4LRBA

Phosphopentomutase s154g variant soaked with 2,3-dideoxyribose 5-phosphate
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTGADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 146
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrbA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrbA01
3A52A 3NKOA 3T02A 5LRMA 1ANIA 4CXSA 5L0KA 3M8YA 4KAVA 4UOPA 4CYSA 4N7TA 3M7VA 1KH9A 3UN2A 4TN0A 4LRCA 1N2LA 1SHNA 2W8DA 4GTZA 4LR7A 1KH4A 3UN5A 2X98A 3BDFA 4KJGA 1O99A 2QZUA 1N2KA 2GA3A 4CXKA 4UPKA 3UN3A 3BDHA 4FDJA 1ZEFA 1E33P 3MK1A 4YR1A 3NVLA 3T00A 1HDHA 1AJDA 5EGHA 2W5VA 4ZG9A 1AUKA 3ED4A 1AJBA 1ELYA 2IUCB 4CYRA 4B56A 3IDDA 3NKPA 3BDGA 3E2DA 2W5SA 4MIVA 2RH6A 5DLWA 3DYCA 1KH5A 1ANJA 2W5WA 4LRBA 4ZGAA 1B8JA 1E2SP 1EW8A 3NKQA 3NKRA 5C66A 5KXAA 5AJ9A 1ZEBA 2W5TA 3WBHA 3SZZA 1KHNA 4MHXA 4UPHA 1EW2A 5DLTA 1ALKA 5LQQA 1HQAA 1EQJA 1AJAA 3KD8A 3TX0A 4KJDA 4MY4A 4LRDA 2GSUA 3B5QA 4LR8A 1ALIA 3UO0A 5LIAA 4LR9A 5GOVA 3WAXA 3IGYB 4ZG6A 3UNYA 2W5XA 4UPIA 5TJ3A 4KAYA 1AJCA 4UOOA 3NKNA 4QAXA 1KHKA 1URAA 3SZYA 3TWZA 3MK2A 4GTXA 1SHQA 2ZKTA 1O98A 1FSUA 5DLVA 3MK0A 4GTWA 5L0BA 2W5QA 3WAWA 4LQYA 1P49A 2W8SA 2XR9A 4FDIA 5GRRA 1ALJA 3M8WA 1ELXA 1EJJA 1KH7A 5LRNA 3T01A 5HRTA 4GTYA 5INHA 2GLQA 1HJKA 5L0EA 3M8ZA 1E3CP 2ANHA 1KHLA 1EW9A 2GSOA 2IUCA 2W5RA 3TG0A 2GSNA 5EGEA 4KM4A 1EI6A 1Y6VA 3BDGB 4UORA 2XRGA 2G9YA 4NWXA 2VQRA 4LREA 1ALHA 1URBA 1K7HA 5K4PA 1ED8A 1ELZA 1KHJA 3NKMA 3Q3QA 3OT9A 3WAVA 1ZEDA 2D1GA 4ZG7A 5IJSA 4LRAA 3LXQA 1ED9A 5IJQA 3WAYA 3IGZB 4NWJA 3CMRA 4CXUA 1Y7AA 3DPCA 2IFYA 1E1ZP 4UPLA 4LRFA 4LR2A
chains in the Genus database with same CATH superfamily
2EC2A 2ASLA 3NMRA 1RAEB 5HQ8A 1NJYA 5C24A 5HQLA 2ZNZA 1AZSA 2G9OA 3FBCA 2R7RA 3UN2A 4JI4F 4BC7A 4DUYF 2GVZA 3AXMA 3NGUA 1Q86T 3PG9A 3F41A 2UV8G 1KLNA 4IOAQ 4NLUA 4JV1A 1D8YA 4J9RA 4WZMA 3R6LB 4YB5A 4J9SA 5C66A 2ACYA 2HW3A 1HWLA 1RKIA 3SZZA 2R8HA 4C8ZA 4DLGA 2J6SA 3FCHA 2HBZB 2V4JA 2P6TA 2CNLB 3NAIA 1JLFA 1RACB 2HK2A 3OLBA 5KFXA 4CIOA 5HVGA 4TNOA 4JI3J 1RISA 2JVOA 4DQRA 1YI2S 4IG0A 2R2SA 2IUCA 3MMAB 2C2ZB 1TUGB 2XLIA 5A8RA 4GKKJ 2FJVA 3D5MA 2ZH7A 4OJGA 1E6YA 3FVYA 4KGMA 1ALHA 4DR2F 2HFZA 2QLFB 4DR4F 4LRAA 1ULRA 4ZLJA 3HZEA 5C2GA 2B4UA 3R7BB 2ZD1A 1FFSB 2XGQA 3BO4A 5KFCA 3W9JA 2F9JA 2B6AB 2AF6A 1H2UX 1G1XA 3GG0A 1KLMB 2JLFA 5ETQA 3JSRA 1BQMB 4K4VA 1T3NA 3LP0A 5CYMB 2AYGA 2B51A 3PRVA 9RUBA 1TL3A 2BE7D 3UPFA 2C3PA 1B0VA 2HPUA 4ETXA 1PBAA 1EQ0A 3I96A 1YJTA 3PR5B 4PWDB 1RTZA 5KOXA 3DGVA 4NXNF 1KTQA 2GV1A 1HD0A 1SJ3P 4ZLLA 4MYTA 1S6QB 3TAQA 4D3HA 1IKYA 3KNAA 4CO5A 2MJUA 4AQYJ 4O0NA 2RU9A 4Y0FA 4BHQA 2Z30B 1EB0A 3OR1A 1XQIA 3IBCB 2EVZA 4A8QA 5K8MA 4X65F 1VBKA 5L0KA 4FYWB 1YZ7A 2PE8A 2KVIA 2BOAA 4I7FA 3NS5A 3OVBA 1VOMA 4IH6A 3K58A 2WRMA 1KFSA 5KG7A 5J2NB 1SB6A 3QT6A 5IXUA 2RHSB 1HBOA 3EX7B 2V4QA 3HKWA 4Y2MA 3ZTSA 1SXLA 4JI6F 5TJ3A 4ZCIA 5F8IA 3HVRA 5D3GA 1WHWA 2WVFA 3LP2A 3NRBA 1S97A 1HBUB 1NK9A 3GPAA 2DR8A 3CULA 2GSOA 4DR5J 2VC0A 1NSKL 1RDRA 2QEXS 2PO4A 4E0DA 4YS2A 2Z56B 3JTOA 2R9LA 1TL7B 2M5YA 1N34F 3FMWA 3PFEA 2RS8A 3I56S 1S1UA 2CWKA 3KLIB 3BF4A 4P72A 1NJWA 2P8IA 1SHNA 4X66F 4GMKA 3QLHB 2PMZD 1H98A 4J9KA 5LJ3Y 3T9NA 3D67A 3I55S 2MPUA 1Q0NA 2IFXA 2UP1A 2BE2A 1JIHA 1WEZA 3DN9A 3ICLA 3RTVA 3H5UA 2WB1D 3JSBA 3O8WA 2E66A 3S1TA 3W7BA 2ZH8A 4B3OB 4YMEA 1U8SA 3AOAA 4OLOA 2ADCA 4MFBA 5HATA 3SBMA 1FRXA 1KHKA 3TVZA 3SDEB 2B5JA 2FZGB 4ZN1A 1FKOA 5HP1B 1Q79A 4ZVQB 2CQ3A 3BQ0A 1PCAA 1MROB 4LF7F 3NEKA 4PXDA 2HFOA 3KTQA 2IYGA 2VOPA 1RYRA 1VQKS 2RUGA 4KTQA 3NXZA 1T03A 3TVYA 1KQKA 1VRTA 2IDLA 1Y10A 4CYUB 4EEYA 1PBUA 1ANIA 3GWCA 3PYEA 2GHVC 5HBMB 3HXMA 3TA0A 3C19A 5KFNA 2ZOFA 1FRHA 2RRAA 2KXFA 2GCFA 1UVKA 2M8HA 3MR2A 4G1PA 3FSIA 4XIUA 3Q22A 4GO7X 2VQFJ 3PW2A 1IVZA 1DJ0A 2NUUG 1CJVA 2IRYA 1GXTA 1NPKA 2AU0A 4JI8F 3CE8A 4J9MA 3N5BA 2IBOA 2DNLA 4DV3J 2PFDA 4ICLB 1UKUA 2QL7B 3I5AA 4FZVA 1S1TB 3TWZA 5JVHQ 5CAAA 4X62J 2F40A 2DH7A 2GVZB 3L95X 3SSSA 5IT0A 1DBDA 1C4CA 1G2EA 1RU2A 2H48B 2K2PA 2E1CA 3HVTA 4P52A 1SVDA 1X5PA 4UZCA 3GIIA 3R2DJ 1LW0A 4UPLA 3PKMA 3KHLA 1RTIA 3DLEA 5BJRA 4NE9C 2OAUA 4JI7J 3VALA 1JLFB 3MF5A 2W8DA 2AEJA 3OL7A 2GA3A 3SFGA 3W1YC 2MHNA 1YTYA 3G82A 4J9VA 4X84A 2CRLA 3OL9A 2IUCB 5E3PA 1R0BG 3HM9A 4EUVA 5K8OA 2CPDA 3AY0A 1HIYA 4ZKAA 4JYAF 4KBIA 1Q78A 4H4OB 2HQ3A 3DFEA 2H3EB 1TK8A 4LFAF 2RRNA 2XHCA 2ZD1B 1LWFA 1RT6B 2BQUA 2EWHA 2CIMA 1MMLA 3D6FB 1NH7A 3MCOA 3FQKA 2V5HG 3PRDA 3Q8PB 4CLLA 5ADZA 1U25A 2HHUA 3ZZRA 2CFXA 4JI2F 4RPFA 1MMDA 1SKRA 4F3MA 1IUJA 2VQRA 5FJ4A 4LREA 1TL3B 3Q3QA 2I8EA 2QYGA 3AT1B 4DPTA 1LWCB 2MQNA 3C3LA 2M9KA 3TZXA 4NLRA 5KFPA 1NRKA 1S59A 2VKZG 1RWOB 4M5IA 4FPIA 3DGPA 2YKPA 1OSCA 1XMOJ 2CZVC 2BMBA 1T94A 4RW4A 2AD9A 1RU1A 2CZ4A 1TP7A 2KL8A 1SL1A 3GCXP 4Q5VA 1C1CA 2HIQA 5G0RA 4GC6A 4ZVEA 2OSQA 3OR1B 1S0MA 2H4WB 1DY3A 3A3OB 1NHVA 4RW9A 2HIYA 2WVEA 4UW2A 2ZBCA 2P2CB 2DK2A 3B8HA 2KDOA 2QLXA 4I7FB 1R8HA 1N8RT 4DL6A 1X9SA 3TYTA 3PKYA 2FJWA 4LFCJ 5GAGI 1Q4RA 3M8PA 4I1TA 4P6QA 2DEJA 3KWMA 1HBOB 4LIRA 4F4YA 3ILIA 1H6KX 5KFHA 3HHKA 4PR6A 4DUYJ 1VJWA 4JV5F 4CYSA 2CJAA 4DPWA 2FVPA 3D3CJ 2R7VA 4DG1A 4AD6A 2NYHA 5LMNF 2MKHA 2BRKA 4QZVB 1H74A 1EIYB 2XY6A 1VGYA 1XR5A 2OTJS 4W98A 5M2PA 4DV5F 2NZCA 1DFDA 3DLGA 2IAJB 4LBPA 3IM8A 3SIPB 3P8BB 4OZ2A 3W5YA 2A1BA 4C8LA 1XMQF 4ES2A 1P49A 1KOOA 3K2YA 3BQ1A 2BE9B 3W3SA 1LNQA 4FN5A 3OTOF 4DR2J 1RHUB 3IWNC 4DR4J 1S9EA 3D4JA 5FD1A 2G0IA 2ZZMA 5BYRA 1YBAA 2KB2A 2VASA 3IS9A 4KAIA 5IWAF 2QC3A 2KRRA 2KT5A 3W61A 4ELTA 4DR1F 3OHBA 4TVAB 5B0DA 1R43A 3QATA 1FKOB 1N2KA 2E1AA 4JV2A 3ZZ0A 2YTCA 4PXBA 2OD6A 5L1JA 1IR2A 1F9HA 3CD0A 1U47A 3FBEA 4WYWA 1X0PA 1WTFA 4I68A 2RH6A 1ANJA 4M5KA 1OO0B 2MDAA 3W9HA 4J9QA 4NXNJ 3EVWA 3TQEA 4IRDA 4AE5A 3IBWA 4OYOA 4AL7A 4WE1A 4P2XA 1PIEA 4GVBB 5GAEI 4RUBA 3VVUA 3O3LA 4RLEA 1IBLF 1Q1KA 3FZ2A 2G1DA 1HWKA 4ZDNA 2JC0A 3H4DA 2MXYA 2XSJA 2K7JA 2VC1A 1M90T 1U0SA 1CJVB 4X65J 5ETTA 2F7VA 1T9UA 3CCJS 2YNFB 3NBPB 1C0UB 1QTMA 4ZG7A 3CJQA 3HLUA 4CLPA 3DRRA 1NLKL 3FJ2A 1TZ0A 3TEHB 4B9NA 4F8RA 4LIWA 2LA4A 4KGVB 2K8GA 3O6QA 2CPJA 2DCLA 4UPKA 2O5DA 1RE1B 1D0EA 4HL9A 3ZZUA 2W9CA 4FDFA 4I2QA 3J7Z5 1QD1A 4DV2F 1KH5A 3HVTB 4WPAA 3KDNA 4KSEB 1TQLA 1YJWS 4JI6J 4ZITA 2R2RA 2Y1LB 4O44A 3UW1A 1LW0B 4KO0A 1HQAA 4HDGA 3OJSA 3DLEB 2C22A 3CO0P 5CABA 5HMYA 4NI2A 4JB8B 2OHDA 3ENVA 5L46A 3CB4A 2HS0A 1N34J 2XRGA 2D3OR 4J37A 3AFGA 3BO3A 2MYFA 3G4SS 1ELZA 4O3OA 2XC9A 4ZCKA 4PYDA 1PG5B 1LW2A 1GXUA 4X66J 1NSAA 3DRPA 2ZJPQ 4IFYA 1HI8A 1XTZA 3CPWR 1MWYA 1WC5A 2UVRA 4NCGA 3I0SA 4CCHA 2VBYA 1YG0A 4Q0BA 4TYAA 3T00A 3TP2A 2KYXA 2FY1A 2NPIA 1EJ7L 3MM8B 3R7NB 3LWLA 5AXMA 5H9FJ 3TX8A 3J81U 3QGPA 3RYLA 1B64A 1U7LA 4HTIA 2XB2D 5C25A 4Q45A 4RO0A 2YWKA 4C3KA 4LR9A 2W24A 4XPCA 1ZS6A 1ZOTA 3CCZA 2VL1A 4LF7J 2RT3A 3D68A 2RRBA 5M2UA 5HRTA 2LYVA 2RF2A 3LTOA 4NPOA 3NNCA 3KUEA 4TXSA 2VQEF 2MGZA 2U2FA 2HBQB 2YNIA 4K0KF 5G0RB 1GX6A 1K7HA 3VAGA 4W90B 2DR5A 1ZEDA 5GMEA 1GTEA 2HVIA 2VA3A 1M5KC 4RW9B 3GB0A 4ZVPB 3C14B 2CQCA 3W5ZA 3EGVA 2XMJA 5FLXU 2EI5A 4JI8J 2Z8QA 1WG1A 3IR7B 4YB7A 4CYRA 2XI3A 4NLSA 1HQUA 3TZWA 1QAIA 2R4FA 2XI2A 3TVKA 3CO9A 3PJWA 4NASA 4WFAQ 2LQJA 1NPPA 1WI8A 4IYQA 3CEDA 3DYAB 1CJTA 4R25A 1WORA 2AV5A 2R8JA 2W01A 2FLPA 2XMTA 1TUVA 1V9OA 2BRLA 2DD8S 3R27A 3DHWC 1RBLA 3SSQA 3MUTP 1M5VC 3G6YA 3W9IA 4ECTA 3OBIA 2L3MA 3TANA 1RT2A 1SH0A 2BJ7A 3POTB 2JEIA 4PPDA 4HHHA 4DX7A 4OHYA 3IG1B 3DLGB 4WZQA 5B0GA 4WBFA 2DNQA 1NK4A 3L4BC 2UU9F 1VC0A 1WJ9A 1YK9A 3M2UA 5DG7A 3OVAA 2E1RA 3JAMU 1N36F 2IRUA 4Q7AA 4CXKA 4K4YA 3UN3A 1DTQB 5JJBA 2YKAA 2X3GA 1S9EB 2LCWA 2GAGC 3NKPA 5A76A 4F7VA 1JLEB 3QJJA 1JMTA 3SMZA 1OIAA 1U2CA 1C2PA 4LFAJ 1W25A 1L3TA 3W60A 2D3O1 1GMVA 1FJEB 1F9FA 2R7WA 4Y2CA 3OVSA 3RW6A 1PAUB 2C2NA 2E7XA 3RW7A 2HVZA 5IV3A 4B9TA 1U24A 3NLCA 2M3DA 3MR5A 1UEVA 3KJQB 2GJFA 1FKAF 4JI2J 1CQNA 3VGSA 3GR1A 2J7UA 3T6BA 2B8PA 1U02A 3IP0A 1Q82T 5KFLA 3JXOA 3WX8A 2V2ZA 4WK1A 3P45B 2HLUA 3JQMA 2GC8A 4L73A 3PYFA 4KE5A 3BM7A 3CD6S 5EGEA 1X4HA 4QPTA 1XMBA 4CH7A 4IG3A 3T5HA 2GJIA 2MJNA 4KRWA 1FXRA 4DOZA 3ADAC 4U7UD 1NKBA 2IFYA 3MD3A 4WE1B 4G1QA 4DR7F 4ELUA 1SBRA 4KAVA 3OV7A 1U1NA 3RB3A 2ZZTA 3VHQA 3MUMP 3CGIA 4LR7A 1N0UA 2HVDA 4DR3F 2XSJB 2ZBQA 1KVJA 4B3MF 3FC9A 3QQCD 3QRRA 3J80Y 2VG7B 4KB7A 2B3TB 3QJLA 2IDEA 4TU7A 2KJWA 3NY0A 3WIUA 4ZVFA 3VAIA 1TKZA 5CXTA 3K5OA 4O3RA 4ZPBA 1U2RA 4CO4A 1JLAA 4PUOA 1F5BA 4ES1A 1NAQA 4DUZF 1F6TA 3SCJE 1RT1A 2CVIA 4MKAA 4IR9A 1Z4UA 4BCAA 1LOUA 3Q2SC 5KFRA 3TQ1A 2W9CB 4GKJJ 2R2UA 4I2QB 4FYVB 3DLHA 3AAWB 2ZOGA 2E7WA 3EVOA 4JV5J 1ED8A 2OPRA 2RHQB 1BE4A 1K73T 2XMAA 4O44B 4KO0B 4C3MA 4LRFA 2G0JA 2QA4S 5I42B 5LMNJ 4CP5A 1U8WA 2DGSA 4YFUA 1DURA 4DUTA 2VKRA 3ETOA 1RWUA 4CLSA 2KO1A 3I9V9 3J7AN 2IY5B 4DV5J 3GIKA 3PX0A 2HQDA 3V81B 2Z0GA 4B56A 2I6WA 2ZH1A 5LL6d 2ZUGA 1E2SP 4QYRA 2O67A 1RBOB 3NG8A 4QR0A 2UUAF 2YKNA 3SFUA 1XMQJ 1VRQC 1LW2B 3R9LA 2H4YB 2DNGA 5HSPA 2HVEA 3J7ZT 4IFYB 1WUUA 3FRYA 2ILYA 3CCQS 3OTOJ 2NZ4A 4QIWD 3CXCR 3CJ5A 3VZIA 4QAXA 1T9XA 3TO8A 3T1HF 3CCLS 3D54A 1B0TA 2Y3YA 3CDAA 1ZPVA 3I0SB 3AODA 3RBEA 3DC2A 2PN6A 2FC9A 2WOMA 3T5KA 3TEGA 3EZOA 2UVVA 2FGCA 4ECXA 4NRUA 2JLEA 1N4LA 4WXOA 5E2QA 5IWAJ 2A18A 5IQ6A 2ZH6A 2ZKUA 4KKOA 2D1GA 5IT9U 4AL6A 5DETA 4DR1J 1OY6A 4TQRA 3ZXWA 3HD1A 1X5TA 2XCPA 2Q6CA 4HHUA 3W5XA 3W8PA 3E3XA 1H73A 4FXDA 2BKNA 5MAOA 2R7UA 1FJCA 1DQAA 1ZM4A 4ZK7M 2YNIB 2KN4A 1SJQA 5LSOA 4OQJA 4DCPB 4ZVUB 1IBLJ 1V3RA 4X4TA 3UO0A 3I0RA 3M6UA 1EZZB 5EX3A 4BWJA 2VBXA 3NMAA 2G13A 5HLFB 4WKRA 2XG8A 1IN0A 2UXCF 1HQEA 4YP3A 1Y6VA 1HQUB 4L74A 5GAGU 3WDOA 1Q5YA 3I5CA 1JKHA 2QFIA 4F2SA 3ISZA 2FLNA 3S7RA 1VIOA 3WC0A 4MKBA 1FRJA 1NDKA 1LWXA 2C1EB 2YXLA 3H20A 1GFWB 1HBNA 2C3OA 4CNYA 2BDPA 1EKRA 3KK2B 3CUNA 3J81j 4ILRA 1FDAA 4DV2J 1TL1A 3BGLA 1J5OB 1S79A 2VOOA 1N54B 1WDDA 1Q8KA 4OI3A 1REVA 1RT2B 4NYOA 4OV1A 3PX6A 4DX8H 4TN2A 3HMJG 1EETB 1FWKA 3BKTA 3PJXA 5E0OA 3KLFB 2JX2A 4DQQA 2GHWA 4QQBA 3WAXA 2XMMA 4KAYA 3N28A 3FDSA 4I2PB 2JOQA 2QG9B 4NXMF 4ZCMA 1P27B 3H90A 4WK3A 1HJKA 1XERA 1RWVB 3IWLA 7FD1A 1XWLA 2H54B 4RWXA 5KFTA 3AOBA 5F3ZA 4USKA 4HH0A 4O3NA 1B99A 3V4IA 3HO1A 1O0PA 3MTKA 1XNQJ 2CVEA 2HZVA 3LANA 2IVYA 4KY3A 3O2IA 3CJTA 3RRHA 2V8GA 4UTGA 4A8SA 4HLBA 5CCLA 4R5PA 1X4GA 2LQBA 4LMZA 3EXYA 3EICA 1OWXA 3OUYB 3LGHA 4PZVA 2VBWA 3M30A 3DOMA 2EK1A 2HBRB 3GJQB 3UDCA 3U7JA 3AB4B 1KHNA 3DRXA 4NA3A 4CO0A 4G1QB 2RQ4A 1GMWD 3ILOA 1SJFA 1AT1B 5GAEU 1R6VA 2L08A 1RADB 2YNGA 2VQEJ 2DR6A 3BSAA 1RTHA 4X2BA 3LOUA 3N9UC 3CCWA 3T01A 3RRGA 1VQ9S 1ZAXA 3M8ZA 4B9SA 1F1BB 4OL8A 2UUTA 1UVLA 4IH5A 4PXCA 2CJQA 1EX8A 4KFBA 2B7BB 3Q8UA 2DYAA 4ECWA 4LJMA 4KR0B 3UD4P 4YDDB 4ED2A 3NKYA 3OXFA 1Z1ZA 3BH6B 3BN7A 2VFRA 1JLAB 1RLDA 4PUOB 1OQ6A 1W7WA 2J7KA 1D3WA 4J7CA 4J9PA 2B8QA 4M5LA 5A2QY 3MOZA 1RT1B 2G0CA 2XEXA 4IR1A 3VAMA 2GJ2A 1DQ9A 3HHNB 5GMKa 2CJ9A 2W5SA 4DV7F 1FVSA 3IGVA 3MOJB 4ILLA 2OPRB 1VYAA 2NCKL 5DDPC 2DO4A 4Y6IA 5FDLA 3SCIE 3OFHA 1RAHB 3PM9A 2VPZB 1D1UA 2ZVIA 2Z2MA 4I6AA 2EKYA 5ETLA 4ANDA 2YWGA 3ENWA 2EC0A 2A2DA 2HG4A 1I94F 5DLGA 3BEGB 3MGJA 1N52B 3GMGA 3NWRA 2UU9J 4ANCA 1W26A 3AA9A 3KK3A 3DI6A 2YKNB 3L09A 1AFIA 4CXUA 1S6PB 1N36J 4IQXA 1UVIA 4FNIA 3RB4A 3D0HE 4QWBA 5H9EJ 3U1MA 3GIMA 3GIJA 2CPFA 3P96A 3QBCA 4WYLA 4A8WA 1APSA 4N77A 3RJMB 1WTBA 5DLWA 1UJ5A 3H2LA 2V63A 2YH0A 1P9YA 4OX9J 4KKOB 1QE1A 4MIAA 4V19X 2XGPA 1NNDA 4HT7A 1P1TA 2V8DA 3VGTA 2C2RA 1YJUA 3US5A 3HVWA 2HWIA 4ZP6A 5AXKA 4FDIA 1IKWA 3MEKA 3M2VA 3KHGA 4P2FA 3VGUA 3W8GA 3KHRA 1IJFB 5B0BA 4PWWA 1S9FA 1WC3A 2AT1B 2ZBPA 4DR7J 4A47A 5K4PA 2K7KA 5E3RA 2UVWA 5IJQA 5BYSA 5KFVA 3EJMA 2JSXA 3R1LA 1SCJB 3KNGA 2Y0BB 2BJDA 3ZNUA 4DR3J 2FHKA 3JS9A 3AJDA 2K3KA 4B3MJ 3T6JA 2VZ9A 3GV8B 3PACA 2W2MP 5AE2A 5JMNA 5K14A 2WVDA 3CT9A 2OEMA 3ENQA 2PGCA 1BGXT 3CIZA 1N6QA 5U47A 3VWSA 1UZHA 1NU4A 3KLVA 3HDSA 3QIDA 3QGGA 1NK5A 1JKHB 3CIMA 1SJRA 4L75A 2W5TA 5GAHI 2YKMA 4NYZA 4ZS6A 4DUZJ 1IM6A 2KFNA 1EQJA 2VUGA 3GYGA 4L3NA 1HBNB 2YPYA 4J9LA 3UNYA 4F3QA 4KC5A 3NOGA 4UF4A 3FEYB 4F2RA 4NEZA 4JI3F 3N0VA 2JH3A 1XJWB 3PX4A 4FYXB 2R7SA 1TL1B 2W4PA 5KT4A 2RKIA 2BKPA 1FJ7A 1REVB 2W2NP 3DLKB 1HW8A 3K8WA 9ATCB 5J1NA 4U9RA 1V5IB 4KHRA 1UPPA 1U0HB 2Y1RI 5HROA 3IM9A 2AJ4A 1YIJS 1VQ6S 2DH9A 2DXEA 4WFYA 2ZH5A 4UOCA 2WSFC 2CQIA 1U1PA 2V2VA 3PY8A 2MZSA 5D0GA 2YNHA 2X98A 2XYHB 4F4KA 1AB8A 2PIIA 4DL0C 4U8VA 1WSRA 1B3TA 3EPGA 1R8AA 3N6NA 3MECA 2UUAJ 3V6DB 1HNVA 2V9WA 1IKXA 1WEYA 2MLZA 2PSZA 4PKDB 3V4IB 2NSCA 2XZTB 5D0HA 1OYEA 3MXHP 1U1OA 3T1HJ 4USTA 1VHIA 3SSRA 4WCEQ 3HFVA 1JXEA 5A8WB 3UFCX 1VQSA 4CM2A 1IBCB 1MWZA 3I9ZA 4ED6A 1RT5A 2V6AA 5F0WA 3NKNA 2HHSA 1T0TV 1FXDA 2DEIA 2L9DA 4R5PB 4QYZJ 4CRJA 4RW6A 2XHWA 1UMJA 2ANHA 4CLUA 1QSSA 2DNMA 3WBZA 4X4PA 5IC4B 3M9NB 2L9WA 2CQDA 4ZP7A 3ZTQA 3M30B 1M5OC 1NMEB 2N7YA 3DOMB 2NUHA 2PMWA 1I1GA 2Q66A 2GS8A 3DXSX 2FB0A 3AB2B 4LR2A 3A52A 2H9ZA 3GZ7A 4OZNA 4OJ1A 1H38A 2PT0A 2YNGB 4DFPA 1RT4B 3RBZA 1F3FA 1JXVA 4DFJA 2OH2A 4QWEA 5EGHA 2VBZA 1HHQA 3L7UA 5E5NA 1H2VZ 1MMNA 1YKWA 2I38A 1FDBA 1EHWA 1FE4A 2BA9A 1B8JA 2YKQA 2MKSA 2CQPA 1BHNA 4N47A 3CWJA 4WU3A 2JVRA 2VDIA 4ZIVA 2XMUA 1T11A 3DMJB 2VPYB 4DZDA 1FF2A 4LR8A 5D0EA 3GV7B 2O66A 4M63A 1U1LA 3PHTA 1FRKA 2U1AA 1LWEB 1O98A 2HMIA 4XK8C 3E01B 1S9GB 5DM7Q 2J5AA 4DR5F 1Y4ZB 3THPA 4ECZA 4PXEA 5C2CA 2IM1A 3N6MA 5I4MA 4MK7A 1FK9B 1KTVA 4S0MA 1JQGA 1HWUA 1HYSA 3ZTRA 2VFUA 3LAKA 3NKMA 1K44A 5ETRA 5HVFA 1NK8A 2QTWA 4NMXA 4UQGA 2APOA 3TOQA 3ULHA 4DSFA 5FDLB 4PQAA 3GV5B 2HGLA 1TK5A 1KR4A 4M94A 3K89A 4OYZA 1WOPA 5BYQA 1J27A 3NVLA 2CNOB 2M2BA 2RE1A 3G71S 4CLKA 2WAQD 2CWXA 3FKBA 2QA2A 2YKOA 2YWWA 3T1YF 2IIHA 3KK3B 3DOKB 3FRZA 4MK9A 3JSMA 4RU2A 2GFFA 4NXMJ 1T7PA 1DHMA 3OFEA 2GA7A 5LSRA 4LF5F 3EPIA 2E5LF 3HULA 4O0IA 3V6HA 2RS2A 1HD1A 3LPYA 1MN9A 3GJRB 4EU0A 2RB7A 1IWAA 1R31A 5EWFA 3CVKA 2RJZA 2Y9HA 4ECRA 4BDPA 3R5GA 2L48A 1N56A 1RQ0A 1QE1B 4NL5A 1X9MA 1XEZA 3MFHA 1S6QA 4NLGA 3AH6A 4WF9Q 2YQ1A 2ATLA 1AUDA 4LSLB 1K0VA 5J2QB 1UJ4A 1SQEA 1TVRA 2VB6A 2G2YA 4FS1A 2DO0A 1IKWB 2GVDA 3CD5A 3CDEA 5KG5A 3M2VB 3NCPA 5C5JA 1V6HA 4P73A 2EKNA 4K2JA 1VC6A 4ES3A 2UUWA 1JK9B 2WW8A 1L3SA 1YHQS 1S57A 4RR5A 2EBEA 3QFWA 2CDRB 1DZ5A 5GVQA 1KEKA 4K4SA 4LUBA 4X62F 5KFGA 4FVCA 3I82A 2OJ3A 3D28A 3MM6A 1RTDA 3B78A 1BQNB 4I0WA 2QSFA 1TFYA 4WJBA 2YX1A 4B3TF 2VD3A 2ZWPA 1N6QB 5KG4A 4U7UK 1VDHA 4CLFA 2N3OA 2HFSA 1RI7A 4OX8A 4OJ3A 3G86A 2O3DA 4YOEA 1RT7A 3LXQA 4F25A 5DZ7A 3D6HB 1HWJA 3THVA 5KFYA 3IGNA 4Z7YA 5KG1A 3W66A 5KFEA 4F3OA 3NKOA 1CS4B 2BJ8A 1AXQA 5HVHA 4FF3A 1N2LA 4DV7J 4OYBA 3GU0A 2AJ2A 4OLPA 2HHHJ 4EWTA 1FFWB 4HACA 3S8SA 3OXLA 2FHOB 2DRAA 1VRUB 1D9AA 4DWIA 3W63A 4OV6A 1FRIA 3I4HX 4URSA 5HROB 2J8AA 2A0FB 2QMXA 1AJAA 2GSUA 4Y34A 1VQ5S 4LQ9A 3PZPA 4UOOA 1NJXA 4Z37A 1YJ7A 1I94J 1CEZA 2DRBA 5AE1A 2YNHB 3HSZA 4LF1A 5LRNA 4PG5A 2AX1A 2NLWA 3PTWA 2BJ9A 1YBUA 1LKZA 5L0EA 3D1OA 3MECB 1UW9A 2C42A 2H5EA 1IKXB 1GK8A 3Q8RB 4OYMA 1IWGA 2FJEB 3BV8A 2KT3A 3A8EA 4R0JA 3A4TA 2IVMA 1CPZA 3JQKA 4XDDA 1VHFA 3AD7C 1RSCA 1MROA 2XS2A 4RW7B 1UZDA 1KVKA 3RB0A 4ZVOB 4C8YA 1RB0A 4TN0A 5E7OB 4NLYA 3MCSA 4WU2A 3RAXA 1OQ3A 3QYYA 3MR7A 3LA0A 3BS9A 3MEDA 3Q24A 5HBMA 4NWBA 2HHVA 2XYGB 3M32A 4BC9A 2MKYA 4K4WA 2CQ2A 3P6YC 2ZFHA 4RW8A 5IFMA 2QLWA 4OZJA 2ADBA 3M6WA 1Y5NB 4CQ1A 1FX2A 3H2VE 3GONA 4R0EA 4YR3A 5C42B 4ICLA 4FF1A 3QWUA 5KFDA 1S1TA 5IZHA 5KFKA 2I0XA 3G8QA 3D2WA 3X1LB 2Z2YB 1X9WA 2KHCA 4DPOA 3NL0A 4AFFA 2HMIB 1X5OA 3R3TA 4QWDA 1FHTA 2D9OA 3N01A 5ETNA 3IR6B 3M9OB 5B09A 3RAMA 3PO5A 3PRBA 1KN6A 3OTDA 2FVCA 3CJRA 4RUCA 1HYSB 2LFVA 5HK4A 5IM0A 2CUYA 1F9EB 2DNYA 4CI0B 4ZHRB 1FDDA 2KZMA 3UD5A 1KP6A 3EWGA 2IMOA 3CJ0A 2KM8B 3A3NB 4YN3B 4H4OA 8ATCB 4PQUB 2BACA 2FJDB 2HQIA 4Q2LA 1K1SA 2KU7A 2AZ3A 4ZA1A 1RT6A 2BW7A 2HQFA 5GMDA 5LMUF 3MD1A 1X4BA 2V9KA 3JSMB 3M8QB 4ZJOA 1RWWB 1VQNS 2J9CA 2DITA 1NZAA 2BZ2A 2H65B 3DCAA 2W4DA 2QO3A 3OW2R 2OSRA 5ETMA 4I56A 2HFVA 1N33F 3E2EA 4IQMA 1LWCA 3LF0A 4QBUA 3AD8C 3CJ4A 4YR1A 3BN4A 4ZPVR 1VQLS 4CO1A 2GIRA 4DSJA 2GGPA 3QPIA 5ETVA 4A8MP 2CJKA 2BOPA 4KT0C 4DPXA 3EXCX 2IJNA 4N41A 3HHLD 2F5GA 4DL3A 4I67A 3EYZA 2B9YA 3C6TA 3CC4S 3LGNA 4WFZA 1A6LA 3BSOA 4Y65A 4YEAA 1XK8A 3MTJA 2OTLS 1WOOA 2YPZA 4LVOP 1AJCA 4C0OC 4ERDA 3CCSS 4O23A 1TVRB 4G65A 2A3JA 1ZA2B 2GVDB 3RAQA 4CO3A 4AT1B 4ZLPA 1FXLA 1WKLA 3C8YA 2Y1IA 2HGMA 2GX8A 1RJJA 2HHTA 2VIHA 3GSDA 3NOCA 1VQOS 4QJVA 2RMLA 2E1PA 2CG4A 2MQMA 2J0QD 4F4ZA 2QV6A 3R97A 3KG0A 1M5HA 4DX6A 1NEEA 2NXUA 1ZPWX 1IM4A 3H2UB 3MM6B 1RTDB 3DLLQ 1UEKA 4KJGA 1M1GA 4IFVA 4UOHA 2UUBF 3NWGA 4FDJA 4IKAA 4K4ZA 2JRSA 4F4XA 3HSJA 4Y2IA 3NGTA 1ZAVA 4PRFA 5DDOC 3VZHA 3IMQJ 5GAHU 2RAQA 1RT7B 4I6WA 1L3VA 2DT9A 3LALA 3FFIB 2DGUA 5CA5A 2ZBIA 3DXBA 2ATCB 3K5MA 4N8NA 4IUFA 1SHQA 1SV5A 3EVMA 1NK7A 1BWEA 2WB4A 2BR0A 3KHHA 4PCQA 2IAJA 1LK7A 2EFVA 3V6JA 4J91A 1FNXH 2COLA 1HPZB 4HACB 1VQ8S 3PW0A 4A48A 4K4TA 3KJVA 3EZUA 1UA1A 2MZJA 2EFGA 2D9PA 3H98A 3HSDA 2FUG9 1Y7AA 1X4FA 2VV5A 1AW0A 3TUJC 1VS3A 4YR2A 5L1IA 1TK0A 1I51B 2LQ9A 2Q79A 3T1YJ 2CPZA 1U1RA 2IHR1 4H4MA 2M88A 5A6WA 2AQ4A 3BGUA 2QL5B 3MPDA 4LF5J 3DDNA 2E5LJ 3C46A 2ASYA 2QZ8A 5J1PA 3V2UC 8RUCA 2LVWA 1ALIA 3KUGA 1VFJA 2XLJA 4RJVA 3WHIA 1FEEA 5HJXA 1KKHA 2ZHAA 3N6LA 3BGRB 2CADA 1KVIA 2ZC3A 4J5OA 4GVBA 2GSNA 3DM2A 4DL4A 3MEDB 2MEWA 2D74B 2VDHA 3M6XA 1H7XA 3D6MB 4EZ9A 2MTLA 1KHJA 1Y5IB 3M32B 1P9QC 3LH2S 4RW8B 3IO1A 3EE3A 3NS6A 3P5BP 1CSJA 1XN9A 1NBEB 2YNFA 5IQQA 3NBPA 3OLAA 1C0UA 3UN5A 2ZDOA 2XM3A 4R8UA 2FTRA 2KM8C 3GFYA 1RWXB 1KHWA 2PA3A 1T95A 1RHQB 4LRBA 1HW9A 2F8HA 2HLTA 3M1VA 1RA7A 4MHXA 4UPHA 2W2OP 4TY9A 3QRQA 1SJ1A 1U2FA 4B3TJ 2QE5A 3KUHA 2AWZA 3DU5A 1U1QA 6AT1B 1TKTB 1GMUA 2DGXA 3DRYA 4UUWA 2WHOA 3QGHA 1KONA 3GFZA 4Q2MA 1QUPA 2J76E 4KHPF 5IM0B 4ZVRB 1FCAA 3VVTA 1HR0F 7AT1B 3MHYA 2HFNA 3PHEA 3BDEA 3F56A 4NEYA 2GO8A 4CXSA 4FYDA 5ETSA 1UVNA 4GTZA 2J7WA 2W9BA 3Q8QB 1BMQB 1RHRB 5EDWA 1Q16B 2W8KA 2O1PA 4P2MA 1ZA1B 2AKWB 1RXOB 2B4PA 2R7XA 1AUKA 3I6PA 4NLTA 3BDGA 4YQWA 5DGAA 3B6BA 2XMKA 4CWBA 5BR8F 4MMOA 1NDCA 1NKCA 2PDAA 2N4DA 3MM8A 1JLQB 3UCUP 4ETZA 1S4FA 5J2PA 2W5XA 4FP9A 1T8EA 1KC8T 1WD6A 1G6BA 2XR9A 1S6UA 2EG1A 1T9WA 2BJ1A 3OQ2A 2GGPB 1EI6A 4C6AA 2HWHA 2X3DA 4TYBA 3VQSA 3QSIA 5L1KA 1M0SA 2OELA 1TAQA 2M8DB 5DRKA 3C6TB 4MKVA 2GNKA 2ACMA 3PIOQ 2CKWA 1H0HB 1E6VB 2W7OA 3GILA 1AYEA 4F04B 3G6XA 1Q8LA 2ZUAA 1PJ5A 4RU9A 5AXNA 1YQHA 2QJ3A 4OYIA 2UZAA 3ISND 1MG7A 4Y28C 3C14A 5KT3A 1FTCA 3R1HA 1WWHA 2AEMA 3TA2A 3LQVA 1LV5A 1B7YB 1FVQA 4OZ0A 4DJBA 4Q8FA 3UI3A 2EG2A 5LQQA 1JNZB 3FSXA 5KFOA 2LU1A 2AHOB 4OI4A 3TR5A 4IOCQ 4NLPA 2HYIB 1UFWA 5CQGA 3LW5C 4HEA9 4IFVB 4EBDA 4GKJF 3PNIA 3UDEA 2DNOA 4H54A 3DYAA 5AJ3F 2DKOB 4X4NA 2A2CA 1LK5A 3MZIA 5KG6A 2HS4A 2J9DA 3CJKA 2D3ZA 1S12A 5LT5A 2F3JA 1FESA 5DDRC 1RKJA 2JDJA 4AL5A 1KOHA 4MAKA 4DSEA 1Q95G 4JI5F 4ZPDA 2IRXA 4EO8A 3GE9A 1QAYA 5GADI 2VICA 1FTRA 4C11A 3POTA 3GYXB 3I5BA 1SV5B 4F36A 4PWUA 5EX0A 3IG1A 1S7HA 1RWNB 2C2EA 1YVFA 3ITHA 2LDYA 1FKPB 3S6EA 2VPWB 3KJVB 3BJYA 1DRZA 3EMTA 1P1LA 1QAJA 3AJ1A 1JJHA 3MM5A 4ZPWR 1DTQA 2BM0A 1ALKA 4B9LA 1R6YA 1OJ4A 1N5QA 3IAM9 4AXJA 4N56A 2VJUA 2A10A 1JLEA 4OYWA 1SQGA 1FNOA 3KLEA 5F41A 1VCTA 4TLQA 2A6MA 2DBBA 1S4EA 2B7CB 3MURP 2D7SA 5INHA 5LMUJ 1FWPA 4H4MB 1M1KT 3NGKA 3CCUS 5CYJA 2UXBF 4DPUA 3MR6A 5F8JA 2KKHA 2R8IA 3SEOA 2DR9A 3MR3A 1NM2A 1N33J 2Y8WA 4URGA 3A1YG 3QNWB 3Q86A 3QO9B 3KLHA 3IN5A 4PG7A 4UOPA 4RBTA 4Z7CA 3QWPA 1WKJA 4EZ6A 3TJAA 4LF4F 3ZZPA 2AGPA 4E98A 2W8LA 1N5YA 4PAAA 4DV4F 1WEXA 3KJNB 1OPZA 1ELYA 5ETKA 2V8HA 3VCDA 3DM2B 4ATNA 1QAXA 3UQSA 3BBFA 3VGVA 2GZOA 3FBBA 4G3IA 1MN7A 1R0AA 2FPHX 4HI2A 2GQQA 2ZHBA 4G6VB 5K8PA 3BREA 3H0PA 3MEGA 5KT5A 4QWCA 2ZH2A 2DJWA 3DHXA 1WACA 2HS3A 2VG7A 1NSPA 3PEHA 4ZMMA 4R8UB 1B7FA 1U4BA 5HI7A 4URQU 3TJ8A 4KM4A 2OPSB 3TAPA 3P5TL 3JQJA 5B0AA 2RVJA 1TMMA 1TV6A 3P3DA 2F9DA 2B56A 2LXFA 2HFUA 3DDIA 1PYOB 2CAJA 3M1VB 1WOSA 2B43A 4QPXA 2W4CA 2UUBJ 1SC6A 2HGNA 3FBFA 4X64F 1Q53A 2F4VF 2C3YA 1K9MT 1SC4B 3F44A 1RHJB 3BQ2A 1R7IA 4DF4A 1V3SA 7FDRA 1BQXA 5KAKA 3N4WA 4MK8A 3UR3C 3LUYA 4OX7A 1MU2A 2DTJA 1UJ6A 5I42A 4LF6F 4NZ7A 1S1VB 4QR2A 1UL3A 3SXLA 2FQQB 2BV3A 1SJ4P 2RQMA 1CC8A 5DDQC 2IA6A 2X1GA 4DL7A 4U96A 1Y9OA 4KJDA 3FZBA 3V81A 4DV6F 2VONA 2HHWA 1FFGB 4ZG6A 2AJ1A 2XZDB 3QMQA 1N5VA 5F8MA 3R7SB 3LP1A 4MKYA 2W9BB 2W8SA 4L76A 1ZZFA 5J1EA 1ACMB 2KFZA 1R0CB 1KD1T 4BLGA 2GQCA 3LO3A 1YJVA 5E3AA 3BDGB 2QL9B 1S0NA 5KG2A 4DSLA 3OSPA 1NJIT 1XNQF 4QIEA 4DV0J 2W9AA 1EARA 2ZZNA 1FO1A 1SPBP 2HRUA 2ROGA 4OFZA 5J2PB 3ETMA 5D6GA 3CMQA 3BR8A 2E9RX 2V2KA 2CPEA 2DH8A 3IDDA 3OR2A 1KDNA 3NGDA 3BPDA 1FEHA 2MSTA 1K8AT 3CDBA 3THTA 3D0IE 2HK3A 3KG1A 4AYBD 4CNZA 3CC2S 2DHXA 4LRDA 3J7YI 1FD2A 3OD2A 2POKA 3PW7A 3N5FA 5A6PA 5DQGA 2AGOA 4LQYA 3HP6A 1URNA 5DQIA 4ED3A 1SIZA 1U1MA 2MY8A 3EUNA 3DRSB 2HHXA 2QSWA 2UV8A 4ED8A 4GC7A 4OZ3A 2ZC4A 5K8NA 2WK4A 3EDRB 1U6ZA 2CPYA 1S6OA 5HLFA 2LU2A 4I69A 1Q8BA 3WAYA 4USVA 2DHAA 2OLWA 1DARA 4KGXB 4YB6A 2LXIA 3H42A 1GQEA 4USUA 4XAKA 3Q89A 1HBMA 3C2PA 4ZVTB 3ZZOA 4NX9A 1T9VA 2BVZA 3OL6A 5D4NA 3TZYA 2RD5C 3ZC4A 2WONB 3H5XA 4DF8A 1QSYA 3KK2A 2KXHA 4A4JA 3CJKB 1KWMA 2C2KB 4X4UA 1ZTWA 3V6KA 4NA1A 1S1XB 1J5OA 1UP1A 2OKQA 4A8KA 3KDOA 3G8TA 4N76A 4EBEA 3KD8A 4HKQA 2PMHA 1CJKA 2G2OA 4C11B 3Q2TC 4MT1A 3WAWA 1EETA 2DNPA 3KLFA 3DLJA 4GTYA 2GLQA 4KHPJ 3OTBA 4UY85 1E3CP 2G2ZA 3ITHB 5T14A 2MKKA 3G6VA 1HR0J 4C98A 2KT2A 1CULA 4O4GA 4I2PA 5HL7Q 1QLNA 1URBA 5D4LA 1GNKA 3ET6B 3RBXA 1MW7A 3MM5B 4B3SF 4DV1J 4ZJLA 4FKYA 4P9SA 4C7QA 2IA0A 1NDPA 1RCOB 4LQ3A 3H40A 2KZZA 2QIFA 2LMIA 2VPXB 2GIFA 3PCOB 1KH9A 3KLEB 3VAHA 1VR6A 4WWSA 1RT3A 4DBQA 4C2MA 5BR8J 5L9XA 4CTAA 3BH7B 4NLDA 2Q43A 4OX9F 3ELHA 3BGOP 2OPPB 2YX4A 1HMVB 4OHWA 3BKFA 3UCZP 5F9NA 1NJZA 2P9GA 3NCQA 3RZAA 2OIHA 3W2VA 3PJ9A 5F9LA 4KV8A 3H25A 3KLHB 2PEHA 3OUYA 3UDVA 1RABB 3ZO7A 2W2QP 5GRRA 1JLBA 2KVQE 1KQGB 1N5YB 1GAOA 2X1AA 2W7PA 2FLOA 1NK0A 4OYAA 2FVQA 1UWAA 2VJVA 3TI0A 2ALZA 4FBUA 2CNNB 2XULA 4DI6A 2EW9A 5B7WA 1R0AB 3HHLB 5KFIA 2XZWA 1UETA 5HMXA 2DHHA 3RBDA 5HANA 5E41A 1F3VA 3MI7X 3GQCA 1HNWF 3MEGB 1Z2LA 4C8KA 3M7VA 2ROPA 3HVAA 3UVJB 5HJYA 1WKKA 2LP4A 4ID8A 2R8GA 3GJSB 3U02A 1KS2A 1MWQA 1H2TZ 3ONQA 3SYZA 4ZG9A 4FYYB 2AZ1A 2DISA 2AEFA 2HQCA 1RHMB 1RGVA 3OJUA 1I6JA 1TV6B 4DSIA 3NKQA 4ECYA 1IXKA 4BWMA 3O44A 2E1MC 2DIVA 5HMZA 1G7CB 5KFZA 3QIPB 2QN6B 5AJ3J 4NMLA 2E9ZA 4PG4A 1RAJA 3IR5B 1AA1B 1CJUB 2IBKA 3WX4A 2AJ0A 1FJGF 2W5QA 4IO1A 5KT7A 1HWIA 2HAIA 4FBTA 2NXNA 1MU2B 2QGFB 2HNDA 1QUVA 2CDQA 5LM7E 4NCBA 4JI5J 2BJEA 4MIWA 4ZLNA 4LF8F 2M0GB 4F26A 4ECSA 2LA6A 5IT4A 3CF5Q 2R42A 3OL8A 3H5SA 2DGTA 5D4PA 3TUPA 1RWMB 1IQZA 1VQYA 3VAKA 4USMA 2XCAA 1C4AA 4DDFA 3JB9k 2CA9A 2PFFB 2AJFE 3LP1B 1YRXA 2CPHA 1ZAWA 1HQ2A 1Y5LB 2RQKA 1S6PA 5J1EB 3U1LA 1S10A 3K7RA 4ZPAA 4DL2A 2YQ3A 1N5SA 3NCRA 1RLCL 3KXDA 1T05A 3CDUA 1RAIB 1UAWA 5H9FK 4FXWA 4CLTA 3M8SA 4DSKA 2BX6A 2ZITA 3HX9A 3CC7S 2QRRA 1SKSA 3G87A 2CJYB 2UXBJ 2EEYA 3NGSA 4JI1F 4A8FA 5I3QA 3HT3A 4K4UA 1FT8A 3CMES 3UD3P 3OR2B 1LXNA 2XLKA 2K1RA 5C24B 1AZSB 4OI6A 1TKDA 3JYTA 2V4RA 1Y3KA 1H3DA 4TY8A 3J81Y 4ALZA 3IXQA 4LF4J 2UXDF 3L9ZA 1I3OB 4KQZA 2CJXB 3AOCA 2GMJA 4DV4J 3EZ5A 2WSCC 1NK6A 4U6PA 2RILA 5L1LA 1X4DA 4KYZA 3NS7B 3HK2A 4YR0A 5F0UA 2ZEJA 4IO9Q 3ED4A 1CBKA 4EFAC 1AJBA 6FD1A 2H1YA 3FEXB 4BBYA 2PI4A 3DYCA 2JL9A 5E3QA 2V4JB 3R5CA 1WDTA 3ILLA 1O5JA 4DFMA 4IG0B 3I32A 2RQCA 4X4VA 2BJ3A 5T41A 5CD4A 1C0TA 5A8RB 5IS2A 2KG0A 2QLBB 1O6XA 1HBMB 1E6YB 5K5MA 4OMFG 3ZTPA 2J6UA 4P2SA 3ZFVA 2D1CA 2FIUA 3PO4A 4X4OA 5HO4A 3F73A 1Q7LB 5B0EA 2C3UA 1SH3A 3BBCA 5KTQA 1F2GA 5FLXY 4LF2A 4W4MA 4UQTA 4K5SA 5A8KA 2NXEA 4X64J 2F4VJ 4OI1A 3MPVA 4RX6A 5D4OA 1E1ZP 5LSLA 5GADU 3DLKA 4DR6F 5G4DA 4B9MA 1CJKB 4I64A 2XWXA 3LP0B 1U1KA 4WKYA 4LF6J 1HI0P 1TKXA 4Y3CA 1U0HA 3BYRA 2FJXA 1X5SA 3SQGA 4ZCLA 2HZAA 2E5IA 2V69A 3HHEA 1CULB 1TL5A 4O4GB 4DV6J 2Z4PA 3LAMA 4Z2XA 4J9OA 5KFBA 2OGUA 1MNEA 2ZVSA 3DDKA 5F8HA 3VR1A 1EW2A 1IKYB 5C7PA 3V6DA 3HHLC 4YUDA 3IGYB 4ZJQA 2BANA 2ZKTA 1O51A 1RT3B 3FK4A 2WSEC 5IC6B 5EWEA 1UWBA 4CTAB 1UTAA 3JAMY 5A8WA 3C6UA 1BUXA 4QW9A 1FDNA 4K5RA 4LT6A 1WG4A 3KOAA 4WTYA 5B0FA 3UE2A 4O3SA 4DHVA 4UY8T 3W2VB 4C4WA 1RAFB 4KV8B 2Z2ZA 4UZBA 2JFKA 4DN9A 3R5JB 4Y00A 3UWTA 4RBVA 3M05A 4NCAA 3D7SB 4OHVA 2R7OA 1JLBB 1JX4A 4JI4J 5RUBA 4JP8A 1BLUA 1L5UA 1PAEX 1XR6A 2JEGA 1YJRA 2MQLA 1FNMA 1LFPA 1EW8A 1RT4A 2NREA 5D3GB 5AJ9A 5JVGQ 3LP2B 4H4KA 5D78A 5KFAA 2AIRB 2LKZA 2VODA 5GOVA 4Y2KA 2DNRA 3FNNA 4C0BA 2ZNYA 1XC9A 1UCNA 1N0VC 2BYCA 1R8PA 3U27A 3MCMA 1SC1B 1X60A 3DMJA 1X4CA 4ZPCA 3QT5A 1U45A 3MMBA 1RCXB 1S1UB 3GP9A 4FS2A 1LWEA 3NP5A 3E01A 1S9GA 2V68A 5DJBA 4CH1A 1YX2A 4O3PA 5SZTA 3PYDA 4DZ6A 5A0YA 1OY8A 5LRMA 1WF2A 1FK9A 2C28A 1XNRF 3W64A 1S1WA 1RTJA 3UDLA 3FSYA 2BE2B 3V4MA 2ALYB 2HHHF 3GFHA 1VQ4S 4Q43A 2DNNA 2MZTA 1ZEFA 5CZVA 4ZVHA 3IA0A 4CLWA 2HNDB 1ZM9A 1K1QA 2DHGA 2MZQA 1H72C 2G4BA 4MFBB 3BB5A 1P6TA 4YY3F 3ZNJ1 3CMAS 3NKRA 1NUEA 2B5JB 2X7IA 2N7CA 1GX5A 2FJBB 1IBKF 3HI9A 3BDPA 4EO6A 2H51B 2B9XA 4B9UA 2XWYA 1T03B 3DOKA 1T9YA 1X4AA 2HNYA 3SZ2A 4PEOA 1CVJA 1VRTB 2RU3A 4YHHF 3RU0A 3J80U 3C16A 4C8NA 3TRGA 4B3SJ 2IMWP 1JJCB 5I3PA 1F0XA 5EHHA 1B70B 1QM9A 2CNKB 1T05B 1T9TA 2LXUA 1VQ7S 1L3UA 2HHQA 3DOLA 2JFDA 4WP3A 2R7QA 3MPYA 2CQHA 3PFOA 3QSYB 2J6TA 2YWFA 1S7IA 2Q1LA 2HZCA 2VFTA 3D66A 5KFMA 4EYHB 1SKUB 1HARA 4C8MA 1Z2ZA 3K57A 2BQ3A 3KG4A 3MM7A 4LSLA 1NZ8A 2XSFA 4DPYA 1U09A 4ECVA 4ZP8A 3O1LA 4MH8A 4NZ0A 5J2QA 2R2TA 1URRA 1F60B 1RYSA 2K1RB 1PC5A 2PEBA 2CQGA 2ROEA 3JYTB 2B9WA 3WBHA 2DXFA 5LXRA 4TY8B 3QT7A 2RH3A 2FD2A 4RNNA 4KJIA 4C48A 3J7YU 3M9MB 3SCLE 4LFBF 2HVHA 5IT9Y 3OSNA 1NDLA 3OPKA 2E44A 2C2OB 3PV8A 1OYDA 2HURA 2QMUB 4M5MA 2YY3A 2DGWA 2IJRA 3PEJA 3GR0A 5JXSA 3T5LA 4ER8A 3MM9A 1RTIB 4ZN3A 3PR4A 1HNWJ 1BQNA 1Q81T 5DM6Q 5KG3A 3RR8A 3VQTA 5LOQA 2MB0B 4IRKA 3D1HA 2IPOB 1KSPA 3R8YA 3G82B 3NGRA 3TUIC 1C0TB 2M7SA 3L7PA 1DTTA 3D6TB 3S01A 3MCNA 3WC2A 3MMCA 2XNQA 2M70A 4I6YA 5K9FA 2X51A 3AHPA 4RNFA 1CS4A 2DIUA 2ZBRA 4JOUA 4HVZA 1X8DA 4EK2A 2W5WA 2O01C 1NSQA 1LWFB 5A8KB 2LDIA 5KT2A 4YB1P 1Q7YT 3VV2B 4CLYA 2WCXA 1TL4A 1FJGJ 2VG6A 3BGFA 3G96A 2MQQA 2CQBA 2H5IB 2KXNB 3IAS9 2SXLA 5EN1A 1WI6A 3BYPA 4K2XA 2DPJA 5KOWA 1VRUA 1TTHB 5KT6A 3MAAA 1TKXB 4M95A 1ALJA 5IOLA 2C3MA 4LF8J 1U6FA 3SQGB 1PJ6A 2BABA 3QAUA 3AJ2A 1RAGB 3Q8YA 3WZ0A 4D3GA 3DGPB 4B17A 5HN0A 2PI5A 4QWAA 1UFLA 5MLCV 2NXJA 2HSEB 1RP5A 3TZZA 2ILZA 2KH9A 4EGLA 4RW4B 2Z57B 3MAQA 2IYIA 1C1BA 1S0OA 4M5DA 2ZH3A 2BANB 2KHDA 2B4OA 2OFGX 1C1CB 2XMVA 5KFSA 4TKTA 4B08A 4DMZA 1H7WA 2A6OA 3MK1A 1UWBB 1EQMA 3C6UB 4RW7A 3T5JA 1R89A 4TU9A 1ZM3A 2PC6A 4QU7A 4I4BA 2D69A 4LF9F 3ISNC 5FIIA 3G6ES 1NHUA 4ZOSA 1S5ZA 4JI1J 2W7AA 1BXNA 1VI7A 4PPZA 8AT1B 5I3UA 4P74A 5B08A 2MHEA 4JI0F 1U48A 3M8PB 1TFWA 3OFGA 5L0BA 4HT5A 1QJHA 3GG1A 1EJJA 2I1RA 4A8OA 1U49A 2XQCA 4EMDA 4L72B 4N5SA 2DXDA 2W5RA 3O5TB 3HF5A 4FF4A 2QT7A 4K8RA 4FKXA 3UNGC 2UXDJ 1SH2A 2V94A 3Q0AA 4DG1B 2W1BA 3WAVA 4G1IA 4MYUA 5C42A 2BXJA 3D3BJ 1DLOA 1FD8A 1D09B 1LEOA 3GYNA 2IM2A 3SV3A 1OSDA 4X4QA 3R6GB 2YH1A 2DGOA 2B9EA 2F4FA 3M6VA 1D9DA 2JC1A 3NAHA 3MMBB 1RWPB 3RUBL 3BZQA 4DN0A 4OHXA 4CM0A 2VFVA 4DLEA 2L9NA 1IBMF 5AXLA 2NXCA 2K06A 1WNEA 5CCMA 3K5LA 4DU7A 4ILMA 1ITPA 4UOGA 4TLRA 3IRWP 2P6SA 4F67A 5A0YB 1M5PC 4JYAJ 1OY9A 1QDUB 2D3UA 2VF3A 3CCTA 1S1WB 1RTJB 2MKJA 3CW2C 3KMSA 3A8JA 1JNRB 1JLCA 2HNZA 3Q8VA 2B4VA 3IS9B 4ZHRA 2MSSA 3LWMA 3TG0A 5DGBA 3G8SA 1V5VA 3V5RA 4DR6J 1OPIA 4QOTA 4O3QA 3D1QA 4EYIB 4ZVSB 3VTIA 3AA8A 4PQUA 2VFSA 4ED0A 2XY7A 3UCGA 2V67A 3DNCA 4N7TA 4ZIWA 1S72S 2WVCA 3BDFA 2HNYB 1U26A 3KYLA 3M8QA 4WFXA 5F3TA 5H9EK 4KHMA 3C16B 2OO4A 4OJHA 2BUNA 1ELOA 1P8GA 3I87A 3IWXA 3PYGA 2IC3A 4J9NA 4NLVA 4MIVA 1YZ6A 1Y11A 4OHZA 3DOLB 4DL5A 2DGQA 1NCLA 1YRTA 1AUSL 2MLXA 1A9NB 4DCJB 1SKWA 2EXUA 1ZZNA 2ZJQQ 5A2QU 2AYEA 3JSYA 2XY5A 3P4UB 3BPSP 3HFKA 1JWWA 3B4DA 2AGQA 1N48A 1G4CA 3QZ8A 3MM7B 3DRRB 1KHLA 2ABYA 1CQMA 2CJBA 2IJFA 1EAYC 3B4MA 3MPUB 1UVJA 2LECA 2E29A 1NHKL 2V2QA 3K0JA 2N4CA 3CNQP 1UW4A 2VHGA 1HNZF 1TMJA 2RSQA 5B0CA 2RIJA 4BS2A 3K5PA 2XMWA 2AYMA 5EUHA 1HKAA 3A8KA 2KYZA 3BSNA 2DNZA 3RGIA 5D0RA 4PG6A 2KJVA 3QT8A 3GJTB 1V3ZA 1B4SA 5D15A 2X1BA 2GIQA 4F02A 4K59A 3ZZTA 5EGYA 3MM9B 4ANEA 1GMWA 5HQMA 3MDFA 1JLGA 1TELA 2LEBA 5H1SV 4KGZB 2OMLA 3GTYX 5KXAA 4KPYA 2Z58B 4NI2B 2YX7A 3SV4A 2JJ4D 3M2RA 2DY9A 4P7TA 1SIWB 4CO2A 1VQMS 2DVIA 3J7A1 4F4WA 4OZLA 4WFNQ 1VJQA 4Y2AA 1DTTB 2K3IA 5DLVA 1VIXA 4X4SA 3MMCB 4V19J 4LSNA 2W2PP 3FFIA 2LQ5A 2I9SA 4OZ1A 3A8IA 3OFFA 3DRPB 5DS7A 1NPRA 4OYPA 2KI2A 1QTNB 3HKZD 4NCGB 1XNRJ 2FC8A 2L41A 1YDLA 4QU6A 5IJSA 4Q0BB 3IGZB 1T3OA 3F0NA 2VG6B 4WP8A 3CTRA 3A12A 1VK8A 1HPZA 2E5HA 3K17A 2ASDA 1EP4A 3CCMS 1R27B 4RL1A 5J2MA 2AX0A 4LRCA 3MAAB 2WBRA 3AD9C 1O99A 2QZUA 2R3VA 4YY3J 3FCVA 3DLBA 3BDHA 1NB7A 5C25B 2J0WA 2C2DA 2MZRA 4U67Q 1ROFA 4AXIA 4DX5A 3E2DA 1IBKJ 4EBCA 3KFWX 1ICEB 1ZEBA 2OEJA 2QFJA 2JZ5A 1CC7A 4IDKA 2RF2B 1S76D 2QYCA 3HFZB 4QIGA 5IV4A 2H5JB 4RUHA 1C1BB 4H4KC 4YHHJ 4M5DB 2MGZB 1YGYA 2E5JA 2FDNA 4FXVA 2ZOMA 2XYPB 4B3RF 3M4XA 5KFJA 5KFUA 4QYZK 4KH1B 5HAOA 4KGKA 5T7LA 1HNXF 1YLXA 1YWXA 5THWA 3CCVS 1S99A 4WIQA 2F63A 2P9CA 2J9DE 3MEEA 4LVNP 2JEJA 1F5AA 3IRXA 2CPXA 3BGRA 1HA1A 2AJQA 2E9TA 2OI2A 4A46A 5I3UB 1FE0A 4UT4A 4K7QA 3EGZA 2GHPA 2Y8YA 4AUKA 1FWLA 3ILJA 4USJC 1CJTB 4WP9A 4XO0A 3Q83A 3CCRS 2WW4A 4RNOA 1S48A 4QW8A 4LFBJ 2ZWOA 2ZHOA 1IKVA 4WTOB 5KFFA 5E33A 1XBWA 2JEFA 2E7VA 4C9DA 4MJKA 2UUCF 1ZBTA 2OP5A 3K5NA 5CD4H 1DLOB 1Y3JA 4RUAA 2OD4A 4WXWA 4DQIA 2P9EA 2MZ1A 2FGOA 2FHJD 1WG5A 4PG8A 1G3OA 2DCUB 2HRTA 1JJ2R 1D9FA 2LEPA 1EW9A 1REGX 1OS5A 4UOFA 2GMLA 3M2UB 1TKTA 1N32F 3B82A 2QX0A 4OIXA 2BEFA 3ENAA 2VG5A 1A0OB 4ELVA 4IH7A 2D41A 1X0FA 2JNJA 1VBZA 1GT8A 3CSKA 2FYXA 1HFEL 2ZM6F 1KH4A 1ZTTA 4NOHA 1JLCB 2HNZB 5LXYA 1CLFA 1JB0C 2RUSA 5F8NA 5CHCB 3K8VA 3BBBA 2J8SA 4ED5A 5DG8A 4IOBA 1RAOA 4PYAA 4GO5X 5CYQA 1VMBA 5DLTA 2JWNA 4M8LA 2XTJP 3GFXA 3H5YA 4L3KA 1S77D 3BR9A 2Y1JA 4E8UA 3D9BA 3IC1A 4IG3B 4KPCA 1VBYA 2HWTA 4WIIA 5KFQA 4HR2A 4P71A 4M5GA 3E51A 5ETPA 1VLYA 1HLWA 1JLQA 3DU6A 4NLOA 2IC3B 2G9YA 2QLJB 5DLFA 1IR1A 4LBIA 2MKIA 1RAAB 1ZETA 3CJSA 1X7VA 1VLOA 1DQ8A 4ECQA 4K0KJ 3H8YA 3DPCA 2NSBA 2EBGA 3H7HB 1IJEB 3KJFB 4V1Ak 5EWGA 1KNZA 1A7GE 1RZMA 4U7CA 1N88A 4C8OA 1BWVA 2IM0A 2AYBA 1HDHA 4LF9J 1AJDA 1E6VA 1TKZB 3C66A 1TR0A 3TNVA 4N8OA 3EM1A 1Q5VA 2Q3PA 3L3CA 1M5SA 4A8XA 2DPIA 1VISA 1FI4A 4JI0J 4K50A 1T02A 3G9CA 4MY4A 2GMHA 4F0HA 1WHVA 2F8MA 5BXIA 4F50A 1WF0A 3H4BA 1QVFR 2EFQA 1PSDA 4NLWA 2X1FA 2HHPA 3KLGA 2F65A 4CH0S 3CDWA 3R2CJ 5M2RA 2Q6BA 5JUMA 1JLGB 2HAFA 1WELA 3C15A 2XO7A 2ZE2A 4OI0A 2DNHA 3M2RB 1M1HA 1J5EF 3T19A 3GCWP 1MLAA 2E5GA 1UPMB 1FRLA 1RK8A 4ZP9A 1HNIA 2FY8A 4DEZA 1R3NA 1BD6A 4C97A 4X4RA 1IBMJ 1R8BA 4LSNB 4RKUC 2NPFA 4UUXA 3AQOA 3R5AA 2WBMA 4C3LA 3FUYA 3HJVA 4JBCA 1LXJA 1QY7A 1Y7PA 2BKOA 2QA1A 2EK6A 5DO2A 2BQRA 1X4EA 1WSVA 3GSIA 4WFBQ 1DAXA 2WOMB 1FKPA 4KH0B 5L39A 5LIAA 2NQPA 1EP4B 5J2MB 3JTNA 4IRCA 1PC4A 2V8PA 1YITS 1FSUA 3MK0A 4USIA 4DXLA 3VF0B 2LLZA 3M8WA 3QJPA 3TUZC 2YVSA 3PXGa 5ETOA 2OPQA 4DV0F 4GRSA 4GVLA 4OI2A 2FLLA 3BSCA 4HHJA 1XIQA 1VBXA 2XS5A 4IDKB 3R5BA 4ZVGA 1GTHA 4LSZB 4XDCA 2MQPA 2MY7A 2F1FA 4CDIA 2I5JA 4E2FB 4F4AA 3BKUA 2HKEA 2M4MA 4B9VA 3QO9A 5T7LB 3I0RB 2V0NA 3HZGA 3ZTOA 4QR1A 3VAJA 3MEEB 3W2WA 1IR0A 3TAMA 3KK1A 1VK3A 3IRXB 2KG1A 4HDHA 4M5NA 3SQOP 4M1KA 1GXLA 1HQEB 4NRTA 2HRYA 5KFWA 5KG0A 4MIBA 3EGNA 3M8RA 3G2XA 3MK2A 1VC5A 2KRBA 1SUQA 1J2VA 4GTWA 3CJ3A 1YJNS 3PDNA 1ZYQA 3TJ9A 4QCLA 3SI8A 1HNZJ 4HI1A 2N82B 1D8ZA 5AE3A 3HT0A 2PD1A 1GEHA 1WHYA 3LGMA 2GW8A 1IKVB 3OT9A 4P10A 1WHXA 3ZZZA 1ED9A 1EKSA 1HHSA 2QA4G 3E8OA 4GKKF 5D8HB 1WC0A 4M5HA 3RR7A 2OPSA 2Y0SD 2GO9A 4PABA 4ED7A 2XS7A 1SL0A 4RZRA 4CT8A 2ASJA 2YBVA 2DR7A 3OTEA 4P75A 4ID5A 3T41A 1NO8A 4NLQA 1RUSA 1FRMA 1LQ9A 4ZGAA 4U95A 2DGVA 1YBTA 2VG5B 4ZPTR 3HD2A 2HEKA 3EGWB 4O4RA 1HL6A 4CLZA 1S1VA 4CZCA 3X3UA 3VAFA 2GQ2A 1UA0A 3RG6A 1NKEA 4XTTA 3GIRA 2OFHX 4FNHA 4XPEA 1KHVA 3U1NA 1O8BA 2CQ1A 4KIAA 2VH7A 4DV1F 3RB6A 4L6V3 2NYIA 4NWJA 4Q8EA 5CYQB 2OEKA 4AQYF 4OZ5A 3QGIA 2CQ4A 4OX6A 4DFKA 3QRPA 1WC1A 3M8YA 5F8GA 3MUVP 4USHA 4RBUA 2CPIA 3IBFB 3B54A 2W5VA 1OMSA 3MWBA 4QIFA 3H59A 2MQ8A 2AW0A 4A8YA 3MAHA 1PJ7A 1RTHB 4J90A 3RRKA 4B3RJ 4RWWA 2FVRA 1RA6A 3FGVA 2DHSA 1JJ4A 1FX4A 4DQSA 4OYXA 1URAA 1UEUA 2DRDA 4GTXA 3TARA 4DQPA 3QFHA 4KFBB 1HNXJ 1WC4A 1JXLA 5CH7B 1U6BA 4HH1A 2KFYA 1SL2A 1SI9A 4K4XA 1SQFA 2XO6A 4TU8A 1R8CA 1KQSR 2UXCJ 3FCWA 3AQPA 2LEAA 1AROP 2RDDA 2QMWA 1TUWA 4B02A 2V8VA 2M52A 3GLJA 1Q8IA 3CD7A 5ITHA 3DRSA 1XR7A 4HTJA 1K47A 2IM3A 3CCES 3KLGB 3MMAA 2ZJRQ 2UVUA 2UUCJ 4JV0A 3I31A 1K0TA 1Y00A 2CQ0A 3BO2A 3C15B 4F0MA 2ZE2B 1PYSB 4YDXA 5L8RC 5L9NA 2WONA 3T1AA 2ZH4A 1X31C 3KMQA 2ZH9A 1PKUA 1HNIB 2RNEA 4JUZA 3WQPA 2FHMA 1IQTA 2WVBA 1S1XA 1N32J 2XNRA 1KH7A 1PGZA 3ZZYA 3DI6B 2B6AA 2FHJA 2YQ0A 3HJFA 2Z2LA 4J9UE 1KLMA 3MPWA 1F5CA 1HI1A 1BQMA 2W25A 3OTCA 5CYMA 2NR0A 5K20B 3K59A 2YWHA 5AT1B 1MSWD 2FZKB 2OMOA 2VU5A 2ZM6J 3HCXA 3T02A 3FEZA 4PWDA 4FF2A 4P7VA 2WTFA 2AMCB 3ET6A 3AXKA 1HHTP 1RHKB 3N79A 1RWKB 3L7OA 3WIVA 5LJ5Y 3JTPA 3MMJA 3OXGA 2OPQB 2YWEA 2KTQA 3W62A 1YRUA 1PILA 4EI2A 2CYYA 3D0GE 2VQFF 3B5QA 2DB1A 2R8KA 2R7TA 2CXEA 3SZYA 2OPPA 3A13A 3PW5A 2J0SD 1HMVA 2I5JB 4DV3F 4W92B 1YJ9S 1PYTA 3TW0A 5HMWA 1ELXA 2G1HA 4FPRA 4F0KA 1FA0A 3I4PA 3SCKE 2J9EA 5DZ6A 4UORA 5J2NA 4NA2A 3W2WB 3CJ8A 3NNHA 1BC6A 3TAMB 1ZH5A 3KK1B 4TQSA 3PIPQ 5K14B 4C0HA 1NXIA 3OHAA 3PVXA 1AFJA 3TA1A 2EPIA 4ITSA 1YSJA 5D77A 4CT9A 1B0PA 1S0VA 4DS5A 3QZ7A 1I5OB 2J0XA 2V50A 2EFNA 2V34A 1WC6A 2ERRA 3HHLA 1SUQB 1WF1A 2VA2A 1PO6A 2PA8D 1SC3B 1NH8A 1HBUA 2JHEA 1UVMA 4USWA 2YKMB 1E33P 3FMBA 2WZ1A 3EDQB 1QSLA 4M5JA 4JI7F 3FQLA 1KRPA 2JLGA 3UR0A 4FVMA 1Y0HA 3UVJA 2FZCB 1TAUA 5E3CA 2GAHC 3A3PB 3QAEA 2RDJA 1TL7A 2C2MB 3CJ2A 2RKIB 3TX0A 2HQGA 4DS4A 3KLIA 1LFWA 2MLYA 1TU0B 5DG9A 4HYKA 2F8EX 4RNMA 4DCOB 2NS1B 2OUGA 3P49B 1KBRA 3QLHA 3HPOA 2CG8A 4ID5B 4RNHA 2BM1A 1FERA 4QIVA 3QIPA 3W65A 1J5EJ 4NWXA 1CJUA 2EFOA 5DQHA 1RBAA 3HSGA 2N3LA 2B0GA 3CMRA 4U8YA 4MTPA 1S49A 4B3OA 4ED4A 3T3FA 2FVSA 1HNVB 2AP6A 1KQFB 2MQOA 3R5DA 2MKCA 1F2HA 4ECUA 3SDEA 1ZM2A 2DNKA 5HP1A 3Q23A 3PW4A 4NZ6A 2LQ8A 4NLXA 1UFKA 1RT5B 2BW2A 1XMOF 5F8LA 4Q44A 2IVFB 1GH8A 6FDRA 4RW6B 2FJAB 2XBPA 4CYUA 4ED1A 4LBHA 2I2YA 5SUHA 3LPEA 1CG2A 3T9ZA 1N5TA 4UPIA 1QVGR 1BY9A 1W2IA 4ENOA 2BBEA 2CZ9A 3MFIA 2P5VA 2MMYA 2DY1A 5CZXA 3DKDA 2EFPA 3NNAA 5L38A 2RDIA 1L3KA 1NB2A 1W2BR 3HHDA 2ZDPA 3Q8SB 2HBYB 4NYPA 3IFEA 1KFDA 3KKFA 4DU8A 1VQPS 4LFCF
chains in the Genus database with same CATH topology
3A52A 3NKOA 3T02A 5LRMA 1ANIA 4CXSA 5L0KA 3M8YA 4KAVA 4UOPA 4CYSA 4N7TA 3M7VA 1KH9A 3UN2A 4TN0A 4LRCA 1N2LA 1SHNA 2W8DA 4GTZA 4LR7A 1KH4A 3UN5A 2X98A 3BDFA 4KJGA 1O99A 2QZUA 1N2KA 2GA3A 4CXKA 4UPKA 3UN3A 3BDHA 4FDJA 1ZEFA 1E33P 3MK1A 4YR1A 3NVLA 3T00A 1HDHA 1AJDA 5EGHA 2W5VA 4ZG9A 1AUKA 3ED4A 1AJBA 1ELYA 2IUCB 4CYRA 4B56A 3IDDA 3NKPA 3BDGA 3E2DA 2W5SA 4MIVA 2RH6A 5DLWA 3DYCA 1KH5A 1ANJA 2W5WA 4LRBA 4ZGAA 1B8JA 1E2SP 1EW8A 3NKQA 3NKRA 5C66A 5KXAA 5AJ9A 1ZEBA 2W5TA 3WBHA 3SZZA 1KHNA 4MHXA 4UPHA 1EW2A 5DLTA 1ALKA 5LQQA 1HQAA 1EQJA 1AJAA 3KD8A 3TX0A 4KJDA 4MY4A 4LRDA 2GSUA 3B5QA 4LR8A 1ALIA 3UO0A 5LIAA 4LR9A 5GOVA 3WAXA 3IGYB 4ZG6A 3UNYA 2W5XA 4UPIA 5TJ3A 4KAYA 1AJCA 4UOOA 3NKNA 4QAXA 1KHKA 1URAA 3SZYA 3TWZA 3MK2A 4GTXA 1SHQA 2ZKTA 1O98A 1FSUA 5DLVA 3MK0A 4GTWA 5L0BA 2W5QA 3WAWA 4LQYA 1P49A 2W8SA 2XR9A 4FDIA 5GRRA 1ALJA 3M8WA 1ELXA 1EJJA 1KH7A 5LRNA 3T01A 5HRTA 4GTYA 5INHA 2GLQA 1HJKA 5L0EA 3M8ZA 1E3CP 2ANHA 1KHLA 1EW9A 2GSOA 2IUCA 2W5RA 3TG0A 2GSNA 5EGEA 4KM4A 1EI6A 1Y6VA 3BDGB 4UORA 2XRGA 2G9YA 4NWXA 2VQRA 4LREA 1ALHA 1URBA 1K7HA 5K4PA 1ED8A 1ELZA 1KHJA 3NKMA 3Q3QA 3OT9A 3WAVA 1ZEDA 2D1GA 4ZG7A 5IJSA 4LRAA 3LXQA 1ED9A 5IJQA 3WAYA 3IGZB 4NWJA 3CMRA 4CXUA 1Y7AA 3DPCA 2IFYA 1E1ZP 4UPLA 4LRFA 4LR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A52 A;  3NKO A;  3T02 A;  5LRM A;  1ANI A;  4CXS A;  5L0K A;  3M8Y A;  4KAV A;  4UOP A;  4CYS A;  4N7T A;  3M7V A;  1KH9 A;  3UN2 A;  4TN0 A;  4LRC A;  1N2L A;  1SHN A;  2W8D A;  4GTZ A;  4LR7 A;  1KH4 A;  3UN5 A;  2X98 A;  3BDF A;  4KJG A;  1O99 A;  2QZU A;  1N2K A;  2GA3 A;  4CXK A;  4UPK A;  3UN3 A;  3BDH A;  4FDJ A;  1ZEF A;  1E33 P;  3MK1 A;  4YR1 A;  3NVL A;  3T00 A;  1HDH A;  1AJD A;  5EGH A;  2W5V A;  4ZG9 A;  1AUK A;  3ED4 A;  1AJB A;  1ELY A;  2IUC B;  4CYR A;  4B56 A;  3IDD A;  3NKP A;  3BDG A;  3E2D A;  2W5S A;  4MIV A;  2RH6 A;  5DLW A;  3DYC A;  1KH5 A;  1ANJ A;  2W5W A;  4LRB A;  4ZGA A;  1B8J A;  1E2S P;  1EW8 A;  3NKQ A;  3NKR A;  5C66 A;  5KXA A;  5AJ9 A;  1ZEB A;  2W5T A;  3WBH A;  3SZZ A;  1KHN A;  4MHX A;  4UPH A;  1EW2 A;  5DLT A;  1ALK A;  5LQQ A;  1HQA A;  1EQJ A;  1AJA A;  3KD8 A;  3TX0 A;  4KJD A;  4MY4 A;  4LRD A;  2GSU A;  3B5Q A;  4LR8 A;  1ALI A;  3UO0 A;  5LIA A;  4LR9 A;  5GOV A;  3WAX A;  3IGY B;  4ZG6 A;  3UNY A;  2W5X A;  4UPI A;  5TJ3 A;  4KAY A;  1AJC A;  4UOO A;  3NKN A;  4QAX A;  1KHK A;  1URA A;  3SZY A;  3TWZ A;  3MK2 A;  4GTX A;  1SHQ A;  2ZKT A;  1O98 A;  1FSU A;  5DLV A;  3MK0 A;  4GTW A;  5L0B A;  2W5Q A;  3WAW A;  4LQY A;  1P49 A;  2W8S A;  2XR9 A;  4FDI A;  5GRR A;  1ALJ A;  3M8W A;  1ELX A;  1EJJ A;  1KH7 A;  5LRN A;  3T01 A;  5HRT A;  4GTY A;  5INH A;  2GLQ A;  1HJK A;  5L0E A;  3M8Z A;  1E3C P;  2ANH A;  1KHL A;  1EW9 A;  2GSO A;  2IUC A;  2W5R A;  3TG0 A;  2GSN A;  5EGE A;  4KM4 A;  1EI6 A;  1Y6V A;  3BDG B;  4UOR A;  2XRG A;  2G9Y A;  4NWX A;  2VQR A;  4LRE A;  1ALH A;  1URB A;  1K7H A;  5K4P A;  1ED8 A;  1ELZ A;  1KHJ A;  3NKM A;  3Q3Q A;  3OT9 A;  3WAV A;  1ZED A;  2D1G A;  4ZG7 A;  5IJS A;  4LRA A;  3LXQ A;  1ED9 A;  5IJQ A;  3WAY A;  3IGZ B;  4NWJ A;  3CMR A;  4CXU A;  1Y7A A;  3DPC A;  2IFY A;  1E1Z P;  4UPL A;  4LRF A;  4LR2 A; 
#chains in the Genus database with same CATH topology
 2EC2 A;  2ASL A;  3NMR A;  1RAE B;  5HQ8 A;  1NJY A;  5C24 A;  5HQL A;  2ZNZ A;  1AZS A;  2G9O A;  3FBC A;  2R7R A;  3UN2 A;  4JI4 F;  4BC7 A;  4DUY F;  2GVZ A;  3AXM A;  3NGU A;  1Q86 T;  3PG9 A;  3F41 A;  2UV8 G;  1KLN A;  4IOA Q;  4NLU A;  4JV1 A;  1D8Y A;  4J9R A;  4WZM A;  3R6L B;  4YB5 A;  4J9S A;  5C66 A;  2ACY A;  2HW3 A;  1HWL A;  1RKI A;  3SZZ A;  2R8H A;  4C8Z A;  4DLG A;  2J6S A;  3FCH A;  2HBZ B;  2V4J A;  2P6T A;  2CNL B;  3NAI A;  1JLF A;  1RAC B;  2HK2 A;  3OLB A;  5KFX A;  4CIO A;  5HVG A;  4TNO A;  4JI3 J;  1RIS A;  2JVO A;  4DQR A;  1YI2 S;  4IG0 A;  2R2S A;  2IUC A;  3MMA B;  2C2Z B;  1TUG B;  2XLI A;  5A8R A;  4GKK J;  2FJV A;  3D5M A;  2ZH7 A;  4OJG A;  1E6Y A;  3FVY A;  4KGM A;  1ALH A;  4DR2 F;  2HFZ A;  2QLF B;  4DR4 F;  4LRA A;  1ULR A;  4ZLJ A;  3HZE A;  5C2G A;  2B4U A;  3R7B B;  2ZD1 A;  1FFS B;  2XGQ A;  3BO4 A;  5KFC A;  3W9J A;  2F9J A;  2B6A B;  2AF6 A;  1H2U X;  1G1X A;  3GG0 A;  1KLM B;  2JLF A;  5ETQ A;  3JSR A;  1BQM B;  4K4V A;  1T3N A;  3LP0 A;  5CYM B;  2AYG A;  2B51 A;  3PRV A;  9RUB A;  1TL3 A;  2BE7 D;  3UPF A;  2C3P A;  1B0V A;  2HPU A;  4ETX A;  1PBA A;  1EQ0 A;  3I96 A;  1YJT A;  3PR5 B;  4PWD B;  1RTZ A;  5KOX A;  3DGV A;  4NXN F;  1KTQ A;  2GV1 A;  1HD0 A;  1SJ3 P;  4ZLL A;  4MYT A;  1S6Q B;  3TAQ A;  4D3H A;  1IKY A;  3KNA A;  4CO5 A;  2MJU A;  4AQY J;  4O0N A;  2RU9 A;  4Y0F A;  4BHQ A;  2Z30 B;  1EB0 A;  3OR1 A;  1XQI A;  3IBC B;  2EVZ A;  4A8Q A;  5K8M A;  4X65 F;  1VBK A;  5L0K A;  4FYW B;  1YZ7 A;  2PE8 A;  2KVI A;  2BOA A;  4I7F A;  3NS5 A;  3OVB A;  1VOM A;  4IH6 A;  3K58 A;  2WRM A;  1KFS A;  5KG7 A;  5J2N B;  1SB6 A;  3QT6 A;  5IXU A;  2RHS B;  1HBO A;  3EX7 B;  2V4Q A;  3HKW A;  4Y2M A;  3ZTS A;  1SXL A;  4JI6 F;  5TJ3 A;  4ZCI A;  5F8I A;  3HVR A;  5D3G A;  1WHW A;  2WVF A;  3LP2 A;  3NRB A;  1S97 A;  1HBU B;  1NK9 A;  3GPA A;  2DR8 A;  3CUL A;  2GSO A;  4DR5 J;  2VC0 A;  1NSK L;  1RDR A;  2QEX S;  2PO4 A;  4E0D A;  4YS2 A;  2Z56 B;  3JTO A;  2R9L A;  1TL7 B;  2M5Y A;  1N34 F;  3FMW A;  3PFE A;  2RS8 A;  3I56 S;  1S1U A;  2CWK A;  3KLI B;  3BF4 A;  4P72 A;  1NJW A;  2P8I A;  1SHN A;  4X66 F;  4GMK A;  3QLH B;  2PMZ D;  1H98 A;  4J9K A;  5LJ3 Y;  3T9N A;  3D67 A;  3I55 S;  2MPU A;  1Q0N A;  2IFX A;  2UP1 A;  2BE2 A;  1JIH A;  1WEZ A;  3DN9 A;  3ICL A;  3RTV A;  3H5U A;  2WB1 D;  3JSB A;  3O8W A;  2E66 A;  3S1T A;  3W7B A;  2ZH8 A;  4B3O B;  4YME A;  1U8S A;  3AOA A;  4OLO A;  2ADC A;  4MFB A;  5HAT A;  3SBM A;  1FRX A;  1KHK A;  3TVZ A;  3SDE B;  2B5J A;  2FZG B;  4ZN1 A;  1FKO A;  5HP1 B;  1Q79 A;  4ZVQ B;  2CQ3 A;  3BQ0 A;  1PCA A;  1MRO B;  4LF7 F;  3NEK A;  4PXD A;  2HFO A;  3KTQ A;  2IYG A;  2VOP A;  1RYR A;  1VQK S;  2RUG A;  4KTQ A;  3NXZ A;  1T03 A;  3TVY A;  1KQK A;  1VRT A;  2IDL A;  1Y10 A;  4CYU B;  4EEY A;  1PBU A;  1ANI A;  3GWC A;  3PYE A;  2GHV C;  5HBM B;  3HXM A;  3TA0 A;  3C19 A;  5KFN A;  2ZOF A;  1FRH A;  2RRA A;  2KXF A;  2GCF A;  1UVK A;  2M8H A;  3MR2 A;  4G1P A;  3FSI A;  4XIU A;  3Q22 A;  4GO7 X;  2VQF J;  3PW2 A;  1IVZ A;  1DJ0 A;  2NUU G;  1CJV A;  2IRY A;  1GXT A;  1NPK A;  2AU0 A;  4JI8 F;  3CE8 A;  4J9M A;  3N5B A;  2IBO A;  2DNL A;  4DV3 J;  2PFD A;  4ICL B;  1UKU A;  2QL7 B;  3I5A A;  4FZV A;  1S1T B;  3TWZ A;  5JVH Q;  5CAA A;  4X62 J;  2F40 A;  2DH7 A;  2GVZ B;  3L95 X;  3SSS A;  5IT0 A;  1DBD A;  1C4C A;  1G2E A;  1RU2 A;  2H48 B;  2K2P A;  2E1C A;  3HVT A;  4P52 A;  1SVD A;  1X5P A;  4UZC A;  3GII A;  3R2D J;  1LW0 A;  4UPL A;  3PKM A;  3KHL A;  1RTI A;  3DLE A;  5BJR A;  4NE9 C;  2OAU A;  4JI7 J;  3VAL A;  1JLF B;  3MF5 A;  2W8D A;  2AEJ A;  3OL7 A;  2GA3 A;  3SFG A;  3W1Y C;  2MHN A;  1YTY A;  3G82 A;  4J9V A;  4X84 A;  2CRL A;  3OL9 A;  2IUC B;  5E3P A;  1R0B G;  3HM9 A;  4EUV A;  5K8O A;  2CPD A;  3AY0 A;  1HIY A;  4ZKA A;  4JYA F;  4KBI A;  1Q78 A;  4H4O B;  2HQ3 A;  3DFE A;  2H3E B;  1TK8 A;  4LFA F;  2RRN A;  2XHC A;  2ZD1 B;  1LWF A;  1RT6 B;  2BQU A;  2EWH A;  2CIM A;  1MML A;  3D6F B;  1NH7 A;  3MCO A;  3FQK A;  2V5H G;  3PRD A;  3Q8P B;  4CLL A;  5ADZ A;  1U25 A;  2HHU A;  3ZZR A;  2CFX A;  4JI2 F;  4RPF A;  1MMD A;  1SKR A;  4F3M A;  1IUJ A;  2VQR A;  5FJ4 A;  4LRE A;  1TL3 B;  3Q3Q A;  2I8E A;  2QYG A;  3AT1 B;  4DPT A;  1LWC B;  2MQN A;  3C3L A;  2M9K A;  3TZX A;  4NLR A;  5KFP A;  1NRK A;  1S59 A;  2VKZ G;  1RWO B;  4M5I A;  4FPI A;  3DGP A;  2YKP A;  1OSC A;  1XMO J;  2CZV C;  2BMB A;  1T94 A;  4RW4 A;  2AD9 A;  1RU1 A;  2CZ4 A;  1TP7 A;  2KL8 A;  1SL1 A;  3GCX P;  4Q5V A;  1C1C A;  2HIQ A;  5G0R A;  4GC6 A;  4ZVE A;  2OSQ A;  3OR1 B;  1S0M A;  2H4W B;  1DY3 A;  3A3O B;  1NHV A;  4RW9 A;  2HIY A;  2WVE A;  4UW2 A;  2ZBC A;  2P2C B;  2DK2 A;  3B8H A;  2KDO A;  2QLX A;  4I7F B;  1R8H A;  1N8R T;  4DL6 A;  1X9S A;  3TYT A;  3PKY A;  2FJW A;  4LFC J;  5GAG I;  1Q4R A;  3M8P A;  4I1T A;  4P6Q A;  2DEJ A;  3KWM A;  1HBO B;  4LIR A;  4F4Y A;  3ILI A;  1H6K X;  5KFH A;  3HHK A;  4PR6 A;  4DUY J;  1VJW A;  4JV5 F;  4CYS A;  2CJA A;  4DPW A;  2FVP A;  3D3C J;  2R7V A;  4DG1 A;  4AD6 A;  2NYH A;  5LMN F;  2MKH A;  2BRK A;  4QZV B;  1H74 A;  1EIY B;  2XY6 A;  1VGY A;  1XR5 A;  2OTJ S;  4W98 A;  5M2P A;  4DV5 F;  2NZC A;  1DFD A;  3DLG A;  2IAJ B;  4LBP A;  3IM8 A;  3SIP B;  3P8B B;  4OZ2 A;  3W5Y A;  2A1B A;  4C8L A;  1XMQ F;  4ES2 A;  1P49 A;  1KOO A;  3K2Y A;  3BQ1 A;  2BE9 B;  3W3S A;  1LNQ A;  4FN5 A;  3OTO F;  4DR2 J;  1RHU B;  3IWN C;  4DR4 J;  1S9E A;  3D4J A;  5FD1 A;  2G0I A;  2ZZM A;  5BYR A;  1YBA A;  2KB2 A;  2VAS A;  3IS9 A;  4KAI A;  5IWA F;  2QC3 A;  2KRR A;  2KT5 A;  3W61 A;  4ELT A;  4DR1 F;  3OHB A;  4TVA B;  5B0D A;  1R43 A;  3QAT A;  1FKO B;  1N2K A;  2E1A A;  4JV2 A;  3ZZ0 A;  2YTC A;  4PXB A;  2OD6 A;  5L1J A;  1IR2 A;  1F9H A;  3CD0 A;  1U47 A;  3FBE A;  4WYW A;  1X0P A;  1WTF A;  4I68 A;  2RH6 A;  1ANJ A;  4M5K A;  1OO0 B;  2MDA A;  3W9H A;  4J9Q A;  4NXN J;  3EVW A;  3TQE A;  4IRD A;  4AE5 A;  3IBW A;  4OYO A;  4AL7 A;  4WE1 A;  4P2X A;  1PIE A;  4GVB B;  5GAE I;  4RUB A;  3VVU A;  3O3L A;  4RLE A;  1IBL F;  1Q1K A;  3FZ2 A;  2G1D A;  1HWK A;  4ZDN A;  2JC0 A;  3H4D A;  2MXY A;  2XSJ A;  2K7J A;  2VC1 A;  1M90 T;  1U0S A;  1CJV B;  4X65 J;  5ETT A;  2F7V A;  1T9U A;  3CCJ S;  2YNF B;  3NBP B;  1C0U B;  1QTM A;  4ZG7 A;  3CJQ A;  3HLU A;  4CLP A;  3DRR A;  1NLK L;  3FJ2 A;  1TZ0 A;  3TEH B;  4B9N A;  4F8R A;  4LIW A;  2LA4 A;  4KGV B;  2K8G A;  3O6Q A;  2CPJ A;  2DCL A;  4UPK A;  2O5D A;  1RE1 B;  1D0E A;  4HL9 A;  3ZZU A;  2W9C A;  4FDF A;  4I2Q A;  3J7Z 5;  1QD1 A;  4DV2 F;  1KH5 A;  3HVT B;  4WPA A;  3KDN A;  4KSE B;  1TQL A;  1YJW S;  4JI6 J;  4ZIT A;  2R2R A;  2Y1L B;  4O44 A;  3UW1 A;  1LW0 B;  4KO0 A;  1HQA A;  4HDG A;  3OJS A;  3DLE B;  2C22 A;  3CO0 P;  5CAB A;  5HMY A;  4NI2 A;  4JB8 B;  2OHD A;  3ENV A;  5L46 A;  3CB4 A;  2HS0 A;  1N34 J;  2XRG A;  2D3O R;  4J37 A;  3AFG A;  3BO3 A;  2MYF A;  3G4S S;  1ELZ A;  4O3O A;  2XC9 A;  4ZCK A;  4PYD A;  1PG5 B;  1LW2 A;  1GXU A;  4X66 J;  1NSA A;  3DRP A;  2ZJP Q;  4IFY A;  1HI8 A;  1XTZ A;  3CPW R;  1MWY A;  1WC5 A;  2UVR A;  4NCG A;  3I0S A;  4CCH A;  2VBY A;  1YG0 A;  4Q0B A;  4TYA A;  3T00 A;  3TP2 A;  2KYX A;  2FY1 A;  2NPI A;  1EJ7 L;  3MM8 B;  3R7N B;  3LWL A;  5AXM A;  5H9F J;  3TX8 A;  3J81 U;  3QGP A;  3RYL A;  1B64 A;  1U7L A;  4HTI A;  2XB2 D;  5C25 A;  4Q45 A;  4RO0 A;  2YWK A;  4C3K A;  4LR9 A;  2W24 A;  4XPC A;  1ZS6 A;  1ZOT A;  3CCZ A;  2VL1 A;  4LF7 J;  2RT3 A;  3D68 A;  2RRB A;  5M2U A;  5HRT A;  2LYV A;  2RF2 A;  3LTO A;  4NPO A;  3NNC A;  3KUE A;  4TXS A;  2VQE F;  2MGZ A;  2U2F A;  2HBQ B;  2YNI A;  4K0K F;  5G0R B;  1GX6 A;  1K7H A;  3VAG A;  4W90 B;  2DR5 A;  1ZED A;  5GME A;  1GTE A;  2HVI A;  2VA3 A;  1M5K C;  4RW9 B;  3GB0 A;  4ZVP B;  3C14 B;  2CQC A;  3W5Z A;  3EGV A;  2XMJ A;  5FLX U;  2EI5 A;  4JI8 J;  2Z8Q A;  1WG1 A;  3IR7 B;  4YB7 A;  4CYR A;  2XI3 A;  4NLS A;  1HQU A;  3TZW A;  1QAI A;  2R4F A;  2XI2 A;  3TVK A;  3CO9 A;  3PJW A;  4NAS A;  4WFA Q;  2LQJ A;  1NPP A;  1WI8 A;  4IYQ A;  3CED A;  3DYA B;  1CJT A;  4R25 A;  1WOR A;  2AV5 A;  2R8J A;  2W01 A;  2FLP A;  2XMT A;  1TUV A;  1V9O A;  2BRL A;  2DD8 S;  3R27 A;  3DHW C;  1RBL A;  3SSQ A;  3MUT P;  1M5V C;  3G6Y A;  3W9I A;  4ECT A;  3OBI A;  2L3M A;  3TAN A;  1RT2 A;  1SH0 A;  2BJ7 A;  3POT B;  2JEI A;  4PPD A;  4HHH A;  4DX7 A;  4OHY A;  3IG1 B;  3DLG B;  4WZQ A;  5B0G A;  4WBF A;  2DNQ A;  1NK4 A;  3L4B C;  2UU9 F;  1VC0 A;  1WJ9 A;  1YK9 A;  3M2U A;  5DG7 A;  3OVA A;  2E1R A;  3JAM U;  1N36 F;  2IRU A;  4Q7A A;  4CXK A;  4K4Y A;  3UN3 A;  1DTQ B;  5JJB A;  2YKA A;  2X3G A;  1S9E B;  2LCW A;  2GAG C;  3NKP A;  5A76 A;  4F7V A;  1JLE B;  3QJJ A;  1JMT A;  3SMZ A;  1OIA A;  1U2C A;  1C2P A;  4LFA J;  1W25 A;  1L3T A;  3W60 A;  2D3O 1;  1GMV A;  1FJE B;  1F9F A;  2R7W A;  4Y2C A;  3OVS A;  3RW6 A;  1PAU B;  2C2N A;  2E7X A;  3RW7 A;  2HVZ A;  5IV3 A;  4B9T A;  1U24 A;  3NLC A;  2M3D A;  3MR5 A;  1UEV A;  3KJQ B;  2GJF A;  1FKA F;  4JI2 J;  1CQN A;  3VGS A;  3GR1 A;  2J7U A;  3T6B A;  2B8P A;  1U02 A;  3IP0 A;  1Q82 T;  5KFL A;  3JXO A;  3WX8 A;  2V2Z A;  4WK1 A;  3P45 B;  2HLU A;  3JQM A;  2GC8 A;  4L73 A;  3PYF A;  4KE5 A;  3BM7 A;  3CD6 S;  5EGE A;  1X4H A;  4QPT A;  1XMB A;  4CH7 A;  4IG3 A;  3T5H A;  2GJI A;  2MJN A;  4KRW A;  1FXR A;  4DOZ A;  3ADA C;  4U7U D;  1NKB A;  2IFY A;  3MD3 A;  4WE1 B;  4G1Q A;  4DR7 F;  4ELU A;  1SBR A;  4KAV A;  3OV7 A;  1U1N A;  3RB3 A;  2ZZT A;  3VHQ A;  3MUM P;  3CGI A;  4LR7 A;  1N0U A;  2HVD A;  4DR3 F;  2XSJ B;  2ZBQ A;  1KVJ A;  4B3M F;  3FC9 A;  3QQC D;  3QRR A;  3J80 Y;  2VG7 B;  4KB7 A;  2B3T B;  3QJL A;  2IDE A;  4TU7 A;  2KJW A;  3NY0 A;  3WIU A;  4ZVF A;  3VAI A;  1TKZ A;  5CXT A;  3K5O A;  4O3R A;  4ZPB A;  1U2R A;  4CO4 A;  1JLA A;  4PUO A;  1F5B A;  4ES1 A;  1NAQ A;  4DUZ F;  1F6T A;  3SCJ E;  1RT1 A;  2CVI A;  4MKA A;  4IR9 A;  1Z4U A;  4BCA A;  1LOU A;  3Q2S C;  5KFR A;  3TQ1 A;  2W9C B;  4GKJ J;  2R2U A;  4I2Q B;  4FYV B;  3DLH A;  3AAW B;  2ZOG A;  2E7W A;  3EVO A;  4JV5 J;  1ED8 A;  2OPR A;  2RHQ B;  1BE4 A;  1K73 T;  2XMA A;  4O44 B;  4KO0 B;  4C3M A;  4LRF A;  2G0J A;  2QA4 S;  5I42 B;  5LMN J;  4CP5 A;  1U8W A;  2DGS A;  4YFU A;  1DUR A;  4DUT A;  2VKR A;  3ETO A;  1RWU A;  4CLS A;  2KO1 A;  3I9V 9;  3J7A N;  2IY5 B;  4DV5 J;  3GIK A;  3PX0 A;  2HQD A;  3V81 B;  2Z0G A;  4B56 A;  2I6W A;  2ZH1 A;  5LL6 d;  2ZUG A;  1E2S P;  4QYR A;  2O67 A;  1RBO B;  3NG8 A;  4QR0 A;  2UUA F;  2YKN A;  3SFU A;  1XMQ J;  1VRQ C;  1LW2 B;  3R9L A;  2H4Y B;  2DNG A;  5HSP A;  2HVE A;  3J7Z T;  4IFY B;  1WUU A;  3FRY A;  2ILY A;  3CCQ S;  3OTO J;  2NZ4 A;  4QIW D;  3CXC R;  3CJ5 A;  3VZI A;  4QAX A;  1T9X A;  3TO8 A;  3T1H F;  3CCL S;  3D54 A;  1B0T A;  2Y3Y A;  3CDA A;  1ZPV A;  3I0S B;  3AOD A;  3RBE A;  3DC2 A;  2PN6 A;  2FC9 A;  2WOM A;  3T5K A;  3TEG A;  3EZO A;  2UVV A;  2FGC A;  4ECX A;  4NRU A;  2JLE A;  1N4L A;  4WXO A;  5E2Q A;  5IWA J;  2A18 A;  5IQ6 A;  2ZH6 A;  2ZKU A;  4KKO A;  2D1G A;  5IT9 U;  4AL6 A;  5DET A;  4DR1 J;  1OY6 A;  4TQR A;  3ZXW A;  3HD1 A;  1X5T A;  2XCP A;  2Q6C A;  4HHU A;  3W5X A;  3W8P A;  3E3X A;  1H73 A;  4FXD A;  2BKN A;  5MAO A;  2R7U A;  1FJC A;  1DQA A;  1ZM4 A;  4ZK7 M;  2YNI B;  2KN4 A;  1SJQ A;  5LSO A;  4OQJ A;  4DCP B;  4ZVU B;  1IBL J;  1V3R A;  4X4T A;  3UO0 A;  3I0R A;  3M6U A;  1EZZ B;  5EX3 A;  4BWJ A;  2VBX A;  3NMA A;  2G13 A;  5HLF B;  4WKR A;  2XG8 A;  1IN0 A;  2UXC F;  1HQE A;  4YP3 A;  1Y6V A;  1HQU B;  4L74 A;  5GAG U;  3WDO A;  1Q5Y A;  3I5C A;  1JKH A;  2QFI A;  4F2S A;  3ISZ A;  2FLN A;  3S7R A;  1VIO A;  3WC0 A;  4MKB A;  1FRJ A;  1NDK A;  1LWX A;  2C1E B;  2YXL A;  3H20 A;  1GFW B;  1HBN A;  2C3O A;  4CNY A;  2BDP A;  1EKR A;  3KK2 B;  3CUN A;  3J81 j;  4ILR A;  1FDA A;  4DV2 J;  1TL1 A;  3BGL A;  1J5O B;  1S79 A;  2VOO A;  1N54 B;  1WDD A;  1Q8K A;  4OI3 A;  1REV A;  1RT2 B;  4NYO A;  4OV1 A;  3PX6 A;  4DX8 H;  4TN2 A;  3HMJ G;  1EET B;  1FWK A;  3BKT A;  3PJX A;  5E0O A;  3KLF B;  2JX2 A;  4DQQ A;  2GHW A;  4QQB A;  3WAX A;  2XMM A;  4KAY A;  3N28 A;  3FDS A;  4I2P B;  2JOQ A;  2QG9 B;  4NXM F;  4ZCM A;  1P27 B;  3H90 A;  4WK3 A;  1HJK A;  1XER A;  1RWV B;  3IWL A;  7FD1 A;  1XWL A;  2H54 B;  4RWX A;  5KFT A;  3AOB A;  5F3Z A;  4USK A;  4HH0 A;  4O3N A;  1B99 A;  3V4I A;  3HO1 A;  1O0P A;  3MTK A;  1XNQ J;  2CVE A;  2HZV A;  3LAN A;  2IVY A;  4KY3 A;  3O2I A;  3CJT A;  3RRH A;  2V8G A;  4UTG A;  4A8S A;  4HLB A;  5CCL A;  4R5P A;  1X4G A;  2LQB A;  4LMZ A;  3EXY A;  3EIC A;  1OWX A;  3OUY B;  3LGH A;  4PZV A;  2VBW A;  3M30 A;  3DOM A;  2EK1 A;  2HBR B;  3GJQ B;  3UDC A;  3U7J A;  3AB4 B;  1KHN A;  3DRX A;  4NA3 A;  4CO0 A;  4G1Q B;  2RQ4 A;  1GMW D;  3ILO A;  1SJF A;  1AT1 B;  5GAE U;  1R6V A;  2L08 A;  1RAD B;  2YNG A;  2VQE J;  2DR6 A;  3BSA A;  1RTH A;  4X2B A;  3LOU A;  3N9U C;  3CCW A;  3T01 A;  3RRG A;  1VQ9 S;  1ZAX A;  3M8Z A;  4B9S A;  1F1B B;  4OL8 A;  2UUT A;  1UVL A;  4IH5 A;  4PXC A;  2CJQ A;  1EX8 A;  4KFB A;  2B7B B;  3Q8U A;  2DYA A;  4ECW A;  4LJM A;  4KR0 B;  3UD4 P;  4YDD B;  4ED2 A;  3NKY A;  3OXF A;  1Z1Z A;  3BH6 B;  3BN7 A;  2VFR A;  1JLA B;  1RLD A;  4PUO B;  1OQ6 A;  1W7W A;  2J7K A;  1D3W A;  4J7C A;  4J9P A;  2B8Q A;  4M5L A;  5A2Q Y;  3MOZ A;  1RT1 B;  2G0C A;  2XEX A;  4IR1 A;  3VAM A;  2GJ2 A;  1DQ9 A;  3HHN B;  5GMK a;  2CJ9 A;  2W5S A;  4DV7 F;  1FVS A;  3IGV A;  3MOJ B;  4ILL A;  2OPR B;  1VYA A;  2NCK L;  5DDP C;  2DO4 A;  4Y6I A;  5FDL A;  3SCI E;  3OFH A;  1RAH B;  3PM9 A;  2VPZ B;  1D1U A;  2ZVI A;  2Z2M A;  4I6A A;  2EKY A;  5ETL A;  4AND A;  2YWG A;  3ENW A;  2EC0 A;  2A2D A;  2HG4 A;  1I94 F;  5DLG A;  3BEG B;  3MGJ A;  1N52 B;  3GMG A;  3NWR A;  2UU9 J;  4ANC A;  1W26 A;  3AA9 A;  3KK3 A;  3DI6 A;  2YKN B;  3L09 A;  1AFI A;  4CXU A;  1S6P B;  1N36 J;  4IQX A;  1UVI A;  4FNI A;  3RB4 A;  3D0H E;  4QWB A;  5H9E J;  3U1M A;  3GIM A;  3GIJ A;  2CPF A;  3P96 A;  3QBC A;  4WYL A;  4A8W A;  1APS A;  4N77 A;  3RJM B;  1WTB A;  5DLW A;  1UJ5 A;  3H2L A;  2V63 A;  2YH0 A;  1P9Y A;  4OX9 J;  4KKO B;  1QE1 A;  4MIA A;  4V19 X;  2XGP A;  1NND A;  4HT7 A;  1P1T A;  2V8D A;  3VGT A;  2C2R A;  1YJU A;  3US5 A;  3HVW A;  2HWI A;  4ZP6 A;  5AXK A;  4FDI A;  1IKW A;  3MEK A;  3M2V A;  3KHG A;  4P2F A;  3VGU A;  3W8G A;  3KHR A;  1IJF B;  5B0B A;  4PWW A;  1S9F A;  1WC3 A;  2AT1 B;  2ZBP A;  4DR7 J;  4A47 A;  5K4P A;  2K7K A;  5E3R A;  2UVW A;  5IJQ A;  5BYS A;  5KFV A;  3EJM A;  2JSX A;  3R1L A;  1SCJ B;  3KNG A;  2Y0B B;  2BJD A;  3ZNU A;  4DR3 J;  2FHK A;  3JS9 A;  3AJD A;  2K3K A;  4B3M J;  3T6J A;  2VZ9 A;  3GV8 B;  3PAC A;  2W2M P;  5AE2 A;  5JMN A;  5K14 A;  2WVD A;  3CT9 A;  2OEM A;  3ENQ A;  2PGC A;  1BGX T;  3CIZ A;  1N6Q A;  5U47 A;  3VWS A;  1UZH A;  1NU4 A;  3KLV A;  3HDS A;  3QID A;  3QGG A;  1NK5 A;  1JKH B;  3CIM A;  1SJR A;  4L75 A;  2W5T A;  5GAH I;  2YKM A;  4NYZ A;  4ZS6 A;  4DUZ J;  1IM6 A;  2KFN A;  1EQJ A;  2VUG A;  3GYG A;  4L3N A;  1HBN B;  2YPY A;  4J9L A;  3UNY A;  4F3Q A;  4KC5 A;  3NOG A;  4UF4 A;  3FEY B;  4F2R A;  4NEZ A;  4JI3 F;  3N0V A;  2JH3 A;  1XJW B;  3PX4 A;  4FYX B;  2R7S A;  1TL1 B;  2W4P A;  5KT4 A;  2RKI A;  2BKP A;  1FJ7 A;  1REV B;  2W2N P;  3DLK B;  1HW8 A;  3K8W A;  9ATC B;  5J1N A;  4U9R A;  1V5I B;  4KHR A;  1UPP A;  1U0H B;  2Y1R I;  5HRO A;  3IM9 A;  2AJ4 A;  1YIJ S;  1VQ6 S;  2DH9 A;  2DXE A;  4WFY A;  2ZH5 A;  4UOC A;  2WSF C;  2CQI A;  1U1P A;  2V2V A;  3PY8 A;  2MZS A;  5D0G A;  2YNH A;  2X98 A;  2XYH B;  4F4K A;  1AB8 A;  2PII A;  4DL0 C;  4U8V A;  1WSR A;  1B3T A;  3EPG A;  1R8A A;  3N6N A;  3MEC A;  2UUA J;  3V6D B;  1HNV A;  2V9W A;  1IKX A;  1WEY A;  2MLZ A;  2PSZ A;  4PKD B;  3V4I B;  2NSC A;  2XZT B;  5D0H A;  1OYE A;  3MXH P;  1U1O A;  3T1H J;  4UST A;  1VHI A;  3SSR A;  4WCE Q;  3HFV A;  1JXE A;  5A8W B;  3UFC X;  1VQS A;  4CM2 A;  1IBC B;  1MWZ A;  3I9Z A;  4ED6 A;  1RT5 A;  2V6A A;  5F0W A;  3NKN A;  2HHS A;  1T0T V;  1FXD A;  2DEI A;  2L9D A;  4R5P B;  4QYZ J;  4CRJ A;  4RW6 A;  2XHW A;  1UMJ A;  2ANH A;  4CLU A;  1QSS A;  2DNM A;  3WBZ A;  4X4P A;  5IC4 B;  3M9N B;  2L9W A;  2CQD A;  4ZP7 A;  3ZTQ A;  3M30 B;  1M5O C;  1NME B;  2N7Y A;  3DOM B;  2NUH A;  2PMW A;  1I1G A;  2Q66 A;  2GS8 A;  3DXS X;  2FB0 A;  3AB2 B;  4LR2 A;  3A52 A;  2H9Z A;  3GZ7 A;  4OZN A;  4OJ1 A;  1H38 A;  2PT0 A;  2YNG B;  4DFP A;  1RT4 B;  3RBZ A;  1F3F A;  1JXV A;  4DFJ A;  2OH2 A;  4QWE A;  5EGH A;  2VBZ A;  1HHQ A;  3L7U A;  5E5N A;  1H2V Z;  1MMN A;  1YKW A;  2I38 A;  1FDB A;  1EHW A;  1FE4 A;  2BA9 A;  1B8J A;  2YKQ A;  2MKS A;  2CQP A;  1BHN A;  4N47 A;  3CWJ A;  4WU3 A;  2JVR A;  2VDI A;  4ZIV A;  2XMU A;  1T11 A;  3DMJ B;  2VPY B;  4DZD A;  1FF2 A;  4LR8 A;  5D0E A;  3GV7 B;  2O66 A;  4M63 A;  1U1L A;  3PHT A;  1FRK A;  2U1A A;  1LWE B;  1O98 A;  2HMI A;  4XK8 C;  3E01 B;  1S9G B;  5DM7 Q;  2J5A A;  4DR5 F;  1Y4Z B;  3THP A;  4ECZ A;  4PXE A;  5C2C A;  2IM1 A;  3N6M A;  5I4M A;  4MK7 A;  1FK9 B;  1KTV A;  4S0M A;  1JQG A;  1HWU A;  1HYS A;  3ZTR A;  2VFU A;  3LAK A;  3NKM A;  1K44 A;  5ETR A;  5HVF A;  1NK8 A;  2QTW A;  4NMX A;  4UQG A;  2APO A;  3TOQ A;  3ULH A;  4DSF A;  5FDL B;  4PQA A;  3GV5 B;  2HGL A;  1TK5 A;  1KR4 A;  4M94 A;  3K89 A;  4OYZ A;  1WOP A;  5BYQ A;  1J27 A;  3NVL A;  2CNO B;  2M2B A;  2RE1 A;  3G71 S;  4CLK A;  2WAQ D;  2CWX A;  3FKB A;  2QA2 A;  2YKO A;  2YWW A;  3T1Y F;  2IIH A;  3KK3 B;  3DOK B;  3FRZ A;  4MK9 A;  3JSM A;  4RU2 A;  2GFF A;  4NXM J;  1T7P A;  1DHM A;  3OFE A;  2GA7 A;  5LSR A;  4LF5 F;  3EPI A;  2E5L F;  3HUL A;  4O0I A;  3V6H A;  2RS2 A;  1HD1 A;  3LPY A;  1MN9 A;  3GJR B;  4EU0 A;  2RB7 A;  1IWA A;  1R31 A;  5EWF A;  3CVK A;  2RJZ A;  2Y9H A;  4ECR A;  4BDP A;  3R5G A;  2L48 A;  1N56 A;  1RQ0 A;  1QE1 B;  4NL5 A;  1X9M A;  1XEZ A;  3MFH A;  1S6Q A;  4NLG A;  3AH6 A;  4WF9 Q;  2YQ1 A;  2ATL A;  1AUD A;  4LSL B;  1K0V A;  5J2Q B;  1UJ4 A;  1SQE A;  1TVR A;  2VB6 A;  2G2Y A;  4FS1 A;  2DO0 A;  1IKW B;  2GVD A;  3CD5 A;  3CDE A;  5KG5 A;  3M2V B;  3NCP A;  5C5J A;  1V6H A;  4P73 A;  2EKN A;  4K2J A;  1VC6 A;  4ES3 A;  2UUW A;  1JK9 B;  2WW8 A;  1L3S A;  1YHQ S;  1S57 A;  4RR5 A;  2EBE A;  3QFW A;  2CDR B;  1DZ5 A;  5GVQ A;  1KEK A;  4K4S A;  4LUB A;  4X62 F;  5KFG A;  4FVC A;  3I82 A;  2OJ3 A;  3D28 A;  3MM6 A;  1RTD A;  3B78 A;  1BQN B;  4I0W A;  2QSF A;  1TFY A;  4WJB A;  2YX1 A;  4B3T F;  2VD3 A;  2ZWP A;  1N6Q B;  5KG4 A;  4U7U K;  1VDH A;  4CLF A;  2N3O A;  2HFS A;  1RI7 A;  4OX8 A;  4OJ3 A;  3G86 A;  2O3D A;  4YOE A;  1RT7 A;  3LXQ A;  4F25 A;  5DZ7 A;  3D6H B;  1HWJ A;  3THV A;  5KFY A;  3IGN A;  4Z7Y A;  5KG1 A;  3W66 A;  5KFE A;  4F3O A;  3NKO A;  1CS4 B;  2BJ8 A;  1AXQ A;  5HVH A;  4FF3 A;  1N2L A;  4DV7 J;  4OYB A;  3GU0 A;  2AJ2 A;  4OLP A;  2HHH J;  4EWT A;  1FFW B;  4HAC A;  3S8S A;  3OXL A;  2FHO B;  2DRA A;  1VRU B;  1D9A A;  4DWI A;  3W63 A;  4OV6 A;  1FRI A;  3I4H X;  4URS A;  5HRO B;  2J8A A;  2A0F B;  2QMX A;  1AJA A;  2GSU A;  4Y34 A;  1VQ5 S;  4LQ9 A;  3PZP A;  4UOO A;  1NJX A;  4Z37 A;  1YJ7 A;  1I94 J;  1CEZ A;  2DRB A;  5AE1 A;  2YNH B;  3HSZ A;  4LF1 A;  5LRN A;  4PG5 A;  2AX1 A;  2NLW A;  3PTW A;  2BJ9 A;  1YBU A;  1LKZ A;  5L0E A;  3D1O A;  3MEC B;  1UW9 A;  2C42 A;  2H5E A;  1IKX B;  1GK8 A;  3Q8R B;  4OYM A;  1IWG A;  2FJE B;  3BV8 A;  2KT3 A;  3A8E A;  4R0J A;  3A4T A;  2IVM A;  1CPZ A;  3JQK A;  4XDD A;  1VHF A;  3AD7 C;  1RSC A;  1MRO A;  2XS2 A;  4RW7 B;  1UZD A;  1KVK A;  3RB0 A;  4ZVO B;  4C8Y A;  1RB0 A;  4TN0 A;  5E7O B;  4NLY A;  3MCS A;  4WU2 A;  3RAX A;  1OQ3 A;  3QYY A;  3MR7 A;  3LA0 A;  3BS9 A;  3MED A;  3Q24 A;  5HBM A;  4NWB A;  2HHV A;  2XYG B;  3M32 A;  4BC9 A;  2MKY A;  4K4W A;  2CQ2 A;  3P6Y C;  2ZFH A;  4RW8 A;  5IFM A;  2QLW A;  4OZJ A;  2ADB A;  3M6W A;  1Y5N B;  4CQ1 A;  1FX2 A;  3H2V E;  3GON A;  4R0E A;  4YR3 A;  5C42 B;  4ICL A;  4FF1 A;  3QWU A;  5KFD A;  1S1T A;  5IZH A;  5KFK A;  2I0X A;  3G8Q A;  3D2W A;  3X1L B;  2Z2Y B;  1X9W A;  2KHC A;  4DPO A;  3NL0 A;  4AFF A;  2HMI B;  1X5O A;  3R3T A;  4QWD A;  1FHT A;  2D9O A;  3N01 A;  5ETN A;  3IR6 B;  3M9O B;  5B09 A;  3RAM A;  3PO5 A;  3PRB A;  1KN6 A;  3OTD A;  2FVC A;  3CJR A;  4RUC A;  1HYS B;  2LFV A;  5HK4 A;  5IM0 A;  2CUY A;  1F9E B;  2DNY A;  4CI0 B;  4ZHR B;  1FDD A;  2KZM A;  3UD5 A;  1KP6 A;  3EWG A;  2IMO A;  3CJ0 A;  2KM8 B;  3A3N B;  4YN3 B;  4H4O A;  8ATC B;  4PQU B;  2BAC A;  2FJD B;  2HQI A;  4Q2L A;  1K1S A;  2KU7 A;  2AZ3 A;  4ZA1 A;  1RT6 A;  2BW7 A;  2HQF A;  5GMD A;  5LMU F;  3MD1 A;  1X4B A;  2V9K A;  3JSM B;  3M8Q B;  4ZJO A;  1RWW B;  1VQN S;  2J9C A;  2DIT A;  1NZA A;  2BZ2 A;  2H65 B;  3DCA A;  2W4D A;  2QO3 A;  3OW2 R;  2OSR A;  5ETM A;  4I56 A;  2HFV A;  1N33 F;  3E2E A;  4IQM A;  1LWC A;  3LF0 A;  4QBU A;  3AD8 C;  3CJ4 A;  4YR1 A;  3BN4 A;  4ZPV R;  1VQL S;  4CO1 A;  2GIR A;  4DSJ A;  2GGP A;  3QPI A;  5ETV A;  4A8M P;  2CJK A;  2BOP A;  4KT0 C;  4DPX A;  3EXC X;  2IJN A;  4N41 A;  3HHL D;  2F5G A;  4DL3 A;  4I67 A;  3EYZ A;  2B9Y A;  3C6T A;  3CC4 S;  3LGN A;  4WFZ A;  1A6L A;  3BSO A;  4Y65 A;  4YEA A;  1XK8 A;  3MTJ A;  2OTL S;  1WOO A;  2YPZ A;  4LVO P;  1AJC A;  4C0O C;  4ERD A;  3CCS S;  4O23 A;  1TVR B;  4G65 A;  2A3J A;  1ZA2 B;  2GVD B;  3RAQ A;  4CO3 A;  4AT1 B;  4ZLP A;  1FXL A;  1WKL A;  3C8Y A;  2Y1I A;  2HGM A;  2GX8 A;  1RJJ A;  2HHT A;  2VIH A;  3GSD A;  3NOC A;  1VQO S;  4QJV A;  2RML A;  2E1P A;  2CG4 A;  2MQM A;  2J0Q D;  4F4Z A;  2QV6 A;  3R97 A;  3KG0 A;  1M5H A;  4DX6 A;  1NEE A;  2NXU A;  1ZPW X;  1IM4 A;  3H2U B;  3MM6 B;  1RTD B;  3DLL Q;  1UEK A;  4KJG A;  1M1G A;  4IFV A;  4UOH A;  2UUB F;  3NWG A;  4FDJ A;  4IKA A;  4K4Z A;  2JRS A;  4F4X A;  3HSJ A;  4Y2I A;  3NGT A;  1ZAV A;  4PRF A;  5DDO C;  3VZH A;  3IMQ J;  5GAH U;  2RAQ A;  1RT7 B;  4I6W A;  1L3V A;  2DT9 A;  3LAL A;  3FFI B;  2DGU A;  5CA5 A;  2ZBI A;  3DXB A;  2ATC B;  3K5M A;  4N8N A;  4IUF A;  1SHQ A;  1SV5 A;  3EVM A;  1NK7 A;  1BWE A;  2WB4 A;  2BR0 A;  3KHH A;  4PCQ A;  2IAJ A;  1LK7 A;  2EFV A;  3V6J A;  4J91 A;  1FNX H;  2COL A;  1HPZ B;  4HAC B;  1VQ8 S;  3PW0 A;  4A48 A;  4K4T A;  3KJV A;  3EZU A;  1UA1 A;  2MZJ A;  2EFG A;  2D9P A;  3H98 A;  3HSD A;  2FUG 9;  1Y7A A;  1X4F A;  2VV5 A;  1AW0 A;  3TUJ C;  1VS3 A;  4YR2 A;  5L1I A;  1TK0 A;  1I51 B;  2LQ9 A;  2Q79 A;  3T1Y J;  2CPZ A;  1U1R A;  2IHR 1;  4H4M A;  2M88 A;  5A6W A;  2AQ4 A;  3BGU A;  2QL5 B;  3MPD A;  4LF5 J;  3DDN A;  2E5L J;  3C46 A;  2ASY A;  2QZ8 A;  5J1P A;  3V2U C;  8RUC A;  2LVW A;  1ALI A;  3KUG A;  1VFJ A;  2XLJ A;  4RJV A;  3WHI A;  1FEE A;  5HJX A;  1KKH A;  2ZHA A;  3N6L A;  3BGR B;  2CAD A;  1KVI A;  2ZC3 A;  4J5O A;  4GVB A;  2GSN A;  3DM2 A;  4DL4 A;  3MED B;  2MEW A;  2D74 B;  2VDH A;  3M6X A;  1H7X A;  3D6M B;  4EZ9 A;  2MTL A;  1KHJ A;  1Y5I B;  3M32 B;  1P9Q C;  3LH2 S;  4RW8 B;  3IO1 A;  3EE3 A;  3NS6 A;  3P5B P;  1CSJ A;  1XN9 A;  1NBE B;  2YNF A;  5IQQ A;  3NBP A;  3OLA A;  1C0U A;  3UN5 A;  2ZDO A;  2XM3 A;  4R8U A;  2FTR A;  2KM8 C;  3GFY A;  1RWX B;  1KHW A;  2PA3 A;  1T95 A;  1RHQ B;  4LRB A;  1HW9 A;  2F8H A;  2HLT A;  3M1V A;  1RA7 A;  4MHX A;  4UPH A;  2W2O P;  4TY9 A;  3QRQ A;  1SJ1 A;  1U2F A;  4B3T J;  2QE5 A;  3KUH A;  2AWZ A;  3DU5 A;  1U1Q A;  6AT1 B;  1TKT B;  1GMU A;  2DGX A;  3DRY A;  4UUW A;  2WHO A;  3QGH A;  1KON A;  3GFZ A;  4Q2M A;  1QUP A;  2J76 E;  4KHP F;  5IM0 B;  4ZVR B;  1FCA A;  3VVT A;  1HR0 F;  7AT1 B;  3MHY A;  2HFN A;  3PHE A;  3BDE A;  3F56 A;  4NEY A;  2GO8 A;  4CXS A;  4FYD A;  5ETS A;  1UVN A;  4GTZ A;  2J7W A;  2W9B A;  3Q8Q B;  1BMQ B;  1RHR B;  5EDW A;  1Q16 B;  2W8K A;  2O1P A;  4P2M A;  1ZA1 B;  2AKW B;  1RXO B;  2B4P A;  2R7X A;  1AUK A;  3I6P A;  4NLT A;  3BDG A;  4YQW A;  5DGA A;  3B6B A;  2XMK A;  4CWB A;  5BR8 F;  4MMO A;  1NDC A;  1NKC A;  2PDA A;  2N4D A;  3MM8 A;  1JLQ B;  3UCU P;  4ETZ A;  1S4F A;  5J2P A;  2W5X A;  4FP9 A;  1T8E A;  1KC8 T;  1WD6 A;  1G6B A;  2XR9 A;  1S6U A;  2EG1 A;  1T9W A;  2BJ1 A;  3OQ2 A;  2GGP B;  1EI6 A;  4C6A A;  2HWH A;  2X3D A;  4TYB A;  3VQS A;  3QSI A;  5L1K A;  1M0S A;  2OEL A;  1TAQ A;  2M8D B;  5DRK A;  3C6T B;  4MKV A;  2GNK A;  2ACM A;  3PIO Q;  2CKW A;  1H0H B;  1E6V B;  2W7O A;  3GIL A;  1AYE A;  4F04 B;  3G6X A;  1Q8L A;  2ZUA A;  1PJ5 A;  4RU9 A;  5AXN A;  1YQH A;  2QJ3 A;  4OYI A;  2UZA A;  3ISN D;  1MG7 A;  4Y28 C;  3C14 A;  5KT3 A;  1FTC A;  3R1H A;  1WWH A;  2AEM A;  3TA2 A;  3LQV A;  1LV5 A;  1B7Y B;  1FVQ A;  4OZ0 A;  4DJB A;  4Q8F A;  3UI3 A;  2EG2 A;  5LQQ A;  1JNZ B;  3FSX A;  5KFO A;  2LU1 A;  2AHO B;  4OI4 A;  3TR5 A;  4IOC Q;  4NLP A;  2HYI B;  1UFW A;  5CQG A;  3LW5 C;  4HEA 9;  4IFV B;  4EBD A;  4GKJ F;  3PNI A;  3UDE A;  2DNO A;  4H54 A;  3DYA A;  5AJ3 F;  2DKO B;  4X4N A;  2A2C A;  1LK5 A;  3MZI A;  5KG6 A;  2HS4 A;  2J9D A;  3CJK A;  2D3Z A;  1S12 A;  5LT5 A;  2F3J A;  1FES A;  5DDR C;  1RKJ A;  2JDJ A;  4AL5 A;  1KOH A;  4MAK A;  4DSE A;  1Q95 G;  4JI5 F;  4ZPD A;  2IRX A;  4EO8 A;  3GE9 A;  1QAY A;  5GAD I;  2VIC A;  1FTR A;  4C11 A;  3POT A;  3GYX B;  3I5B A;  1SV5 B;  4F36 A;  4PWU A;  5EX0 A;  3IG1 A;  1S7H A;  1RWN B;  2C2E A;  1YVF A;  3ITH A;  2LDY A;  1FKP B;  3S6E A;  2VPW B;  3KJV B;  3BJY A;  1DRZ A;  3EMT A;  1P1L A;  1QAJ A;  3AJ1 A;  1JJH A;  3MM5 A;  4ZPW R;  1DTQ A;  2BM0 A;  1ALK A;  4B9L A;  1R6Y A;  1OJ4 A;  1N5Q A;  3IAM 9;  4AXJ A;  4N56 A;  2VJU A;  2A10 A;  1JLE A;  4OYW A;  1SQG A;  1FNO A;  3KLE A;  5F41 A;  1VCT A;  4TLQ A;  2A6M A;  2DBB A;  1S4E A;  2B7C B;  3MUR P;  2D7S A;  5INH A;  5LMU J;  1FWP A;  4H4M B;  1M1K T;  3NGK A;  3CCU S;  5CYJ A;  2UXB F;  4DPU A;  3MR6 A;  5F8J A;  2KKH A;  2R8I A;  3SEO A;  2DR9 A;  3MR3 A;  1NM2 A;  1N33 J;  2Y8W A;  4URG A;  3A1Y G;  3QNW B;  3Q86 A;  3QO9 B;  3KLH A;  3IN5 A;  4PG7 A;  4UOP A;  4RBT A;  4Z7C A;  3QWP A;  1WKJ A;  4EZ6 A;  3TJA A;  4LF4 F;  3ZZP A;  2AGP A;  4E98 A;  2W8L A;  1N5Y A;  4PAA A;  4DV4 F;  1WEX A;  3KJN B;  1OPZ A;  1ELY A;  5ETK A;  2V8H A;  3VCD A;  3DM2 B;  4ATN A;  1QAX A;  3UQS A;  3BBF A;  3VGV A;  2GZO A;  3FBB A;  4G3I A;  1MN7 A;  1R0A A;  2FPH X;  4HI2 A;  2GQQ A;  2ZHB A;  4G6V B;  5K8P A;  3BRE A;  3H0P A;  3MEG A;  5KT5 A;  4QWC A;  2ZH2 A;  2DJW A;  3DHX A;  1WAC A;  2HS3 A;  2VG7 A;  1NSP A;  3PEH A;  4ZMM A;  4R8U B;  1B7F A;  1U4B A;  5HI7 A;  4URQ U;  3TJ8 A;  4KM4 A;  2OPS B;  3TAP A;  3P5T L;  3JQJ A;  5B0A A;  2RVJ A;  1TMM A;  1TV6 A;  3P3D A;  2F9D A;  2B56 A;  2LXF A;  2HFU A;  3DDI A;  1PYO B;  2CAJ A;  3M1V B;  1WOS A;  2B43 A;  4QPX A;  2W4C A;  2UUB J;  1SC6 A;  2HGN A;  3FBF A;  4X64 F;  1Q53 A;  2F4V F;  2C3Y A;  1K9M T;  1SC4 B;  3F44 A;  1RHJ B;  3BQ2 A;  1R7I A;  4DF4 A;  1V3S A;  7FDR A;  1BQX A;  5KAK A;  3N4W A;  4MK8 A;  3UR3 C;  3LUY A;  4OX7 A;  1MU2 A;  2DTJ A;  1UJ6 A;  5I42 A;  4LF6 F;  4NZ7 A;  1S1V B;  4QR2 A;  1UL3 A;  3SXL A;  2FQQ B;  2BV3 A;  1SJ4 P;  2RQM A;  1CC8 A;  5DDQ C;  2IA6 A;  2X1G A;  4DL7 A;  4U96 A;  1Y9O A;  4KJD A;  3FZB A;  3V81 A;  4DV6 F;  2VON A;  2HHW A;  1FFG B;  4ZG6 A;  2AJ1 A;  2XZD B;  3QMQ A;  1N5V A;  5F8M A;  3R7S B;  3LP1 A;  4MKY A;  2W9B B;  2W8S A;  4L76 A;  1ZZF A;  5J1E A;  1ACM B;  2KFZ A;  1R0C B;  1KD1 T;  4BLG A;  2GQC A;  3LO3 A;  1YJV A;  5E3A A;  3BDG B;  2QL9 B;  1S0N A;  5KG2 A;  4DSL A;  3OSP A;  1NJI T;  1XNQ F;  4QIE A;  4DV0 J;  2W9A A;  1EAR A;  2ZZN A;  1FO1 A;  1SPB P;  2HRU A;  2ROG A;  4OFZ A;  5J2P B;  3ETM A;  5D6G A;  3CMQ A;  3BR8 A;  2E9R X;  2V2K A;  2CPE A;  2DH8 A;  3IDD A;  3OR2 A;  1KDN A;  3NGD A;  3BPD A;  1FEH A;  2MST A;  1K8A T;  3CDB A;  3THT A;  3D0I E;  2HK3 A;  3KG1 A;  4AYB D;  4CNZ A;  3CC2 S;  2DHX A;  4LRD A;  3J7Y I;  1FD2 A;  3OD2 A;  2POK A;  3PW7 A;  3N5F A;  5A6P A;  5DQG A;  2AGO A;  4LQY A;  3HP6 A;  1URN A;  5DQI A;  4ED3 A;  1SIZ A;  1U1M A;  2MY8 A;  3EUN A;  3DRS B;  2HHX A;  2QSW A;  2UV8 A;  4ED8 A;  4GC7 A;  4OZ3 A;  2ZC4 A;  5K8N A;  2WK4 A;  3EDR B;  1U6Z A;  2CPY A;  1S6O A;  5HLF A;  2LU2 A;  4I69 A;  1Q8B A;  3WAY A;  4USV A;  2DHA A;  2OLW A;  1DAR A;  4KGX B;  4YB6 A;  2LXI A;  3H42 A;  1GQE A;  4USU A;  4XAK A;  3Q89 A;  1HBM A;  3C2P A;  4ZVT B;  3ZZO A;  4NX9 A;  1T9V A;  2BVZ A;  3OL6 A;  5D4N A;  3TZY A;  2RD5 C;  3ZC4 A;  2WON B;  3H5X A;  4DF8 A;  1QSY A;  3KK2 A;  2KXH A;  4A4J A;  3CJK B;  1KWM A;  2C2K B;  4X4U A;  1ZTW A;  3V6K A;  4NA1 A;  1S1X B;  1J5O A;  1UP1 A;  2OKQ A;  4A8K A;  3KDO A;  3G8T A;  4N76 A;  4EBE A;  3KD8 A;  4HKQ A;  2PMH A;  1CJK A;  2G2O A;  4C11 B;  3Q2T C;  4MT1 A;  3WAW A;  1EET A;  2DNP A;  3KLF A;  3DLJ A;  4GTY A;  2GLQ A;  4KHP J;  3OTB A;  4UY8 5;  1E3C P;  2G2Z A;  3ITH B;  5T14 A;  2MKK A;  3G6V A;  1HR0 J;  4C98 A;  2KT2 A;  1CUL A;  4O4G A;  4I2P A;  5HL7 Q;  1QLN A;  1URB A;  5D4L A;  1GNK A;  3ET6 B;  3RBX A;  1MW7 A;  3MM5 B;  4B3S F;  4DV1 J;  4ZJL A;  4FKY A;  4P9S A;  4C7Q A;  2IA0 A;  1NDP A;  1RCO B;  4LQ3 A;  3H40 A;  2KZZ A;  2QIF A;  2LMI A;  2VPX B;  2GIF A;  3PCO B;  1KH9 A;  3KLE B;  3VAH A;  1VR6 A;  4WWS A;  1RT3 A;  4DBQ A;  4C2M A;  5BR8 J;  5L9X A;  4CTA A;  3BH7 B;  4NLD A;  2Q43 A;  4OX9 F;  3ELH A;  3BGO P;  2OPP B;  2YX4 A;  1HMV B;  4OHW A;  3BKF A;  3UCZ P;  5F9N A;  1NJZ A;  2P9G A;  3NCQ A;  3RZA A;  2OIH A;  3W2V A;  3PJ9 A;  5F9L A;  4KV8 A;  3H25 A;  3KLH B;  2PEH A;  3OUY A;  3UDV A;  1RAB B;  3ZO7 A;  2W2Q P;  5GRR A;  1JLB A;  2KVQ E;  1KQG B;  1N5Y B;  1GAO A;  2X1A A;  2W7P A;  2FLO A;  1NK0 A;  4OYA A;  2FVQ A;  1UWA A;  2VJV A;  3TI0 A;  2ALZ A;  4FBU A;  2CNN B;  2XUL A;  4DI6 A;  2EW9 A;  5B7W A;  1R0A B;  3HHL B;  5KFI A;  2XZW A;  1UET A;  5HMX A;  2DHH A;  3RBD A;  5HAN A;  5E41 A;  1F3V A;  3MI7 X;  3GQC A;  1HNW F;  3MEG B;  1Z2L A;  4C8K A;  3M7V A;  2ROP A;  3HVA A;  3UVJ B;  5HJY A;  1WKK A;  2LP4 A;  4ID8 A;  2R8G A;  3GJS B;  3U02 A;  1KS2 A;  1MWQ A;  1H2T Z;  3ONQ A;  3SYZ A;  4ZG9 A;  4FYY B;  2AZ1 A;  2DIS A;  2AEF A;  2HQC A;  1RHM B;  1RGV A;  3OJU A;  1I6J A;  1TV6 B;  4DSI A;  3NKQ A;  4ECY A;  1IXK A;  4BWM A;  3O44 A;  2E1M C;  2DIV A;  5HMZ A;  1G7C B;  5KFZ A;  3QIP B;  2QN6 B;  5AJ3 J;  4NML A;  2E9Z A;  4PG4 A;  1RAJ A;  3IR5 B;  1AA1 B;  1CJU B;  2IBK A;  3WX4 A;  2AJ0 A;  1FJG F;  2W5Q A;  4IO1 A;  5KT7 A;  1HWI A;  2HAI A;  4FBT A;  2NXN A;  1MU2 B;  2QGF B;  2HND A;  1QUV A;  2CDQ A;  5LM7 E;  4NCB A;  4JI5 J;  2BJE A;  4MIW A;  4ZLN A;  4LF8 F;  2M0G B;  4F26 A;  4ECS A;  2LA6 A;  5IT4 A;  3CF5 Q;  2R42 A;  3OL8 A;  3H5S A;  2DGT A;  5D4P A;  3TUP A;  1RWM B;  1IQZ A;  1VQY A;  3VAK A;  4USM A;  2XCA A;  1C4A A;  4DDF A;  3JB9 k;  2CA9 A;  2PFF B;  2AJF E;  3LP1 B;  1YRX A;  2CPH A;  1ZAW A;  1HQ2 A;  1Y5L B;  2RQK A;  1S6P A;  5J1E B;  3U1L A;  1S10 A;  3K7R A;  4ZPA A;  4DL2 A;  2YQ3 A;  1N5S A;  3NCR A;  1RLC L;  3KXD A;  1T05 A;  3CDU A;  1RAI B;  1UAW A;  5H9F K;  4FXW A;  4CLT A;  3M8S A;  4DSK A;  2BX6 A;  2ZIT A;  3HX9 A;  3CC7 S;  2QRR A;  1SKS A;  3G87 A;  2CJY B;  2UXB J;  2EEY A;  3NGS A;  4JI1 F;  4A8F A;  5I3Q A;  3HT3 A;  4K4U A;  1FT8 A;  3CME S;  3UD3 P;  3OR2 B;  1LXN A;  2XLK A;  2K1R A;  5C24 B;  1AZS B;  4OI6 A;  1TKD A;  3JYT A;  2V4R A;  1Y3K A;  1H3D A;  4TY8 A;  3J81 Y;  4ALZ A;  3IXQ A;  4LF4 J;  2UXD F;  3L9Z A;  1I3O B;  4KQZ A;  2CJX B;  3AOC A;  2GMJ A;  4DV4 J;  3EZ5 A;  2WSC C;  1NK6 A;  4U6P A;  2RIL A;  5L1L A;  1X4D A;  4KYZ A;  3NS7 B;  3HK2 A;  4YR0 A;  5F0U A;  2ZEJ A;  4IO9 Q;  3ED4 A;  1CBK A;  4EFA C;  1AJB A;  6FD1 A;  2H1Y A;  3FEX B;  4BBY A;  2PI4 A;  3DYC A;  2JL9 A;  5E3Q A;  2V4J B;  3R5C A;  1WDT A;  3ILL A;  1O5J A;  4DFM A;  4IG0 B;  3I32 A;  2RQC A;  4X4V A;  2BJ3 A;  5T41 A;  5CD4 A;  1C0T A;  5A8R B;  5IS2 A;  2KG0 A;  2QLB B;  1O6X A;  1HBM B;  1E6Y B;  5K5M A;  4OMF G;  3ZTP A;  2J6U A;  4P2S A;  3ZFV A;  2D1C A;  2FIU A;  3PO4 A;  4X4O A;  5HO4 A;  3F73 A;  1Q7L B;  5B0E A;  2C3U A;  1SH3 A;  3BBC A;  5KTQ A;  1F2G A;  5FLX Y;  4LF2 A;  4W4M A;  4UQT A;  4K5S A;  5A8K A;  2NXE A;  4X64 J;  2F4V J;  4OI1 A;  3MPV A;  4RX6 A;  5D4O A;  1E1Z P;  5LSL A;  5GAD U;  3DLK A;  4DR6 F;  5G4D A;  4B9M A;  1CJK B;  4I64 A;  2XWX A;  3LP0 B;  1U1K A;  4WKY A;  4LF6 J;  1HI0 P;  1TKX A;  4Y3C A;  1U0H A;  3BYR A;  2FJX A;  1X5S A;  3SQG A;  4ZCL A;  2HZA A;  2E5I A;  2V69 A;  3HHE A;  1CUL B;  1TL5 A;  4O4G B;  4DV6 J;  2Z4P A;  3LAM A;  4Z2X A;  4J9O A;  5KFB A;  2OGU A;  1MNE A;  2ZVS A;  3DDK A;  5F8H A;  3VR1 A;  1EW2 A;  1IKY B;  5C7P A;  3V6D A;  3HHL C;  4YUD A;  3IGY B;  4ZJQ A;  2BAN A;  2ZKT A;  1O51 A;  1RT3 B;  3FK4 A;  2WSE C;  5IC6 B;  5EWE A;  1UWB A;  4CTA B;  1UTA A;  3JAM Y;  5A8W A;  3C6U A;  1BUX A;  4QW9 A;  1FDN A;  4K5R A;  4LT6 A;  1WG4 A;  3KOA A;  4WTY A;  5B0F A;  3UE2 A;  4O3S A;  4DHV A;  4UY8 T;  3W2V B;  4C4W A;  1RAF B;  4KV8 B;  2Z2Z A;  4UZB A;  2JFK A;  4DN9 A;  3R5J B;  4Y00 A;  3UWT A;  4RBV A;  3M05 A;  4NCA A;  3D7S B;  4OHV A;  2R7O A;  1JLB B;  1JX4 A;  4JI4 J;  5RUB A;  4JP8 A;  1BLU A;  1L5U A;  1PAE X;  1XR6 A;  2JEG A;  1YJR A;  2MQL A;  1FNM A;  1LFP A;  1EW8 A;  1RT4 A;  2NRE A;  5D3G B;  5AJ9 A;  5JVG Q;  3LP2 B;  4H4K A;  5D78 A;  5KFA A;  2AIR B;  2LKZ A;  2VOD A;  5GOV A;  4Y2K A;  2DNR A;  3FNN A;  4C0B A;  2ZNY A;  1XC9 A;  1UCN A;  1N0V C;  2BYC A;  1R8P A;  3U27 A;  3MCM A;  1SC1 B;  1X60 A;  3DMJ A;  1X4C A;  4ZPC A;  3QT5 A;  1U45 A;  3MMB A;  1RCX B;  1S1U B;  3GP9 A;  4FS2 A;  1LWE A;  3NP5 A;  3E01 A;  1S9G A;  2V68 A;  5DJB A;  4CH1 A;  1YX2 A;  4O3P A;  5SZT A;  3PYD A;  4DZ6 A;  5A0Y A;  1OY8 A;  5LRM A;  1WF2 A;  1FK9 A;  2C28 A;  1XNR F;  3W64 A;  1S1W A;  1RTJ A;  3UDL A;  3FSY A;  2BE2 B;  3V4M A;  2ALY B;  2HHH F;  3GFH A;  1VQ4 S;  4Q43 A;  2DNN A;  2MZT A;  1ZEF A;  5CZV A;  4ZVH A;  3IA0 A;  4CLW A;  2HND B;  1ZM9 A;  1K1Q A;  2DHG A;  2MZQ A;  1H72 C;  2G4B A;  4MFB B;  3BB5 A;  1P6T A;  4YY3 F;  3ZNJ 1;  3CMA S;  3NKR A;  1NUE A;  2B5J B;  2X7I A;  2N7C A;  1GX5 A;  2FJB B;  1IBK F;  3HI9 A;  3BDP A;  4EO6 A;  2H51 B;  2B9X A;  4B9U A;  2XWY A;  1T03 B;  3DOK A;  1T9Y A;  1X4A A;  2HNY A;  3SZ2 A;  4PEO A;  1CVJ A;  1VRT B;  2RU3 A;  4YHH F;  3RU0 A;  3J80 U;  3C16 A;  4C8N A;  3TRG A;  4B3S J;  2IMW P;  1JJC B;  5I3P A;  1F0X A;  5EHH A;  1B70 B;  1QM9 A;  2CNK B;  1T05 B;  1T9T A;  2LXU A;  1VQ7 S;  1L3U A;  2HHQ A;  3DOL A;  2JFD A;  4WP3 A;  2R7Q A;  3MPY A;  2CQH A;  3PFO A;  3QSY B;  2J6T A;  2YWF A;  1S7I A;  2Q1L A;  2HZC A;  2VFT A;  3D66 A;  5KFM A;  4EYH B;  1SKU B;  1HAR A;  4C8M A;  1Z2Z A;  3K57 A;  2BQ3 A;  3KG4 A;  3MM7 A;  4LSL A;  1NZ8 A;  2XSF A;  4DPY A;  1U09 A;  4ECV A;  4ZP8 A;  3O1L A;  4MH8 A;  4NZ0 A;  5J2Q A;  2R2T A;  1URR A;  1F60 B;  1RYS A;  2K1R B;  1PC5 A;  2PEB A;  2CQG A;  2ROE A;  3JYT B;  2B9W A;  3WBH A;  2DXF A;  5LXR A;  4TY8 B;  3QT7 A;  2RH3 A;  2FD2 A;  4RNN A;  4KJI A;  4C48 A;  3J7Y U;  3M9M B;  3SCL E;  4LFB F;  2HVH A;  5IT9 Y;  3OSN A;  1NDL A;  3OPK A;  2E44 A;  2C2O B;  3PV8 A;  1OYD A;  2HUR A;  2QMU B;  4M5M A;  2YY3 A;  2DGW A;  2IJR A;  3PEJ A;  3GR0 A;  5JXS A;  3T5L A;  4ER8 A;  3MM9 A;  1RTI B;  4ZN3 A;  3PR4 A;  1HNW J;  1BQN A;  1Q81 T;  5DM6 Q;  5KG3 A;  3RR8 A;  3VQT A;  5LOQ A;  2MB0 B;  4IRK A;  3D1H A;  2IPO B;  1KSP A;  3R8Y A;  3G82 B;  3NGR A;  3TUI C;  1C0T B;  2M7S A;  3L7P A;  1DTT A;  3D6T B;  3S01 A;  3MCN A;  3WC2 A;  3MMC A;  2XNQ A;  2M70 A;  4I6Y A;  5K9F A;  2X51 A;  3AHP A;  4RNF A;  1CS4 A;  2DIU A;  2ZBR A;  4JOU A;  4HVZ A;  1X8D A;  4EK2 A;  2W5W A;  2O01 C;  1NSQ A;  1LWF B;  5A8K B;  2LDI A;  5KT2 A;  4YB1 P;  1Q7Y T;  3VV2 B;  4CLY A;  2WCX A;  1TL4 A;  1FJG J;  2VG6 A;  3BGF A;  3G96 A;  2MQQ A;  2CQB A;  2H5I B;  2KXN B;  3IAS 9;  2SXL A;  5EN1 A;  1WI6 A;  3BYP A;  4K2X A;  2DPJ A;  5KOW A;  1VRU A;  1TTH B;  5KT6 A;  3MAA A;  1TKX B;  4M95 A;  1ALJ A;  5IOL A;  2C3M A;  4LF8 J;  1U6F A;  3SQG B;  1PJ6 A;  2BAB A;  3QAU A;  3AJ2 A;  1RAG B;  3Q8Y A;  3WZ0 A;  4D3G A;  3DGP B;  4B17 A;  5HN0 A;  2PI5 A;  4QWA A;  1UFL A;  5MLC V;  2NXJ A;  2HSE B;  1RP5 A;  3TZZ A;  2ILZ A;  2KH9 A;  4EGL A;  4RW4 B;  2Z57 B;  3MAQ A;  2IYI A;  1C1B A;  1S0O A;  4M5D A;  2ZH3 A;  2BAN B;  2KHD A;  2B4O A;  2OFG X;  1C1C B;  2XMV A;  5KFS A;  4TKT A;  4B08 A;  4DMZ A;  1H7W A;  2A6O A;  3MK1 A;  1UWB B;  1EQM A;  3C6U B;  4RW7 A;  3T5J A;  1R89 A;  4TU9 A;  1ZM3 A;  2PC6 A;  4QU7 A;  4I4B A;  2D69 A;  4LF9 F;  3ISN C;  5FII A;  3G6E S;  1NHU A;  4ZOS A;  1S5Z A;  4JI1 J;  2W7A A;  1BXN A;  1VI7 A;  4PPZ A;  8AT1 B;  5I3U A;  4P74 A;  5B08 A;  2MHE A;  4JI0 F;  1U48 A;  3M8P B;  1TFW A;  3OFG A;  5L0B A;  4HT5 A;  1QJH A;  3GG1 A;  1EJJ A;  2I1R A;  4A8O A;  1U49 A;  2XQC A;  4EMD A;  4L72 B;  4N5S A;  2DXD A;  2W5R A;  3O5T B;  3HF5 A;  4FF4 A;  2QT7 A;  4K8R A;  4FKX A;  3UNG C;  2UXD J;  1SH2 A;  2V94 A;  3Q0A A;  4DG1 B;  2W1B A;  3WAV A;  4G1I A;  4MYU A;  5C42 A;  2BXJ A;  3D3B J;  1DLO A;  1FD8 A;  1D09 B;  1LEO A;  3GYN A;  2IM2 A;  3SV3 A;  1OSD A;  4X4Q A;  3R6G B;  2YH1 A;  2DGO A;  2B9E A;  2F4F A;  3M6V A;  1D9D A;  2JC1 A;  3NAH A;  3MMB B;  1RWP B;  3RUB L;  3BZQ A;  4DN0 A;  4OHX A;  4CM0 A;  2VFV A;  4DLE A;  2L9N A;  1IBM F;  5AXL A;  2NXC A;  2K06 A;  1WNE A;  5CCM A;  3K5L A;  4DU7 A;  4ILM A;  1ITP A;  4UOG A;  4TLR A;  3IRW P;  2P6S A;  4F67 A;  5A0Y B;  1M5P C;  4JYA J;  1OY9 A;  1QDU B;  2D3U A;  2VF3 A;  3CCT A;  1S1W B;  1RTJ B;  2MKJ A;  3CW2 C;  3KMS A;  3A8J A;  1JNR B;  1JLC A;  2HNZ A;  3Q8V A;  2B4V A;  3IS9 B;  4ZHR A;  2MSS A;  3LWM A;  3TG0 A;  5DGB A;  3G8S A;  1V5V A;  3V5R A;  4DR6 J;  1OPI A;  4QOT A;  4O3Q A;  3D1Q A;  4EYI B;  4ZVS B;  3VTI A;  3AA8 A;  4PQU A;  2VFS A;  4ED0 A;  2XY7 A;  3UCG A;  2V67 A;  3DNC A;  4N7T A;  4ZIW A;  1S72 S;  2WVC A;  3BDF A;  2HNY B;  1U26 A;  3KYL A;  3M8Q A;  4WFX A;  5F3T A;  5H9E K;  4KHM A;  3C16 B;  2OO4 A;  4OJH A;  2BUN A;  1ELO A;  1P8G A;  3I87 A;  3IWX A;  3PYG A;  2IC3 A;  4J9N A;  4NLV A;  4MIV A;  1YZ6 A;  1Y11 A;  4OHZ A;  3DOL B;  4DL5 A;  2DGQ A;  1NCL A;  1YRT A;  1AUS L;  2MLX A;  1A9N B;  4DCJ B;  1SKW A;  2EXU A;  1ZZN A;  2ZJQ Q;  5A2Q U;  2AYE A;  3JSY A;  2XY5 A;  3P4U B;  3BPS P;  3HFK A;  1JWW A;  3B4D A;  2AGQ A;  1N48 A;  1G4C A;  3QZ8 A;  3MM7 B;  3DRR B;  1KHL A;  2ABY A;  1CQM A;  2CJB A;  2IJF A;  1EAY C;  3B4M A;  3MPU B;  1UVJ A;  2LEC A;  2E29 A;  1NHK L;  2V2Q A;  3K0J A;  2N4C A;  3CNQ P;  1UW4 A;  2VHG A;  1HNZ F;  1TMJ A;  2RSQ A;  5B0C A;  2RIJ A;  4BS2 A;  3K5P A;  2XMW A;  2AYM A;  5EUH A;  1HKA A;  3A8K A;  2KYZ A;  3BSN A;  2DNZ A;  3RGI A;  5D0R A;  4PG6 A;  2KJV A;  3QT8 A;  3GJT B;  1V3Z A;  1B4S A;  5D15 A;  2X1B A;  2GIQ A;  4F02 A;  4K59 A;  3ZZT A;  5EGY A;  3MM9 B;  4ANE A;  1GMW A;  5HQM A;  3MDF A;  1JLG A;  1TEL A;  2LEB A;  5H1S V;  4KGZ B;  2OML A;  3GTY X;  5KXA A;  4KPY A;  2Z58 B;  4NI2 B;  2YX7 A;  3SV4 A;  2JJ4 D;  3M2R A;  2DY9 A;  4P7T A;  1SIW B;  4CO2 A;  1VQM S;  2DVI A;  3J7A 1;  4F4W A;  4OZL A;  4WFN Q;  1VJQ A;  4Y2A A;  1DTT B;  2K3I A;  5DLV A;  1VIX A;  4X4S A;  3MMC B;  4V19 J;  4LSN A;  2W2P P;  3FFI A;  2LQ5 A;  2I9S A;  4OZ1 A;  3A8I A;  3OFF A;  3DRP B;  5DS7 A;  1NPR A;  4OYP A;  2KI2 A;  1QTN B;  3HKZ D;  4NCG B;  1XNR J;  2FC8 A;  2L41 A;  1YDL A;  4QU6 A;  5IJS A;  4Q0B B;  3IGZ B;  1T3O A;  3F0N A;  2VG6 B;  4WP8 A;  3CTR A;  3A12 A;  1VK8 A;  1HPZ A;  2E5H A;  3K17 A;  2ASD A;  1EP4 A;  3CCM S;  1R27 B;  4RL1 A;  5J2M A;  2AX0 A;  4LRC A;  3MAA B;  2WBR A;  3AD9 C;  1O99 A;  2QZU A;  2R3V A;  4YY3 J;  3FCV A;  3DLB A;  3BDH A;  1NB7 A;  5C25 B;  2J0W A;  2C2D A;  2MZR A;  4U67 Q;  1ROF A;  4AXI A;  4DX5 A;  3E2D A;  1IBK J;  4EBC A;  3KFW X;  1ICE B;  1ZEB A;  2OEJ A;  2QFJ A;  2JZ5 A;  1CC7 A;  4IDK A;  2RF2 B;  1S76 D;  2QYC A;  3HFZ B;  4QIG A;  5IV4 A;  2H5J B;  4RUH A;  1C1B B;  4H4K C;  4YHH J;  4M5D B;  2MGZ B;  1YGY A;  2E5J A;  2FDN A;  4FXV A;  2ZOM A;  2XYP B;  4B3R F;  3M4X A;  5KFJ A;  5KFU A;  4QYZ K;  4KH1 B;  5HAO A;  4KGK A;  5T7L A;  1HNX F;  1YLX A;  1YWX A;  5THW A;  3CCV S;  1S99 A;  4WIQ A;  2F63 A;  2P9C A;  2J9D E;  3MEE A;  4LVN P;  2JEJ A;  1F5A A;  3IRX A;  2CPX A;  3BGR A;  1HA1 A;  2AJQ A;  2E9T A;  2OI2 A;  4A46 A;  5I3U B;  1FE0 A;  4UT4 A;  4K7Q A;  3EGZ A;  2GHP A;  2Y8Y A;  4AUK A;  1FWL A;  3ILJ A;  4USJ C;  1CJT B;  4WP9 A;  4XO0 A;  3Q83 A;  3CCR S;  2WW4 A;  4RNO A;  1S48 A;  4QW8 A;  4LFB J;  2ZWO A;  2ZHO A;  1IKV A;  4WTO B;  5KFF A;  5E33 A;  1XBW A;  2JEF A;  2E7V A;  4C9D A;  4MJK A;  2UUC F;  1ZBT A;  2OP5 A;  3K5N A;  5CD4 H;  1DLO B;  1Y3J A;  4RUA A;  2OD4 A;  4WXW A;  4DQI A;  2P9E A;  2MZ1 A;  2FGO A;  2FHJ D;  1WG5 A;  4PG8 A;  1G3O A;  2DCU B;  2HRT A;  1JJ2 R;  1D9F A;  2LEP A;  1EW9 A;  1REG X;  1OS5 A;  4UOF A;  2GML A;  3M2U B;  1TKT A;  1N32 F;  3B82 A;  2QX0 A;  4OIX A;  2BEF A;  3ENA A;  2VG5 A;  1A0O B;  4ELV A;  4IH7 A;  2D41 A;  1X0F A;  2JNJ A;  1VBZ A;  1GT8 A;  3CSK A;  2FYX A;  1HFE L;  2ZM6 F;  1KH4 A;  1ZTT A;  4NOH A;  1JLC B;  2HNZ B;  5LXY A;  1CLF A;  1JB0 C;  2RUS A;  5F8N A;  5CHC B;  3K8V A;  3BBB A;  2J8S A;  4ED5 A;  5DG8 A;  4IOB A;  1RAO A;  4PYA A;  4GO5 X;  5CYQ A;  1VMB A;  5DLT A;  2JWN A;  4M8L A;  2XTJ P;  3GFX A;  3H5Y A;  4L3K A;  1S77 D;  3BR9 A;  2Y1J A;  4E8U A;  3D9B A;  3IC1 A;  4IG3 B;  4KPC A;  1VBY A;  2HWT A;  4WII A;  5KFQ A;  4HR2 A;  4P71 A;  4M5G A;  3E51 A;  5ETP A;  1VLY A;  1HLW A;  1JLQ A;  3DU6 A;  4NLO A;  2IC3 B;  2G9Y A;  2QLJ B;  5DLF A;  1IR1 A;  4LBI A;  2MKI A;  1RAA B;  1ZET A;  3CJS A;  1X7V A;  1VLO A;  1DQ8 A;  4ECQ A;  4K0K J;  3H8Y A;  3DPC A;  2NSB A;  2EBG A;  3H7H B;  1IJE B;  3KJF B;  4V1A k;  5EWG A;  1KNZ A;  1A7G E;  1RZM A;  4U7C A;  1N88 A;  4C8O A;  1BWV A;  2IM0 A;  2AYB A;  1HDH A;  4LF9 J;  1AJD A;  1E6V A;  1TKZ B;  3C66 A;  1TR0 A;  3TNV A;  4N8O A;  3EM1 A;  1Q5V A;  2Q3P A;  3L3C A;  1M5S A;  4A8X A;  2DPI A;  1VIS A;  1FI4 A;  4JI0 J;  4K50 A;  1T02 A;  3G9C A;  4MY4 A;  2GMH A;  4F0H A;  1WHV A;  2F8M A;  5BXI A;  4F50 A;  1WF0 A;  3H4B A;  1QVF R;  2EFQ A;  1PSD A;  4NLW A;  2X1F A;  2HHP A;  3KLG A;  2F65 A;  4CH0 S;  3CDW A;  3R2C J;  5M2R A;  2Q6B A;  5JUM A;  1JLG B;  2HAF A;  1WEL A;  3C15 A;  2XO7 A;  2ZE2 A;  4OI0 A;  2DNH A;  3M2R B;  1M1H A;  1J5E F;  3T19 A;  3GCW P;  1MLA A;  2E5G A;  1UPM B;  1FRL A;  1RK8 A;  4ZP9 A;  1HNI A;  2FY8 A;  4DEZ A;  1R3N A;  1BD6 A;  4C97 A;  4X4R A;  1IBM J;  1R8B A;  4LSN B;  4RKU C;  2NPF A;  4UUX A;  3AQO A;  3R5A A;  2WBM A;  4C3L A;  3FUY A;  3HJV A;  4JBC A;  1LXJ A;  1QY7 A;  1Y7P A;  2BKO A;  2QA1 A;  2EK6 A;  5DO2 A;  2BQR A;  1X4E A;  1WSV A;  3GSI A;  4WFB Q;  1DAX A;  2WOM B;  1FKP A;  4KH0 B;  5L39 A;  5LIA A;  2NQP A;  1EP4 B;  5J2M B;  3JTN A;  4IRC A;  1PC4 A;  2V8P A;  1YIT S;  1FSU A;  3MK0 A;  4USI A;  4DXL A;  3VF0 B;  2LLZ A;  3M8W A;  3QJP A;  3TUZ C;  2YVS A;  3PXG a;  5ETO A;  2OPQ A;  4DV0 F;  4GRS A;  4GVL A;  4OI2 A;  2FLL A;  3BSC A;  4HHJ A;  1XIQ A;  1VBX A;  2XS5 A;  4IDK B;  3R5B A;  4ZVG A;  1GTH A;  4LSZ B;  4XDC A;  2MQP A;  2MY7 A;  2F1F A;  4CDI A;  2I5J A;  4E2F B;  4F4A A;  3BKU A;  2HKE A;  2M4M A;  4B9V A;  3QO9 A;  5T7L B;  3I0R B;  2V0N A;  3HZG A;  3ZTO A;  4QR1 A;  3VAJ A;  3MEE B;  3W2W A;  1IR0 A;  3TAM A;  3KK1 A;  1VK3 A;  3IRX B;  2KG1 A;  4HDH A;  4M5N A;  3SQO P;  4M1K A;  1GXL A;  1HQE B;  4NRT A;  2HRY A;  5KFW A;  5KG0 A;  4MIB A;  3EGN A;  3M8R A;  3G2X A;  3MK2 A;  1VC5 A;  2KRB A;  1SUQ A;  1J2V A;  4GTW A;  3CJ3 A;  1YJN S;  3PDN A;  1ZYQ A;  3TJ9 A;  4QCL A;  3SI8 A;  1HNZ J;  4HI1 A;  2N82 B;  1D8Z A;  5AE3 A;  3HT0 A;  2PD1 A;  1GEH A;  1WHY A;  3LGM A;  2GW8 A;  1IKV B;  3OT9 A;  4P10 A;  1WHX A;  3ZZZ A;  1ED9 A;  1EKS A;  1HHS A;  2QA4 G;  3E8O A;  4GKK F;  5D8H B;  1WC0 A;  4M5H A;  3RR7 A;  2OPS A;  2Y0S D;  2GO9 A;  4PAB A;  4ED7 A;  2XS7 A;  1SL0 A;  4RZR A;  4CT8 A;  2ASJ A;  2YBV A;  2DR7 A;  3OTE A;  4P75 A;  4ID5 A;  3T41 A;  1NO8 A;  4NLQ A;  1RUS A;  1FRM A;  1LQ9 A;  4ZGA A;  4U95 A;  2DGV A;  1YBT A;  2VG5 B;  4ZPT R;  3HD2 A;  2HEK A;  3EGW B;  4O4R A;  1HL6 A;  4CLZ A;  1S1V A;  4CZC A;  3X3U A;  3VAF A;  2GQ2 A;  1UA0 A;  3RG6 A;  1NKE A;  4XTT A;  3GIR A;  2OFH X;  4FNH A;  4XPE A;  1KHV A;  3U1N A;  1O8B A;  2CQ1 A;  4KIA A;  2VH7 A;  4DV1 F;  3RB6 A;  4L6V 3;  2NYI A;  4NWJ A;  4Q8E A;  5CYQ B;  2OEK A;  4AQY F;  4OZ5 A;  3QGI A;  2CQ4 A;  4OX6 A;  4DFK A;  3QRP A;  1WC1 A;  3M8Y A;  5F8G A;  3MUV P;  4USH A;  4RBU A;  2CPI A;  3IBF B;  3B54 A;  2W5V A;  1OMS A;  3MWB A;  4QIF A;  3H59 A;  2MQ8 A;  2AW0 A;  4A8Y A;  3MAH A;  1PJ7 A;  1RTH B;  4J90 A;  3RRK A;  4B3R J;  4RWW A;  2FVR A;  1RA6 A;  3FGV A;  2DHS A;  1JJ4 A;  1FX4 A;  4DQS A;  4OYX A;  1URA A;  1UEU A;  2DRD A;  4GTX A;  3TAR A;  4DQP A;  3QFH A;  4KFB B;  1HNX J;  1WC4 A;  1JXL A;  5CH7 B;  1U6B A;  4HH1 A;  2KFY A;  1SL2 A;  1SI9 A;  4K4X A;  1SQF A;  2XO6 A;  4TU8 A;  1R8C A;  1KQS R;  2UXC J;  3FCW A;  3AQP A;  2LEA A;  1ARO P;  2RDD A;  2QMW A;  1TUW A;  4B02 A;  2V8V A;  2M52 A;  3GLJ A;  1Q8I A;  3CD7 A;  5ITH A;  3DRS A;  1XR7 A;  4HTJ A;  1K47 A;  2IM3 A;  3CCE S;  3KLG B;  3MMA A;  2ZJR Q;  2UVU A;  2UUC J;  4JV0 A;  3I31 A;  1K0T A;  1Y00 A;  2CQ0 A;  3BO2 A;  3C15 B;  4F0M A;  2ZE2 B;  1PYS B;  4YDX A;  5L8R C;  5L9N A;  2WON A;  3T1A A;  2ZH4 A;  1X31 C;  3KMQ A;  2ZH9 A;  1PKU A;  1HNI B;  2RNE A;  4JUZ A;  3WQP A;  2FHM A;  1IQT A;  2WVB A;  1S1X A;  1N32 J;  2XNR A;  1KH7 A;  1PGZ A;  3ZZY A;  3DI6 B;  2B6A A;  2FHJ A;  2YQ0 A;  3HJF A;  2Z2L A;  4J9U E;  1KLM A;  3MPW A;  1F5C A;  1HI1 A;  1BQM A;  2W25 A;  3OTC A;  5CYM A;  2NR0 A;  5K20 B;  3K59 A;  2YWH A;  5AT1 B;  1MSW D;  2FZK B;  2OMO A;  2VU5 A;  2ZM6 J;  3HCX A;  3T02 A;  3FEZ A;  4PWD A;  4FF2 A;  4P7V A;  2WTF A;  2AMC B;  3ET6 A;  3AXK A;  1HHT P;  1RHK B;  3N79 A;  1RWK B;  3L7O A;  3WIV A;  5LJ5 Y;  3JTP A;  3MMJ A;  3OXG A;  2OPQ B;  2YWE A;  2KTQ A;  3W62 A;  1YRU A;  1PIL A;  4EI2 A;  2CYY A;  3D0G E;  2VQF F;  3B5Q A;  2DB1 A;  2R8K A;  2R7T A;  2CXE A;  3SZY A;  2OPP A;  3A13 A;  3PW5 A;  2J0S D;  1HMV A;  2I5J B;  4DV3 F;  4W92 B;  1YJ9 S;  1PYT A;  3TW0 A;  5HMW A;  1ELX A;  2G1H A;  4FPR A;  4F0K A;  1FA0 A;  3I4P A;  3SCK E;  2J9E A;  5DZ6 A;  4UOR A;  5J2N A;  4NA2 A;  3W2W B;  3CJ8 A;  3NNH A;  1BC6 A;  3TAM B;  1ZH5 A;  3KK1 B;  4TQS A;  3PIP Q;  5K14 B;  4C0H A;  1NXI A;  3OHA A;  3PVX A;  1AFJ A;  3TA1 A;  2EPI A;  4ITS A;  1YSJ A;  5D77 A;  4CT9 A;  1B0P A;  1S0V A;  4DS5 A;  3QZ7 A;  1I5O B;  2J0X A;  2V50 A;  2EFN A;  2V34 A;  1WC6 A;  2ERR A;  3HHL A;  1SUQ B;  1WF1 A;  2VA2 A;  1PO6 A;  2PA8 D;  1SC3 B;  1NH8 A;  1HBU A;  2JHE A;  1UVM A;  4USW A;  2YKM B;  1E33 P;  3FMB A;  2WZ1 A;  3EDQ B;  1QSL A;  4M5J A;  4JI7 F;  3FQL A;  1KRP A;  2JLG A;  3UR0 A;  4FVM A;  1Y0H A;  3UVJ A;  2FZC B;  1TAU A;  5E3C A;  2GAH C;  3A3P B;  3QAE A;  2RDJ A;  1TL7 A;  2C2M B;  3CJ2 A;  2RKI B;  3TX0 A;  2HQG A;  4DS4 A;  3KLI A;  1LFW A;  2MLY A;  1TU0 B;  5DG9 A;  4HYK A;  2F8E X;  4RNM A;  4DCO B;  2NS1 B;  2OUG A;  3P49 B;  1KBR A;  3QLH A;  3HPO A;  2CG8 A;  4ID5 B;  4RNH A;  2BM1 A;  1FER A;  4QIV A;  3QIP A;  3W65 A;  1J5E J;  4NWX A;  1CJU A;  2EFO A;  5DQH A;  1RBA A;  3HSG A;  2N3L A;  2B0G A;  3CMR A;  4U8Y A;  4MTP A;  1S49 A;  4B3O A;  4ED4 A;  3T3F A;  2FVS A;  1HNV B;  2AP6 A;  1KQF B;  2MQO A;  3R5D A;  2MKC A;  1F2H A;  4ECU A;  3SDE A;  1ZM2 A;  2DNK A;  5HP1 A;  3Q23 A;  3PW4 A;  4NZ6 A;  2LQ8 A;  4NLX A;  1UFK A;  1RT5 B;  2BW2 A;  1XMO F;  5F8L A;  4Q44 A;  2IVF B;  1GH8 A;  6FDR A;  4RW6 B;  2FJA B;  2XBP A;  4CYU A;  4ED1 A;  4LBH A;  2I2Y A;  5SUH A;  3LPE A;  1CG2 A;  3T9Z A;  1N5T A;  4UPI A;  1QVG R;  1BY9 A;  1W2I A;  4ENO A;  2BBE A;  2CZ9 A;  3MFI A;  2P5V A;  2MMY A;  2DY1 A;  5CZX A;  3DKD A;  2EFP A;  3NNA A;  5L38 A;  2RDI A;  1L3K A;  1NB2 A;  1W2B R;  3HHD A;  2ZDP A;  3Q8S B;  2HBY B;  4NYP A;  3IFE A;  1KFD A;  3KKF A;  4DU8 A;  1VQP S;  4LFC F; 
#chains in the Genus database with same CATH homology
 3A52 A;  3NKO A;  3T02 A;  5LRM A;  1ANI A;  4CXS A;  5L0K A;  3M8Y A;  4KAV A;  4UOP A;  4CYS A;  4N7T A;  3M7V A;  1KH9 A;  3UN2 A;  4TN0 A;  4LRC A;  1N2L A;  1SHN A;  2W8D A;  4GTZ A;  4LR7 A;  1KH4 A;  3UN5 A;  2X98 A;  3BDF A;  4KJG A;  1O99 A;  2QZU A;  1N2K A;  2GA3 A;  4CXK A;  4UPK A;  3UN3 A;  3BDH A;  4FDJ A;  1ZEF A;  1E33 P;  3MK1 A;  4YR1 A;  3NVL A;  3T00 A;  1HDH A;  1AJD A;  5EGH A;  2W5V A;  4ZG9 A;  1AUK A;  3ED4 A;  1AJB A;  1ELY A;  2IUC B;  4CYR A;  4B56 A;  3IDD A;  3NKP A;  3BDG A;  3E2D A;  2W5S A;  4MIV A;  2RH6 A;  5DLW A;  3DYC A;  1KH5 A;  1ANJ A;  2W5W A;  4LRB A;  4ZGA A;  1B8J A;  1E2S P;  1EW8 A;  3NKQ A;  3NKR A;  5C66 A;  5KXA A;  5AJ9 A;  1ZEB A;  2W5T A;  3WBH A;  3SZZ A;  1KHN A;  4MHX A;  4UPH A;  1EW2 A;  5DLT A;  1ALK A;  5LQQ A;  1HQA A;  1EQJ A;  1AJA A;  3KD8 A;  3TX0 A;  4KJD A;  4MY4 A;  4LRD A;  2GSU A;  3B5Q A;  4LR8 A;  1ALI A;  3UO0 A;  5LIA A;  4LR9 A;  5GOV A;  3WAX A;  3IGY B;  4ZG6 A;  3UNY A;  2W5X A;  4UPI A;  5TJ3 A;  4KAY A;  1AJC A;  4UOO A;  3NKN A;  4QAX A;  1KHK A;  1URA A;  3SZY A;  3TWZ A;  3MK2 A;  4GTX A;  1SHQ A;  2ZKT A;  1O98 A;  1FSU A;  5DLV A;  3MK0 A;  4GTW A;  5L0B A;  2W5Q A;  3WAW A;  4LQY A;  1P49 A;  2W8S A;  2XR9 A;  4FDI A;  5GRR A;  1ALJ A;  3M8W A;  1ELX A;  1EJJ A;  1KH7 A;  5LRN A;  3T01 A;  5HRT A;  4GTY A;  5INH A;  2GLQ A;  1HJK A;  5L0E A;  3M8Z A;  1E3C P;  2ANH A;  1KHL A;  1EW9 A;  2GSO A;  2IUC A;  2W5R A;  3TG0 A;  2GSN A;  5EGE A;  4KM4 A;  1EI6 A;  1Y6V A;  3BDG B;  4UOR A;  2XRG A;  2G9Y A;  4NWX A;  2VQR A;  4LRE A;  1ALH A;  1URB A;  1K7H A;  5K4P A;  1ED8 A;  1ELZ A;  1KHJ A;  3NKM A;  3Q3Q A;  3OT9 A;  3WAV A;  1ZED A;  2D1G A;  4ZG7 A;  5IJS A;  4LRA A;  3LXQ A;  1ED9 A;  5IJQ A;  3WAY A;  3IGZ B;  4NWJ A;  3CMR A;  4CXU A;  1Y7A A;  3DPC A;  2IFY A;  1E1Z P;  4UPL A;  4LRF A;  4LR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...