;  3JAM U;  4IOC Q;  3IC1 A;  1YIJ S;  2YQ3 A;  3H2U B;  2VH7 A;  4FDI A;  2OPS A;  5LSR A;  1CJV B;  2B7C B;  4DR1 J;  3DDN A;  5ETQ A;  5HRO A;  4UPK A;  3PVX A;  2N4D A;  4B3S F;  4OYW A;  1UEU A;  4Y2C A;  4B9M A;  1U8S A;  1B4S A;  3NMR A;  1MWZ A;  3CO0 P;  3R1L A;  4AL6 A;  2QMW A;  3M9O B;  1J5O B;  2GLQ A;  1FI4 A;  4F3M A;  1KWM A;  4M5H A;  1RHQ B;  2GFF A;  2YY3 A;  2OEJ A;  1FD2 A;  1AT1 B;  4LSL A;  1VGY A;  4L72 B;  4P2M A;  4Q5V A;  2HHH J;  2JEJ A;  2VA2 A;  1RTH B;  3PYF A;  1VK3 A;  1C1B A;  2CUY A;  1RT7 A;  2YX1 A;  1C0U A;  1EKR A;  1RAD B;  2MST A;  3GG1 A;  3GB0 A;  4RBT A;  2ATC B;  1HNZ J;  1AJD A;  3AJD A;  3CCE S;  2Q66 A;  2P6S A;  1UW9 A;  4L6V 3;  1XJW B;  3SDE A;  5A8K A;  2RHS B;  5B7W A;  2CJX B;  2WB4 A;  1VQ5 S;  1R0A A;  3DLL Q;  1DUR A;  1ELY A;  4DX6 A;  4CO5 A;  2LEB A;  5KXA A;  2ALZ A;  5H1S V;  5HL7 Q;  4LF9 F;  4WFN Q;  3M30 A;  3ELH A;  5I42 B;  2VPW B;  4ED1 A;  2BJ7 A;  2W9C A;  1FTR A;  5DDQ C;  2NPI A;  2ZNZ A;  1XC9 A;  1ROF A;  3WAW A;  5JMN A;  3IM9 A;  3BSO A;  3QFW A;  4IQM A;  1KSP A;  3NBP B;  2IRU A;  3BYP A;  4OX7 A;  4FS1 A;  4YN3 B;  8RUC A;  1ZAV A;  2I5J B;  1C1C B;  4UQG A;  2HBZ B;  3GZ7 A;  5EWF A;  1J27 A;  4X64 F;  4DS5 A;  2EPI A;  2V2Q A;  2DR5 A;  2EFG A;  2VG5 B;  2F5G A;  1GK8 A;  1ZEF A;  1X7V A;  1V5V A;  3QLH A;  1U1M A;  2ZH1 A;  2KO1 A;  3MPV A;  4RW6 B;  3IDD A;  1RAI B;  5HVH A;  4X4Q A;  2DNO A;  2CNK B;  1M5S A;  4EZ6 A;  2I38 A;  2HZV A;  4F02 A;  1L3K A;  3HJF A;  4CO0 A;  1E3C P;  1RJJ A;  2FLO A;  3FBE A;  3FBC A;  1PO6 A;  1TKT A;  5KG4 A;  4F4Y A;  4FS2 A;  2JVO A;  4NWJ A;  1YBT A;  2Y1J A;  1JLC A;  1DTT B;  4C48 A;  4DX5 A;  1S72 S;  2ZZM A;  5L1K A;  5G4D A;  1V3Z A;  1WAC A;  2CKW A;  4ED5 A;  1SKS A;  2IM1 A;  4QR2 A;  3MR5 A;  3D6M B;  5CYM B;  2DCL A;  2GZO A;  1F9E B;  3I5C A;  2OJ3 A;  4LFB J;  1GQE A;  2W5R A;  2NXE A;  3T6B A;  1TUV A;  2FDN A;  4F4W A;  3LGN A;  2LEC A;  2NXC A;  4KV8 B;  4GVB A;  4ZJL A;  3I96 A;  4W4M A;  1UZH A;  2ZC4 A;  3HI9 A;  3IFE A;  2R2R A;  3WBZ A;  2B5J B;  1ZTT A;  2IYI A;  2LCW A;  3W3S A;  2DNM A;  2WRM A;  2PII A;  2GO8 A;  1CBK A;  1MN7 A;  2AEM A;  2WVC A;  3BBB A;  3IXQ A;  3M2U B;  4ATN A;  1RAJ A;  2YWK A;  1KEK A;  3VAJ A;  1WTB A;  1RT2 A;  4ECR A;  1F3F A;  1IUJ A;  2FLL A;  1EIY B;  2HHS A;  4PG6 A;  2KRR A;  3BGO P;  3AJ2 A;  4QW9 A;  2QLB B;  4TY8 B;  1DQ8 A;  3P6Y C;  4QYZ K;  1JB0 C;  5KG5 A;  5B09 A;  3V81 A;  2HAI A;  1QUP A;  3HVW A;  4FF2 A;  2BM1 A;  3TZW A;  4C3L A;  5LRM A;  1X4B A;  1HQA A;  4DV0 J;  4C2M A;  4DR5 J;  4Q45 A;  3MAH A;  3DYA A;  1B0P A;  3BO2 A;  3SZY A;  5IT9 Y;  2KI2 A;  3LH2 S;  1TKX B;  2H3E B;  1FER A;  1BQM B;  2V8D A;  1CJK B;  3OR1 A;  2ROE A;  2CG4 A;  3P8B B;  4R5P B;  2Y1L B;  5F8L A;  4CLF A;  5KG2 A;  5E2Q A;  2EFQ A;  3ZZP A;  5SUH A;  2IJF A;  4UOP A;  1MSW D;  2AWZ A;  2DHS A;  3J7Y I;  3U7J A;  4ZIV A;  4X62 J;  4DV2 J;  2FJW A;  4JI4 F;  3LXQ A;  3DU5 A;  1D3W A;  3QT7 A;  5KFE A;  1SBR A;  3OUY A;  2G4B A;  1AJA A;  3M7V A;  4FPI A;  1UKU A;  3GU0 A;  2W24 A;  2QA1 A;  3VAI A;  2AJ4 A;  1ALI A;  1J5E F;  3D1O A;  1QM9 A;  3PFE A;  2NXJ A;  2MZR A;  3LAM A;  5IWA F;  2IBK A;  1QE1 B;  3D66 A;  2DNR A;  3SBM A;  1B99 A;  3WQP A;  2E9T A;  1KH9 A;  1IBC B;  1I5O B;  4TU8 A;  3CMQ A;  4ZVP B;  3CUN A;  5H9E J;  4C6A A;  4F0K A;  3R3T A;  1HHT P;  1LW0 A;  3UDL A;  4KJD A;  2GMH A;  1FJC A;  5G0R A;  5KFB A;  1MG7 A;  4CLP A;  1RT3 B;  3A8K A;  1VQ9 S;  4CYS A;  1CC8 A;  2GV1 A;  2ZBI A;  5D0G A;  4P7T A;  1HNX J;  1PKU A;  4F4Z A;  1XEZ A;  2FHK A;  3MMA A;  1RWN B;  1YDL A;  1JXE A;  5GMK a;  3HFV A;  1PGZ A;  2EVZ A;  2R9L A;  4A46 A;  1RTZ A;  5IXU A;  2C28 A;  4P9S A;  3CJK A;  1KHN A;  3IBW A;  1WOO A;  4KIA A;  5IT0 A;  2VU5 A;  2KHD A;  2J9D A;  4ZLN A;  5IV4 A;  5KFH A;  2NYI A;  5DJB A;  3PX4 A;  1YJR A;  3DI6 A;  4K0K F;  1ZS6 A;  3OSN A;  3R6L B;  2K7K A;  2UV8 G;  5BYR A;  1K1S A;  2GVZ A;  4USV A;  1OSD A;  4K7Q A;  4WBF A;  2FD2 A;  5J1P A;  3VQS A;  4ZPA A;  1VQM S;  2XSJ A;  3E3X A;  2JC0 A;  1S5Z A;  1VC5 A;  2RQC A;  1TUG B;  2MKY A;  2BJ1 A;  4IH5 A;  4CO1 A;  1NZ8 A;  2ZHB A;  1CEZ A;  5L1J A;  4YR3 A;  5LMU J;  1SKR A;  3EE3 A;  4RLE A;  1YI2 S;  1W26 A;  3OL7 A;  3KJV A;  3DHX A;  4HTJ A;  4ECY A;  2P9C A;  4NLS A;  5I4M A;  3M1V B;  3VGT A;  4KGX B;  3KOA A;  2IUC A;  1HPZ B;  1W2I A;  2EWH A;  3QGP A;  2UXB J;  5LIA A;  2AJ2 A;  4OZN A;  3RRK A;  4PQA A;  4ZP9 A;  1UWA A;  3ZNU A;  2RDJ A;  1RYS A;  4WYL A;  4C11 A;  3H8Y A;  2KH9 A;  3DKD A;  4C4W A;  1RP5 A;  2LFV A;  4UPL A;  4ZHR B;  5LT5 A;  4DG1 A;  1FFW B;  3E51 A;  3W5X A;  1PIE A;  2NRE A;  1A7G E;  1I51 B;  2AJQ A;  2UXD F;  4JI7 F;  4QR1 A;  4JUZ A;  3AB2 B;  2MKJ A;  3VWS A;  3EX7 B;  3T9N A;  4IRD A;  1GNK A;  1WD6 A;  2FPH X;  5I3U A;  3KHH A;  2P8I A;  1HBU A;  5K14 B;  3ADA C;  2JL9 A;  3O2I A;  4JI6 F;  1TFW A;  1S1T B;  1XTZ A;  4HI2 A;  4C97 A;  2QRR A;  2APO A;  1VLO A;  4DU7 A;  4DR2 J;  3DI6 B;  5GAG I;  1U09 A;  2NQP A;  3BH6 B;  3LA0 A;  1CSJ A;  4M5D B;  4FYX B;  4CDI A;  1KN6 A;  1A6L A;  3QRR A;  2HWT A;  3D0H E;  1FDB A;  4ZLP A;  3AFG A;  2G0J A;  1RAH B;  4CLW A;  4FKY A;  1FE0 A;  3EIC A;  4DFK A;  4CXK A;  4DFM A;  1RTI B;  4WXW A;  1GH8 A;  1QAX A;  1R27 B;  1T11 A;  3DRP B;  5D4O A;  4AYB D;  1WC4 A;  4U6P A;  2R7X A;  1SC3 B;  3CCZ A;  4C3K A;  3OLB A;  2J0S D;  3PXG a;  2IRY A;  1IM4 A;  3HVT A;  4ZVF A;  3U02 A;  4X65 J;  3PHE A;  1U4B A;  2YVS A;  5BJR A;  2P9G A;  3AH6 A;  2B9Y A;  2JC1 A;  3AD9 C;  2ZH7 A;  4M95 A;  1S0V A;  3UCG A;  3HVR A;  1R8A A;  1EHW A;  1FDA A;  3C66 A;  5LL6 d;  3FCH A;  5IFM A;  1T3N A;  4ZP6 A;  4DMZ A;  4F04 B;  2W4D A;  1TMM A;  5F0W A;  3PW4 A;  3NS7 B;  2JNJ A;  2HKE A;  3MM9 A;  3TVK A;  2Z8Q A;  3HHL D;  3M8S A;  2IFX A;  4YS2 A;  1GFW B;  1R6Y A;  2OPR B;  4NRU A;  4GKK J;  1IKX B;  5KFA A;  1J5O A;  1KFD A;  3CSK A;  4O4R A;  3Q0A A;  3BDP A;  2GA3 A;  3GFZ A;  2D41 A;  2I5J A;  2Y3Y A;  3IBC B;  4AXI A;  4LF2 A;  3W62 A;  3H5S A;  1WOR A;  3K5P A;  2ASY A;  2E7X A;  4ZPT R;  2OTJ S;  3UR0 A;  5DM6 Q;  4RNH A;  4PRF A;  2HRU A;  2KZM A;  1FES A;  1KR4 A;  3WIV A;  3HT3 A;  2PD1 A;  2ZVI A;  3W2V B;  1REV B;  3RTV A;  1YJN S;  1N2K A;  2W5X A;  2LU2 A;  1YTY A;  1NSA A;  2KKH A;  3OR2 A;  1NHV A;  1GXT A;  4WU2 A;  3PR4 A;  4DZ6 A;  2YXL A;  1R0A B;  3HHE A;  4I68 A;  4A47 A;  5RUB A;  3EZO A;  1RXO B;  4RU9 A;  1JLA B;  4GRS A;  4HHU A;  4FYV B;  2QSW A;  4NLW A;  2ZH6 A;  2VJU A;  1RT7 B;  1VK8 A;  4RPF A;  3DDI A;  3GFX A;  2C3P A;  4UOC A;  2HBY B;  4J9V A;  2DEI A;  5KFG A;  3OTE A;  1T7P A;  2HMI A;  4B3O B;  2FZG B;  2OTL S;  1RAE B;  3RRH A;  3QZ7 A;  1SPB P;  3PJX A;  3OPK A;  3W9I A;  4XDD A;  2WCX A;  3CO9 A;  3HHL B;  3OFF A;  1JKH A;  2BXJ A;  2P9E A;  3VZH A;  2W8S A;  3PDN A;  2JDJ A;  4O3Q A;  2ASL A;  1WKK A;  3ILI A;  4I56 A;  3BO4 A;  1AZS B;  3KFW X;  3OJS A;  4JV5 J;  3C15 A;  3PAC A;  3H2L A;  1HBN A;  1RHU B;  4WU3 A;  1HPZ A;  4B56 A;  1PG5 B;  1KNZ A;  1KTV A;  1P27 B;  4A8O A;  3ZTO A;  2C2R A;  3KNA A;  3LP1 B;  2V63 A;  2VHG A;  2B3T B;  3QFH A;  1KDN A;  3GII A;  5D3G A;  1O98 A;  2XMK A;  1JJC B;  1HBM B;  1X9S A;  5KFW A;  1RGV A;  3M6X A;  3NCQ A;  3P3D A;  4ICL B;  3MM7 A;  1XMQ F;  1NBE B;  1NJW A;  3RBZ A;  2QE5 A;  3ULH A;  1VS3 A;  2W2O P;  2DNK A;  1Y5I B;  2XNR A;  5DLT A;  4DS4 A;  1MRO B;  4LR8 A;  2K3K A;  1L3S A;  1ZA2 B;  1JX4 A;  2PC6 A;  4RO0 A;  3RUB L;  5CXT A;  1KVI A;  4DF8 A;  1BQX A;  5F41 A;  1WEL A;  3NS5 A;  4YB1 P;  3QAE A;  3MMC A;  2HHW A;  3HKW A;  3OHB A;  4X64 J;  4DPU A;  1X9M A;  2L08 A;  3BPS P;  1NK5 A;  4IUF A;  5CH7 B;  2HND A;  2G2Z A;  5L0E A;  3M32 A;  4TYB A;  3G6V A;  1HA1 A;  1IXK A;  1LWE B;  1Y3K A;  3KUG A;  4PWW A;  4P2S A;  3R5C A;  3JSR A;  3WHI A;  2IA0 A;  1NJY A;  1JLA A;  4PCQ A;  1I94 J;  1NND A;  1WC1 A;  4B3M F;  1RT5 B;  2R4F A;  1FTC A;  1SUQ B;  2G2Y A;  2E7W A;  3PFO A;  1LQ9 A;  4CH7 A;  1VCT A;  5DQI A;  2XMA A;  1FK9 A;  5IQ6 A;  4UUW A;  1YVF A;  4TQR A;  2QLF B;  3UD3 P;  1S6U A;  1F6T A;  4BLG A;  2PO4 A;  3PO5 A;  3M8Q B;  2XUL A;  2OLW A;  4AT1 B;  2X1G A;  4ZG9 A;  3SV4 A;  2DY1 A;  1RAC B;  2WVB A;  3ITH A;  5GVQ A;  2CJY B;  4LBH A;  5K20 B;  4PPZ A;  1YLX A;  3DRY A;  2VPX B;  5KT4 A;  5ETV A;  1BY9 A;  1FWK A;  1GT8 A;  2CPX A;  4NLY A;  2QL7 B;  2FVR A;  3SFU A;  1V3S A;  4IFY B;  1MU2 A;  2FQQ B;  4UQT A;  3N6N A;  1VC0 A;  5I3Q A;  2OPR A;  2G1D A;  3I32 A;  3US5 A;  5E3Q A;  1YJU A;  1FKP A;  4ZVS B;  4CLS A;  4NCB A;  4KGZ B;  5J2M B;  1S1X B;  5B0D A;  3LW5 C;  2E5H A;  4UZC A;  3Q8R B;  4KAV A;  4M5N A;  2EFN A;  3CJ2 A;  2N7Y A;  4KBI A;  1FKO B;  2X1B A;  2EG2 A;  5ETR A;  3W65 A;  1XIQ A;  9RUB A;  4XO0 A;  4C0H A;  3ET6 A;  5ETM A;  4EU0 A;  2OGU A;  3MR6 A;  2R7Q A;  2Q6C A;  4CLZ A;  4DLE A;  2RF2 A;  2XZT B;  3JSY A;  3JXO A;  4DR7 F;  5KFF A;  1UL3 A;  4BDP A;  4JYA J;  1QAI A;  1MN9 A;  1NU4 A;  3QNW B;  3D6H B;  3W8P A;  2EKN A;  4AE5 A;  5K8O A;  2HHU A;  1FEE A;  1F5C A;  2BW2 A;  2QTW A;  1RAG B;  2L9N A;  4GVL A;  3KHG A;  2RHQ B;  2D9O A;  3G87 A;  3WBH A;  3HKZ D;  3B54 A;  4P73 A;  1RDR A;  5JVH Q;  2IFY A;  4XAK A;  1QTN B;  3G2X A;  2ZH8 A;  4HI1 A;  1FDD A;  2MLY A;  3K58 A;  2LLZ A;  2JZ5 A;  1JLG A;  4OYX A;  4WJB A;  3ENA A;  5TJ3 A;  4G1I A;  4QQB A;  3M8Z A;  4CT8 A;  2AJ0 A;  3ENQ A;  3KJV B;  3TWZ A;  4ZP8 A;  2LQ9 A;  1HNW J;  1R31 A;  1VQY A;  3Q3Q A;  1TK0 A;  4MHX A;  3P96 A;  4CYU B;  1ED8 A;  4OFZ A;  1VQK S;  2IVM A;  4ECW A;  1FA0 A;  4DL6 A;  2O01 C;  1MNE A;  2XSJ B;  1A0O B;  1S9G A;  3SQG B;  5DG9 A;  1ULR A;  4LR2 A;  1WEY A;  4J9Q A;  4UTG A;  2R8K A;  4KE5 A;  4ZP7 A;  3B4M A;  3GWC A;  3OQ2 A;  4DX7 A;  3I0R B;  4TY9 A;  4EZ9 A;  1VFJ A;  2RRN A;  2XLI A;  2JSX A;  2AZ1 A;  2QLJ B;  3FDS A;  4RJV A;  3DLG B;  2E1R A;  2YKN A;  3W2W A;  4XPE A;  3G6X A;  3M05 A;  3D28 A;  3T6J A;  4DX8 H;  1TQL A;  2XMW A;  3CJ8 A;  3CJ3 A;  5KFT A;  5A2Q U;  1K9M T;  3R7N B;  5KG1 A;  5L46 A;  1QSS A;  2BBE A;  3F0N A;  4OZ1 A;  2O3D A;  3BDH A;  1TKZ A;  3OTC A;  3I87 A;  4LRC A;  2C22 A;  1TL4 A;  1X4A A;  2AT1 B;  1KLN A;  4FXW A;  2AQ4 A;  1MMN A;  4HH1 A;  3TX0 A;  5CAA A;  2XGP A;  4GKJ F;  1YRU A;  4JI0 J;  3WAY A;  3FQL A;  4X4R A;  1VBZ A;  1S6Q B;  2XB2 D;  2VOO A;  1JWW A;  4K4U A;  3ZC4 A;  1IKV B;  5HN0 A;  4ECT A;  4GO5 X;  4DSE A;  3T5H A;  1FKO A;  2W5T A;  3H40 A;  3CD5 A;  1FRK A;  5DLW A;  1B0V A;  1K73 T;  7AT1 B;  1WF0 A;  3VGV A;  2IBO A;  5DET A;  5EWG A;  3G4S S;  1RT4 A;  1RWK B;  2HNY A;  4MYT A;  2W2N P;  4MIW A;  1MU2 B;  3BN7 A;  3DOM B;  4RNF A;  2ZH4 A;  5MAO A;  5KFK A;  5DM7 Q;  4CRJ A;  4B3T J;  5LXR A;  4LF5 F;  5AT1 B;  1NHK L;  2AEJ A;  3OUY B;  5EHH A;  1QTM A;  2GSN A;  2X3D A;  4C9D A;  1IBL J;  5E3A A;  3ITH B;  4PR6 A;  4JI2 F;  7FDR A;  3CCW A;  4U95 A;  1KVK A;  1H7X A;  3VAK A;  1LWX A;  2GSO A;  1RIS A;  2QFJ A;  3UW1 A;  4GTY A;  2CQP A;  2FHM A;  3GYX B;  3JTO A;  3M8Q A;  4I7F B;  2YKM B;  1UWB A;  3LP1 A;  4MFB B;  2XO6 A;  1WC5 A;  4KH1 B;  3AOB A;  4OX8 A;  2DGT A;  2CA9 A;  3OSP A;  2UUT A;  4N56 A;  1N5Q A;  5DQH A;  3PHT A;  5D6G A;  2V34 A;  2MMY A;  1P9Y A;  3C15 B;  5GAE I;  1PC4 A;  4TLQ A;  2RQ4 A;  1X4E A;  1F60 B;  2OEM A;  3FZ2 A;  3SCJ E;  4X66 J;  1U1R A;  1B7F A;  1SUQ A;  3HM9 A;  3V81 B;  1S77 D;  2XG8 A;  2B6A A;  3M2R B;  2ACM A;  4RU2 A;  2MY8 A;  3ZZT A;  2FJA B;  3RR7 A;  4LFC J;  1HHS A;  3CCU S;  5CYQ A;  4O3P A;  2CQ2 A;  4ZG6 A;  1Q8K A;  1VRT B;  2GO9 A;  4A8M P;  1IBK J;  2M3D A;  4NMX A;  3QGH A;  3L4B C;  2HMI B;  2EW9 A;  3H25 A;  3TYT A;  1MRO A;  1RAO A;  4C98 A;  4MK8 A;  1IJF B;  4M63 A;  3AD7 C;  1CC7 A;  4OYI A;  4WIQ A;  3SCK E;  4CLY A;  2VQF J;  4DUZ F;  3KD8 A;  3MM5 A;  1Q86 T;  3ETO A;  2R7V A;  1Y5L B;  2YWW A;  1N5T A;  1X31 C;  5DS7 A;  3CB4 A;  3AB4 B;  2DH8 A;  1SQG A;  2JH3 A;  3CC4 S;  1WG1 A;  4NLD A;  1SJQ A;  2B51 A;  1E6V A;  3NGT A;  3VVU A;  1HNX F;  1QY7 A;  4KY3 A;  1RLC L;  4N5S A;  4UF4 A;  2B8P A;  2DCU B;  3UWT A;  4ED7 A;  3IGN A;  1RUS A;  2U1A A;  3M8Y A;  4OI2 A;  1RHM B;  3UVJ A;  4BHQ A;  2HGM A;  1UW4 A;  3ZZY A;  4DL5 A;  2ADC A;  3TOQ A;  1J2V A;  1U47 A;  1E6V B;  3JQM A;  4Y65 A;  2F4V F;  2CPD A;  2BZ2 A;  2QN6 B;  2F4F A;  2J76 E;  2M5Y A;  3IP0 A;  3MEK A;  2H4W B;  3OXG A;  4USJ C;  1M5O C;  2Z2Z A;  4MH8 A;  2D3O 1;  4PWD B;  4YR0 A;  1S7I A;  3OT9 A;  4I67 A;  2RD5 C;  2VFU A;  1O51 A;  3DNC A;  3SQO P;  4OZL A;  6FD1 A;  2MY7 A;  3BN4 A;  4X65 F;  3MR3 A;  3IGV A;  3Q8Y A;  2N4C A;  2YQ1 A;  3VZI A;  3CJR A;  2VBW A;  4U7U D;  1AFI A;  2PI4 A;  2WAQ D;  1JJ4 A;  3N9U C;  2B6A B;  5ETP A;  1S1U A;  1TL1 A;  1QAJ A;  5AXK A;  1Z1Z A;  1R0C B;  1SC1 B;  1AA1 B;  2CPE A;  2IVY A;  1FKP B;  1RBL A;  1DBD A;  3BR9 A;  3MAA A;  2BUN A;  4NZ0 A;  5C24 A;  4F0H A;  1AFJ A;  2CWK A;  3BDF A;  4CQ1 A;  3DRS A;  2GAH C;  2ADB A;  4GMK A;  4ZCM A;  2Z2L A;  1U02 A;  4Q2L A;  1Y9O A;  1XN9 A;  2VIC A;  2AX1 A;  4DXL A;  4K59 A;  4UOG A;  4WE1 B;  2DGS A;  1EAY C;  2LVW A;  2QA2 A;  4Z7Y A;  5B0C A;  5CAB A;  5L9N A;  2KVQ E;  4DPO A;  2OPP A;  3KLH B;  4DI6 A;  2HIQ A;  3TA2 A;  4DSF A;  4F3O A;  2VOP A;  5KFZ A;  4K4V A;  4J7C A;  2EC2 A;  3H0P A;  4LT6 A;  5KOW A;  2HW3 A;  5JJB A;  1D09 B;  3TX8 A;  1S6P A;  5HMZ A;  1SJF A;  1NLK L;  2H65 B;  3WX4 A;  5DDR C;  1NSK L;  1T0T V;  2W9A A;  1TEL A;  3CW2 C;  1T9Y A;  3D6T B;  3FEZ A;  2QFI A;  3NCR A;  1FNO A;  5HSP A;  4OYO A;  3PYE A;  4PKD B;  1LWE A;  1SJR A;  3ZXW A;  3V6J A;  2BAN A;  1AUK A;  2LDI A;  4V19 X;  2CNO B;  1OS5 A;  1DTQ A;  1UA0 A;  4J9K A;  4DQP A;  1HW8 A;  4YY3 J;  4NLO A;  1BQN B;  5GRR A;  1HI1 A;  4NPO A;  3A8I A;  4WK3 A;  1V5I B;  3I55 S;  1JK9 B;  1ITP A;  3T01 A;  4K2J A;  4RWW A;  2HHV A;  4KM4 A;  4FYW B;  3FMW A;  4NX9 A;  1X4G A;  3NBP A;  4U9R A;  5L8R C;  5KT5 A;  1RT1 A;  1U1L A;  4ES1 A;  5C66 A;  2OPQ B;  4OHX A;  3E2E A;  3IWN C;  1PJ6 A;  3TZZ A;  4PWU A;  3MCO A;  4J9U E;  4G6V B;  4ZVG A;  4RNN A;  1YG0 A;  2QT7 A;  4AD6 A;  5THW A;  5INH A;  4ILR A;  1FXL A;  3W2W B;  2A10 A;  3EGV A;  2JJ4 D;  2VB6 A;  4CYR A;  2E5L F;  1QJH A;  5IC4 B;  4O3S A;  1EET A;  3QIP A;  4Y2I A;  1X4D A;  1FF2 A;  1KON A;  1U2F A;  1YZ7 A;  4M5D A;  4DCP B;  4L74 A;  4O0I A;  5EGE A;  2RDI A;  2OFH X;  2R8H A;  2XNQ A;  2XC9 A;  1T05 A;  4G1P A;  1R8P A;  3BB5 A;  3LPE A;  2HHP A;  1NRK A;  4NXM F;  1BE4 A;  3GYG A;  3WAV A;  3RYL A;  4ILL A;  4QU7 A;  2CRL A;  2W4P A;  1KQF B;  2B9X A;  4B02 A;  3MTJ A;  3QID A;  4F4A A;  3OHA A;  4URS A;  1BWE A;  2DH7 A;  4DG1 B;  2VG7 B;  2Q43 A;  4P71 A;  2CNN B;  2O1P A;  1GXL A;  3MPU B;  1Q0N A;  2WW4 A;  4OJH A;  2C2Z B;  2BYC A;  2L9D A;  2ZD1 B;  4M5J A;  2KFN A;  5D4P A;  3J80 U;  1UMJ A;  3QT6 A;  1HNI B;  2VDH A;  3RJM B;  5HMY A;  4TVA B;  3K59 A;  1CUL B;  2DRA A;  4WKR A;  3ZFV A;  1RWW B;  4D3G A;  4GO7 X;  3TUJ C;  1PAU B;  1UET A;  2YTC A;  4F25 A;  3UFC X;  4ZVU B;  1SC6 A;  2DYA A;  1JQG A;  4FVM A;  4DEZ A;  1JNR B;  5HO4 A;  2JFK A;  3K17 A;  3LF0 A;  4O0N A;  2EXU A;  1RBO B;  2DHX A;  2O67 A;  4RUB A;  1CQN A;  1HI8 A;  4KYZ A;  2KRB A;  1BGX T;  3OBI A;  3DLH A;  3G96 A;  2GVD A;  1EAR A;  2OEL A;  4CIO A;  3MEE A;  3C19 A;  5I42 A;  2CPY A;  1BWV A;  3I9V 9;  4EEY A;  3FQK A;  4QIW D;  2HSE B;  1G1X A;  4YUD A;  2RH6 A;  2CVE A;  4NLX A;  3A3O B;  3O6Q A;  5HI7 A;  3HMJ G;  2A1B A;  5E41 A;  1DY3 A;  5FDL A;  2ZIT A;  2BMB A;  4IG3 A;  2KT3 A;  3BKU A;  3FFI B;  5KFR A;  5KG7 A;  3I31 A;  3GIK A;  2DKO B;  2RRA A;  3OFG A;  3THP A;  1RKI A;  4DZD A;  5IV3 A;  5L39 A;  5J2P B;  4H4K C;  4ANC A;  4ZJO A;  1ZED A;  3NVL A;  2R2S A;  1X4F A;  5EX0 A;  2AU0 A;  3OR1 B;  4NZ6 A;  1S9E B;  4HHJ A;  3UQS A;  4R5P A;  5JVG Q;  2V4J B;  2VL1 A;  1TKZ B;  1FCA A;  1TL5 A;  3DHW C;  4NL5 A;  4EWT A;  3BQ1 A;  4YB5 A;  4ZPC A;  4EO6 A;  4DV2 F;  3PW5 A;  3WIU A;  1UVI A;  5C25 A;  2OMO A;  2Y0B B;  4RW4 A;  3SMZ A;  2YNH B;  3DGP B;  5BXI A;  1GTE A;  4M1K A;  4ZVT B;  4DOZ A;  1LW0 B;  2YBV A;  4LIR A;  3HT0 A;  2ZUA A;  2CJA A;  4G3I A;  4LSN B;  1H7W A;  1WHX A;  1ZM2 A;  4QR0 A;  2FY1 A;  4P2F A;  5F3T A;  1SKU B;  3G71 S;  3UDE A;  2QMU B;  2EK1 A;  1SQF A;  3NLC A;  1U6F A;  5A6W A;  1RWX B;  2J9E A;  4DSK A;  4LF9 J;  1CJT B;  4ECZ A;  1U1P A;  1I94 F;  4ID5 B;  1WG4 A;  2MHN A;  2PA8 D;  3SEO A;  1KBR A;  3D0I E;  1TU0 B;  4FDJ A;  4ZK7 M;  1RB0 A;  2J7U A;  5IM0 B;  3EZU A;  1VQS A;  2AGQ A;  1IJE B;  4JV0 A;  4MAK A;  3CJS A;  4WII A;  4KC5 A;  4YR1 A;  2QO3 A;  3K2Y A;  3LGM A;  4ALZ A;  3ZZR A;  2BOA A;  4YME A;  3MM7 B;  2UZA A;  2GW8 A;  1YZ6 A;  1JLG B;  3N28 A;  6FDR A;  5HMX A;  2KG0 A;  3MFI A;  2DGU A;  3PY8 A;  4NXM J;  3HF5 A;  4EGL A;  3F56 A;  3CWJ A;  2R3V A;  4F26 A;  1IWA A;  1FWL A;  3MM6 B;  4DLG A;  2NSC A;  3PEH A;  2ZOG A;  2Z2Y B;  2PFD A;  4XK8 C;  3WC0 A;  5M2P A;  4F67 A;  2PEH A;  5C5J A;  1OMS A;  3ENV A;  3MMB A;  3FBF A;  4IO1 A;  4CTA B;  1RWO B;  1RQ0 A;  3MUR P;  4C8M A;  4QYR A;  4DV1 J;  5IT9 U;  2B56 A;  3M9M B;  2UUB F;  3IG1 A;  3NAH A;  4NA2 A;  4B9L A;  1L5U A;  3TG0 A;  2OI2 A;  1UFW A;  5CYJ A;  1KLM B;  2V4R A;  3I0R A;  5IS2 A;  3BBF A;  2LP4 A;  2ZJR Q;  4ECV A;  5KFX A;  3MFH A;  4NAS A;  4E2F B;  3IR6 B;  1J5E J;  1RA6 A;  4ZKA A;  4NWB A;  1C4C A;  1LEO A;  2GIR A;  1WSR A;  5DLG A;  1S1X A;  3O44 A;  2CPI A;  1X5P A;  5BYQ A;  1WKL A;  2OH2 A;  4Q0B A;  1HJK A;  4PYA A;  4P10 A;  4WZM A;  1FSU A;  4P75 A;  3TZY A;  1ZH5 A;  4LF8 F;  1S59 A;  3KDN A;  1C0T B;  4C7Q A;  3KXD A;  3C14 B;  3CD0 A;  1XK8 A;  1EZZ B;  1HW9 A;  3IGZ B;  2J5A A;  3JQK A;  4PXD A;  4DL0 C;  5BR8 F;  2D3U A;  2DPJ A;  2FGC A;  1S76 D;  3CD6 S;  2GSU A;  4DSI A;  1FJ7 A;  1ALJ A;  2IC3 B;  3W5Y A;  4IQX A;  4WP8 A;  1RSC A;  4NXN J;  1Q82 T;  1OQ6 A;  1S0N A;  1HNW F;  2VC1 A;  2HNZ B;  5FLX Y;  2W5Q A;  3AXM A;  2OPQ A;  3KLI B;  2E1P A;  2V8G A;  3D1H A;  1T9W A;  1D8Z A;  1Q7L B;  1TTH B;  1EP4 A;  1LW2 B;  1YKW A;  2HVD A;  3BYR A;  3FVY A;  3KG1 A;  3MR7 A;  3OTB A;  5T7L A;  4MT1 A;  1I6J A;  1R0B G;  1U6Z A;  2Z30 B;  3LUY A;  4G1Q A;  4J37 A;  2KM8 C;  3JYT A;  1QE1 A;  2F8M A;  4USH A;  4ECU A;  3GIJ A;  4NA3 A;  3H5X A;  1S1W A;  2EFP A;  2K1R B;  2GCF A;  1RAB B;  3M8P A;  1HQU A;  3R6G B;  5FDL B;  1NPK A;  2XYH B;  1R8C A;  3VVT A;  4QWC A;  5AXM A;  5F9L A;  1D9F A;  4LQ3 A;  3T1H J;  3T00 A;  3B78 A;  4MKY A;  2LQJ A;  4PG5 A;  1TV6 A;  1E2S P;  1ED9 A;  2B4U A;  2ACY A;  4GTZ A;  3GSD A;  2YPZ A;  3MM8 B;  5HVF A;  3PX0 A;  4FKX A;  1URR A;  2IMW P;  2ROG A;  1TR0 A;  2OPP B;  3OJU A;  2BVZ A;  1DHM A;  2CNL B;  2GS8 A;  1TVR B;  2J0X A;  2V6A A;  4WE1 A;  3J7Y U;  1CJK A;  2BM0 A;  1NXI A;  3K7R A;  3OVS A;  4PUO B;  1U26 A;  4AUK A;  2EBE A;  5IWA J;  4BWJ A;  2UUA J;  1UJ5 A;  3KK1 B;  2IPO B;  3DM2 B;  3NKR A;  2ZE2 A;  1DQA A;  2YKO A;  2CQD A;  2XY6 A;  1JKH B;  4L3K A;  2R7U A;  2XMM A;  5L1L A;  3K57 A;  3MEC B;  5J1E A;  3CMA S;  1TL1 B;  4UOO A;  3P5T L;  3F44 A;  4QCL A;  4CLU A;  3H20 A;  3HCX A;  4OQJ A;  1T95 A;  3IRX A;  1ZM4 A;  4USW A;  3UNG C;  2DNH A;  4O44 B;  3VAH A;  4FBU A;  4K4S A;  5GOV A;  2HFU A;  3EWG A;  3M6U A;  4F36 A;  3BGF A;  5IOL A;  2ZH2 A;  4OI4 A;  3PJ9 A;  4RNO A;  1D1U A;  2G9Y A;  1NJI T;  1VIO A;  2GA7 A;  4H4O A;  4PEO A;  1PYS B;  1V9O A;  3HDS A;  3S01 A;  1VMB A;  1FJG F;  1RE1 B;  1D9D A;  3KUH A;  5ETK A;  4C11 B;  2DIV A;  2RML A;  2FHJ D;  1KQS R;  2R8I A;  5KT7 A;  1G7C B;  3KK3 B;  1NJZ A;  4LF8 J;  1EI6 A;  5GAD U;  1KH7 A;  3AHP A;  1Y0H A;  1HBN B;  2OHD A;  3I9Z A;  4CM2 A;  2DD8 S;  2WBR A;  2FVS A;  2BJ8 A;  1VR6 A;  4OI3 A;  4NML A;  2KG1 A;  3NEK A;  3TI0 A;  2DB1 A;  2E44 A;  4DBQ A;  5AXL A;  3NKM A;  1U2R A;  1VDH A;  3CPW R;  3CC7 S;  4K5R A;  4DN9 A;  5LQQ A;  2V5H G;  3BR8 A;  3IWX A;  2PMH A;  4KHM A;  2EFO A;  4PUO A;  3DOK B;  3RAX A;  1VRT A;  2CZ4 A;  2OIH A;  2IM0 A;  3LWL A;  1HAR A;  1AJC A;  2ZH5 A;  1WEX A;  3RB3 A;  3HHN B;  3PYD A;  3C3L A;  1A9N B;  4NLU A;  2QZU A;  2DGO A;  3HFK A;  5HRT A;  3W8G A;  4EUV A;  4DN0 A;  2JEI A;  1WEZ A;  2OD6 A;  4OJG A;  4F3Q A;  2B7B B;  2MJU A;  1Y4Z B;  3FK4 A;  1ZBT A;  3KWM A;  1JLQ B;  5ETO A;  2V9W A;  5B0A A;  3GE9 A;  4I2P A;  4CLK A;  2IYG A;  4QIF A;  2H1Y A;  3SZZ A;  3GLJ A;  3KK1 A;  5G0R B;  4N47 A;  3QYY A;  1X5S A;  1CS4 B;  3WAX A;  2FC8 A;  3ILJ A;  3CF5 Q;  2M2B A;  1NB2 A;  3QO9 B;  5KOX A;  3PV8 A;  1G6B A;  4UOF A;  2GJF A;  2ASJ A;  5E0O A;  3WC2 A;  2OAU A;  1H38 A;  2ZH9 A;  4MK7 A;  4DFP A;  1IR2 A;  3BGL A;  2ZM6 J;  1S10 A;  2Q79 A;  1ELX A;  5HK4 A;  3TJ8 A;  4KRW A;  2I8E A;  3FSI A;  1N2L A;  3J7A N;  2BX6 A;  3G86 A;  1U1Q A;  1JMT A;  2C3Y A;  4IDK A;  3Q24 A;  4DF4 A;  5DZ6 A;  1HQU B;  3QGG A;  2LKZ A;  3OL8 A;  1DZ5 A;  4B9S A;  2Y9H A;  1RA7 A;  1YRX A;  2PGC A;  3CT9 A;  2HS4 A;  4ELT A;  4USM A;  4I6W A;  3CJ4 A;  4AXJ A;  2QX0 A;  2YWE A;  2C1E B;  2V8P A;  4K4X A;  1ZOT A;  2J0Q D;  1ACM B;  4RR5 A;  2DPI A;  4DUY J;  2Z56 B;  3GJS B;  3HSD A;  2CQ4 A;  4IG0 B;  2FIU A;  2A6M A;  5I3P A;  4J9S A;  2BOP A;  1ALK A;  2OFG X;  3LP2 A;  1FT8 A;  4ZPD A;  3R2C J;  1FFG B;  2ZWP A;  3PRB A;  1H74 A;  2ATL A;  1OJ4 A;  3TVZ A;  4EMD A;  3PG9 A;  5KT3 A;  1C2P A;  2BJ9 A;  3AOC A;  1FD8 A;  4Q2M A;  2J6S A;  4ANE A;  2HWH A;  2N3L A;  2YKA A;  2I6W A;  5GAG U;  1FJG J;  2QC3 A;  5T14 A;  4S0M A;  3BZQ A;  1UEK A;  3GFY A;  2GQ2 A;  4CO3 A;  5IJQ A;  5K8M A;  4PPD A;  4YFU A;  3P45 B;  4PXC A;  2YNG B;  4ITS A;  2GQC A;  4N8O A;  3ZTQ A;  3KLE B;  1ELZ A;  4PG4 A;  1N6Q A;  2MQQ A;  2NSB A;  2FB0 A;  5ETS A;  3NMA A;  2UXC F;  1N32 J;  1Y3J A;  1NM2 A;  2OML A;  1RWV B;  2VG6 B;  3GPA A;  1IR1 A;  2VFR A;  4K8R A;  1NSQ A;  3EXY A;  4CO4 A;  5IM0 A;  3HXM A;  3QJJ A;  5EGH A;  4A4J A;  3JQJ A;  4IRC A;  3DLJ A;  4M5L A;  1BLU A;  2DGQ A;  5M2R A;  3V6K A;  1BMQ B;  4W90 B;  1WDD A;  1M5V C;  3IGY B;  2K8G A;  2QLW A;  2UVU A;  2B5J A;  3A3P B;  1Z4U A;  2VOD A;  5EN1 A;  1HYS B;  4DR3 J;  3QIP B;  4X4V A;  4U96 A;  2VD3 A;  5DDP C;  4ED8 A;  2HVH A;  1MLA A;  3NS6 A;  1O0P A;  4DV5 F;  2HUR A;  2W5V A;  4LF1 A;  1X4C A;  2PDA A;  4MIB A;  2XI2 A;  3AA9 A;  4B3R F;  1HWL A;  3Q22 A;  3KLF B;  1WC0 A;  4ZPB A;  4C8N A;  3DLE B;  1YJW S;  4RX6 A;  3A3N B;  1S99 A;  3VCD A;  1DJ0 A;  1SQE A;  3RW6 A;  5LXY A;  2GML A;  1UAW A;  3MM6 A;  4DDF A;  3J7Z T;  2ZKU A;  4LRD A;  3G6Y A;  1YX2 A;  2ANH A;  1LWC B;  2FHO B;  3C16 A;  1NK7 A;  3CME S;  4JB8 B;  3B5Q A;  4RW9 B;  2OKQ A;  4IYQ A;  1EQJ A;  1EB0 A;  3LQV A;  3TRG A;  2F1F A;  2MEW A;  3AQO A;  1IR0 A;  1KQG B;  2ZBC A;  2DY9 A;  2H54 B;  4OL8 A;  1CJU A;  2RRB A;  4IH6 A;  3SSQ A;  2G0I A;  5E3C A;  4ELU A;  1URN A;  3T5J A;  4RWX A;  1C1C A;  1NZA A;  2QGF B;  3D68 A;  3FRZ A;  3PIO Q;  3J81 j;  1TFY A;  1M90 T;  3AXK A;  4N41 A;  3MUV P;  3DRR B;  4XPC A;  3VAF A;  4OYB A;  1EW9 A;  2AX0 A;  3W7B A;  3O5T B;  3MD1 A;  3MEE B;  3MZI A;  4OIX A;  2J6U A;  5J1N A;  1O5J A;  2WOM A;  2NUU G;  2MHE A;  1Y00 A;  4C3M A;  3DU6 A;  3EYZ A;  3B4D A;  4UZB A;  2RS2 A;  1GMV A;  2HQI A;  3A1Y G;  4QW8 A;  5DZ7 A;  4JI1 J;  1HDH A;  4C0B A;  4Y34 A;  2VPY B;  4K4W A;  4J5O A;  3BJY A;  2V4J A;  3OXF A;  4F2R A;  1IVZ A;  1H73 A;  3T5L A;  2D3O R;  3CJT A;  1SJ4 P;  2H5E A;  2XY7 A;  2ZZT A;  1UTA A;  4JI6 J;  2X3G A;  3JSB A;  2RKI B;  1SV5 B;  1Q8L A;  5JXS A;  4RUH A;  5E7O B;  3V4I A;  1EJ7 L;  2F65 A;  3AD8 C;  2E9Z A;  1PSD A;  4OLP A;  1OSC A;  2HPU A;  3VGU A;  3Q8P B;  4KFB B;  3IRX B;  3T1A A;  2Z57 B;  1NHU A;  4FF4 A;  5ITH A;  2LXU A;  2RIJ A;  2MB0 B;  1IKY B;  3VGS A;  3M9N B;  4URQ U;  3GV7 B;  3CC2 S;  3KLV A;  1W2B R;  1L3U A;  1N32 F;  2RDD A;  3W1Y C;  2M88 A;  2KYX A;  2YPY A;  4NOH A;  1UCN A;  5LSL A;  3JTN A;  2VC0 A;  4RUC A;  2BEF A;  2CIM A;  1RU2 A;  1M5K C;  3J81 U;  4CXU A;  1F0X A;  2A3J A;  3G82 B;  3MCM A;  4Q7A A;  3KG4 A;  2ZDO A;  3O8W A;  2V50 A;  2HLU A;  2MZQ A;  4ZVQ B;  3NGD A;  2A2D A;  4N8N A;  4JI0 F;  2CJB A;  4TN0 A;  5BR8 J;  3OW2 R;  2CVI A;  4B08 A;  2KZZ A;  1DTT A;  2C3U A;  3NOC A;  1HLW A;  2WHO A;  3MUT P;  1JJ2 R;  4I2Q A;  2KHC A;  2OO4 A;  2UXB F;  1QD1 A;  3PEJ A;  4JV2 A;  1N5S A;  3ISZ A;  1CG2 A;  4DV3 J;  4PQU B;  2I1R A;  4EBD A;  2CJQ A;  4EYH B;  2AEF A;  2E5L J;  2EKY A;  4GC6 A;  2IDE A;  3I0S A;  1VBX A;  1G3O A;  5K4P A;  2HZC A;  2XZD B;  4P52 A;  2IHR 1;  5KFV A;  4LBP A;  3QLH B;  4O44 A;  3MM9 B;  4E8U A;  1FX2 A;  5KG0 A;  4JI7 J;  3DC2 A;  2IDL A;  4OI1 A;  3HPO A;  4LF4 J;  4NEY A;  4KJG A;  4JI2 J;  5F8J A;  2YWH A;  2XS2 A;  1HL6 A;  1NUE A;  4ZCI A;  1EP4 B;  1EET B;  3PYG A;  5AJ3 F;  2MGZ A;  1Z2L A;  3R5G A;  2AYE A;  1F1B B;  3OTD A;  3CDB A;  3SYZ A;  4DR2 F;  4RBU A;  1TK8 A;  1FVQ A;  1S6P B;  2QMX A;  1ZET A;  1KHK A;  5DLV A;  1N36 J;  3DRP A;  5CYM A;  4X66 F;  4ZPV R;  1AUS L;  2CPJ A;  1HD0 A;  3MEG A;  3QO9 A;  4WFA Q;  3M6W A;  2F8H A;  1FWP A;  5C7P A;  3BO3 A;  2MKK A;  3GCX P;  1SKW A;  4RW8 B;  4IKA A;  4HH0 A;  3ZZU A;  1RT6 A;  4B9V A;  1PBA A;  1ELO A;  3GCW P;  3DMJ B;  3UD5 A;  4CH0 S;  1DAX A;  4WP3 A;  3DLB A;  4C8Y A;  5C24 B;  4XDC A;  3SXL A;  1IBK F;  2Y8Y A;  4WFY A;  2IRX A;  4PWD A;  3FUY A;  4ZDN A;  3W5Z A;  1RTD A;  2VA3 A;  2ERR A;  2BAB A;  4E0D A;  1X9W A;  1VQ6 S;  3JSM A;  2HFV A;  3DOL A;  2MYF A;  3FMB A;  4LSL B;  1AJB A;  3M32 B;  1WHY A;  1FRX A;  3HSG A;  3L7P A;  5T7L B;  2XMU A;  2L9W A;  2XYP B;  1Z2Z A;  1YSJ A;  1YJV A;  2C42 A;  1LW2 A;  3FNN A;  3H98 A;  4MYU A;  5D0R A;  3R8Y A;  1FDN A;  8ATC B;  2W9B A;  1XNQ F;  4H4K A;  5LM7 E;  4ED6 A;  1DLO A;  2MTL A;  1S0O A;  2HG4 A;  1XMB A;  3E01 A;  1KHV A;  4NXN F;  2KT5 A;  2KM8 B;  3TUZ C;  5EDW A;  1N34 F;  3A52 A;  3NKO A;  2JOQ A;  4MIA A;  3KLF A;  1JXL A;  3BSC A;  5C42 A;  5F8G A;  4LF7 F;  5AJ9 A;  3LAK A;  2QIF A;  4X4T A;  4UY8 T;  1IWG A;  2OP5 A;  2IC3 A;  4B3T F;  4LF5 J;  2I9S A;  1NKC A;  2POK A;  3DLG A;  3QJL A;  4M5G A;  4ZJQ A;  1FHT A;  1L3V A;  4RL1 A;  1VRQ C;  3UVJ B;  1RWP B;  5DRK A;  3SCL E;  4M5M A;  3TR5 A;  4U7C A;  2QEX S;  4GTX A;  5A8K B;  2W01 A;  1K1Q A;  5CCM A;  3C14 A;  2WSC C;  2HEK A;  4J9L A;  1VBY A;  3GTY X;  3HD1 A;  3H59 A;  4LF6 F;  1IKY A;  1S1U B;  2RQK A;  2FJV A;  3K8V A;  2RU3 A;  3SZ2 A;  1RTH A;  4JBC A;  5EWE A;  2D1G A;  1VIX A;  1WOP A;  2H51 B;  2DNQ A;  2WVD A;  3GJQ B;  4USI A;  4ILM A;  4DV7 J;  1MWY A;  4ID5 A;  4K2X A;  2ILZ A;  1PIL A;  3A8J A;  3K5L A;  3UD4 P;  1HIY A;  2BQ3 A;  4LFC F;  4KPC A;  3ZTR A;  4W92 B;  1IBM J;  4OZ0 A;  2VF3 A;  2XSF A;  4O4G B;  2DRB A;  2Q6B A;  1YGY A;  3QT5 A;  4HDH A;  4F8R A;  3QJP A;  1P1L A;  1P49 A;  3OFE A;  2C2N A;  4V19 J;  1IN0 A;  5C25 B;  1VQ4 S;  4OMF G;  3P49 B;  1RWU A;  3M1V A;  3QMQ A;  4ETX A;  2XLK A;  2KTQ A;  2PE8 A;  3CTR A;  3R5A A;  2DR6 A;  2ZHO A;  4ID8 A;  4IFV A;  3N01 A;  4LJM A;  4I7F A;  4LQ9 A;  5KFO A;  3CCQ S;  3RAQ A;  1LWF B;  1ZPV A;  2R7S A;  2FTR A;  4KJI A;  2NZ4 A;  1BXN A;  1WJ9 A;  2QLX A;  1Q78 A;  4P72 A;  2E9R X;  4PZV A;  3KJN B;  2BKO A;  3SCI E;  4BC7 A;  2EFV A;  1UFL A;  4ZPW R;  5A8R B;  2BR0 A;  1QAY A;  2ZBP A;  1UVK A;  3P5B P;  2H5I B;  5J2M A;  1NK9 A;  2DHG A;  2GVZ B;  4DPT A;  2J8A A;  3DOM A;  4A8Y A;  4H4M B;  4KHP J;  2HK3 A;  2WON B;  3PNI A;  3A4T A;  4DL3 A;  1RT4 B;  2HNY B;  5A8R A;  1NJX A;  2HHT A;  3B8H A;  2V2K A;  3W61 A;  2ZC3 A;  5KFY A;  3EZ5 A;  3VR1 A;  4KSE B;  3IN5 A;  2B8Q A;  2W8L A;  1UVN A;  3C16 B;  3I4H X;  3CJK B;  2KN4 A;  3HSJ A;  5L0K A;  2QA4 S;  1O99 A;  3DGP A;  1M5P C;  1FRL A;  2RVJ A;  4J9P A;  2B9W A;  2J0W A;  2ZKT A;  3N5F A;  1S49 A;  5CQG A;  5ADZ A;  2N7C A;  2DIT A;  4A8S A;  2R2T A;  2HGL A;  1N52 B;  1UVM A;  2CPZ A;  1UEV A;  5KG3 A;  4OX9 J;  2XZW A;  2PMZ D;  2V2V A;  2YKM A;  1R8B A;  4HT7 A;  4O3O A;  1JLB B;  3DDK A;  4DFJ A;  1WTF A;  3OXL A;  3T19 A;  1OIA A;  3MD3 A;  1JLQ A;  5LJ3 Y;  1B3T A;  1RTI A;  5HLF B;  1XWL A;  3H2V E;  1N34 J;  3NL0 A;  4ZGA A;  1OQ3 A;  4JOU A;  5F8H A;  3OTO F;  1B70 B;  2MDA A;  5DQG A;  3ICL A;  4HAC B;  3D67 A;  4QU6 A;  1D8Y A;  1R8H A;  5AE3 A;  2HND B;  4JP8 A;  4X84 A;  1Y10 A;  2N82 B;  2J6T A;  4TU7 A;  3EGZ A;  2MZ1 A;  1U6B A;  4NI2 B;  4OHV A;  4MY4 A;  2IJR A;  1WOS A;  4WFX A;  2UU9 J;  2BQU A;  1Q7Y T;  2NUH A;  4ECX A;  4DR6 J;  2DBB A;  2VV5 A;  1Y11 A;  2W7A A;  2DO0 A;  2NXU A;  2QZ8 A;  2NPF A;  5L38 A;  3KG0 A;  2AGP A; 
#chains in the Genus database with same CATH homology
 3TX0 A;  4LRD A;  1B8J A;  1AUK A;  1ZEF A;  2ANH A;  2IUC B;  3WAY A;  4B56 A;  1AJB A;  1EI6 A;  3IDD A;  3MK1 A;  1KH7 A;  4QAX A;  1ALH A;  3B5Q A;  1O98 A;  1EQJ A;  5GRR A;  2W5T A;  5DLW A;  2IUC A;  3NKN A;  1E3C P;  4LR7 A;  5LIA A;  4LRE A;  2W5W A;  3NKM A;  4LRA A;  5DLT A;  1KH4 A;  4NWJ A;  4LR8 A;  4UPI A;  5C66 A;  5LQQ A;  3ED4 A;  3A52 A;  1SHN A;  4UPL A;  3TG0 A;  1EW9 A;  5AJ9 A;  3UN3 A;  2GSN A;  1AJC A;  5INH A;  2W5R A;  5L0B A;  3NKO A;  3UN2 A;  2GSO A;  5IJS A;  2QZU A;  4CYR A;  1URB A;  4GTY A;  5HRT A;  1HDH A;  4GTX A;  2W8D A;  5EGE A;  4LQY A;  3BDG A;  3UO0 A;  3UNY A;  1HJK A;  3DYC A;  5L0E A;  4CXS A;  1EJJ A;  1FSU A;  3SZZ A;  3CMR A;  2D1G A;  1E1Z P;  3M8W A;  2GSU A;  3WAX A;  3WAV A;  4ZG9 A;  4YR1 A;  4CXK A;  3IGZ B;  5LRN A;  3T01 A;  4ZG6 A;  4LRB A;  1SHQ A;  4UPH A;  1ELX A;  4NWX A;  2W5S A;  1EW2 A;  3UN5 A;  2XRG A;  5LRM A;  1HQA A;  1E33 P;  1N2L A;  2W5Q A;  3KD8 A;  1P49 A;  3SZY A;  4ZG7 A;  1ANI A;  4N7T A;  4KAV A;  1K7H A;  4CXU A;  4KAY A;  3M8Y A;  4KM4 A;  1EW8 A;  1AJA A;  4GTW A;  4FDI A;  3NKQ A;  1ALK A;  4TN0 A;  1KHJ A;  3LXQ A;  4UPK A;  3T00 A;  3M7V A;  1E2S P;  1ED9 A;  2GA3 A;  1KHL A;  2RH6 A;  4GTZ A;  1ZEB A;  4MIV A;  2X98 A;  1ALJ A;  2VQR A;  3WBH A;  3MK2 A;  1ALI A;  2GLQ A;  2IFY A;  3OT9 A;  5IJQ A;  4LR9 A;  1ELZ A;  5K4P A;  1KH9 A;  1N2K A;  5L0K A;  1O99 A;  2W5X A;  5TJ3 A;  1ZED A;  3NVL A;  3M8Z A;  4UOP A;  2ZKT A;  3TWZ A;  3NKR A;  1Y6V A;  4KJG A;  1URA A;  3Q3Q A;  4KJD A;  4MHX A;  5EGH A;  1ED8 A;  1AJD A;  1Y7A A;  1KH5 A;  3BDF A;  4CYS A;  3IGY B;  3E2D A;  3BDG B;  1ELY A;  4LR2 A;  4UOO A;  1KHK A;  2XR9 A;  4ZGA A;  5DLV A;  1ANJ A;  4LRF A;  5KXA A;  3NKP A;  1KHN A;  2W5V A;  5GOV A;  3DPC A;  3MK0 A;  2G9Y A;  3WAW A;  3T02 A;  4MY4 A;  2W8S A;  4FDJ A;  3BDH A;  4LRC A;  4UOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...