4LRBA

Phosphopentomutase s154g variant soaked with 2,3-dideoxyribose 5-phosphate
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTGADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 146
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrbA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrbA01
3WAYA 3BDGA 4LRAA 2VQRA 3MK0A 1SHQA 1EQJA 1AJDA 5LRMA 5DLWA 2XR9A 2ANHA 1ALJA 3NKMA 2W5RA 4KM4A 3BDHA 5INHA 3NKPA 2W8DA 3SZZA 1EW8A 4GTWA 1EI6A 3WAXA 3BDFA 5K4PA 5IJQA 1AJAA 3M8YA 3NKNA 5GRRA 2IUCB 1AJBA 3LXQA 3MK2A 4LRBA 1KHKA 3M8WA 1E33P 2W8SA 1O98A 4UPKA 1P49A 2IUCA 1E1ZP 3NKOA 3OT9A 5TJ3A 1K7HA 4KAYA 4LR2A 2GLQA 2ZKTA 5L0EA 4GTZA 4TN0A 1ALIA 1E3CP 3A52A 4ZGAA 4LRFA 5LQQA 1N2LA 4NWXA 4LR9A 3IGYB 3UN2A 4ZG6A 1KH7A 4B56A 5HRTA 3E2DA 3MK1A 4MY4A 2W5XA 1Y7AA 2GSOA 2W5VA 4CXKA 4UPHA 4LRDA 5L0BA 5DLTA 3M7VA 4UOPA 1EW9A 3CMRA 2D1GA 4CXSA 1O99A 3WBHA 1AJCA 1KHLA 1EW2A 4KJDA 3KD8A 4ZG7A 2W5SA 4UPLA 1ALKA 3TX0A 1HDHA 3T01A 5EGHA 5L0KA 4N7TA 3T02A 1ELXA 4CYSA 1ELZA 1ZEFA 4ZG9A 1ELYA 4GTXA 5EGEA 2XRGA 5KXAA 1ZEDA 4LR8A 4LR7A 1E2SP 1ANIA 1ANJA 2GSUA 3DPCA 3NKRA 1KH5A 1B8JA 3TWZA 1ALHA 3WAWA 2RH6A 4UPIA 4CXUA 1KHJA 5GOVA 1ZEBA 1URAA 1HQAA 3B5QA 3NKQA 4GTYA 4MHXA 4UOOA 3IGZB 4UORA 5AJ9A 5IJSA 5C66A 3WAVA 3ED4A 3SZYA 1N2KA 4KAVA 4LREA 4MIVA 1AUKA 1SHNA 3UN5A 3UNYA 4KJGA 2GSNA 3UN3A 1KHNA 1KH4A 4FDIA 1FSUA 1EJJA 4FDJA 2GA3A 1ED8A 1HJKA 4LQYA 4NWJA 3BDGB 4CYRA 4YR1A 2QZUA 1ED9A 2X98A 3DYCA 5LRNA 3IDDA 3TG0A 3T00A 3NVLA 1Y6VA 1KH9A 3Q3QA 3M8ZA 5DLVA 3UO0A 5LIAA 2IFYA 2W5QA 2W5WA 2G9YA 2W5TA 4QAXA 4LRCA 1URBA
chains in the Genus database with same CATH superfamily
3EE3A 1UJ5A 3I5BA 4H4MA 1RT5B 2BE7D 3CCLS 3D1QA 4JYAJ 1N34J 3IGNA 3M2RA 1CULB 3CULA 2LP4A 3NOCA 3K89A 3G86A 2POKA 2EEYA 4Y2IA 4A8XA 1RHQB 2FLPA 4X4QA 3RAQA 2ZKTA 2ZBCA 2QZ8A 2WRMA 4WFBQ 4MY4A 3BO2A 3TAPA 1YX2A 4N8OA 3TAMA 4NXNJ 2AF6A 2OSRA 1LWEB 4XTTA 4WF9Q 2RHSB 5MLCV 1EETA 3QNWB 4IRDA 3CCZA 2ASYA 2CPDA 2QJ3A 2FVQA 1YKWA 3MECB 3R7NB 2N4CA 1FWPA 2AJ4A 1Q4RA 3BZQA 1A9NB 3DM2B 1FVQA 1L3UA 5HMWA 1LWFA 4WFAQ 3MDFA 5IQQA 4ED0A 2FGCA 2EVZA 2E5LF 1AROP 5H9EJ 4DQPA 4LRAA 4MKYA 3CEDA 4W90B 2OO4A 4LQ3A 2UXCJ 2JEIA 4DFJA 4R5PB 4TU8A 4LF4F 3DYAA 1YJVA 5CYJA 4IKAA 3M6WA 2JH3A 3R5DA 4KAYA 4R8UA 2JSXA 4HVZA 1RAEB 1ZYQA 2BE2B 1NSAA 2W7OA 3PYEA 4AYBD 2Y0SD 2W5SA 4A8YA 5JJBA 1PO6A 5CZVA 1KONA 1RHMB 4A8MP 1PIEA 1ELZA 1YZ7A 1A7GE 2UVRA 1MNEA 3BYPA 2XLKA 3ZZUA 3GJTB 2GSUA 4WIIA 2RH6A 3BN7A 1DY3A 1TKTB 2I38A 3FSYA 4FYWB 2OEJA 4DV3F 1Y3KA 1WOOA 4O3SA 4QOTA 5F9LA 1P1LA 3PW0A 1H0HB 2ZHOA 2KT5A 1RTIA 1IWAA 1F6TA 2JC1A 1JK9B 1R8HA 1P8GA 2DNYA 2LEBA 4BCAA 5IJQA 3GG0A 1OMSA 3W63A 3TVZA 2PO4A 3TNVA 2QA4S 1WC3A 1XTZA 4ECQA 3M9MB 2Q1LA 4QIEA 4ZLJA 2RDDA 3BPDA 3VZIA 4DR6J 2NCKL 1IVZA 4NASA 4RL1A 4DG1A 3EDRB 4YUDA 1RBLA 4DQQA 2IRUA 5D4OA 2MLZA 2HPUA 2IIHA 2JOQA 1T9VA 3IR6B 3FEXB 4FN5A 5DDPC 1PBUA 5D15A 3DRYA 3BBCA 2OPQB 2VG6B 4RW8A 4J9OA 3OR1A 3NBPB 2U2FA 3MM7B 1F5AA 1TL4A 1B0VA 1QVGR 1JMTA 1X5OA 4J9QA 3OLAA 1QSYA 1VCTA 2JFKA 1SIWB 4X65F 3C8YA 3GIMA 4MMOA 3MZIA 2VQEF 2QYGA 3F44A 4H4OB 4DS5A 2BMBA 2LECA 4L73A 4ZP8A 1CJTB 1WF1A 3J7A1 4O3NA 1DURA 1NNDA 1PG5B 1ULRA 3LW5C 4DR5J 4CYUB 1KLMB 2VV5A 1N6QA 5DRKA 1X5TA 2PSZA 8RUCA 2XB2D 4OJHA 3VQTA 2DJWA 4NCBA 2DRBA 1YDLA 3B54A 1GMWA 4GTZA 3SEOA 3PJWA 1S5ZA 3IA0A 2R42A 2ZDPA 1BMQB 1VRQC 3MOZA 2Y1JA 2KG0A 4FNHA 1Y5LB 3QO9B 3D66A 2JEFA 4ZS6A 3P5TL 4MKAA 4JI8J 3J81U 3THTA 1N56A 1HYSA 3ZTPA 1R8BA 3FBCA 4E8UA 3JSRA 4YHHJ 2B5JB 4MIVA 3LAKA 3PXGa 4ZP7A 4LFCF 2XYGB 1Q8IA 4K5SA 3MMCA 4ID5B 1UVKA 3JSYA 3B4MA 2XY6A 5E5NA 3TA1A 3GIJA 2FB0A 4F4ZA 1Y10A 2A2CA 2QMUB 2F1FA 1Q81T 2IMWP 3T1YF 3RR7A 4IRKA 4IQMA 1SJQA 2YNHA 3M8YA 5KFCA 5KT7A 1E33P 3RB0A 5JVHQ 2LXUA 4KFBA 2ATLA 2VFUA 1K7HA 1JLEA 4RNFA 2ZNYA 1HKAA 3BS9A 2V4RA 3C6UA 4LR9A 4LVNP 1SJ1A 2DGVA 1VC5A 1HWJA 4N56A 2ROEA 3UD5A 4DPTA 1I3OB 2FGOA 4EZ9A 1YJUA 4I6YA 2FYXA 4ILRA 1K0VA 5IM0B 2FY1A 2F63A 5HJXA 3M9NB 1E6YA 1HNVA 5AJ9A 3SXLA 5KG6A 4KKOB 4KY3A 2Q43A 2DITA 2QX0A 2I5JA 1EJJA 1KTQA 3ELHA 5IV4A 3BDGB 1S1TB 4ZN3A 1GT8A 2PN6A 4HACB 3I56S 4B17A 3HO1A 4NWBA 2OMOA 3GILA 3NGTA 1K73T 3CJQA 2MGZB 3LP2B 4TNOA 5IT0A 4J90A 4F4WA 4V1Ak 4F50A 4JI5F 1N88A 1N36F 1MN9A 4RW9A 3R5BA 3OJSA 4MFBA 5HRTA 4CLUA 1TKZB 4DV1J 3CDWA 2M5YA 2B8PA 2WBMA 4UPHA 1XJWB 1RT2B 1KNZA 5IC6B 3TX0A 2Z2ZA 1MWZA 2RMLA 1XNQF 2J0QD 3R2CJ 1M5SA 2XRGA 1ITPA 4J9RA 2VONA 3EPGA 3VAKA 2YNGB 5DG9A 3TA2A 1S1XA 3AJDA 1TQLA 4TVAB 2F5GA 2QE5A 2QLWA 5DG8A 2DGSA 2F8HA 3N5BA 1RAAB 3HT0A 2KU7A 4U96A 2Q3PA 2W5WA 1C0UA 1RK8A 4IH6A 4TN2A 1OIAA 2HS0A 5ETNA 4X4NA 4KR0B 3C3LA 3IFEA 3GR0A 2QA1A 3M8PA 2OFGX 3MUMP 1HQEB 5AXMA 3DOMA 1JXLA 3CDAA 2ZH8A 1OPIA 3ZC4A 1S76D 4J5OA 1OJ4A 3G4SS 2PI5A 3SSSA 4ZVFA 2IAJB 3TR5A 2CPHA 1ACMB 2LU1A 3WBHA 2AYMA 3D6MB 4O4GB 1URRA 4B9UA 1NK6A 1NCLA 2K1RB 4CRJA 3FGVA 4DEZA 5EGEA 2X3GA 4Q8FA 2R7TA 4ER8A 2ZH6A 1VBXA 3PEJA 3VAIA 2J9DE 1XNRF 3TA0A 1UJ6A 2GNKA 4RKUC 1B7FA 4F25A 1S1WB 5ETVA 1NJYA 3NS5A 3CD7A 3DYCA 1VQNS 1D8ZA 1U2CA 2W5QA 4ERDA 1RAIB 5L1IA 2HGMA 5C24B 1CQNA 4QIWD 1RT3B 3FRYA 4M95A 4QYZK 4TLRA 4I6WA 4IUFA 1FKOA 2NXNA 5CXTA 3MMAB 3IR7B 3RG6A 1KSPA 2BUNA 1RAHB 4ANCA 2VZ9A 3EZOA 1F9EB 3M1VA 2AIRB 3A3PB 2OEKA 1V6HA 2C2ZB 4C0HA 1RT4B 4DR2F 2N7YA 4RU9A 4Z37A 3CWJA 4LF9J 3T01A 3TARA 2DNHA 1WC5A 4LF1A 1P1TA 4RW7B 2XS7A 5B0GA 4P2FA 4KH1B 5F8GA 1NH7A 2H5IB 2DH8A 4IO1A 3M8QB 1S7HA 3IWLA 1S0OA 1URAA 2DK2A 4I0WA 5DLVA 1FJGF 4CM2A 2DXFA 3N0VA 3CCWA 2JEJA 2LU2A 3IWXA 1JNRB 2F9DA 4FDJA 5F8JA 4AL6A 1WTBA 2J9DA 3AHPA 4IR1A 2UV8G 3UQSA 1VRTA 4M5LA 4JI6F 1RAOA 2FIUA 2JNJA 4EI2A 4LF5F 2DNMA 4JI2J 2PIIA 5IT9Y 3RGIA 1VLYA 3KOAA 1O98A 3L7PA 4H4KA 2ASJA 2ZBPA 1RAJA 2OPRB 1PJ5A 2VG7B 2ZBRA 2XMJA 1JLCB 1RWVB 1ZAVA 1VQMS 5D6GA 3WDOA 2XZWA 4USUA 2DH7A 4ECSA 4DX6A 4ED6A 1O99A 2LQ5A 3IC1A 1CJKB 2BJ7A 3HHLD 3T1HJ 1VHIA 4Q2MA 2KDOA 1P9YA 4LJMA 2NXJA 4Z7YA 5IWAF 5IOLA 1M5VC 4H54A 2LXFA 3I0RB 1HNXF 2RHQB 2XMVA 3HSDA 4M5NA 3PRDA 1TL3A 2HFVA 3K5OA 2O5DA 4TXSA 3KKFA 4K7QA 3AOCA 3AQOA 1SBRA 4WU2A 4YB5A 2RNEA 4M5DB 2KTQA 2DCUB 3QIPB 3ZTRA 1KEKA 1APSA 1ZZFA 3PM9A 2W5TA 4DR3J 1IR2A 3RUBL 3CSKA 5T7LB 4FP9A 3MURP 5GAHU 2GW8A 2FQQB 5K14B 4KJIA 4LF7J 3LXQA 2R2SA 1S72S 3TO8A 2VPWB 3GPAA 1L5UA 2CJKA 5D0EA 2M4MA 2XS5A 4D3HA 5A8KB 5F3TA 2IA6A 4WKYA 3PACA 1L3VA 2HHHF 1PGZA 2NS1B 3MXHP 1Y7AA 2MQQA 2V8HA 3SFGA 1X9SA 2DO4A 3MAQA 3AY0A 2HFOA 3H42A 4KH0B 1FD8A 3HFKA 4FXDA 1D0EA 1ALKA 1HW8A 2GX8A 2QGFB 2AHOB 1EAYC 5D0GA 3WQPA 5CQGA 3OUYB 3Q8SB 2AU0A 3G96A 1JLAB 4YN3B 1N5YB 1XMOJ 1GQEA 2XMMA 2R2TA 3VAJA 2X51A 3RB6A 4PG6A 2EW9A 2P9GA 3FRZA 1RT1A 1PYSB 1I94J 4QU6A 1WF0A 1WKLA 1AFJA 3MFIA 4C8LA 5GAHI 1SC1B 2QSWA 3G2XA 2KT2A 1R0AA 3PR5B 4NZ7A 2RS2A 1Q5VA 3I9V9 4M63A 3D28A 1QSLA 3RBDA 2M70A 1FKPA 4CLYA 1XMBA 2NXEA 2HZAA 1IBKF 2HURA 1KBRA 3GU0A 2Y3YA 2BABA 4KTQA 2I8EA 3PHTA 1HNIA 4A8WA 2XYPB 4WP8A 4WXOA 5L0KA 5BR8F 4FBUA 1X7VA 5CHCB 4ZITA 5LXRA 3KLFA 5B7WA 1MU2B 5GADI 3JSMA 1NPRA 3IM8A 4GTYA 4RNNA 3ETOA 3R7BB 3W2WA 2HRTA 5HP1B 3THVA 1AUKA 1VDHA 4WFYA 3AFGA 4P6QA 3GFYA 2C1EB 5KFMA 2KM8B 3C16A 4USWA 2V4JB 1IN0A 3MK0A 1B70B 4OYPA 2Z0GA 4U8YA 4IFYA 4GKKJ 1BY9A 1JX4A 3GIKA 3U02A 2CZVC 3O8WA 1BWVA 3POTB 3BKTA 2ZOFA 1RT7A 1SKRA 1S9EB 1UEKA 3I82A 3D0GE 1PSDA 3C2PA 1S4EA 2MQNA 1K1QA 3W60A 3M05A 3NRBA 1N2LA 1KQGB 3QLHA 3PR4A 3BGOP 1RP5A 5ITHA 3TJ9A 1LW0A 1YBAA 1JLGA 4X84A 4FF4A 3RTVA 1OWXA 4TQRA 3SV4A 4RW4A 2A18A 2HVEA 2J7UA 1TKXB 4ZG9A 5F0WA 2KG1A 4FVMA 1NDKA 2GAHC 4Y65A 4IG0B 1AT1B 2IBKA 5SZTA 4OHWA 2CJAA 4C8NA 1B99A 1HQAA 3T9ZA 3D6FB 1VISA 3ZZRA 2D9OA 3MR2A 1U1KA 2XBPA 4EO8A 1IUJA 3G6XA 3I96A 3UO0A 5CD4A 3KUGA 3P3DA 3JQKA 5LRMA 1YWXA 3AB2B 4ECWA 2UUCJ 2MPUA 2NSCA 2HAIA 1V5VA 2Z8QA 4FDFA 1UZHA 3OL7A 2GVZA 6FD1A 2VPYB 2QLXA 2DNOA 4U8VA 2R2UA 3SDEB 2BJ1A 2W4PA 1IBLF 3C14A 3BKUA 3SV3A 2HS4A 4NLRA 2IDLA 3Q0AA 4JV5F 1TMJA 5FLXY 4MKVA 1T8EA 4F3OA 2AZ1A 1R7IA 1VQPS 3CD6S 3B78A 4RBUA 2F4VJ 5LMNJ 1QAIA 4HI2A 1UZDA 1BHNA 4NLXA 2VDHA 1TVRB 1UPPA 4Q7AA 2M7SA 4L3NA 1RTDA 3BH7B 2ADBA 2HQ3A 4DL3A 3WZ0A 3HJFA 4IQXA 5HLFB 3GG1A 3KK3B 1DQAA 3V4IA 1KH9A 1U1OA 3WAYA 2HNDB 3GCXP 2VBZA 1RWNB 1UWBB 4V19X 2FVPA 2CQHA 2CKWA 3HHLC 2HWHA 4M5JA 1AZSB 5I4MA 3QMQA 1ZETA 4NOHA 4FPIA 3KHLA 4OHZA 4HKQA 2CG4A 3C6TA 4NLVA 2YTCA 2EBGA 4LRDA 4PXEA 4ELUA 1WDTA 2CQBA 4FF2A 3TANA 4LBPA 4Q44A 1PC5A 2R7XA 3KK2B 1S0VA 2E7VA 2JLFA 1M1HA 5C2GA 1SQGA 3MMJA 1HBMB 2VC0A 4DMZA 1NSKL 3LH2S 4F36A 4ECYA 4M5GA 3KLEB 2ZH2A 3NKQA 4K0KF 2ZC4A 2VOOA 5C66A 3QT7A 3TRGA 4B9NA 3IG1A 2GQQA 2OKQA 1IJFB 3W9HA 2F3JA 3GLJA 4DX8H 2L9DA 2ACYA 2AZ3A 4DV4F 4DFMA 1TL5A 4CYRA 3HD2A 1S7IA 4H4MB 2FJXA 3PYDA 4QJVA 4BHQA 2R2RA 1DARA 1FHTA 3M2RB 3BBFA 2WTFA 2DHGA 3SYZA 3MK2A 4A8FA 1C4CA 2FLOA 2W9BA 1PAEX 2B56A 4JI7F 2Z57B 5KOXA 4WK3A 1ROFA 3MUTP 3L7OA 1QM9A 4KV8A 3TAMB 1N36J 1S1UA 4CZCA 1LFPA 2P5VA 2EFOA 4A4JA 4ZIVA 2UXBF 1EETB 2WVBA 2MY8A 1B4SA 2L3MA 4DL0C 1F3FA 1U1MA 1H7WA 2DTJA 5FDLA 2ZWOA 3BH6B 1N5QA 3BN4A 1NKEA 3MAHA 3PVXA 1MROA 2M0GB 2DNKA 1EX8A 3EYZA 3HHDA 4RBTA 3DLJA 3R9LA 2DPJA 3D7SB 1GXTA 1HBOA 3I9ZA 2GJIA 3UDLA 3KFWX 1Y00A 4DV2F 5GOVA 4MHXA 2E7XA 3WAVA 1VGYA 1LWFB 2QSFA 4P74A 2J8SA 2HHTA 5L39A 4ED4A 2DNPA 3MUVP 4OZNA 3DRSA 3H5YA 3HVWA 4E2FB 2H51B 3DYAB 2B7BB 3H20A 5DLFA 1EI6A 2B51A 1M1KT 1W26A 2PC6A 4FXVA 1WG4A 2IA0A 4R8UB 4K4UA 3IO1A 4AXJA 3B82A 3T5LA 3RBXA 4ICLA 1TUGB 2RUSA 2G2ZA 3E2DA 1UJ4A 2DRDA 1JLQA 3G9CA 3DGVA 4QR0A 2KZMA 3MCOA 4DUZJ 3SCIE 5CYMA 3HM9A 2UUWA 3GV7B 1SKSA 2ZBIA 3DRXA 3DOLA 4DV7J 1T05A 1UA1A 1ZTWA 1N33F 5LT5A 4NE9C 2CQDA 2E1MC 5DDRC 1RT6A 2XCAA 3VAGA 4B3MF 2YY3A 3ADAC 1YGYA 1X4DA 1Y7PA 2PMWA 4CO1A 3H2VE 2HFSA 1RTIB 5LJ5Y 2A3JA 3HSGA 1TU0B 5IC4B 4ZPVR 3CB4A 2DB1A 4JI3F 2J8AA 2UU9F 1NPPA 2K3KA 2XSJA 3UDCA 5D0HA 3TJ8A 3G8QA 4NEYA 1NUEA 4MK8A 4HDGA 3QGHA 4NWXA 4CT8A 3SI8A 4HDHA 4DG1B 3DRRA 5HMYA 1F0XA 3H98A 5ETKA 4UQTA 4WZQA 1OY6A 4NLPA 2ZE2B 5A8RA 5A8WA 1HDHA 3KG4A 1Z2LA 4PPDA 1FRMA 2CWKA 4B3RJ 2RUGA 3MWBA 1X5SA 4X2BA 2OPSA 2CJBA 5FJ4A 4P71A 3D5MA 2HS3A 1B64A 4I2QA 4OYXA 2G9OA 1WC6A 3PNIA 1N2KA 1CJUA 4LFAF 3EVMA 2FVSA 1NMEB 1FFWB 2HNYB 4GVBA 3KMSA 2A0FB 4O23A 5AXLA 3SSRA 2MHNA 2XGQA 4B9TA 4DDFA 1ELOA 1N6QB 2YWFA 3K5NA 3VGSA 3MM5A 3UI3A 3UW1A 2OEMA 4RUBA 2AEJA 4KC5A 1Q7LB 1N5TA 2ZC3A 3M2UA 4KGMA 2HFNA 4RUHA 2UUBJ 4DSJA 1CC8A 1ALIA 3A1YG 2G4BA 4J9UE 5AXNA 3ZZ0A 4CLFA 5HVHA 3WBZA 1QE1B 3T9NA 3HD1A 1D09B 3K58A 5A0YA 1HHSA 4Y34A 2UP1A 3PEHA 3SBMA 1H6KX 2MQLA 4NLDA 1HYSB 2DGXA 1FEHA 1ZM9A 2FY8A 1RLDA 4O3OA 4QZVB 2KB2A 3HCXA 4UORA 5KG3A 5ETRA 2YH1A 4I4BA 3MMCB 1GMUA 4UOHA 3EXCX 1YRUA 3N6LA 4CO3A 4U95A 1W7WA 1HQUA 3NY0A 1SUQB 4HT7A 4Q8EA 2IJRA 3TX8A 2RKIA 2JRSA 1FI4A 2YNHB 1SL2A 3JTNA 4PYDA 1XR6A 1FRHA 3MOJB 4NXMF 4KFBB 1JLEB 3D4JA 3BSAA 2ASDA 4NRUA 3C6UB 3KLIA 4EZ6A 5HROA 5HVFA 2DVIA 4L6V3 4KHMA 1KS2A 2P2CB 2HRYA 1OYEA 4M1KA 2R9LA 4DQRA 3KLHB 5CA5A 1EQ0A 3CC7S 2Z2LA 9ATCB 1WTFA 3Q8YA 3LPYA 1MW7A 2YQ1A 2BXJA 3MTJA 2IVFB 1E6YB 2RF2A 1HNVB 2B3TB 2MQ8A 3TZZA 2IJNA 1O0PA 5LM7E 2W7PA 1FDBA 2J5AA 1VQYA 1ALHA 4I1TA 1YJ9S 3GYNA 4UOOA 2RILA 2I5JB 4LVOP 1Q7YT 2OUGA 2G1DA 2BM0A 1IBMJ 1RB0A 3JQJA 2ROGA 3OTOF 2XLIA 1ED9A 5EDWA 5K5MA 5D3GA 2VASA 2VQRA 3I55S 1SHQA 1N32F 1MMLA 3H5XA 1WELA 3DI6A 2P9CA 2RQKA 5AJ3J 3RZAA 2VKZG 1QY7A 1X4CA 2AEMA 2HK2A 1LNQA 2FZKB 1RKJA 4I7FA 4DV6F 4MFBB 3WX4A 1YVFA 2MZRA 3R2DJ 2W8KA 3R5CA 1GFWB 4C48A 4DPYA 1B7YB 2QG9B 3ZZPA 1V3ZA 2BW2A 3SSQA 4RWWA 3V81A 2GO8A 3HSZA 2NZ4A 4NCGA 4F26A 4UPLA 1M0SA 4N5SA 4DI6A 4UUXA 1U6BA 1TFYA 1S79A 1S1XB 2JL9A 3CJSA 2OJ3A 2KYZA 3TWZA 5IT9U 3ILIA 3NP5A 2OAUA 4RNOA 1J2VA 2IDEA 4LF6F 1NKCA 1O6XA 1SH0A 2W8LA 2QL5B 3V6DA 1C0UB 4F0KA 1D3WA 4NMXA 1ZH5A 5BYRA 1YK9A 1CJVA 3P96A 3ZTOA 4J9SA 1TTHB 3RRGA 4DCJB 2MZJA 3Q2SC 1KVIA 1RBOB 3DOMB 1FE4A 3VTIA 3H25A 2CXEA 4PRFA 1VYAA 3D0HE 1LWXA 2B4PA 3ZNJ1 3BYRA 2IVYA 1P6TA 1JLFA 2AX1A 5M2UA 2KHDA 1GXLA 5HO4A 5C42A 4CXSA 5EWFA 3UDEA 3UDVA 1KFSA 3B8HA 5E3AA 1OO0B 4C97A 3EM1A 1NAQA 2YKPA 3VQSA 2JFDA 1NSPA 2XGPA 1U1LA 3MEEA 3O2IA 5CCMA 1UETA 4NRTA 3K17A 3BPSP 1N0UA 4ZJQA 5KFGA 2VFTA 1VIXA 4P7TA 3QFHA 1VI7A 4WK1A 1WEXA 4KJGA 3FJ2A 2XMAA 5KFKA 5KFQA 3SZ2A 2N82B 4X4PA 4ZP6A 3NVLA 4L75A 4OZ2A 3UCGA 4RBVA 2MQMA 2YH0A 1SH3A 1FKOB 5CD4H 4TLQA 3T6BA 4YQWA 3B6BA 2LFVA 2QRRA 2BRKA 1R8AA 3PRBA 3TOQA 2DGOA 2FC9A 1RE1B 5DQHA 5HSPA 1DTQA 3IBCB 1TR0A 2FVCA 1GTEA 1NDLA 5D4NA 1LXJA 4MTPA 3JTPA 4CH7A 3GB0A 2R7QA 3VGTA 4JV5J 4B08A 5BXIA 2KL8A 2P8IA 5KFIA 2K2PA 4NYZA 4F4YA 4LR8A 4C7QA 5KFHA 2NYIA 2WCXA 1IKYB 2J0WA 2BJ9A 3K7RA 4F2RA 3WX8A 2CG8A 3VF0B 4ZVPB 2B4VA 2KZZA 1MMDA 4OX7A 1DRZA 2KM8C 1SKWA 2YWWA 3H5SA 5LSRA 4UW2A 4ZVEA 2ZJRQ 1Y6VA 3JB9k 3DFEA 4I2PA 2CPYA 4AXIA 4LQ9A 4D3GA 1BQMB 3QAUA 2J7KA 4NZ0A 1SKUB 5DQIA 4P73A 1WC1A 1HNZF 5DZ6A 3K5LA 4CT9A 1IBCB 1VBKA 4DLEA 2GJFA 3OTCA 3E01A 4P10A 5KT4A 1TELA 4PWDA 5ETOA 5BYQA 4WFZA 5B08A 5C5JA 2VPZB 5L0BA 2W4CA 4A46A 3E51A 3CMRA 2PMHA 3MPUB 3IP0A 1CS4A 2E9RX 3BQ2A 1XC9A 1ZEFA 2AGPA 1EKRA 4DR1J 4B3OA 1TL3B 3HHKA 1DHMA 3CO9A 3FFIB 1U6ZA 5AE1A 3UCZP 4JI4F 4YFUA 2BBEA 3NMRA 4WKRA 2B4OA 3MM8A 4OZLA 5HQLA 2MKKA 2XO7A 2CPEA 2LDYA 2OLWA 1R0BG 4RPFA 4QU7A 2V2QA 4CP5A 4UOCA 3I5AA 1Z1ZA 4KHPJ 3EXYA 3NGUA 3S8SA 2CQIA 4PR6A 4AFFA 3N28A 3L9ZA 1SC3B 2X7IA 3FEYB 5GRRA 2UVWA 1KQSR 3KXDA 1WNEA 2EFNA 3JSBA 1HLWA 4F3QA 2AJ1A 3D3CJ 4OYWA 4YB7A 1RWPB 3MM6A 4M94A 3NL0A 2QV6A 4BBYA 4K8RA 4UOFA 4DUTA 3G6VA 1GMWD 5KFTA 4U9RA 2XZTB 3H90A 2BKNA 1CULA 2EKYA 2HW3A 4QWCA 2MZ1A 1LEOA 3A12A 3KDNA 3PW4A 4MK7A 4U6PA 3CNQP 2ILZA 2BJEA 3NKRA 4WE1A 1HWIA 4PUOB 4DR7J 5D0RA 1WG1A 4DV2J 2QLFB 1F3VA 1RT1B 1KD1T 1N4LA 1RCOB 1HI0P 1HR0F 1NM2A 2BOAA 3DKDA 1XEZA 2CNKB 4IOCQ 2HLUA 3R8YA 2GAGC 1TAUA 1WOPA 2MEWA 3CJKB 1PYTA 5LSOA 1RWMB 3O44A 1VQ4S 2FJWA 2AT1B 3MECA 3OVAA 1H2UX 1H7XA 1S49A 1EW8A 3LO3A 1FKPB 1NZAA 1KHKA 1RYRA 1S6QA 4ECTA 2MZQA 4Y28C 5HBMA 4YB1P 4Y2MA 4FS1A 2NUHA 3QYYA 3C66A 4MT1A 2EFGA 1HBNB 2JJ4D 2W5XA 2J6UA 3N4WA 4P75A 2VFVA 4I6AA 2W2QP 4R5PA 2ABYA 3OD2A 2YVSA 3KLFB 1NB7A 3PKMA 1PKUA 1C1CB 5KFLA 3JSMB 4MIAA 1FA0A 3OBIA 1E2SP 3GCWP 2KHCA 2OSQA 3G82B 5F8HA 3W2WB 1B8JA 4FYYB 4ECRA 1UFLA 1V9OA 4L72B 4X66F 3UN5A 1UTAA 3C16B 3ZNUA 1R0CB 1J5EJ 2PI4A 3CVKA 2V34A 3CXCR 4GO5X 1AJDA 5F8NA 2IY5B 2DNLA 3D0IE 1UVJA 5G4DA 4CH1A 5DLGA 4EBEA 1M5OC 2HIYA 3BGUA 5CYQB 3FSIA 3X3UA 4QQBA 2LEAA 3BSNA 1TKTA 5KFEA 3BDPA 3KJQB 3OL6A 4GC6A 5B0AA 1RISA 3KYLA 3AJ1A 2R8GA 3QLHB 1FFSB 3L95X 2KXNB 1LW0B 1PILA 2YPYA 1L3KA 4WU3A 3T3FA 4ZG6A 3MCSA 4LT6A 1VQOS 4RW4B 3IAS9 5DLTA 4F7VA 1RWOB 2BW7A 1NJIT 2CRLA 3D6HB 3FCHA 1AUDA 2AYEA 3IRXB 3N6NA 3N79A 4WFXA 3W9JA 4KGXB 3W8PA 5AT1B 3EGNA 3MPYA 2C2MB 4X64F 2AWZA 3ET6A 1NH8A 2GFFA 4ITSA 4ES1A 2A1BA 4ZK7M 1HARA 1VS3A 3UNYA 1W2BR 1KDNA 4X4OA 2KT3A 2W01A 4I56A 2N7CA 3I0SA 5LMUF 2OPQA 1DTTA 2VG6A 4JI1F 2EPIA 2BR0A 1Q1KA 2VFSA 3MM7A 2P9EA 4NA2A 3SQGA 2K7KA 2DY1A 3R5JB 1QDUB 2W24A 3LGMA 5C25A 2OPPA 4F8RA 4DN9A 3FZBA 2VB6A 2XI3A 3OSPA 3MPDA 3A52A 2PT0A 1FESA 4TQSA 4YY3J 3M4XA 4KIAA 1RZMA 2HHPA 2MKSA 5F8LA 2AJ0A 3QIDA 4RR5A 2MZTA 4A8SA 1XR5A 3R97A 3BQ1A 2MLYA 1FNMA 3PJXA 2ILYA 1UVNA 1WD6A 1I51B 3ZZOA 2CNNB 2ZZTA 3RAMA 1U8SA 1T3NA 2W4DA 3O6QA 1RTDB 1WI6A 5F8MA 1H98A 1QAJA 4G1QB 3DNCA 3M30B 1F60B 2H1YA 2EC0A 3V4IB 1RXOB 1KH4A 3RR8A 3EMTA 2V0NA 2A6MA 2I6WA 2J6SA 1RUSA 5L1LA 4X4VA 2HFUA 1XERA 3KUEA 4L74A 4YB6A 4AL7A 3J80U 4DR4J 3W9IA 1PJ6A 4DS4A 4C11B 2V69A 2G2YA 4ZLPA 2B5JA 4DV0F 3DLGA 3CDBA 5ETQA 4ALZA 4NPOA 4KQZA 1N0VC 2WK4A 2D69A 1N54B 5H9FK 1HWKA 3HMJG 4RU2A 3RB3A 2W1BA 3BQ0A 3DRPA 3F73A 3NG8A 2ZUAA 2Z30B 2FLLA 2UUAJ 3J7Z5 3K5PA 1RWWB 1KH5A 3IG1B 4UT4A 2YPZA 5T41A 4EYHB 3KG1A 1VRUA 3H2LA 4C3MA 1MLAA 3ZZZA 1U4BA 1HI8A 4JV0A 3DLKB 4E0DA 3RYLA 2CQ3A 4HH0A 3VWSA 4FDIA 2HBQB 3D67A 3MAAA 5IM0A 2JVRA 2E29A 4CCHA 2W9BB 1U8WA 2P6TA 3CO0P 4C8KA 3NKNA 1OQ6A 2CQ0A 4M5HA 4OFZA 4OI3A 4GKJF 2I0XA 2W2OP 1RTJA 3BGLA 2N4DA 1S1UB 2RS8A 1MSWD 1S1TA 3NNHA 2FC8A 1FRLA 5JVGQ 4JYAF 5F41A 3OXFA 2PDAA 2V6AA 3N9UC 1N34F 2MKYA 4MYTA 3NWRA 2VFRA 5FDLB 3CE8A 1Q8BA 2WONA 5A6PA 3NGSA 2MGZA 2HZCA 3IBFB 2C2RA 1EW2A 1GEHA 4KJDA 2WHOA 4QWAA 4R25A 1HBOB 1D9DA 1ZEDA 3NEKA 4NXNF 4C8OA 4HT5A 1S10A 2VIHA 3BR8A 5L46A 3B5QA 3K8WA 2MYFA 3TZWA 4KAVA 3C19A 1WUUA 2MXYA 1QTNB 2DISA 2XWXA 4QAXA 2CJXB 2EK6A 3HHLB 4DBQA 2KRRA 1U49A 4PG8A 4ZDNA 4C8MA 5IS2A 3BDHA 3CCQS 3W61A 1YQHA 3CD0A 1WC0A 3G71S 3ICLA 4ICLB 1C4AA 3VAHA 4FS2A 3VHQA 3UR0A 1P27B 3NAHA 5HK4A 2UXCF 4B02A 4KPYA 5L0EA 2W2PP 1HI1A 5EWEA 1JLQB 3J81Y 5KG4A 4LMZA 5CYMB 3MI7X 4NCAA 2VC1A 2E44A 4NI2A 5KFAA 2J7WA 2D1GA 4N77A 3H40A 2BJDA 7FDRA 3QT6A 1HQEA 1NK8A 2YKMA 3HKWA 1RT6B 1LQ9A 4EK2A 4QWDA 2F9JA 2GMHA 1U1RA 4QWBA 3PW5A 4PABA 3D6TB 5CABA 2PA3A 1FE0A 3ZZTA 1VQ7S 4IH5A 2AW0A 1ED8A 2DIUA 1SC4B 5KG0A 5L9XA 2OI2A 4ANEA 1D9FA 4DSIA 2B9WA 1NJWA 3G87A 2WVCA 4WYLA 2ALYB 3K2YA 2QTWA 1M1GA 2H5JB 3R7SB 1S1WA 4QW8A 2KN4A 3RU0A 4N47A 3ZXWA 4P2SA 2H4WB 2D3OR 3IWNC 2GV1A 3MM9A 2IRXA 4AQYF 4ECZA 3UCUP 1XQIA 2LYVA 2C3UA 5A8RB 1RT3A 3RW6A 2KFZA 5FD1A 1AA1B 2ZM6F 1Y9OA 3L7UA 4M5IA 3Q89A 2HRUA 4PEOA 3FQLA 2OPSB 4K4TA 3T02A 1NDPA 4YDXA 3G8SA 1R43A 3HFZB 4DR6F 3T5JA 5KT6A 1CJUB 3U1NA 5LL6d 3WAWA 4Y6IA 5KFRA 3M6VA 4OHYA 1TK0A 4USMA 4LF8J 5KTQA 2DRAA 2WOMA 2FJDB 1YHQS 1G1XA 3KNGA 2F7VA 4LFBJ 4CWBA 5DQGA 1X60A 1CEZA 1EQJA 3R1LA 2DGUA 2DNGA 4P2MA 3MM5B 3BO4A 4LSZB 5L1KA 3M2UB 1S99A 5HQMA 5IQ6A 5RUBA 1HNZJ 2C3OA 1U1NA 4YDDB 4KGKA 2YXLA 2AJQA 4ZGAA 1M5KC 3V6HA 4B3TJ 4A8OA 3S6EA 4DR5F 2MSTA 1TV6B 3QJJA 1J5OA 3R3TA 1EW9A 1M5PC 2KFYA 2M88A 2B43A 2AYGA 3OTEA 2G1HA 5C7PA 1WEYA 3OVSA 2OPRA 3MFHA 4X4TA 3NGKA 1TFWA 1RGVA 2R8HA 5DJBA 3RRHA 1RJJA 2RQMA 3ED4A 5DGAA 1HQUB 3X1LB 1Y4ZB 1RTHA 4JI8F 2VQFF 1CJKA 4X62J 2RJZA 2HQFA 2CDQA 3KK1A 3FSXA 3H2UB 1FKAF 4USTA 2RKIB 5GAGU 1YIJS 2GA7A 4AD6A 4C3KA 3K59A 5IXUA 4YHHF 1NKBA 3KHHA 2F40A 2HVZA 3EX7B 3IAM9 5CZXA 2ROPA 3HFVA 2NREA 1PC4A 3KLIB 1HL6A 5E41A 2YKNA 4QYRA 5HROB 1IKWB 4YP3A 4LUBA 2QIFA 1TUVA 3BEGB 3PFOA 4ZVGA 5DM7Q 1NRKA 3G6YA 1NHUA 2V4QA 1TL1A 3MK1A 1FRKA 5M2PA 2HMIA 3QRPA 4ED8A 3CJRA 2DR6A 1LKZA 5K14A 4JI0J 2Y1RI 2E1PA 2RF2B 4N7TA 3HHNB 3A4TA 1JJ4A 4KT0C 3MF5A 1RHKB 2DXEA 3QGIA 1EKSA 4DV5J 2DNQA 2V63A 2W9CA 2O01C 2LA4A 4Y00A 4B9MA 2PMZD 1RDRA 1UW4A 1DQ8A 3HKZD 3UN3A 4OL8A 5D3GB 3ENAA 4XDCA 4YR1A 4EMDA 1TAQA 3KTQA 3D68A 1HMVA 4H4KC 3LF0A 2HVDA 1R27B 1T9WA 5KFYA 3CUNA 2HNZB 4DQIA 1W2IA 4UPKA 5HQ8A 2DKOB 2J0SD 3QGGA 3Q8PB 4ENOA 4LR2A 4MKBA 1NK7A 3V81B 5KFDA 4ZLLA 4PCQA 2PFDA 4DSLA 3CJ8A 3UNGC 4LSLB 4NCGB 2LKZA 2EXUA 3IR5B 4I67A 3QSYB 3GR1A 4UOPA 1DQ9A 3CJ0A 1AFIA 1RBAA 3LP0A 2UXDJ 1SC6A 3QPIA 1X9WA 2CPFA 3QT5A 4ZN1A 4DV1F 2IC3B 1SIZA 2PD1A 4G6VB 2FJAB 2MZSA 2CNLB 5EGYA 3MGJA 1K9MT 2CPZA 1GX5A 1S0NA 5B0FA 3CJ4A 4UZCA 3Q23A 2NZCA 1VLOA 2CUYA 2WW4A 1JLBA 3PDNA 4YEAA 5KFZA 1VBZA 4JV1A 2BKPA 1CJVB 1GH8A 5E2QA 4Z7CA 1WHYA 1RADB 1QSSA 2HFZA 3HZEA 2AYBA 3QRRA 3A13A 4OI2A 2F65A 2VF3A 1R89A 2X1BA 4DF8A 1FD2A 4IG3A 3BB5A 2HBZB 3MR5A 2JEGA 3OL8A 4LSNA 3W8GA 2HGLA 5LOQA 1REVA 1WORA 3L3CA 1UMJA 3FC9A 2MY7A 1WHXA 1RLCL 1X0FA 2B7CB 3MEEB 4K50A 4OMFG 5GAEU 3NGRA 1S57A 3TEGA 2ZVSA 5HANA 4J9KA 1PYOB 2OTLS 1RYSA 4CLPA 3PFEA 4OX9J 5LXYA 3JAMY 3MR6A 3SCKE 1HD1A 3BGRA 3CTRA 3IMQJ 3GTYX 3SIPB 4ID8A 5A2QU 1BE4A 5I3UA 2GA3A 3IS9A 3ILOA 1U45A 1TKXA 2KVIA 1CVJA 1KFDA 1ZTTA 3D1OA 2ANHA 4IG0A 3A8JA 2HHUA 2LQJA 1FK9B 1LWCA 1T02A 3FCWA 3F41A 3LP1B 1U0HB 2QA4G 2Y1LB 2EKNA 3UWTA 2GMLA 5KFNA 3PX0A 3JXOA 3HSJA 3NKYA 5B0CA 5HN0A 1UL3A 1WC4A 1WHVA 3ZO7A 1L3SA 2NPFA 3RBEA 2RVJA 2XY5A 4FF3A 1S1VA 2GGPA 3CIMA 2YBVA 3KD8A 2PFFB 2JLEA 1H73A 1TMMA 4KSEB 5GAEI 1VBYA 2VG5A 3DLHA 1OS5A 4FKYA 2FZCB 2M8HA 3W7BA 5J2MA 4ZHRA 4NLSA 4URSA 2J76E 2M3DA 5D78A 5AE2A 5E0OA 3AD7C 4LF9F 3FVYA 1HHQA 4U67Q 4G3IA 5AE3A 4DQSA 4I2PB 2X98A 4FKXA 5B09A 3TZXA 1OQ3A 2MKCA 4ZVHA 1F2HA 2W5RA 5KFJA 1VC0A 2CPXA 3OXLA 3SZZA 3M8RA 4RW6A 3EVWA 3CC2S 3QGPA 2A10A 3E01B 5HLFA 2MKHA 4YMEA 1FTRA 4PWDB 3U1LA 4MH8A 1E3CP 4IOAQ 2QA2A 4LRFA 3I5CA 5ETMA 1BXNA 2JLGA 4JI2F 4B9LA 1FXLA 1CS4B 5F9NA 3DMJA 1LXNA 1VJQA 2ADCA 1V3RA 1Y11A 5DO2A 1AZSA 1MWYA 4B3OB 5DETA 1S0MA 3D9BA 3LUYA 1YITS 1YJTA 5ETTA 2YNIB 5J2PA 5KFPA 4ZMMA 4YS2A 5DG7A 5K8OA 2B6AB 4WBFA 1B0TA 4Q5VA 2XMUA 2R7RA 2E5LJ 4QYZJ 2ZOMA 3T1HF 2BE9B 5JXSA 3DOKA 1PAUB 3KK2A 2EK1A 2VD3A 3ILJA 2XTJP 4NA1A 4LF4J 3WC0A 5KFOA 2IMOA 2G9YA 1HFEL 2BM1A 1C1BA 4ZVUB 1BQNA 2E66A 5KT5A 1NPKA 4F0HA 3OFEA 5JMNA 3FBBA 5I42B 2QT7A 3CT9A 1F5CA 4DR3F 4BWMA 3KWMA 2J0XA 1VHFA 4FYVB 5J1EB 3P5BP 4WYWA 4Y0FA 4Q0BA 1FNXH 2R3VA 4C0OC 1Q79A 4LF7F 1NJZA 2GSOA 4NLGA 3KJVA 3WHIA 2AEFA 1HNWF 1G7CB 1NK0A 4HTIA 3HLUA 7AT1B 4WE1B 1EP4A 1S9GA 1PCAA 1J27A 4LR7A 3P6YC 4DV3J 1QD1A 3DPCA 3QRQA 4DHVA 3CJTA 4WJBA 3FCVA 1VQ8S 1O5JA 5DGBA 1IXKA 5DS7A 2BACA 2QC3A 5K20B 1EJ7L 2LXIA 2MLXA 2NLWA 3AA8A 1X4HA 3GSDA 4OYZA 3U1MA 2K3IA 2BANA 3V5RA 1FX4A 2ZH4A 1XMOF 2GVDA 3M2VA 1G2EA 2XR9A 1N52B 4HL9A 1RU1A 2J9CA 1S6QB 3S1TA 1HQ2A 2LMIA 2ZOGA 2XNRA 1NXIA 1SV5A 5HBMB 4PG7A 4ETZA 3P45B 3EDQB 1I94F 2QFJA 1IKXB 3OT9A 5KG5A 2XLJA 2RE1A 4BLGA 3RW7A 1RI7A 1C2PA 2JX2A 4RJVA 3OFGA 2BJ3A 1YTYA 2CDRB 3C15A 3HPOA 1RA6A 2XI2A 4PWWA 1CBKA 2WSCC 2CQPA 1S6UA 4AL5A 4DOZA 3RRKA 4BDPA 3EZ5A 3BREA 2LCWA 1KP6A 3NS6A 2QMWA 5KXAA 4KO0A 4CI0B 2DIVA 2O66A 4X65J 3SQOP 1NK4A 1C0TB 2D74B 2YNFB 1R6YA 4HEA9 4ZCIA 2L41A 2VQEJ 3FMWA 3M8SA 5M2RA 2MKIA 3AT1B 2BA9A 4P9SA 3DCAA 1NHVA 1Q0NA 1KVKA 3LQVA 5KG2A 4O4RA 4CTAA 1JIHA 3KLGA 1T03A 2XCPA 1HPZA 2Y1IA 4NLOA 2ZFHA 4HR2A 3FBEA 5E7OB 3A8IA 1RWKB 3NS7B 2AMCB 3LAMA 2X1GA 1A0OB 4GKKF 4OV6A 2GLQA 2HQDA 4FXWA 4ZVSB 2DCLA 4E98A 1T9XA 4X4UA 5GMKa 3AXKA 4AQYJ 2OMLA 1WSRA 3NLCA 3M7VA 1ZA2B 2LLZA 2N3OA 2ZM6J 4DSEA 3LANA 3PZPA 4RZRA 1IWGA 2Y0BB 2LVWA 4UZBA 3PKYA 1R8CA 2LQ8A 3ET6B 4J7CA 1FERA 2CJYB 1ANIA 4LFCJ 2IPOB 2U1AA 4ZPCA 1CG2A 4TY8A 2VBYA 3MR7A 2RU9A 4OI6A 4DX7A 5ADZA 3JS9A 4HH1A 4QPTA 4PKDB 3AAWB 2DHXA 2RQ4A 5J2QB 2ZE2A 3T1YJ 3I0SB 1R3NA 1OY8A 2HHQA 4M8LA 3W3SA 4ED7A 1N5SA 1DTTB 2CQ1A 3KNAA 3U27A 2OD6A 3SQGB 2BQUA 3K8VA 1Q86T 1MMNA 2MJNA 3T6JA 5C25B 1P9QC 2OPPB 2FJVA 1WKJA 3U7JA 2VA2A 3UR3C 3T1AA 2BKOA 5K9FA 1LK7A 4HTJA 2Y8WA 2HNYA 2VPXB 4RWXA 5E3RA 4TN0A 2UUCF 2NR0A 4OLOA 4NLQA 4ZOSA 2ZH9A 4CXKA 1RWXB 1PBAA 4O3PA 3TYTA 1TZ0A 3NNAA 5A6WA 4CIOA 1SJFA 4O0IA 2CQ4A 3LOUA 4URGA 3OV7A 1T11A 3AOBA 1UKUA 2RRBA 1QUPA 1NZ8A 2CFXA 3S7RA 1X4FA 3TQ1A 3Q8QB 2OH2A 4ES3A 4C8YA 1R6VA 2KI2A 1OSCA 2WBRA 4PXCA 3MR3A 2WW8A 1K0TA 4K2XA 3SZYA 1QE1A 4Y2CA 1UVMA 1Z2ZA 5L8RC 3VALA 4KBIA 1IM4A 4OX8A 3TJAA 2F4VF 4A47A 5LMNF 2VQFJ 1KWMA 3OQ2A 1WACA 3IDDA 4K4YA 2ZJQQ 3ENQA 3T5KA 4JI5J 4ED5A 1FJEB 2XEXA 3DLGB 5KT2A 2VHGA 1B3TA 4R0EA 2ZHAA 4ZVOB 1SUQA 3CF5Q 4DFKA 2V94A 4ZPTR 1XNQJ 4OIXA 2DR5A 2H5EA 2B9YA 4OZJA 2HWIA 3M32A 1HBUA 3DRPB 4O3RA 2ZH3A 3NXZA 2CVEA 2MTLA 3I4HX 4WXWA 1XK8A 1B0PA 1KOHA 4LF2A 4GTXA 1BC6A 2SXLA 1VRUB 4MK9A 2HK3A 1T3OA 1YJNS 3MPWA 2QLJB 2IM2A 2XSFA 2WSEC 3HVTA 4V19J 3N6MA 3KLHA 2V8DA 3MAAB 3R1HA 3EPIA 3BM7A 2EG1A 2IBOA 2RDIA 2VA3A 3T00A 3GE9A 2JVOA 2IFYA 3CCMS 1Q16B 2XS2A 4Y2AA 3THPA 2CA9A 3CW2C 3QSIA 1REGX 3FZ2A 2GHWA 3BDFA 1VFJA 5KFXA 1RTJB 4C9DA 1XIQA 3BBBA 2FLNA 1U0SA 3L09A 2R7SA 2BJ8A 5TJ3A 4CO4A 2E5IA 1M90T 3PYFA 2KJWA 4ZCLA 2WONB 4J9NA 1YZ6A 2I1RA 5IZHA 1GK8A 2CNOB 4KYZA 2EFQA 1VK3A 3BSCA 4FVCA 1XNRJ 3EICA 4FBTA 4O44A 3SCJE 3MEGA 2OFHX 1KQFB 3UE2A 2HAFA 4IR9A 3CJ2A 1T7PA 2E9ZA 2Z2MA 4CXUA 4RUCA 3Q24A 2EFVA 2FD2A 4YOEA 1U48A 2CIMA 1HJKA 2CQ2A 1JNZB 2M9KA 2QZUA 3KHGA 4CO2A 2AP6A 4IRCA 3HXMA 5T14A 2KH9A 5GMDA 3WIUA 4OLPA 4GC7A 1X9MA 5D4LA 2HGNA 4OI1A 1UP1A 1Y0HA 4MIBA 3BR9A 3T5HA 1U47A 1VQKS 4TU7A 5IT4A 3GFHA 4M5MA 1WDDA 1DJ0A 1NO8A 2E1RA 4DR2J 1FXDA 4NI2B 3JYTA 1M5HA 3DHXA 4RW8B 3OR1B 2XMTA 4QR1A 2BQ3A 3V6JA 2C2EA 3VGVA 1DBDA 2C28A 2YKMB 1FO1A 4G1PA 2D7SA 3VR1A 4A48A 4RUAA 1FJGJ 2C3PA 4DZ6A 4K4ZA 1MWQA 2M8DB 1FWLA 4AE5A 4DUZF 2LA6A 3V6KA 2DR9A 1ZEBA 2H65B 2NUUG 4Q2LA 4USHA 4Y2KA 4DV7F 3NWGA 2KKHA 4JI6J 4OJ3A 1RA7A 3GSIA 2FHMA 3MMBA 1K1SA 2HBYB 1T9UA 4LF5J 2R4FA 5KG1A 4A8KA 2HQGA 2CPIA 4ILMA 3FNNA 3QJLA 3AB4B 2VUGA 2K06A 2IM3A 3ENVA 2ZEJA 3B4DA 1UFKA 2CPJA 3MM9B 3M6XA 2IUCA 5KFFA 2GIRA 4P52A 1KKHA 4NMLA 1IKVA 1VQSA 1EZZB 1FDDA 4Z2XA 1S6PA 2DO0A 4W98A 1FTCA 1AUSL 5IWAJ 3MD3A 1KQKA 4ZKAA 1HNXJ 9RUBA 2GQ2A 3DU6A 5BJRA 2YX1A 1RSCA 3BO3A 1Q8KA 2WVEA 1I6JA 1EB0A 4K2JA 2DEIA 5LJ3Y 1UA0A 2KYXA 1EQMA 2W25A 5JUMA 1KR4A 3HDSA 2Q66A 2UUTA 3K5MA 1YRXA 2WOMB 3W2VA 2G0IA 4B3RF 2ZD1A 3HVRA 3C46A 2ZH5A 2R8KA 3EWGA 5E3PA 3TEHB 2NXUA 4WTOB 2VKRA 1BGXT 4CNYA 1FXRA 1YSJA 2BZ2A 1IKYA 2HYIB 1TL7A 4W92B 2CZ9A 2HHHJ 3UFCX 1YBTA 4ED1A 1TUWA 4WFNQ 2WAQD 5HMZA 1AXQA 1IJEB 1J5OB 5LQQA 3D1HA 4FNIA 2AGOA 3TQEA 1BQMA 2UUBF 4HHHA 3W64A 1AJCA 2HVHA 1FDNA 2V9KA 1F5BA 4OZ0A 1QVFR 3LGNA 2HG4A 2GHPA 3ITHA 5BYSA 4DSKA 2IFXA 4OYBA 1DAXA 2F8EX 3DC2A 2Y9HA 1I1GA 6AT1B 1RTHB 2O3DA 3OFFA 3W1YC 3Q8RB 3FQKA 3KK1B 1WJ9A 3LALA 1U1PA 3EJMA 1GAOA 3MCMA 2GSNA 1UPMB 1H74A 2XYHB 3BDEA 1Y3JA 4RW9B 1ZA1B 4FYXB 1SL1A 1Q82T 2H54B 2BVZA 3VCDA 2L9NA 1SJ4P 3PYGA 5KFVA 2B9EA 3FFIA 2EFPA 4IFVA 2YKNB 2DXDA 4OYOA 2DGTA 1RU2A 1UFWA 2HBRB 3OR2A 2C2KB 1H3DA 1IBKJ 2PE8A 4WP9A 5GMEA 3MEDA 1Y5IB 1TL1B 3JAMU 3HT3A 1NDCA 1ZOTA 2HMIB 3UPFA 1ZBTA 5BR8J 4OZ1A 3UN2A 4PWUA 1QAXA 2G0JA 1RHRB 2VJUA 2E1CA 2MSSA 2DHSA 3FK4A 3BGFA 1HNWJ 3IGVA 4L76A 3AD9C 4PPZA 2LQBA 1S4FA 3W5YA 3E2EA 1S48A 3V2UC 1RCXB 2BYCA 2W9CB 1UEVA 4Y3CA 1LW2A 3PRVA 4DL5A 2QEXS 3VVUA 2AKWB 2E5GA 4GMKA 2YQ3A 1KTVA 4IDKA 4FZVA 1V5IB 3BKFA 3EZUA 4DSFA 3M8PB 4MYUA 1IR1A 1Q8LA 1HMVB 4PQAA 5F3ZA 4QW9A 4ZP9A 4L3KA 5EN1A 1VQ9S 4RO0A 4J91A 2VBWA 2GMJA 2DR7A 5GADU 4QCLA 2QFIA 4PXDA 1ALJA 4J9PA 3UVJA 1IBMF 4PUOA 2RSQA 4F4XA 1UWAA 4GTWA 2HQIA 1ZZNA 5HJYA 2FDNA 4LRBA 2OIHA 1FCAA 2GIFA 1UVIA 1YRTA 2DT9A 5I3PA 2ZZMA 3I87A 5KFUA 4DF4A 1T94A 5AJ3F 3M6UA 2YWKA 3BF4A 3TUPA 3CJKA 1U6FA 3LP0B 3GJRB 1RWUA 2C2DA 2MKJA 4UTGA 1BQXA 4EFAC 3GV5B 1Q95G 2XZDB 1EARA 5SUHA 5LSLA 5HATA 1H72C 2RRNA 3W65A 1A6LA 2WB4A 3RBZA 2B8QA 1HBNA 2F8MA 4KGZB 1JLBB 1N8RT 2N3LA 1JKHA 5K8NA 4F4AA 2HLTA 1IM6A 1NU4A 4OHXA 2V8VA 3CC4S 4F67A 1K47A 2YKQA 1C1CA 2M2BA 4USJC 3AQPA 4URQU 3AD8C 3G82A 2DGQA 2CZ4A 3M1VB 2OTJS 2GJ2A 2AX0A 2W8DA 1R31A 1DLOA 2BV3A 4IG3B 2V68A 4UY8T 1JQGA 1NSQA 4OJ1A 4C0BA 8AT1B 1LOUA 4LSNB 4AUKA 1IBLJ 1YBUA 4DN0A 2IYGA 4CDIA 3PO4A 2Z4PA 4K5RA 3MHYA 4QBUA 5CCLA 2DYAA 1REVB 1ZAXA 1E6VA 1X8DA 3TP2A 1UW9A 2HZVA 1SB6A 4DWIA 4FYDA 5CYQA 4OYIA 2VDIA 1FT8A 2R7OA 3CJ3A 3QZ7A 3DGPA 4CLZA 4B3SF 1VRTB 2W7AA 3GJSB 3BGRB 1NEEA 3QAEA 3VGUA 5HAOA 1JJCB 3HI9A 5I3UB 2AD9A 3IS9B 2XC9A 4JV2A 3IRXA 2XULA 2RIJA 3DXSX 5U47A 4J9VA 3Q3QA 2H4YB 1K8AT 1WKKA 4EYIB 3H0PA 2DBBA 4XIUA 2OHDA 2ASLA 1LWCB 4W4MA 3QFWA 1BWEA 4KM4A 2V8GA 3AH6A 5INHA 3J81j 1VOMA 4WCEQ 4NA3A 1AJAA 3CCRS 1RHUB 4MJKA 2HEKA 3N01A 2D3ZA 3T19A 4WWSA 2MJUA 1GMVA 1FVSA 4ED2A 4N8NA 2VODA 1YJWS 4JB8B 2V8PA 5B0DA 4DUYF 1S1VB 3DLEA 3IGYB 2GGPB 5D8HB 1YJ7A 2C2NA 4DPWA 5THWA 2VG5B 3DLBA 2RAQA 3PW2A 4NYOA 4K0KJ 5J2MB 4ZHRB 1ELYA 4PQUA 1VC6A 4DL4A 2ACMA 4XK8C 4O3QA 2DR8A 4DV4J 1WG5A 3DU5A 2QYCA 3R6GB 5KFWA 4YR0A 2P6SA 2AGQA 2YQ0A 4KHRA 2HWTA 5J2NA 2BRLA 4DL2A 5HI7A 4K59A 4XDDA 2UV8A 2NXCA 4LQYA 2PEBA 1D8YA 1EIYB 5ETPA 4ZVTB 1ZM2A 4RW6B 4JI7J 2DHAA 2IRYA 5G0RA 1H2VZ 4J37A 3BV8A 1Q5YA 4G1QA 3M30A 1RT5A 4UY85 2YWEA 1KC8T 5EX3A 2UXBJ 4DL6A 4IH7A 1ZAWA 1V3SA 1G3OA 1OSDA 4ETXA 4UF4A 3DMJB 1QJHA 2RRAA 1NJXA 3OLBA 2G0CA 5J2PB 1Q78A 1KVJA 2Z58B 4ZG7A 4C11A 2YX4A 3I6PA 1LWEA 2VU5A 4G1IA 2D3UA 2B4UA 2LEPA 4ES2A 4ELTA 3VAFA 3G6ES 3I31A 1D1UA 4EO6A 1U7LA 1R0AB 1QAYA 2NSBA 3KJFB 1KOOA 1F9HA 3KLVA 3DOKB 5FLXU 3VAMA 3PHEA 2X3DA 4HLBA 2H3EB 4DR1F 2HHVA 1F2GA 2KRBA 3A8KA 1PJ7A 4RNHA 3A8EA 3DM2A 1X0PA 2CQCA 1C1BB 4OHVA 3KUHA 1BQNB 1X4GA 4F3MA 5LIAA 4DZDA 2XQCA 3FBFA 2APOA 3NKPA 2IM0A 4KHPF 4J9MA 1HNIB 3DLKA 4QIVA 5L9NA 4OV1A 2QO3A 2DNNA 4Q0BB 3HF5A 4FPRA 3PV8A 2CVIA 1DZ5A 3BSOA 4C98A 4NLYA 2K7JA 3KJVB 1SXLA 2KJVA 1N33J 1XBWA 2EWHA 1LV5A 2BE2A 2ZZNA 2CYYA 3S01A 2BEFA 5C2CA 1EP4B 1S9GB 4B3MJ 2GQCA 1QLNA 2HVIA 4DPXA 4QWEA 3AOAA 4O0NA 2YX7A 4IFYB 1TK8A 5EUHA 3NCPA 2IVMA 2GZOA 4ZVQB 4JI3J 4K4VA 2R7UA 1FFGB 3E8OA 1GXUA 1RT7B 2BANB 1RAFB 2UU9J 2GVDB 3M2VB 1CLFA 4DR7F 4TY9A 1ZPVA 1NK9A 1SV5B 3QQCD 4P72A 2XM3A 2HQCA 3GQCA 1JLGB 2GC8A 3MPVA 2L48A 2ALZA 3GFZA 5F8IA 3KDOA 2UVVA 4R0JA 2NQPA 1FF2A 1NB2A 3QWPA 3W66A 3C15B 3LGHA 1U25A 3NCQA 3PW7A 3J7ZT 3HHLA 3EGVA 1KH7A 2RH3A 5L1JA 1O51A 3GJQB 3AXMA 5KT3A 1FNOA 5MAOA 3R6LB 4CLSA 3CCUS 3UD4P 1NHKL 2H9ZA 3ZZYA 4KO0B 4NLUA 1FRJA 2D41A 2PEHA 4LFAJ 4F04B 4USIA 2C22A 4ZJOA 1GX6A 4J9LA 1BD6A 4WIQA 5FIIA 4PAAA 1HIYA 3KG0A 3OW2R 2A2DA 4LREA 4OZ3A 1VK8A 3J80Y 3M9OB 3GIIA 3NBPA 4ATNA 2O67A 3NMAA 4CTAB 2GS8A 3HJVA 3CCSS 3KLGB 1T03B 4ECXA 2H48B 2GVZB 5AXKA 4NYPA 4PYAA 3GYXB 1HPZB 2QL7B 3M8ZA 1VR6A 1T9TA 7FD1A 3C14B 5D4PA 1VJWA 3H4BA 1RTZA 3Q22A 2CADA 4H4OA 5ETSA 2D9PA 1RHJB 1HWLA 3E3XA 1CJTA 1J5EF 1KN6A 4YR2A 3PIOQ 1I5OB 5A76A 3NKOA 4CYUA 1KLMA 4C8ZA 4BC9A 1WEZA 2Q79A 1RQ0A 3GZ7A 3HX9A 2RT3A 3FKBA 2E9TA 3W5XA 2CAJA 3CMQA 5GVQA 4TYBA 1JB0C 1GNKA 4TY8B 2MQPA 3GV8B 3QO9A 3AODA 4EGLA 4OYAA 3CIZA 3GIRA 2E1AA 2DGWA 1SPBP 3BJYA 3ISZA 5IJSA 4JUZA 2AJ2A 3O3LA 2ZDOA 3CCJS 5DZ7A 3K0JA 1S12A 3IRWP 4NXMJ 5J1NA 1RABB 2VOPA 4EUVA 3C6TB 2XHCA 2ZJPQ 4ID5A 2V50A 2DNZA 3P49B 2HHXA 1S97A 2DPIA 2ZH1A 1WSVA 1HHTP 1YI2S 5DM6Q 6FDRA 2BOPA 2E5HA 4TU9A 1FWKA 2C3YA 4OX6A 3GYGA 1SH2A 4ELVA 2ZNZA 2R7VA 2D3O1 2W5VA 1R8PA 3ISND 5E3QA 3SCLE 4XO0A 3TW0A 1JJHA 2JDJA 3A3NB 1XMQF 3IN5A 3IXQA 2HHWA 2ATCB 5KFSA 1LK5A 3SFUA 4YY3F 1BLUA 2JZ5A 5CH7B 2NYHA 3OTOJ 1ANJA 2CJQA 1X4AA 1EHWA 3QJPA 3ZTSA 3H59A 2V2KA 2B0GA 1WF2A 2PGCA 1TV6A 2IM1A 4XPEA 3R5GA 1N32J 2COLA 3EGWB 2WSFC 5J1PA 1S6OA 3N5FA 1X4BA 1S77D 3TI0A 4KKOA 1WOSA 4ZPAA 2EBEA 2YWGA 4S0MA 2FHOB 4U7CA 4KV8B 3V4MA 3CDEA 1SL0A 3BDGA 3D54A 2HSEB 2FHJD 3W5ZA 4CH0S 4DV6J 3NKMA 3QZ8A 4HACA 3OVBA 3PY8A 4TYAA 2JHEA 3HZGA 2OP5A 4DX5A 3PJ9A 1AJBA 3M8WA 1RKIA 3I32A 3D2WA 1VQLS 1MROB 4PG4A 3LP2A 3QBCA 4ECVA 3TZYA 2FVRA 3M32B 1HBUB 2VH7A 3EGZA 2FUG9 4DR4F 3EVOA 3RB4A 2KXHA 4KE5A 4LBIA 4CO5A 2ZHBA 3LTOA 1TKZA 1YLXA 2I9SA 2E7WA 1RT2A 1IKWA 4I69A 1U09A 4LF6J 1FJCA 1F1BB 3HVTB 3IM9A 2XY7A 4NEZA 4EU0A 2YWHA 3DRSB 3VZHA 3DHWC 1UAWA 4WTYA 2HIQA 2YNGA 1OPZA 4DU8A 3Q2TC 5ETLA 2UUAF 1NBEB 2GIQA 4F2SA 2CWXA 2MDAA 3TVKA 3CCES 1CC7A 5HL7Q 2I2YA 3OTDA 3JTOA 2V9WA 3IBWA 1P49A 3DOLB 1T05B 1E1ZP 3VV2B 3AA9A 4CLKA 2AQ4A 4EBDA 2DHHA 3LWMA 4Q43A 3UD3P 2B9XA 4B56A 2WVFA 1DFDA 2DEJA 3CCVS 4U7UD 4QIGA 3CGIA 4I64A 2BQRA 2HNZA 1LFWA 4B9VA 2IAJA 4O44B 3CJ5A 3MEGB 2Z2YB 4USKA 2RB7A 4O4GA 4ZCMA 1FDAA 2PA8D 2K1RA 2MHEA 3R5AA 1U02A 2ZH7A 4NL5A 4LSLA 3Q86A 4X4SA 3GFXA 1AW0A 1UCNA 2KO1A 3A3OB 1VMBA 2XSJB 3PCOB 3LPEA 5LRNA 2IC3A 4PZVA 3PO5A 5H9FJ 3DRRB 2K8GA 5DLWA 4IYQA 1KHWA 3F0NA 3NNCA 3TAQA 5C24A 4ZPWR 2J6TA 1CSJA 5A8WB 2Q6BA 4WP3A 4MIWA 4JOUA 4ZPBA 1HD0A 1IQZA 3MCNA 3JYTB 3MMAA 2VJVA 1G4CA 2W2NP 4I2QB 1K44A 4DPUA 1XWLA 3PX4A 2D1CA 3FUYA 4DLGA 1T95A 1CPZA 4QR2A 2Z56B 5H1SV 2GO9A 2ZITA 5K8PA 2V5HG 3OJUA 4GVBB 4OI4A 4CM0A 1SQFA 1RT4A 4RX6A 4FF1A 4WZMA 3TUZC 2VBXA 4WPAA 4B3SJ 2FJBB 1MN7A 4RW7A 5HVGA 2DY9A 2QMXA 3LA0A 3PG9A 4K4SA 3MMBB 5IV3A 3M8QA 1F9FA 1SHNA 4UQGA 4A8QA 1SJ3P 4CLLA 3OL9A 4CLWA 3EUNA 4ZA1A 4KB7A 3PX6A 3GONA 4QIFA 3US5A 4CO0A 2DH9A 2XMWA 4N76A 4C2MA 5DDOC 5B0EA 3FMBA 2M52A 5KFBA 2W2MP 3WAXA 5A0YB 4N41A 4LBHA 4LIWA 1URNA 1FX2A 3D3BJ 2IUCB 3QWUA 1U26A 4P7VA 4IOBA 1IKVB 5D77A 2E5JA 1S6PB 2UZAA 1D9AA 3OHAA 3J7YU 1AB8A 4OYMA 2VG7A 4DUYJ 1JLCA 2EG2A 2DD8S 1SQEA 2ZUGA 4UOGA 1KLNA 1KHLA 1FK9A 1JXVA 3Q8VA 1ZM3A 5HMXA 4XPCA 1ZS6A 4JI4J 2CQGA 2OD4A 3AJ2A 3LP1A 2X1AA 3L4BC 1Z4UA 2HHSA 1U0HA 3HHEA 4DCOB 5K8MA 2NPIA 3W2VB 3TUJC 2RQCA 1KHJA 2ZD1B 3ENWA 3I0RA 4JBCA 1H2TZ 1WHWA 2WVDA 1FJ7A 2FPHX 3TG0A 4M5DA 3QIPA 1JXEA 3OSNA 1WI8A 1URBA 3RAXA 1TL7B 4BWJA 3ISNC 4NLTA 3O5TB 4ZPDA 4P2XA 4PXBA 4KAIA 4CQ1A 4LF8F 4ZCKA 3KJNB 1TK5A 3OTBA 1RAGB 5T7LA 4LFBF 4OQJA 4BS2A 4OJGA 3ZTQA 3J7YI 1S59A 3H8YA 2FJEB 1Y5NB 4DJBA 2AV5A 3KMQA 2Y8YA 2O1PA 4MAKA 5A8KA 5I3QA 1FRIA 3FEZA 2JWNA 1IQTA 1L3TA 3MEKA 2FHKA 3ITHB 4CLTA 5EGHA 4B3TF 5KAKA 1OY9A 5GAGI 2V2ZA 2QLBB 1HR0J 2R8IA 2HKEA 3DI6B 4C4WA 4C6AA 4TKTA 3OUYA 2IYIA 3P4UB 4GO7X 4U7UK 1JLAA 1UEUA 2C42A 4OI0A 1JJ2R 1N5YA 4I7FB 2YNIA 1MG7A 4IFVB 4F0MA 2B6AA 2FZGB 1ICEB 3O1LA 3ULHA 4X62F 2F4FA 3OR2B 2OELA 3MEDB 2X1FA 1TKDA 1O8BA 4AT1B 1U1QA 2V2VA 5KOWA 5E33A 4DPOA 2Q6CA 2IJFA 3H4DA 1WWHA 1S9FA 4HYKA 4LIRA 3H7HB 2XNQA 3K57A 3CCTA 1KRPA 5F0UA 4DXLA 5I42A 4C3LA 4RNMA 2LDIA 3V6DB 1LW2B 1N48A 1N5VA 2L9WA 2G2OA 5A2QY 1ELXA 1U24A 3TVYA 2VICA 5J1EA 1UVLA 4X66J 4DCPB 2BDPA 3QATA 3ETMA 3NGDA 3OFHA 2C2OB 4IDKB 4ANDA 5KG7A 8ATCB 2LQ9A 4UPIA 4JI0F 4YR3A 3LWLA 1MU2A 1T0TV 3H5UA 3R27A 2MQOA 1KHNA 1FSUA 4DV5F 1X31C 5HP1A 4XAKA 1HW9A 3UVJB 1VQ5S 4OZ5A 1JLFB 4BC7A 5L38A 2BX6A 2DNRA 1SCJB 2ZKUA 3DN9A 4KGVB 1QUVA 2V4JA 1ZM4A 4NLWA 5C42B 3T41A 2C3MA 4RLEA 1HWUA 2ZWPA 3G8TA 2W9AA 4ZVRB 4Q45A 3WC2A 5E3CA 2IHR1 4B9SA 4M5KA 2VL1A 1Q53A 3POTA 4HI1A 3QT8A 4HHJA 1S9EA 1QTMA 3Q8UA 5DDQC 3GMGA 3SMZA 4ZLNA 1H38A 4X64J 2WB1D 5IFMA 1BUXA 1RACB 1IKXA 2FTRA 2FHJA 3ZFVA 4JP8A 2V67A 1X5PA 1JKHB 4ECUA 2UXDF 2XO6A 3DDNA 2XMKA 1SI9A 3MD1A 2ERRA 4KPCA 4QPXA 2RD5C 5LMUJ 1ZPWX 1FRXA 4JI1J 4G65A 3I4PA 3Q83A 4K4XA 3HVAA 4LRCA 1DLOB 1DTQB 2L08A 2A6OA 2UVUA 5B0BA 4ED3A 5H9EK 1C0TA 3HK2A 2YNFA 4GVLA 3NAIA 1U2FA 1E6VB 1NLKL 3NOGA 2WZ1A 1VQ6S 1X4EA 3CPWR 3GP9A 2EC2A 2GHVC 1CQMA 4F02A 5EHHA 1AYEA 1SVDA 4DL7A 3SDEA 1JWWA 4K4WA 3PIPQ 2ZBQA 3TUIC 2XG8A 3DGPB 3PTWA 2XHWA 2OGUA 2QN6B 3FDSA 2RDJA 4ILLA 3RJMB 2GCFA 2G13A 3CD5A 4CNZA 4NX9A 1OYDA 2QL9B 4NZ6A 3MTKA 3VVTA 4ZJLA 1NK5A 3HULA 2MMYA 1TVRA 2ZVIA 2AJFE 4PG5A 2YKAA 3OPKA 4DV0J 3P8BB 4OX9F 2MB0B 3KK3A 1T9YA 3KHRA 2KFNA 3WIVA 3ILLA 3CMES 3DDKA 1GTHA 3JQMA 1YG0A 4IO9Q 4F4KA 4X4RA 2HNDA 2J9EA 1XN9A 5K4PA 3DDIA 1IR0A 1UWBA 1FEEA 5J2QA 2W8SA 2KXFA 3ONQA 3OHBA 2R8JA 3DLEB 4EWTA 1G6BA 1YJRA 1U2RA 4UUWA 3DXBA 2CJ9A 4GRSA 3HP6A 1VIOA 4EEYA 3F56A 3MM8B 2KVQE 2XWYA 1HA1A 1W25A 3J7AN 1XR7A 4ZIWA 4PQUB 5EX0A 1XMQJ 4CYSA 4DFPA 3CMAS 4KRWA 3DLLQ 4USVA 2JC0A 4DU7A 2RU3A 3NCRA 1SJRA 3GWCA 2R7WA 4HHUA 4I68A 1HBMA 5J2NB 1KHVA 3CDUA 1TP7A 3W62A 3IGZB 2YKOA 5CAAA 3KLEA 4EBCA 2EI5A 4NWJA 5G0RB 5EWGA 3OXGA 3MM6B 4GKJJ
chains in the Genus database with same CATH topology
3WAYA 3BDGA 4LRAA 2VQRA 3MK0A 1SHQA 1EQJA 1AJDA 5LRMA 5DLWA 2XR9A 2ANHA 1ALJA 3NKMA 2W5RA 4KM4A 3BDHA 5INHA 3NKPA 2W8DA 3SZZA 1EW8A 4GTWA 1EI6A 3WAXA 3BDFA 5K4PA 5IJQA 1AJAA 3M8YA 3NKNA 5GRRA 2IUCB 1AJBA 3LXQA 3MK2A 4LRBA 1KHKA 3M8WA 1E33P 2W8SA 1O98A 4UPKA 1P49A 2IUCA 1E1ZP 3NKOA 3OT9A 5TJ3A 1K7HA 4KAYA 4LR2A 2GLQA 2ZKTA 5L0EA 4GTZA 4TN0A 1ALIA 1E3CP 3A52A 4ZGAA 4LRFA 5LQQA 1N2LA 4NWXA 4LR9A 3IGYB 3UN2A 4ZG6A 1KH7A 4B56A 5HRTA 3E2DA 3MK1A 4MY4A 2W5XA 1Y7AA 2GSOA 2W5VA 4CXKA 4UPHA 4LRDA 5L0BA 5DLTA 3M7VA 4UOPA 1EW9A 3CMRA 2D1GA 4CXSA 1O99A 3WBHA 1AJCA 1KHLA 1EW2A 4KJDA 3KD8A 4ZG7A 2W5SA 4UPLA 1ALKA 3TX0A 1HDHA 3T01A 5EGHA 5L0KA 4N7TA 3T02A 1ELXA 4CYSA 1ELZA 1ZEFA 4ZG9A 1ELYA 4GTXA 5EGEA 2XRGA 5KXAA 1ZEDA 4LR8A 4LR7A 1E2SP 1ANIA 1ANJA 2GSUA 3DPCA 3NKRA 1KH5A 1B8JA 3TWZA 1ALHA 3WAWA 2RH6A 4UPIA 4CXUA 1KHJA 5GOVA 1ZEBA 1URAA 1HQAA 3B5QA 3NKQA 4GTYA 4MHXA 4UOOA 3IGZB 4UORA 5AJ9A 5IJSA 5C66A 3WAVA 3ED4A 3SZYA 1N2KA 4KAVA 4LREA 4MIVA 1AUKA 1SHNA 3UN5A 3UNYA 4KJGA 2GSNA 3UN3A 1KHNA 1KH4A 4FDIA 1FSUA 1EJJA 4FDJA 2GA3A 1ED8A 1HJKA 4LQYA 4NWJA 3BDGB 4CYRA 4YR1A 2QZUA 1ED9A 2X98A 3DYCA 5LRNA 3IDDA 3TG0A 3T00A 3NVLA 1Y6VA 1KH9A 3Q3QA 3M8ZA 5DLVA 3UO0A 5LIAA 2IFYA 2W5QA 2W5WA 2G9YA 2W5TA 4QAXA 4LRCA 1URBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAY A;  3BDG A;  4LRA A;  2VQR A;  3MK0 A;  1SHQ A;  1EQJ A;  1AJD A;  5LRM A;  5DLW A;  2XR9 A;  2ANH A;  1ALJ A;  3NKM A;  2W5R A;  4KM4 A;  3BDH A;  5INH A;  3NKP A;  2W8D A;  3SZZ A;  1EW8 A;  4GTW A;  1EI6 A;  3WAX A;  3BDF A;  5K4P A;  5IJQ A;  1AJA A;  3M8Y A;  3NKN A;  5GRR A;  2IUC B;  1AJB A;  3LXQ A;  3MK2 A;  4LRB A;  1KHK A;  3M8W A;  1E33 P;  2W8S A;  1O98 A;  4UPK A;  1P49 A;  2IUC A;  1E1Z P;  3NKO A;  3OT9 A;  5TJ3 A;  1K7H A;  4KAY A;  4LR2 A;  2GLQ A;  2ZKT A;  5L0E A;  4GTZ A;  4TN0 A;  1ALI A;  1E3C P;  3A52 A;  4ZGA A;  4LRF A;  5LQQ A;  1N2L A;  4NWX A;  4LR9 A;  3IGY B;  3UN2 A;  4ZG6 A;  1KH7 A;  4B56 A;  5HRT A;  3E2D A;  3MK1 A;  4MY4 A;  2W5X A;  1Y7A A;  2GSO A;  2W5V A;  4CXK A;  4UPH A;  4LRD A;  5L0B A;  5DLT A;  3M7V A;  4UOP A;  1EW9 A;  3CMR A;  2D1G A;  4CXS A;  1O99 A;  3WBH A;  1AJC A;  1KHL A;  1EW2 A;  4KJD A;  3KD8 A;  4ZG7 A;  2W5S A;  4UPL A;  1ALK A;  3TX0 A;  1HDH A;  3T01 A;  5EGH A;  5L0K A;  4N7T A;  3T02 A;  1ELX A;  4CYS A;  1ELZ A;  1ZEF A;  4ZG9 A;  1ELY A;  4GTX A;  5EGE A;  2XRG A;  5KXA A;  1ZED A;  4LR8 A;  4LR7 A;  1E2S P;  1ANI A;  1ANJ A;  2GSU A;  3DPC A;  3NKR A;  1KH5 A;  1B8J A;  3TWZ A;  1ALH A;  3WAW A;  2RH6 A;  4UPI A;  4CXU A;  1KHJ A;  5GOV A;  1ZEB A;  1URA A;  1HQA A;  3B5Q A;  3NKQ A;  4GTY A;  4MHX A;  4UOO A;  3IGZ B;  4UOR A;  5AJ9 A;  5IJS A;  5C66 A;  3WAV A;  3ED4 A;  3SZY A;  1N2K A;  4KAV A;  4LRE A;  4MIV A;  1AUK A;  1SHN A;  3UN5 A;  3UNY A;  4KJG A;  2GSN A;  3UN3 A;  1KHN A;  1KH4 A;  4FDI A;  1FSU A;  1EJJ A;  4FDJ A;  2GA3 A;  1ED8 A;  1HJK A;  4LQY A;  4NWJ A;  3BDG B;  4CYR A;  4YR1 A;  2QZU A;  1ED9 A;  2X98 A;  3DYC A;  5LRN A;  3IDD A;  3TG0 A;  3T00 A;  3NVL A;  1Y6V A;  1KH9 A;  3Q3Q A;  3M8Z A;  5DLV A;  3UO0 A;  5LIA A;  2IFY A;  2W5Q A;  2W5W A;  2G9Y A;  2W5T A;  4QAX A;  4LRC A;  1URB A; 
#chains in the Genus database with same CATH topology
 3EE3 A;  1UJ5 A;  3I5B A;  4H4M A;  1RT5 B;  2BE7 D;  3CCL S;  3D1Q A;  4JYA J;  1N34 J;  3IGN A;  3M2R A;  1CUL B;  3CUL A;  2LP4 A;  3NOC A;  3K89 A;  3G86 A;  2POK A;  2EEY A;  4Y2I A;  4A8X A;  1RHQ B;  2FLP A;  4X4Q A;  3RAQ A;  2ZKT A;  2ZBC A;  2QZ8 A;  2WRM A;  4WFB Q;  4MY4 A;  3BO2 A;  3TAP A;  1YX2 A;  4N8O A;  3TAM A;  4NXN J;  2AF6 A;  2OSR A;  1LWE B;  4XTT A;  4WF9 Q;  2RHS B;  5MLC V;  1EET A;  3QNW B;  4IRD A;  3CCZ A;  2ASY A;  2CPD A;  2QJ3 A;  2FVQ A;  1YKW A;  3MEC B;  3R7N B;  2N4C A;  1FWP A;  2AJ4 A;  1Q4R A;  3BZQ A;  1A9N B;  3DM2 B;  1FVQ A;  1L3U A;  5HMW A;  1LWF A;  4WFA Q;  3MDF A;  5IQQ A;  4ED0 A;  2FGC A;  2EVZ A;  2E5L F;  1ARO P;  5H9E J;  4DQP A;  4LRA A;  4MKY A;  3CED A;  4W90 B;  2OO4 A;  4LQ3 A;  2UXC J;  2JEI A;  4DFJ A;  4R5P B;  4TU8 A;  4LF4 F;  3DYA A;  1YJV A;  5CYJ A;  4IKA A;  3M6W A;  2JH3 A;  3R5D A;  4KAY A;  4R8U A;  2JSX A;  4HVZ A;  1RAE B;  1ZYQ A;  2BE2 B;  1NSA A;  2W7O A;  3PYE A;  4AYB D;  2Y0S D;  2W5S A;  4A8Y A;  5JJB A;  1PO6 A;  5CZV A;  1KON A;  1RHM B;  4A8M P;  1PIE A;  1ELZ A;  1YZ7 A;  1A7G E;  2UVR A;  1MNE A;  3BYP A;  2XLK A;  3ZZU A;  3GJT B;  2GSU A;  4WII A;  2RH6 A;  3BN7 A;  1DY3 A;  1TKT B;  2I38 A;  3FSY A;  4FYW B;  2OEJ A;  4DV3 F;  1Y3K A;  1WOO A;  4O3S A;  4QOT A;  5F9L A;  1P1L A;  3PW0 A;  1H0H B;  2ZHO A;  2KT5 A;  1RTI A;  1IWA A;  1F6T A;  2JC1 A;  1JK9 B;  1R8H A;  1P8G A;  2DNY A;  2LEB A;  4BCA A;  5IJQ A;  3GG0 A;  1OMS A;  3W63 A;  3TVZ A;  2PO4 A;  3TNV A;  2QA4 S;  1WC3 A;  1XTZ A;  4ECQ A;  3M9M B;  2Q1L A;  4QIE A;  4ZLJ A;  2RDD A;  3BPD A;  3VZI A;  4DR6 J;  2NCK L;  1IVZ A;  4NAS A;  4RL1 A;  4DG1 A;  3EDR B;  4YUD A;  1RBL A;  4DQQ A;  2IRU A;  5D4O A;  2MLZ A;  2HPU A;  2IIH A;  2JOQ A;  1T9V A;  3IR6 B;  3FEX B;  4FN5 A;  5DDP C;  1PBU A;  5D15 A;  3DRY A;  3BBC A;  2OPQ B;  2VG6 B;  4RW8 A;  4J9O A;  3OR1 A;  3NBP B;  2U2F A;  3MM7 B;  1F5A A;  1TL4 A;  1B0V A;  1QVG R;  1JMT A;  1X5O A;  4J9Q A;  3OLA A;  1QSY A;  1VCT A;  2JFK A;  1SIW B;  4X65 F;  3C8Y A;  3GIM A;  4MMO A;  3MZI A;  2VQE F;  2QYG A;  3F44 A;  4H4O B;  4DS5 A;  2BMB A;  2LEC A;  4L73 A;  4ZP8 A;  1CJT B;  1WF1 A;  3J7A 1;  4O3N A;  1DUR A;  1NND A;  1PG5 B;  1ULR A;  3LW5 C;  4DR5 J;  4CYU B;  1KLM B;  2VV5 A;  1N6Q A;  5DRK A;  1X5T A;  2PSZ A;  8RUC A;  2XB2 D;  4OJH A;  3VQT A;  2DJW A;  4NCB A;  2DRB A;  1YDL A;  3B54 A;  1GMW A;  4GTZ A;  3SEO A;  3PJW A;  1S5Z A;  3IA0 A;  2R42 A;  2ZDP A;  1BMQ B;  1VRQ C;  3MOZ A;  2Y1J A;  2KG0 A;  4FNH A;  1Y5L B;  3QO9 B;  3D66 A;  2JEF A;  4ZS6 A;  3P5T L;  4MKA A;  4JI8 J;  3J81 U;  3THT A;  1N56 A;  1HYS A;  3ZTP A;  1R8B A;  3FBC A;  4E8U A;  3JSR A;  4YHH J;  2B5J B;  4MIV A;  3LAK A;  3PXG a;  4ZP7 A;  4LFC F;  2XYG B;  1Q8I A;  4K5S A;  3MMC A;  4ID5 B;  1UVK A;  3JSY A;  3B4M A;  2XY6 A;  5E5N A;  3TA1 A;  3GIJ A;  2FB0 A;  4F4Z A;  1Y10 A;  2A2C A;  2QMU B;  2F1F A;  1Q81 T;  2IMW P;  3T1Y F;  3RR7 A;  4IRK A;  4IQM A;  1SJQ A;  2YNH A;  3M8Y A;  5KFC A;  5KT7 A;  1E33 P;  3RB0 A;  5JVH Q;  2LXU A;  4KFB A;  2ATL A;  2VFU A;  1K7H A;  1JLE A;  4RNF A;  2ZNY A;  1HKA A;  3BS9 A;  2V4R A;  3C6U A;  4LR9 A;  4LVN P;  1SJ1 A;  2DGV A;  1VC5 A;  1HWJ A;  4N56 A;  2ROE A;  3UD5 A;  4DPT A;  1I3O B;  2FGO A;  4EZ9 A;  1YJU A;  4I6Y A;  2FYX A;  4ILR A;  1K0V A;  5IM0 B;  2FY1 A;  2F63 A;  5HJX A;  3M9N B;  1E6Y A;  1HNV A;  5AJ9 A;  3SXL A;  5KG6 A;  4KKO B;  4KY3 A;  2Q43 A;  2DIT A;  2QX0 A;  2I5J A;  1EJJ A;  1KTQ A;  3ELH A;  5IV4 A;  3BDG B;  1S1T B;  4ZN3 A;  1GT8 A;  2PN6 A;  4HAC B;  3I56 S;  4B17 A;  3HO1 A;  4NWB A;  2OMO A;  3GIL A;  3NGT A;  1K73 T;  3CJQ A;  2MGZ B;  3LP2 B;  4TNO A;  5IT0 A;  4J90 A;  4F4W A;  4V1A k;  4F50 A;  4JI5 F;  1N88 A;  1N36 F;  1MN9 A;  4RW9 A;  3R5B A;  3OJS A;  4MFB A;  5HRT A;  4CLU A;  1TKZ B;  4DV1 J;  3CDW A;  2M5Y A;  2B8P A;  2WBM A;  4UPH A;  1XJW B;  1RT2 B;  1KNZ A;  5IC6 B;  3TX0 A;  2Z2Z A;  1MWZ A;  2RML A;  1XNQ F;  2J0Q D;  3R2C J;  1M5S A;  2XRG A;  1ITP A;  4J9R A;  2VON A;  3EPG A;  3VAK A;  2YNG B;  5DG9 A;  3TA2 A;  1S1X A;  3AJD A;  1TQL A;  4TVA B;  2F5G A;  2QE5 A;  2QLW A;  5DG8 A;  2DGS A;  2F8H A;  3N5B A;  1RAA B;  3HT0 A;  2KU7 A;  4U96 A;  2Q3P A;  2W5W A;  1C0U A;  1RK8 A;  4IH6 A;  4TN2 A;  1OIA A;  2HS0 A;  5ETN A;  4X4N A;  4KR0 B;  3C3L A;  3IFE A;  3GR0 A;  2QA1 A;  3M8P A;  2OFG X;  3MUM P;  1HQE B;  5AXM A;  3DOM A;  1JXL A;  3CDA A;  2ZH8 A;  1OPI A;  3ZC4 A;  1S76 D;  4J5O A;  1OJ4 A;  3G4S S;  2PI5 A;  3SSS A;  4ZVF A;  2IAJ B;  3TR5 A;  2CPH A;  1ACM B;  2LU1 A;  3WBH A;  2AYM A;  3D6M B;  4O4G B;  1URR A;  4B9U A;  1NK6 A;  1NCL A;  2K1R B;  4CRJ A;  3FGV A;  4DEZ A;  5EGE A;  2X3G A;  4Q8F A;  2R7T A;  4ER8 A;  2ZH6 A;  1VBX A;  3PEJ A;  3VAI A;  2J9D E;  1XNR F;  3TA0 A;  1UJ6 A;  2GNK A;  4RKU C;  1B7F A;  4F25 A;  1S1W B;  5ETV A;  1NJY A;  3NS5 A;  3CD7 A;  3DYC A;  1VQN S;  1D8Z A;  1U2C A;  2W5Q A;  4ERD A;  1RAI B;  5L1I A;  2HGM A;  5C24 B;  1CQN A;  4QIW D;  1RT3 B;  3FRY A;  4M95 A;  4QYZ K;  4TLR A;  4I6W A;  4IUF A;  1FKO A;  2NXN A;  5CXT A;  3MMA B;  3IR7 B;  3RG6 A;  1KSP A;  2BUN A;  1RAH B;  4ANC A;  2VZ9 A;  3EZO A;  1F9E B;  3M1V A;  2AIR B;  3A3P B;  2OEK A;  1V6H A;  2C2Z B;  4C0H A;  1RT4 B;  4DR2 F;  2N7Y A;  4RU9 A;  4Z37 A;  3CWJ A;  4LF9 J;  3T01 A;  3TAR A;  2DNH A;  1WC5 A;  4LF1 A;  1P1T A;  4RW7 B;  2XS7 A;  5B0G A;  4P2F A;  4KH1 B;  5F8G A;  1NH7 A;  2H5I B;  2DH8 A;  4IO1 A;  3M8Q B;  1S7H A;  3IWL A;  1S0O A;  1URA A;  2DK2 A;  4I0W A;  5DLV A;  1FJG F;  4CM2 A;  2DXF A;  3N0V A;  3CCW A;  2JEJ A;  2LU2 A;  3IWX A;  1JNR B;  2F9D A;  4FDJ A;  5F8J A;  4AL6 A;  1WTB A;  2J9D A;  3AHP A;  4IR1 A;  2UV8 G;  3UQS A;  1VRT A;  4M5L A;  4JI6 F;  1RAO A;  2FIU A;  2JNJ A;  4EI2 A;  4LF5 F;  2DNM A;  4JI2 J;  2PII A;  5IT9 Y;  3RGI A;  1VLY A;  3KOA A;  1O98 A;  3L7P A;  4H4K A;  2ASJ A;  2ZBP A;  1RAJ A;  2OPR B;  1PJ5 A;  2VG7 B;  2ZBR A;  2XMJ A;  1JLC B;  1RWV B;  1ZAV A;  1VQM S;  5D6G A;  3WDO A;  2XZW A;  4USU A;  2DH7 A;  4ECS A;  4DX6 A;  4ED6 A;  1O99 A;  2LQ5 A;  3IC1 A;  1CJK B;  2BJ7 A;  3HHL D;  3T1H J;  1VHI A;  4Q2M A;  2KDO A;  1P9Y A;  4LJM A;  2NXJ A;  4Z7Y A;  5IWA F;  5IOL A;  1M5V C;  4H54 A;  2LXF A;  3I0R B;  1HNX F;  2RHQ B;  2XMV A;  3HSD A;  4M5N A;  3PRD A;  1TL3 A;  2HFV A;  3K5O A;  2O5D A;  4TXS A;  3KKF A;  4K7Q A;  3AOC A;  3AQO A;  1SBR A;  4WU2 A;  4YB5 A;  2RNE A;  4M5D B;  2KTQ A;  2DCU B;  3QIP B;  3ZTR A;  1KEK A;  1APS A;  1ZZF A;  3PM9 A;  2W5T A;  4DR3 J;  1IR2 A;  3RUB L;  3CSK A;  5T7L B;  4FP9 A;  3MUR P;  5GAH U;  2GW8 A;  2FQQ B;  5K14 B;  4KJI A;  4LF7 J;  3LXQ A;  2R2S A;  1S72 S;  3TO8 A;  2VPW B;  3GPA A;  1L5U A;  2CJK A;  5D0E A;  2M4M A;  2XS5 A;  4D3H A;  5A8K B;  5F3T A;  2IA6 A;  4WKY A;  3PAC A;  1L3V A;  2HHH F;  1PGZ A;  2NS1 B;  3MXH P;  1Y7A A;  2MQQ A;  2V8H A;  3SFG A;  1X9S A;  2DO4 A;  3MAQ A;  3AY0 A;  2HFO A;  3H42 A;  4KH0 B;  1FD8 A;  3HFK A;  4FXD A;  1D0E A;  1ALK A;  1HW8 A;  2GX8 A;  2QGF B;  2AHO B;  1EAY C;  5D0G A;  3WQP A;  5CQG A;  3OUY B;  3Q8S B;  2AU0 A;  3G96 A;  1JLA B;  4YN3 B;  1N5Y B;  1XMO J;  1GQE A;  2XMM A;  2R2T A;  3VAJ A;  2X51 A;  3RB6 A;  4PG6 A;  2EW9 A;  2P9G A;  3FRZ A;  1RT1 A;  1PYS B;  1I94 J;  4QU6 A;  1WF0 A;  1WKL A;  1AFJ A;  3MFI A;  4C8L A;  5GAH I;  1SC1 B;  2QSW A;  3G2X A;  2KT2 A;  1R0A A;  3PR5 B;  4NZ7 A;  2RS2 A;  1Q5V A;  3I9V 9;  4M63 A;  3D28 A;  1QSL A;  3RBD A;  2M70 A;  1FKP A;  4CLY A;  1XMB A;  2NXE A;  2HZA A;  1IBK F;  2HUR A;  1KBR A;  3GU0 A;  2Y3Y A;  2BAB A;  4KTQ A;  2I8E A;  3PHT A;  1HNI A;  4A8W A;  2XYP B;  4WP8 A;  4WXO A;  5L0K A;  5BR8 F;  4FBU A;  1X7V A;  5CHC B;  4ZIT A;  5LXR A;  3KLF A;  5B7W A;  1MU2 B;  5GAD I;  3JSM A;  1NPR A;  3IM8 A;  4GTY A;  4RNN A;  3ETO A;  3R7B B;  3W2W A;  2HRT A;  5HP1 B;  3THV A;  1AUK A;  1VDH A;  4WFY A;  3AFG A;  4P6Q A;  3GFY A;  2C1E B;  5KFM A;  2KM8 B;  3C16 A;  4USW A;  2V4J B;  1IN0 A;  3MK0 A;  1B70 B;  4OYP A;  2Z0G A;  4U8Y A;  4IFY A;  4GKK J;  1BY9 A;  1JX4 A;  3GIK A;  3U02 A;  2CZV C;  3O8W A;  1BWV A;  3POT B;  3BKT A;  2ZOF A;  1RT7 A;  1SKR A;  1S9E B;  1UEK A;  3I82 A;  3D0G E;  1PSD A;  3C2P A;  1S4E A;  2MQN A;  1K1Q A;  3W60 A;  3M05 A;  3NRB A;  1N2L A;  1KQG B;  3QLH A;  3PR4 A;  3BGO P;  1RP5 A;  5ITH A;  3TJ9 A;  1LW0 A;  1YBA A;  1JLG A;  4X84 A;  4FF4 A;  3RTV A;  1OWX A;  4TQR A;  3SV4 A;  4RW4 A;  2A18 A;  2HVE A;  2J7U A;  1TKX B;  4ZG9 A;  5F0W A;  2KG1 A;  4FVM A;  1NDK A;  2GAH C;  4Y65 A;  4IG0 B;  1AT1 B;  2IBK A;  5SZT A;  4OHW A;  2CJA A;  4C8N A;  1B99 A;  1HQA A;  3T9Z A;  3D6F B;  1VIS A;  3ZZR A;  2D9O A;  3MR2 A;  1U1K A;  2XBP A;  4EO8 A;  1IUJ A;  3G6X A;  3I96 A;  3UO0 A;  5CD4 A;  3KUG A;  3P3D A;  3JQK A;  5LRM A;  1YWX A;  3AB2 B;  4ECW A;  2UUC J;  2MPU A;  2NSC A;  2HAI A;  1V5V A;  2Z8Q A;  4FDF A;  1UZH A;  3OL7 A;  2GVZ A;  6FD1 A;  2VPY B;  2QLX A;  2DNO A;  4U8V A;  2R2U A;  3SDE B;  2BJ1 A;  2W4P A;  1IBL F;  3C14 A;  3BKU A;  3SV3 A;  2HS4 A;  4NLR A;  2IDL A;  3Q0A A;  4JV5 F;  1TMJ A;  5FLX Y;  4MKV A;  1T8E A;  4F3O A;  2AZ1 A;  1R7I A;  1VQP S;  3CD6 S;  3B78 A;  4RBU A;  2F4V J;  5LMN J;  1QAI A;  4HI2 A;  1UZD A;  1BHN A;  4NLX A;  2VDH A;  1TVR B;  1UPP A;  4Q7A A;  2M7S A;  4L3N A;  1RTD A;  3BH7 B;  2ADB A;  2HQ3 A;  4DL3 A;  3WZ0 A;  3HJF A;  4IQX A;  5HLF B;  3GG1 A;  3KK3 B;  1DQA A;  3V4I A;  1KH9 A;  1U1O A;  3WAY A;  2HND B;  3GCX P;  2VBZ A;  1RWN B;  1UWB B;  4V19 X;  2FVP A;  2CQH A;  2CKW A;  3HHL C;  2HWH A;  4M5J A;  1AZS B;  5I4M A;  3QMQ A;  1ZET A;  4NOH A;  4FPI A;  3KHL A;  4OHZ A;  4HKQ A;  2CG4 A;  3C6T A;  4NLV A;  2YTC A;  2EBG A;  4LRD A;  4PXE A;  4ELU A;  1WDT A;  2CQB A;  4FF2 A;  3TAN A;  4LBP A;  4Q44 A;  1PC5 A;  2R7X A;  3KK2 B;  1S0V A;  2E7V A;  2JLF A;  1M1H A;  5C2G A;  1SQG A;  3MMJ A;  1HBM B;  2VC0 A;  4DMZ A;  1NSK L;  3LH2 S;  4F36 A;  4ECY A;  4M5G A;  3KLE B;  2ZH2 A;  3NKQ A;  4K0K F;  2ZC4 A;  2VOO A;  5C66 A;  3QT7 A;  3TRG A;  4B9N A;  3IG1 A;  2GQQ A;  2OKQ A;  1IJF B;  3W9H A;  2F3J A;  3GLJ A;  4DX8 H;  2L9D A;  2ACY A;  2AZ3 A;  4DV4 F;  4DFM A;  1TL5 A;  4CYR A;  3HD2 A;  1S7I A;  4H4M B;  2FJX A;  3PYD A;  4QJV A;  4BHQ A;  2R2R A;  1DAR A;  1FHT A;  3M2R B;  3BBF A;  2WTF A;  2DHG A;  3SYZ A;  3MK2 A;  4A8F A;  1C4C A;  2FLO A;  2W9B A;  1PAE X;  2B56 A;  4JI7 F;  2Z57 B;  5KOX A;  4WK3 A;  1ROF A;  3MUT P;  3L7O A;  1QM9 A;  4KV8 A;  3TAM B;  1N36 J;  1S1U A;  4CZC A;  1LFP A;  2P5V A;  2EFO A;  4A4J A;  4ZIV A;  2UXB F;  1EET B;  2WVB A;  2MY8 A;  1B4S A;  2L3M A;  4DL0 C;  1F3F A;  1U1M A;  1H7W A;  2DTJ A;  5FDL A;  2ZWO A;  3BH6 B;  1N5Q A;  3BN4 A;  1NKE A;  3MAH A;  3PVX A;  1MRO A;  2M0G B;  2DNK A;  1EX8 A;  3EYZ A;  3HHD A;  4RBT A;  3DLJ A;  3R9L A;  2DPJ A;  3D7S B;  1GXT A;  1HBO A;  3I9Z A;  2GJI A;  3UDL A;  3KFW X;  1Y00 A;  4DV2 F;  5GOV A;  4MHX A;  2E7X A;  3WAV A;  1VGY A;  1LWF B;  2QSF A;  4P74 A;  2J8S A;  2HHT A;  5L39 A;  4ED4 A;  2DNP A;  3MUV P;  4OZN A;  3DRS A;  3H5Y A;  3HVW A;  4E2F B;  2H51 B;  3DYA B;  2B7B B;  3H20 A;  5DLF A;  1EI6 A;  2B51 A;  1M1K T;  1W26 A;  2PC6 A;  4FXV A;  1WG4 A;  2IA0 A;  4R8U B;  4K4U A;  3IO1 A;  4AXJ A;  3B82 A;  3T5L A;  3RBX A;  4ICL A;  1TUG B;  2RUS A;  2G2Z A;  3E2D A;  1UJ4 A;  2DRD A;  1JLQ A;  3G9C A;  3DGV A;  4QR0 A;  2KZM A;  3MCO A;  4DUZ J;  3SCI E;  5CYM A;  3HM9 A;  2UUW A;  3GV7 B;  1SKS A;  2ZBI A;  3DRX A;  3DOL A;  4DV7 J;  1T05 A;  1UA1 A;  1ZTW A;  1N33 F;  5LT5 A;  4NE9 C;  2CQD A;  2E1M C;  5DDR C;  1RT6 A;  2XCA A;  3VAG A;  4B3M F;  2YY3 A;  3ADA C;  1YGY A;  1X4D A;  1Y7P A;  2PMW A;  4CO1 A;  3H2V E;  2HFS A;  1RTI B;  5LJ5 Y;  2A3J A;  3HSG A;  1TU0 B;  5IC4 B;  4ZPV R;  3CB4 A;  2DB1 A;  4JI3 F;  2J8A A;  2UU9 F;  1NPP A;  2K3K A;  2XSJ A;  3UDC A;  5D0H A;  3TJ8 A;  3G8Q A;  4NEY A;  1NUE A;  4MK8 A;  4HDG A;  3QGH A;  4NWX A;  4CT8 A;  3SI8 A;  4HDH A;  4DG1 B;  3DRR A;  5HMY A;  1F0X A;  3H98 A;  5ETK A;  4UQT A;  4WZQ A;  1OY6 A;  4NLP A;  2ZE2 B;  5A8R A;  5A8W A;  1HDH A;  3KG4 A;  1Z2L A;  4PPD A;  1FRM A;  2CWK A;  4B3R J;  2RUG A;  3MWB A;  1X5S A;  4X2B A;  2OPS A;  2CJB A;  5FJ4 A;  4P71 A;  3D5M A;  2HS3 A;  1B64 A;  4I2Q A;  4OYX A;  2G9O A;  1WC6 A;  3PNI A;  1N2K A;  1CJU A;  4LFA F;  3EVM A;  2FVS A;  1NME B;  1FFW B;  2HNY B;  4GVB A;  3KMS A;  2A0F B;  4O23 A;  5AXL A;  3SSR A;  2MHN A;  2XGQ A;  4B9T A;  4DDF A;  1ELO A;  1N6Q B;  2YWF A;  3K5N A;  3VGS A;  3MM5 A;  3UI3 A;  3UW1 A;  2OEM A;  4RUB A;  2AEJ A;  4KC5 A;  1Q7L B;  1N5T A;  2ZC3 A;  3M2U A;  4KGM A;  2HFN A;  4RUH A;  2UUB J;  4DSJ A;  1CC8 A;  1ALI A;  3A1Y G;  2G4B A;  4J9U E;  5AXN A;  3ZZ0 A;  4CLF A;  5HVH A;  3WBZ A;  1QE1 B;  3T9N A;  3HD1 A;  1D09 B;  3K58 A;  5A0Y A;  1HHS A;  4Y34 A;  2UP1 A;  3PEH A;  3SBM A;  1H6K X;  2MQL A;  4NLD A;  1HYS B;  2DGX A;  1FEH A;  1ZM9 A;  2FY8 A;  1RLD A;  4O3O A;  4QZV B;  2KB2 A;  3HCX A;  4UOR A;  5KG3 A;  5ETR A;  2YH1 A;  4I4B A;  3MMC B;  1GMU A;  4UOH A;  3EXC X;  1YRU A;  3N6L A;  4CO3 A;  4U95 A;  1W7W A;  1HQU A;  3NY0 A;  1SUQ B;  4HT7 A;  4Q8E A;  2IJR A;  3TX8 A;  2RKI A;  2JRS A;  1FI4 A;  2YNH B;  1SL2 A;  3JTN A;  4PYD A;  1XR6 A;  1FRH A;  3MOJ B;  4NXM F;  4KFB B;  1JLE B;  3D4J A;  3BSA A;  2ASD A;  4NRU A;  3C6U B;  3KLI A;  4EZ6 A;  5HRO A;  5HVF A;  2DVI A;  4L6V 3;  4KHM A;  1KS2 A;  2P2C B;  2HRY A;  1OYE A;  4M1K A;  2R9L A;  4DQR A;  3KLH B;  5CA5 A;  1EQ0 A;  3CC7 S;  2Z2L A;  9ATC B;  1WTF A;  3Q8Y A;  3LPY A;  1MW7 A;  2YQ1 A;  2BXJ A;  3MTJ A;  2IVF B;  1E6Y B;  2RF2 A;  1HNV B;  2B3T B;  2MQ8 A;  3TZZ A;  2IJN A;  1O0P A;  5LM7 E;  2W7P A;  1FDB A;  2J5A A;  1VQY A;  1ALH A;  4I1T A;  1YJ9 S;  3GYN A;  4UOO A;  2RIL A;  2I5J B;  4LVO P;  1Q7Y T;  2OUG A;  2G1D A;  2BM0 A;  1IBM J;  1RB0 A;  3JQJ A;  2ROG A;  3OTO F;  2XLI A;  1ED9 A;  5EDW A;  5K5M A;  5D3G A;  2VAS A;  2VQR A;  3I55 S;  1SHQ A;  1N32 F;  1MML A;  3H5X A;  1WEL A;  3DI6 A;  2P9C A;  2RQK A;  5AJ3 J;  3RZA A;  2VKZ G;  1QY7 A;  1X4C A;  2AEM A;  2HK2 A;  1LNQ A;  2FZK B;  1RKJ A;  4I7F A;  4DV6 F;  4MFB B;  3WX4 A;  1YVF A;  2MZR A;  3R2D J;  2W8K A;  3R5C A;  1GFW B;  4C48 A;  4DPY A;  1B7Y B;  2QG9 B;  3ZZP A;  1V3Z A;  2BW2 A;  3SSQ A;  4RWW A;  3V81 A;  2GO8 A;  3HSZ A;  2NZ4 A;  4NCG A;  4F26 A;  4UPL A;  1M0S A;  4N5S A;  4DI6 A;  4UUX A;  1U6B A;  1TFY A;  1S79 A;  1S1X B;  2JL9 A;  3CJS A;  2OJ3 A;  2KYZ A;  3TWZ A;  5IT9 U;  3ILI A;  3NP5 A;  2OAU A;  4RNO A;  1J2V A;  2IDE A;  4LF6 F;  1NKC A;  1O6X A;  1SH0 A;  2W8L A;  2QL5 B;  3V6D A;  1C0U B;  4F0K A;  1D3W A;  4NMX A;  1ZH5 A;  5BYR A;  1YK9 A;  1CJV A;  3P96 A;  3ZTO A;  4J9S A;  1TTH B;  3RRG A;  4DCJ B;  2MZJ A;  3Q2S C;  1KVI A;  1RBO B;  3DOM B;  1FE4 A;  3VTI A;  3H25 A;  2CXE A;  4PRF A;  1VYA A;  3D0H E;  1LWX A;  2B4P A;  3ZNJ 1;  3BYR A;  2IVY A;  1P6T A;  1JLF A;  2AX1 A;  5M2U A;  2KHD A;  1GXL A;  5HO4 A;  5C42 A;  4CXS A;  5EWF A;  3UDE A;  3UDV A;  1KFS A;  3B8H A;  5E3A A;  1OO0 B;  4C97 A;  3EM1 A;  1NAQ A;  2YKP A;  3VQS A;  2JFD A;  1NSP A;  2XGP A;  1U1L A;  3MEE A;  3O2I A;  5CCM A;  1UET A;  4NRT A;  3K17 A;  3BPS P;  1N0U A;  4ZJQ A;  5KFG A;  2VFT A;  1VIX A;  4P7T A;  3QFH A;  1VI7 A;  4WK1 A;  1WEX A;  4KJG A;  3FJ2 A;  2XMA A;  5KFK A;  5KFQ A;  3SZ2 A;  2N82 B;  4X4P A;  4ZP6 A;  3NVL A;  4L75 A;  4OZ2 A;  3UCG A;  4RBV A;  2MQM A;  2YH0 A;  1SH3 A;  1FKO B;  5CD4 H;  4TLQ A;  3T6B A;  4YQW A;  3B6B A;  2LFV A;  2QRR A;  2BRK A;  1R8A A;  3PRB A;  3TOQ A;  2DGO A;  2FC9 A;  1RE1 B;  5DQH A;  5HSP A;  1DTQ A;  3IBC B;  1TR0 A;  2FVC A;  1GTE A;  1NDL A;  5D4N A;  1LXJ A;  4MTP A;  3JTP A;  4CH7 A;  3GB0 A;  2R7Q A;  3VGT A;  4JV5 J;  4B08 A;  5BXI A;  2KL8 A;  2P8I A;  5KFI A;  2K2P A;  4NYZ A;  4F4Y A;  4LR8 A;  4C7Q A;  5KFH A;  2NYI A;  2WCX A;  1IKY B;  2J0W A;  2BJ9 A;  3K7R A;  4F2R A;  3WX8 A;  2CG8 A;  3VF0 B;  4ZVP B;  2B4V A;  2KZZ A;  1MMD A;  4OX7 A;  1DRZ A;  2KM8 C;  1SKW A;  2YWW A;  3H5S A;  5LSR A;  4UW2 A;  4ZVE A;  2ZJR Q;  1Y6V A;  3JB9 k;  3DFE A;  4I2P A;  2CPY A;  4AXI A;  4LQ9 A;  4D3G A;  1BQM B;  3QAU A;  2J7K A;  4NZ0 A;  1SKU B;  5DQI A;  4P73 A;  1WC1 A;  1HNZ F;  5DZ6 A;  3K5L A;  4CT9 A;  1IBC B;  1VBK A;  4DLE A;  2GJF A;  3OTC A;  3E01 A;  4P10 A;  5KT4 A;  1TEL A;  4PWD A;  5ETO A;  5BYQ A;  4WFZ A;  5B08 A;  5C5J A;  2VPZ B;  5L0B A;  2W4C A;  4A46 A;  3E51 A;  3CMR A;  2PMH A;  3MPU B;  3IP0 A;  1CS4 A;  2E9R X;  3BQ2 A;  1XC9 A;  1ZEF A;  2AGP A;  1EKR A;  4DR1 J;  4B3O A;  1TL3 B;  3HHK A;  1DHM A;  3CO9 A;  3FFI B;  1U6Z A;  5AE1 A;  3UCZ P;  4JI4 F;  4YFU A;  2BBE A;  3NMR A;  4WKR A;  2B4O A;  3MM8 A;  4OZL A;  5HQL A;  2MKK A;  2XO7 A;  2CPE A;  2LDY A;  2OLW A;  1R0B G;  4RPF A;  4QU7 A;  2V2Q A;  4CP5 A;  4UOC A;  3I5A A;  1Z1Z A;  4KHP J;  3EXY A;  3NGU A;  3S8S A;  2CQI A;  4PR6 A;  4AFF A;  3N28 A;  3L9Z A;  1SC3 B;  2X7I A;  3FEY B;  5GRR A;  2UVW A;  1KQS R;  3KXD A;  1WNE A;  2EFN A;  3JSB A;  1HLW A;  4F3Q A;  2AJ1 A;  3D3C J;  4OYW A;  4YB7 A;  1RWP B;  3MM6 A;  4M94 A;  3NL0 A;  2QV6 A;  4BBY A;  4K8R A;  4UOF A;  4DUT A;  3G6V A;  1GMW D;  5KFT A;  4U9R A;  2XZT B;  3H90 A;  2BKN A;  1CUL A;  2EKY A;  2HW3 A;  4QWC A;  2MZ1 A;  1LEO A;  3A12 A;  3KDN A;  3PW4 A;  4MK7 A;  4U6P A;  3CNQ P;  2ILZ A;  2BJE A;  3NKR A;  4WE1 A;  1HWI A;  4PUO B;  4DR7 J;  5D0R A;  1WG1 A;  4DV2 J;  2QLF B;  1F3V A;  1RT1 B;  1KD1 T;  1N4L A;  1RCO B;  1HI0 P;  1HR0 F;  1NM2 A;  2BOA A;  3DKD A;  1XEZ A;  2CNK B;  4IOC Q;  2HLU A;  3R8Y A;  2GAG C;  1TAU A;  1WOP A;  2MEW A;  3CJK B;  1PYT A;  5LSO A;  1RWM B;  3O44 A;  1VQ4 S;  2FJW A;  2AT1 B;  3MEC A;  3OVA A;  1H2U X;  1H7X A;  1S49 A;  1EW8 A;  3LO3 A;  1FKP B;  1NZA A;  1KHK A;  1RYR A;  1S6Q A;  4ECT A;  2MZQ A;  4Y28 C;  5HBM A;  4YB1 P;  4Y2M A;  4FS1 A;  2NUH A;  3QYY A;  3C66 A;  4MT1 A;  2EFG A;  1HBN B;  2JJ4 D;  2W5X A;  2J6U A;  3N4W A;  4P75 A;  2VFV A;  4I6A A;  2W2Q P;  4R5P A;  2ABY A;  3OD2 A;  2YVS A;  3KLF B;  1NB7 A;  3PKM A;  1PKU A;  1C1C B;  5KFL A;  3JSM B;  4MIA A;  1FA0 A;  3OBI A;  1E2S P;  3GCW P;  2KHC A;  2OSQ A;  3G82 B;  5F8H A;  3W2W B;  1B8J A;  4FYY B;  4ECR A;  1UFL A;  1V9O A;  4L72 B;  4X66 F;  3UN5 A;  1UTA A;  3C16 B;  3ZNU A;  1R0C B;  1J5E J;  2PI4 A;  3CVK A;  2V34 A;  3CXC R;  4GO5 X;  1AJD A;  5F8N A;  2IY5 B;  2DNL A;  3D0I E;  1UVJ A;  5G4D A;  4CH1 A;  5DLG A;  4EBE A;  1M5O C;  2HIY A;  3BGU A;  5CYQ B;  3FSI A;  3X3U A;  4QQB A;  2LEA A;  3BSN A;  1TKT A;  5KFE A;  3BDP A;  3KJQ B;  3OL6 A;  4GC6 A;  5B0A A;  1RIS A;  3KYL A;  3AJ1 A;  2R8G A;  3QLH B;  1FFS B;  3L95 X;  2KXN B;  1LW0 B;  1PIL A;  2YPY A;  1L3K A;  4WU3 A;  3T3F A;  4ZG6 A;  3MCS A;  4LT6 A;  1VQO S;  4RW4 B;  3IAS 9;  5DLT A;  4F7V A;  1RWO B;  2BW7 A;  1NJI T;  2CRL A;  3D6H B;  3FCH A;  1AUD A;  2AYE A;  3IRX B;  3N6N A;  3N79 A;  4WFX A;  3W9J A;  4KGX B;  3W8P A;  5AT1 B;  3EGN A;  3MPY A;  2C2M B;  4X64 F;  2AWZ A;  3ET6 A;  1NH8 A;  2GFF A;  4ITS A;  4ES1 A;  2A1B A;  4ZK7 M;  1HAR A;  1VS3 A;  3UNY A;  1W2B R;  1KDN A;  4X4O A;  2KT3 A;  2W01 A;  4I56 A;  2N7C A;  3I0S A;  5LMU F;  2OPQ A;  1DTT A;  2VG6 A;  4JI1 F;  2EPI A;  2BR0 A;  1Q1K A;  2VFS A;  3MM7 A;  2P9E A;  4NA2 A;  3SQG A;  2K7K A;  2DY1 A;  3R5J B;  1QDU B;  2W24 A;  3LGM A;  5C25 A;  2OPP A;  4F8R A;  4DN9 A;  3FZB A;  2VB6 A;  2XI3 A;  3OSP A;  3MPD A;  3A52 A;  2PT0 A;  1FES A;  4TQS A;  4YY3 J;  3M4X A;  4KIA A;  1RZM A;  2HHP A;  2MKS A;  5F8L A;  2AJ0 A;  3QID A;  4RR5 A;  2MZT A;  4A8S A;  1XR5 A;  3R97 A;  3BQ1 A;  2MLY A;  1FNM A;  3PJX A;  2ILY A;  1UVN A;  1WD6 A;  1I51 B;  3ZZO A;  2CNN B;  2ZZT A;  3RAM A;  1U8S A;  1T3N A;  2W4D A;  3O6Q A;  1RTD B;  1WI6 A;  5F8M A;  1H98 A;  1QAJ A;  4G1Q B;  3DNC A;  3M30 B;  1F60 B;  2H1Y A;  2EC0 A;  3V4I B;  1RXO B;  1KH4 A;  3RR8 A;  3EMT A;  2V0N A;  2A6M A;  2I6W A;  2J6S A;  1RUS A;  5L1L A;  4X4V A;  2HFU A;  1XER A;  3KUE A;  4L74 A;  4YB6 A;  4AL7 A;  3J80 U;  4DR4 J;  3W9I A;  1PJ6 A;  4DS4 A;  4C11 B;  2V69 A;  2G2Y A;  4ZLP A;  2B5J A;  4DV0 F;  3DLG A;  3CDB A;  5ETQ A;  4ALZ A;  4NPO A;  4KQZ A;  1N0V C;  2WK4 A;  2D69 A;  1N54 B;  5H9F K;  1HWK A;  3HMJ G;  4RU2 A;  3RB3 A;  2W1B A;  3BQ0 A;  3DRP A;  3F73 A;  3NG8 A;  2ZUA A;  2Z30 B;  2FLL A;  2UUA J;  3J7Z 5;  3K5P A;  1RWW B;  1KH5 A;  3IG1 B;  4UT4 A;  2YPZ A;  5T41 A;  4EYH B;  3KG1 A;  1VRU A;  3H2L A;  4C3M A;  1MLA A;  3ZZZ A;  1U4B A;  1HI8 A;  4JV0 A;  3DLK B;  4E0D A;  3RYL A;  2CQ3 A;  4HH0 A;  3VWS A;  4FDI A;  2HBQ B;  3D67 A;  3MAA A;  5IM0 A;  2JVR A;  2E29 A;  4CCH A;  2W9B B;  1U8W A;  2P6T A;  3CO0 P;  4C8K A;  3NKN A;  1OQ6 A;  2CQ0 A;  4M5H A;  4OFZ A;  4OI3 A;  4GKJ F;  2I0X A;  2W2O P;  1RTJ A;  3BGL A;  2N4D A;  1S1U B;  2RS8 A;  1MSW D;  1S1T A;  3NNH A;  2FC8 A;  1FRL A;  5JVG Q;  4JYA F;  5F41 A;  3OXF A;  2PDA A;  2V6A A;  3N9U C;  1N34 F;  2MKY A;  4MYT A;  3NWR A;  2VFR A;  5FDL B;  3CE8 A;  1Q8B A;  2WON A;  5A6P A;  3NGS A;  2MGZ A;  2HZC A;  3IBF B;  2C2R A;  1EW2 A;  1GEH A;  4KJD A;  2WHO A;  4QWA A;  4R25 A;  1HBO B;  1D9D A;  1ZED A;  3NEK A;  4NXN F;  4C8O A;  4HT5 A;  1S10 A;  2VIH A;  3BR8 A;  5L46 A;  3B5Q A;  3K8W A;  2MYF A;  3TZW A;  4KAV A;  3C19 A;  1WUU A;  2MXY A;  1QTN B;  2DIS A;  2XWX A;  4QAX A;  2CJX B;  2EK6 A;  3HHL B;  4DBQ A;  2KRR A;  1U49 A;  4PG8 A;  4ZDN A;  4C8M A;  5IS2 A;  3BDH A;  3CCQ S;  3W61 A;  1YQH A;  3CD0 A;  1WC0 A;  3G71 S;  3ICL A;  4ICL B;  1C4A A;  3VAH A;  4FS2 A;  3VHQ A;  3UR0 A;  1P27 B;  3NAH A;  5HK4 A;  2UXC F;  4B02 A;  4KPY A;  5L0E A;  2W2P P;  1HI1 A;  5EWE A;  1JLQ B;  3J81 Y;  5KG4 A;  4LMZ A;  5CYM B;  3MI7 X;  4NCA A;  2VC1 A;  2E44 A;  4NI2 A;  5KFA A;  2J7W A;  2D1G A;  4N77 A;  3H40 A;  2BJD A;  7FDR A;  3QT6 A;  1HQE A;  1NK8 A;  2YKM A;  3HKW A;  1RT6 B;  1LQ9 A;  4EK2 A;  4QWD A;  2F9J A;  2GMH A;  1U1R A;  4QWB A;  3PW5 A;  4PAB A;  3D6T B;  5CAB A;  2PA3 A;  1FE0 A;  3ZZT A;  1VQ7 S;  4IH5 A;  2AW0 A;  1ED8 A;  2DIU A;  1SC4 B;  5KG0 A;  5L9X A;  2OI2 A;  4ANE A;  1D9F A;  4DSI A;  2B9W A;  1NJW A;  3G87 A;  2WVC A;  4WYL A;  2ALY B;  3K2Y A;  2QTW A;  1M1G A;  2H5J B;  3R7S B;  1S1W A;  4QW8 A;  2KN4 A;  3RU0 A;  4N47 A;  3ZXW A;  4P2S A;  2H4W B;  2D3O R;  3IWN C;  2GV1 A;  3MM9 A;  2IRX A;  4AQY F;  4ECZ A;  3UCU P;  1XQI A;  2LYV A;  2C3U A;  5A8R B;  1RT3 A;  3RW6 A;  2KFZ A;  5FD1 A;  1AA1 B;  2ZM6 F;  1Y9O A;  3L7U A;  4M5I A;  3Q89 A;  2HRU A;  4PEO A;  3FQL A;  2OPS B;  4K4T A;  3T02 A;  1NDP A;  4YDX A;  3G8S A;  1R43 A;  3HFZ B;  4DR6 F;  3T5J A;  5KT6 A;  1CJU B;  3U1N A;  5LL6 d;  3WAW A;  4Y6I A;  5KFR A;  3M6V A;  4OHY A;  1TK0 A;  4USM A;  4LF8 J;  5KTQ A;  2DRA A;  2WOM A;  2FJD B;  1YHQ S;  1G1X A;  3KNG A;  2F7V A;  4LFB J;  4CWB A;  5DQG A;  1X60 A;  1CEZ A;  1EQJ A;  3R1L A;  2DGU A;  2DNG A;  4P2M A;  3MM5 B;  3BO4 A;  4LSZ B;  5L1K A;  3M2U B;  1S99 A;  5HQM A;  5IQ6 A;  5RUB A;  1HNZ J;  2C3O A;  1U1N A;  4YDD B;  4KGK A;  2YXL A;  2AJQ A;  4ZGA A;  1M5K C;  3V6H A;  4B3T J;  4A8O A;  3S6E A;  4DR5 F;  2MST A;  1TV6 B;  3QJJ A;  1J5O A;  3R3T A;  1EW9 A;  1M5P C;  2KFY A;  2M88 A;  2B43 A;  2AYG A;  3OTE A;  2G1H A;  5C7P A;  1WEY A;  3OVS A;  2OPR A;  3MFH A;  4X4T A;  3NGK A;  1TFW A;  1RGV A;  2R8H A;  5DJB A;  3RRH A;  1RJJ A;  2RQM A;  3ED4 A;  5DGA A;  1HQU B;  3X1L B;  1Y4Z B;  1RTH A;  4JI8 F;  2VQF F;  1CJK A;  4X62 J;  2RJZ A;  2HQF A;  2CDQ A;  3KK1 A;  3FSX A;  3H2U B;  1FKA F;  4UST A;  2RKI B;  5GAG U;  1YIJ S;  2GA7 A;  4AD6 A;  4C3K A;  3K59 A;  5IXU A;  4YHH F;  1NKB A;  3KHH A;  2F40 A;  2HVZ A;  3EX7 B;  3IAM 9;  5CZX A;  2ROP A;  3HFV A;  2NRE A;  1PC4 A;  3KLI B;  1HL6 A;  5E41 A;  2YKN A;  4QYR A;  5HRO B;  1IKW B;  4YP3 A;  4LUB A;  2QIF A;  1TUV A;  3BEG B;  3PFO A;  4ZVG A;  5DM7 Q;  1NRK A;  3G6Y A;  1NHU A;  2V4Q A;  1TL1 A;  3MK1 A;  1FRK A;  5M2P A;  2HMI A;  3QRP A;  4ED8 A;  3CJR A;  2DR6 A;  1LKZ A;  5K14 A;  4JI0 J;  2Y1R I;  2E1P A;  2RF2 B;  4N7T A;  3HHN B;  3A4T A;  1JJ4 A;  4KT0 C;  3MF5 A;  1RHK B;  2DXE A;  3QGI A;  1EKS A;  4DV5 J;  2DNQ A;  2V63 A;  2W9C A;  2O01 C;  2LA4 A;  4Y00 A;  4B9M A;  2PMZ D;  1RDR A;  1UW4 A;  1DQ8 A;  3HKZ D;  3UN3 A;  4OL8 A;  5D3G B;  3ENA A;  4XDC A;  4YR1 A;  4EMD A;  1TAQ A;  3KTQ A;  3D68 A;  1HMV A;  4H4K C;  3LF0 A;  2HVD A;  1R27 B;  1T9W A;  5KFY A;  3CUN A;  2HNZ B;  4DQI A;  1W2I A;  4UPK A;  5HQ8 A;  2DKO B;  2J0S D;  3QGG A;  3Q8P B;  4ENO A;  4LR2 A;  4MKB A;  1NK7 A;  3V81 B;  5KFD A;  4ZLL A;  4PCQ A;  2PFD A;  4DSL A;  3CJ8 A;  3UNG C;  4LSL B;  4NCG B;  2LKZ A;  2EXU A;  3IR5 B;  4I67 A;  3QSY B;  3GR1 A;  4UOP A;  1DQ9 A;  3CJ0 A;  1AFI A;  1RBA A;  3LP0 A;  2UXD J;  1SC6 A;  3QPI A;  1X9W A;  2CPF A;  3QT5 A;  4ZN1 A;  4DV1 F;  2IC3 B;  1SIZ A;  2PD1 A;  4G6V B;  2FJA B;  2MZS A;  2CNL B;  5EGY A;  3MGJ A;  1K9M T;  2CPZ A;  1GX5 A;  1S0N A;  5B0F A;  3CJ4 A;  4UZC A;  3Q23 A;  2NZC A;  1VLO A;  2CUY A;  2WW4 A;  1JLB A;  3PDN A;  4YEA A;  5KFZ A;  1VBZ A;  4JV1 A;  2BKP A;  1CJV B;  1GH8 A;  5E2Q A;  4Z7C A;  1WHY A;  1RAD B;  1QSS A;  2HFZ A;  3HZE A;  2AYB A;  3QRR A;  3A13 A;  4OI2 A;  2F65 A;  2VF3 A;  1R89 A;  2X1B A;  4DF8 A;  1FD2 A;  4IG3 A;  3BB5 A;  2HBZ B;  3MR5 A;  2JEG A;  3OL8 A;  4LSN A;  3W8G A;  2HGL A;  5LOQ A;  1REV A;  1WOR A;  3L3C A;  1UMJ A;  3FC9 A;  2MY7 A;  1WHX A;  1RLC L;  1X0F A;  2B7C B;  3MEE B;  4K50 A;  4OMF G;  5GAE U;  3NGR A;  1S57 A;  3TEG A;  2ZVS A;  5HAN A;  4J9K A;  1PYO B;  2OTL S;  1RYS A;  4CLP A;  3PFE A;  4OX9 J;  5LXY A;  3JAM Y;  3MR6 A;  3SCK E;  1HD1 A;  3BGR A;  3CTR A;  3IMQ J;  3GTY X;  3SIP B;  4ID8 A;  5A2Q U;  1BE4 A;  5I3U A;  2GA3 A;  3IS9 A;  3ILO A;  1U45 A;  1TKX A;  2KVI A;  1CVJ A;  1KFD A;  1ZTT A;  3D1O A;  2ANH A;  4IG0 A;  3A8J A;  2HHU A;  2LQJ A;  1FK9 B;  1LWC A;  1T02 A;  3FCW A;  3F41 A;  3LP1 B;  1U0H B;  2QA4 G;  2Y1L B;  2EKN A;  3UWT A;  2GML A;  5KFN A;  3PX0 A;  3JXO A;  3HSJ A;  3NKY A;  5B0C A;  5HN0 A;  1UL3 A;  1WC4 A;  1WHV A;  3ZO7 A;  1L3S A;  2NPF A;  3RBE A;  2RVJ A;  2XY5 A;  4FF3 A;  1S1V A;  2GGP A;  3CIM A;  2YBV A;  3KD8 A;  2PFF B;  2JLE A;  1H73 A;  1TMM A;  4KSE B;  5GAE I;  1VBY A;  2VG5 A;  3DLH A;  1OS5 A;  4FKY A;  2FZC B;  2M8H A;  3W7B A;  5J2M A;  4ZHR A;  4NLS A;  4URS A;  2J76 E;  2M3D A;  5D78 A;  5AE2 A;  5E0O A;  3AD7 C;  4LF9 F;  3FVY A;  1HHQ A;  4U67 Q;  4G3I A;  5AE3 A;  4DQS A;  4I2P B;  2X98 A;  4FKX A;  5B09 A;  3TZX A;  1OQ3 A;  2MKC A;  4ZVH A;  1F2H A;  2W5R A;  5KFJ A;  1VC0 A;  2CPX A;  3OXL A;  3SZZ A;  3M8R A;  4RW6 A;  3EVW A;  3CC2 S;  3QGP A;  2A10 A;  3E01 B;  5HLF A;  2MKH A;  4YME A;  1FTR A;  4PWD B;  3U1L A;  4MH8 A;  1E3C P;  4IOA Q;  2QA2 A;  4LRF A;  3I5C A;  5ETM A;  1BXN A;  2JLG A;  4JI2 F;  4B9L A;  1FXL A;  1CS4 B;  5F9N A;  3DMJ A;  1LXN A;  1VJQ A;  2ADC A;  1V3R A;  1Y11 A;  5DO2 A;  1AZS A;  1MWY A;  4B3O B;  5DET A;  1S0M A;  3D9B A;  3LUY A;  1YIT S;  1YJT A;  5ETT A;  2YNI B;  5J2P A;  5KFP A;  4ZMM A;  4YS2 A;  5DG7 A;  5K8O A;  2B6A B;  4WBF A;  1B0T A;  4Q5V A;  2XMU A;  2R7R A;  2E5L J;  4QYZ J;  2ZOM A;  3T1H F;  2BE9 B;  5JXS A;  3DOK A;  1PAU B;  3KK2 A;  2EK1 A;  2VD3 A;  3ILJ A;  2XTJ P;  4NA1 A;  4LF4 J;  3WC0 A;  5KFO A;  2IMO A;  2G9Y A;  1HFE L;  2BM1 A;  1C1B A;  4ZVU B;  1BQN A;  2E66 A;  5KT5 A;  1NPK A;  4F0H A;  3OFE A;  5JMN A;  3FBB A;  5I42 B;  2QT7 A;  3CT9 A;  1F5C A;  4DR3 F;  4BWM A;  3KWM A;  2J0X A;  1VHF A;  4FYV B;  5J1E B;  3P5B P;  4WYW A;  4Y0F A;  4Q0B A;  1FNX H;  2R3V A;  4C0O C;  1Q79 A;  4LF7 F;  1NJZ A;  2GSO A;  4NLG A;  3KJV A;  3WHI A;  2AEF A;  1HNW F;  1G7C B;  1NK0 A;  4HTI A;  3HLU A;  7AT1 B;  4WE1 B;  1EP4 A;  1S9G A;  1PCA A;  1J27 A;  4LR7 A;  3P6Y C;  4DV3 J;  1QD1 A;  3DPC A;  3QRQ A;  4DHV A;  3CJT A;  4WJB A;  3FCV A;  1VQ8 S;  1O5J A;  5DGB A;  1IXK A;  5DS7 A;  2BAC A;  2QC3 A;  5K20 B;  1EJ7 L;  2LXI A;  2MLX A;  2NLW A;  3AA8 A;  1X4H A;  3GSD A;  4OYZ A;  3U1M A;  2K3I A;  2BAN A;  3V5R A;  1FX4 A;  2ZH4 A;  1XMO F;  2GVD A;  3M2V A;  1G2E A;  2XR9 A;  1N52 B;  4HL9 A;  1RU1 A;  2J9C A;  1S6Q B;  3S1T A;  1HQ2 A;  2LMI A;  2ZOG A;  2XNR A;  1NXI A;  1SV5 A;  5HBM B;  4PG7 A;  4ETZ A;  3P45 B;  3EDQ B;  1I94 F;  2QFJ A;  1IKX B;  3OT9 A;  5KG5 A;  2XLJ A;  2RE1 A;  4BLG A;  3RW7 A;  1RI7 A;  1C2P A;  2JX2 A;  4RJV A;  3OFG A;  2BJ3 A;  1YTY A;  2CDR B;  3C15 A;  3HPO A;  1RA6 A;  2XI2 A;  4PWW A;  1CBK A;  2WSC C;  2CQP A;  1S6U A;  4AL5 A;  4DOZ A;  3RRK A;  4BDP A;  3EZ5 A;  3BRE A;  2LCW A;  1KP6 A;  3NS6 A;  2QMW A;  5KXA A;  4KO0 A;  4CI0 B;  2DIV A;  2O66 A;  4X65 J;  3SQO P;  1NK4 A;  1C0T B;  2D74 B;  2YNF B;  1R6Y A;  4HEA 9;  4ZCI A;  2L41 A;  2VQE J;  3FMW A;  3M8S A;  5M2R A;  2MKI A;  3AT1 B;  2BA9 A;  4P9S A;  3DCA A;  1NHV A;  1Q0N A;  1KVK A;  3LQV A;  5KG2 A;  4O4R A;  4CTA A;  1JIH A;  3KLG A;  1T03 A;  2XCP A;  1HPZ A;  2Y1I A;  4NLO A;  2ZFH A;  4HR2 A;  3FBE A;  5E7O B;  3A8I A;  1RWK B;  3NS7 B;  2AMC B;  3LAM A;  2X1G A;  1A0O B;  4GKK F;  4OV6 A;  2GLQ A;  2HQD A;  4FXW A;  4ZVS B;  2DCL A;  4E98 A;  1T9X A;  4X4U A;  5GMK a;  3AXK A;  4AQY J;  2OML A;  1WSR A;  3NLC A;  3M7V A;  1ZA2 B;  2LLZ A;  2N3O A;  2ZM6 J;  4DSE A;  3LAN A;  3PZP A;  4RZR A;  1IWG A;  2Y0B B;  2LVW A;  4UZB A;  3PKY A;  1R8C A;  2LQ8 A;  3ET6 B;  4J7C A;  1FER A;  2CJY B;  1ANI A;  4LFC J;  2IPO B;  2U1A A;  4ZPC A;  1CG2 A;  4TY8 A;  2VBY A;  3MR7 A;  2RU9 A;  4OI6 A;  4DX7 A;  5ADZ A;  3JS9 A;  4HH1 A;  4QPT A;  4PKD B;  3AAW B;  2DHX A;  2RQ4 A;  5J2Q B;  2ZE2 A;  3T1Y J;  3I0S B;  1R3N A;  1OY8 A;  2HHQ A;  4M8L A;  3W3S A;  4ED7 A;  1N5S A;  1DTT B;  2CQ1 A;  3KNA A;  3U27 A;  2OD6 A;  3SQG B;  2BQU A;  3K8V A;  1Q86 T;  1MMN A;  2MJN A;  3T6J A;  5C25 B;  1P9Q C;  2OPP B;  2FJV A;  1WKJ A;  3U7J A;  2VA2 A;  3UR3 C;  3T1A A;  2BKO A;  5K9F A;  1LK7 A;  4HTJ A;  2Y8W A;  2HNY A;  2VPX B;  4RWX A;  5E3R A;  4TN0 A;  2UUC F;  2NR0 A;  4OLO A;  4NLQ A;  4ZOS A;  2ZH9 A;  4CXK A;  1RWX B;  1PBA A;  4O3P A;  3TYT A;  1TZ0 A;  3NNA A;  5A6W A;  4CIO A;  1SJF A;  4O0I A;  2CQ4 A;  3LOU A;  4URG A;  3OV7 A;  1T11 A;  3AOB A;  1UKU A;  2RRB A;  1QUP A;  1NZ8 A;  2CFX A;  3S7R A;  1X4F A;  3TQ1 A;  3Q8Q B;  2OH2 A;  4ES3 A;  4C8Y A;  1R6V A;  2KI2 A;  1OSC A;  2WBR A;  4PXC A;  3MR3 A;  2WW8 A;  1K0T A;  4K2X A;  3SZY A;  1QE1 A;  4Y2C A;  1UVM A;  1Z2Z A;  5L8R C;  3VAL A;  4KBI A;  1IM4 A;  4OX8 A;  3TJA A;  2F4V F;  4A47 A;  5LMN F;  2VQF J;  1KWM A;  3OQ2 A;  1WAC A;  3IDD A;  4K4Y A;  2ZJQ Q;  3ENQ A;  3T5K A;  4JI5 J;  4ED5 A;  1FJE B;  2XEX A;  3DLG B;  5KT2 A;  2VHG A;  1B3T A;  4R0E A;  2ZHA A;  4ZVO B;  1SUQ A;  3CF5 Q;  4DFK A;  2V94 A;  4ZPT R;  1XNQ J;  4OIX A;  2DR5 A;  2H5E A;  2B9Y A;  4OZJ A;  2HWI A;  3M32 A;  1HBU A;  3DRP B;  4O3R A;  2ZH3 A;  3NXZ A;  2CVE A;  2MTL A;  3I4H X;  4WXW A;  1XK8 A;  1B0P A;  1KOH A;  4LF2 A;  4GTX A;  1BC6 A;  2SXL A;  1VRU B;  4MK9 A;  2HK3 A;  1T3O A;  1YJN S;  3MPW A;  2QLJ B;  2IM2 A;  2XSF A;  2WSE C;  3HVT A;  4V19 J;  3N6M A;  3KLH A;  2V8D A;  3MAA B;  3R1H A;  3EPI A;  3BM7 A;  2EG1 A;  2IBO A;  2RDI A;  2VA3 A;  3T00 A;  3GE9 A;  2JVO A;  2IFY A;  3CCM S;  1Q16 B;  2XS2 A;  4Y2A A;  3THP A;  2CA9 A;  3CW2 C;  3QSI A;  1REG X;  3FZ2 A;  2GHW A;  3BDF A;  1VFJ A;  5KFX A;  1RTJ B;  4C9D A;  1XIQ A;  3BBB A;  2FLN A;  1U0S A;  3L09 A;  2R7S A;  2BJ8 A;  5TJ3 A;  4CO4 A;  2E5I A;  1M90 T;  3PYF A;  2KJW A;  4ZCL A;  2WON B;  4J9N A;  1YZ6 A;  2I1R A;  5IZH A;  1GK8 A;  2CNO B;  4KYZ A;  2EFQ A;  1VK3 A;  3BSC A;  4FVC A;  1XNR J;  3EIC A;  4FBT A;  4O44 A;  3SCJ E;  3MEG A;  2OFH X;  1KQF B;  3UE2 A;  2HAF A;  4IR9 A;  3CJ2 A;  1T7P A;  2E9Z A;  2Z2M A;  4CXU A;  4RUC A;  3Q24 A;  2EFV A;  2FD2 A;  4YOE A;  1U48 A;  2CIM A;  1HJK A;  2CQ2 A;  1JNZ B;  2M9K A;  2QZU A;  3KHG A;  4CO2 A;  2AP6 A;  4IRC A;  3HXM A;  5T14 A;  2KH9 A;  5GMD A;  3WIU A;  4OLP A;  4GC7 A;  1X9M A;  5D4L A;  2HGN A;  4OI1 A;  1UP1 A;  1Y0H A;  4MIB A;  3BR9 A;  3T5H A;  1U47 A;  1VQK S;  4TU7 A;  5IT4 A;  3GFH A;  4M5M A;  1WDD A;  1DJ0 A;  1NO8 A;  2E1R A;  4DR2 J;  1FXD A;  4NI2 B;  3JYT A;  1M5H A;  3DHX A;  4RW8 B;  3OR1 B;  2XMT A;  4QR1 A;  2BQ3 A;  3V6J A;  2C2E A;  3VGV A;  1DBD A;  2C28 A;  2YKM B;  1FO1 A;  4G1P A;  2D7S A;  3VR1 A;  4A48 A;  4RUA A;  1FJG J;  2C3P A;  4DZ6 A;  4K4Z A;  1MWQ A;  2M8D B;  1FWL A;  4AE5 A;  4DUZ F;  2LA6 A;  3V6K A;  2DR9 A;  1ZEB A;  2H65 B;  2NUU G;  4Q2L A;  4USH A;  4Y2K A;  4DV7 F;  3NWG A;  2KKH A;  4JI6 J;  4OJ3 A;  1RA7 A;  3GSI A;  2FHM A;  3MMB A;  1K1S A;  2HBY B;  1T9U A;  4LF5 J;  2R4F A;  5KG1 A;  4A8K A;  2HQG A;  2CPI A;  4ILM A;  3FNN A;  3QJL A;  3AB4 B;  2VUG A;  2K06 A;  2IM3 A;  3ENV A;  2ZEJ A;  3B4D A;  1UFK A;  2CPJ A;  3MM9 B;  3M6X A;  2IUC A;  5KFF A;  2GIR A;  4P52 A;  1KKH A;  4NML A;  1IKV A;  1VQS A;  1EZZ B;  1FDD A;  4Z2X A;  1S6P A;  2DO0 A;  4W98 A;  1FTC A;  1AUS L;  5IWA J;  3MD3 A;  1KQK A;  4ZKA A;  1HNX J;  9RUB A;  2GQ2 A;  3DU6 A;  5BJR A;  2YX1 A;  1RSC A;  3BO3 A;  1Q8K A;  2WVE A;  1I6J A;  1EB0 A;  4K2J A;  2DEI A;  5LJ3 Y;  1UA0 A;  2KYX A;  1EQM A;  2W25 A;  5JUM A;  1KR4 A;  3HDS A;  2Q66 A;  2UUT A;  3K5M A;  1YRX A;  2WOM B;  3W2V A;  2G0I A;  4B3R F;  2ZD1 A;  3HVR A;  3C46 A;  2ZH5 A;  2R8K A;  3EWG A;  5E3P A;  3TEH B;  2NXU A;  4WTO B;  2VKR A;  1BGX T;  4CNY A;  1FXR A;  1YSJ A;  2BZ2 A;  1IKY A;  2HYI B;  1TL7 A;  4W92 B;  2CZ9 A;  2HHH J;  3UFC X;  1YBT A;  4ED1 A;  1TUW A;  4WFN Q;  2WAQ D;  5HMZ A;  1AXQ A;  1IJE B;  1J5O B;  5LQQ A;  3D1H A;  4FNI A;  2AGO A;  3TQE A;  1BQM A;  2UUB F;  4HHH A;  3W64 A;  1AJC A;  2HVH A;  1FDN A;  2V9K A;  1F5B A;  4OZ0 A;  1QVF R;  3LGN A;  2HG4 A;  2GHP A;  3ITH A;  5BYS A;  4DSK A;  2IFX A;  4OYB A;  1DAX A;  2F8E X;  3DC2 A;  2Y9H A;  1I1G A;  6AT1 B;  1RTH B;  2O3D A;  3OFF A;  3W1Y C;  3Q8R B;  3FQK A;  3KK1 B;  1WJ9 A;  3LAL A;  1U1P A;  3EJM A;  1GAO A;  3MCM A;  2GSN A;  1UPM B;  1H74 A;  2XYH B;  3BDE A;  1Y3J A;  4RW9 B;  1ZA1 B;  4FYX B;  1SL1 A;  1Q82 T;  2H54 B;  2BVZ A;  3VCD A;  2L9N A;  1SJ4 P;  3PYG A;  5KFV A;  2B9E A;  3FFI A;  2EFP A;  4IFV A;  2YKN B;  2DXD A;  4OYO A;  2DGT A;  1RU2 A;  1UFW A;  2HBR B;  3OR2 A;  2C2K B;  1H3D A;  1IBK J;  2PE8 A;  4WP9 A;  5GME A;  3MED A;  1Y5I B;  1TL1 B;  3JAM U;  3HT3 A;  1NDC A;  1ZOT A;  2HMI B;  3UPF A;  1ZBT A;  5BR8 J;  4OZ1 A;  3UN2 A;  4PWU A;  1QAX A;  2G0J A;  1RHR B;  2VJU A;  2E1C A;  2MSS A;  2DHS A;  3FK4 A;  3BGF A;  1HNW J;  3IGV A;  4L76 A;  3AD9 C;  4PPZ A;  2LQB A;  1S4F A;  3W5Y A;  3E2E A;  1S48 A;  3V2U C;  1RCX B;  2BYC A;  2W9C B;  1UEV A;  4Y3C A;  1LW2 A;  3PRV A;  4DL5 A;  2QEX S;  3VVU A;  2AKW B;  2E5G A;  4GMK A;  2YQ3 A;  1KTV A;  4IDK A;  4FZV A;  1V5I B;  3BKF A;  3EZU A;  4DSF A;  3M8P B;  4MYU A;  1IR1 A;  1Q8L A;  1HMV B;  4PQA A;  5F3Z A;  4QW9 A;  4ZP9 A;  4L3K A;  5EN1 A;  1VQ9 S;  4RO0 A;  4J91 A;  2VBW A;  2GMJ A;  2DR7 A;  5GAD U;  4QCL A;  2QFI A;  4PXD A;  1ALJ A;  4J9P A;  3UVJ A;  1IBM F;  4PUO A;  2RSQ A;  4F4X A;  1UWA A;  4GTW A;  2HQI A;  1ZZN A;  5HJY A;  2FDN A;  4LRB A;  2OIH A;  1FCA A;  2GIF A;  1UVI A;  1YRT A;  2DT9 A;  5I3P A;  2ZZM A;  3I87 A;  5KFU A;  4DF4 A;  1T94 A;  5AJ3 F;  3M6U A;  2YWK A;  3BF4 A;  3TUP A;  3CJK A;  1U6F A;  3LP0 B;  3GJR B;  1RWU A;  2C2D A;  2MKJ A;  4UTG A;  1BQX A;  4EFA C;  3GV5 B;  1Q95 G;  2XZD B;  1EAR A;  5SUH A;  5LSL A;  5HAT A;  1H72 C;  2RRN A;  3W65 A;  1A6L A;  2WB4 A;  3RBZ A;  2B8Q A;  1HBN A;  2F8M A;  4KGZ B;  1JLB B;  1N8R T;  2N3L A;  1JKH A;  5K8N A;  4F4A A;  2HLT A;  1IM6 A;  1NU4 A;  4OHX A;  2V8V A;  3CC4 S;  4F67 A;  1K47 A;  2YKQ A;  1C1C A;  2M2B A;  4USJ C;  3AQP A;  4URQ U;  3AD8 C;  3G82 A;  2DGQ A;  2CZ4 A;  3M1V B;  2OTJ S;  2GJ2 A;  2AX0 A;  2W8D A;  1R31 A;  1DLO A;  2BV3 A;  4IG3 B;  2V68 A;  4UY8 T;  1JQG A;  1NSQ A;  4OJ1 A;  4C0B A;  8AT1 B;  1LOU A;  4LSN B;  4AUK A;  1IBL J;  1YBU A;  4DN0 A;  2IYG A;  4CDI A;  3PO4 A;  2Z4P A;  4K5R A;  3MHY A;  4QBU A;  5CCL A;  2DYA A;  1REV B;  1ZAX A;  1E6V A;  1X8D A;  3TP2 A;  1UW9 A;  2HZV A;  1SB6 A;  4DWI A;  4FYD A;  5CYQ A;  4OYI A;  2VDI A;  1FT8 A;  2R7O A;  3CJ3 A;  3QZ7 A;  3DGP A;  4CLZ A;  4B3S F;  1VRT B;  2W7A A;  3GJS B;  3BGR B;  1NEE A;  3QAE A;  3VGU A;  5HAO A;  1JJC B;  3HI9 A;  5I3U B;  2AD9 A;  3IS9 B;  2XC9 A;  4JV2 A;  3IRX A;  2XUL A;  2RIJ A;  3DXS X;  5U47 A;  4J9V A;  3Q3Q A;  2H4Y B;  1K8A T;  1WKK A;  4EYI B;  3H0P A;  2DBB A;  4XIU A;  2OHD A;  2ASL A;  1LWC B;  4W4M A;  3QFW A;  1BWE A;  4KM4 A;  2V8G A;  3AH6 A;  5INH A;  3J81 j;  1VOM A;  4WCE Q;  4NA3 A;  1AJA A;  3CCR S;  1RHU B;  4MJK A;  2HEK A;  3N01 A;  2D3Z A;  3T19 A;  4WWS A;  2MJU A;  1GMV A;  1FVS A;  4ED2 A;  4N8N A;  2VOD A;  1YJW S;  4JB8 B;  2V8P A;  5B0D A;  4DUY F;  1S1V B;  3DLE A;  3IGY B;  2GGP B;  5D8H B;  1YJ7 A;  2C2N A;  4DPW A;  5THW A;  2VG5 B;  3DLB A;  2RAQ A;  3PW2 A;  4NYO A;  4K0K J;  5J2M B;  4ZHR B;  1ELY A;  4PQU A;  1VC6 A;  4DL4 A;  2ACM A;  4XK8 C;  4O3Q A;  2DR8 A;  4DV4 J;  1WG5 A;  3DU5 A;  2QYC A;  3R6G B;  5KFW A;  4YR0 A;  2P6S A;  2AGQ A;  2YQ0 A;  4KHR A;  2HWT A;  5J2N A;  2BRL A;  4DL2 A;  5HI7 A;  4K59 A;  4XDD A;  2UV8 A;  2NXC A;  4LQY A;  2PEB A;  1D8Y A;  1EIY B;  5ETP A;  4ZVT B;  1ZM2 A;  4RW6 B;  4JI7 J;  2DHA A;  2IRY A;  5G0R A;  1H2V Z;  4J37 A;  3BV8 A;  1Q5Y A;  4G1Q A;  3M30 A;  1RT5 A;  4UY8 5;  2YWE A;  1KC8 T;  5EX3 A;  2UXB J;  4DL6 A;  4IH7 A;  1ZAW A;  1V3S A;  1G3O A;  1OSD A;  4ETX A;  4UF4 A;  3DMJ B;  1QJH A;  2RRA A;  1NJX A;  3OLB A;  2G0C A;  5J2P B;  1Q78 A;  1KVJ A;  2Z58 B;  4ZG7 A;  4C11 A;  2YX4 A;  3I6P A;  1LWE A;  2VU5 A;  4G1I A;  2D3U A;  2B4U A;  2LEP A;  4ES2 A;  4ELT A;  3VAF A;  3G6E S;  3I31 A;  1D1U A;  4EO6 A;  1U7L A;  1R0A B;  1QAY A;  2NSB A;  3KJF B;  1KOO A;  1F9H A;  3KLV A;  3DOK B;  5FLX U;  3VAM A;  3PHE A;  2X3D A;  4HLB A;  2H3E B;  4DR1 F;  2HHV A;  1F2G A;  2KRB A;  3A8K A;  1PJ7 A;  4RNH A;  3A8E A;  3DM2 A;  1X0P A;  2CQC A;  1C1B B;  4OHV A;  3KUH A;  1BQN B;  1X4G A;  4F3M A;  5LIA A;  4DZD A;  2XQC A;  3FBF A;  2APO A;  3NKP A;  2IM0 A;  4KHP F;  4J9M A;  1HNI B;  3DLK A;  4QIV A;  5L9N A;  4OV1 A;  2QO3 A;  2DNN A;  4Q0B B;  3HF5 A;  4FPR A;  3PV8 A;  2CVI A;  1DZ5 A;  3BSO A;  4C98 A;  4NLY A;  2K7J A;  3KJV B;  1SXL A;  2KJV A;  1N33 J;  1XBW A;  2EWH A;  1LV5 A;  2BE2 A;  2ZZN A;  2CYY A;  3S01 A;  2BEF A;  5C2C A;  1EP4 B;  1S9G B;  4B3M J;  2GQC A;  1QLN A;  2HVI A;  4DPX A;  4QWE A;  3AOA A;  4O0N A;  2YX7 A;  4IFY B;  1TK8 A;  5EUH A;  3NCP A;  2IVM A;  2GZO A;  4ZVQ B;  4JI3 J;  4K4V A;  2R7U A;  1FFG B;  3E8O A;  1GXU A;  1RT7 B;  2BAN B;  1RAF B;  2UU9 J;  2GVD B;  3M2V B;  1CLF A;  4DR7 F;  4TY9 A;  1ZPV A;  1NK9 A;  1SV5 B;  3QQC D;  4P72 A;  2XM3 A;  2HQC A;  3GQC A;  1JLG B;  2GC8 A;  3MPV A;  2L48 A;  2ALZ A;  3GFZ A;  5F8I A;  3KDO A;  2UVV A;  4R0J A;  2NQP A;  1FF2 A;  1NB2 A;  3QWP A;  3W66 A;  3C15 B;  3LGH A;  1U25 A;  3NCQ A;  3PW7 A;  3J7Z T;  3HHL A;  3EGV A;  1KH7 A;  2RH3 A;  5L1J A;  1O51 A;  3GJQ B;  3AXM A;  5KT3 A;  1FNO A;  5MAO A;  3R6L B;  4CLS A;  3CCU S;  3UD4 P;  1NHK L;  2H9Z A;  3ZZY A;  4KO0 B;  4NLU A;  1FRJ A;  2D41 A;  2PEH A;  4LFA J;  4F04 B;  4USI A;  2C22 A;  4ZJO A;  1GX6 A;  4J9L A;  1BD6 A;  4WIQ A;  5FII A;  4PAA A;  1HIY A;  3KG0 A;  3OW2 R;  2A2D A;  4LRE A;  4OZ3 A;  1VK8 A;  3J80 Y;  3M9O B;  3GII A;  3NBP A;  4ATN A;  2O67 A;  3NMA A;  4CTA B;  2GS8 A;  3HJV A;  3CCS S;  3KLG B;  1T03 B;  4ECX A;  2H48 B;  2GVZ B;  5AXK A;  4NYP A;  4PYA A;  3GYX B;  1HPZ B;  2QL7 B;  3M8Z A;  1VR6 A;  1T9T A;  7FD1 A;  3C14 B;  5D4P A;  1VJW A;  3H4B A;  1RTZ A;  3Q22 A;  2CAD A;  4H4O A;  5ETS A;  2D9P A;  1RHJ B;  1HWL A;  3E3X A;  1CJT A;  1J5E F;  1KN6 A;  4YR2 A;  3PIO Q;  1I5O B;  5A76 A;  3NKO A;  4CYU A;  1KLM A;  4C8Z A;  4BC9 A;  1WEZ A;  2Q79 A;  1RQ0 A;  3GZ7 A;  3HX9 A;  2RT3 A;  3FKB A;  2E9T A;  3W5X A;  2CAJ A;  3CMQ A;  5GVQ A;  4TYB A;  1JB0 C;  1GNK A;  4TY8 B;  2MQP A;  3GV8 B;  3QO9 A;  3AOD A;  4EGL A;  4OYA A;  3CIZ A;  3GIR A;  2E1A A;  2DGW A;  1SPB P;  3BJY A;  3ISZ A;  5IJS A;  4JUZ A;  2AJ2 A;  3O3L A;  2ZDO A;  3CCJ S;  5DZ7 A;  3K0J A;  1S12 A;  3IRW P;  4NXM J;  5J1N A;  1RAB B;  2VOP A;  4EUV A;  3C6T B;  2XHC A;  2ZJP Q;  4ID5 A;  2V50 A;  2DNZ A;  3P49 B;  2HHX A;  1S97 A;  2DPI A;  2ZH1 A;  1WSV A;  1HHT P;  1YI2 S;  5DM6 Q;  6FDR A;  2BOP A;  2E5H A;  4TU9 A;  1FWK A;  2C3Y A;  4OX6 A;  3GYG A;  1SH2 A;  4ELV A;  2ZNZ A;  2R7V A;  2D3O 1;  2W5V A;  1R8P A;  3ISN D;  5E3Q A;  3SCL E;  4XO0 A;  3TW0 A;  1JJH A;  2JDJ A;  3A3N B;  1XMQ F;  3IN5 A;  3IXQ A;  2HHW A;  2ATC B;  5KFS A;  1LK5 A;  3SFU A;  4YY3 F;  1BLU A;  2JZ5 A;  5CH7 B;  2NYH A;  3OTO J;  1ANJ A;  2CJQ A;  1X4A A;  1EHW A;  3QJP A;  3ZTS A;  3H59 A;  2V2K A;  2B0G A;  1WF2 A;  2PGC A;  1TV6 A;  2IM1 A;  4XPE A;  3R5G A;  1N32 J;  2COL A;  3EGW B;  2WSF C;  5J1P A;  1S6O A;  3N5F A;  1X4B A;  1S77 D;  3TI0 A;  4KKO A;  1WOS A;  4ZPA A;  2EBE A;  2YWG A;  4S0M A;  2FHO B;  4U7C A;  4KV8 B;  3V4M A;  3CDE A;  1SL0 A;  3BDG A;  3D54 A;  2HSE B;  2FHJ D;  3W5Z A;  4CH0 S;  4DV6 J;  3NKM A;  3QZ8 A;  4HAC A;  3OVB A;  3PY8 A;  4TYA A;  2JHE A;  3HZG A;  2OP5 A;  4DX5 A;  3PJ9 A;  1AJB A;  3M8W A;  1RKI A;  3I32 A;  3D2W A;  1VQL S;  1MRO B;  4PG4 A;  3LP2 A;  3QBC A;  4ECV A;  3TZY A;  2FVR A;  3M32 B;  1HBU B;  2VH7 A;  3EGZ A;  2FUG 9;  4DR4 F;  3EVO A;  3RB4 A;  2KXH A;  4KE5 A;  4LBI A;  4CO5 A;  2ZHB A;  3LTO A;  1TKZ A;  1YLX A;  2I9S A;  2E7W A;  1RT2 A;  1IKW A;  4I69 A;  1U09 A;  4LF6 J;  1FJC A;  1F1B B;  3HVT B;  3IM9 A;  2XY7 A;  4NEZ A;  4EU0 A;  2YWH A;  3DRS B;  3VZH A;  3DHW C;  1UAW A;  4WTY A;  2HIQ A;  2YNG A;  1OPZ A;  4DU8 A;  3Q2T C;  5ETL A;  2UUA F;  1NBE B;  2GIQ A;  4F2S A;  2CWX A;  2MDA A;  3TVK A;  3CCE S;  1CC7 A;  5HL7 Q;  2I2Y A;  3OTD A;  3JTO A;  2V9W A;  3IBW A;  1P49 A;  3DOL B;  1T05 B;  1E1Z P;  3VV2 B;  3AA9 A;  4CLK A;  2AQ4 A;  4EBD A;  2DHH A;  3LWM A;  4Q43 A;  3UD3 P;  2B9X A;  4B56 A;  2WVF A;  1DFD A;  2DEJ A;  3CCV S;  4U7U D;  4QIG A;  3CGI A;  4I64 A;  2BQR A;  2HNZ A;  1LFW A;  4B9V A;  2IAJ A;  4O44 B;  3CJ5 A;  3MEG B;  2Z2Y B;  4USK A;  2RB7 A;  4O4G A;  4ZCM A;  1FDA A;  2PA8 D;  2K1R A;  2MHE A;  3R5A A;  1U02 A;  2ZH7 A;  4NL5 A;  4LSL A;  3Q86 A;  4X4S A;  3GFX A;  1AW0 A;  1UCN A;  2KO1 A;  3A3O B;  1VMB A;  2XSJ B;  3PCO B;  3LPE A;  5LRN A;  2IC3 A;  4PZV A;  3PO5 A;  5H9F J;  3DRR B;  2K8G A;  5DLW A;  4IYQ A;  1KHW A;  3F0N A;  3NNC A;  3TAQ A;  5C24 A;  4ZPW R;  2J6T A;  1CSJ A;  5A8W B;  2Q6B A;  4WP3 A;  4MIW A;  4JOU A;  4ZPB A;  1HD0 A;  1IQZ A;  3MCN A;  3JYT B;  3MMA A;  2VJV A;  1G4C A;  2W2N P;  4I2Q B;  1K44 A;  4DPU A;  1XWL A;  3PX4 A;  2D1C A;  3FUY A;  4DLG A;  1T95 A;  1CPZ A;  4QR2 A;  2Z56 B;  5H1S V;  2GO9 A;  2ZIT A;  5K8P A;  2V5H G;  3OJU A;  4GVB B;  4OI4 A;  4CM0 A;  1SQF A;  1RT4 A;  4RX6 A;  4FF1 A;  4WZM A;  3TUZ C;  2VBX A;  4WPA A;  4B3S J;  2FJB B;  1MN7 A;  4RW7 A;  5HVG A;  2DY9 A;  2QMX A;  3LA0 A;  3PG9 A;  4K4S A;  3MMB B;  5IV3 A;  3M8Q A;  1F9F A;  1SHN A;  4UQG A;  4A8Q A;  1SJ3 P;  4CLL A;  3OL9 A;  4CLW A;  3EUN A;  4ZA1 A;  4KB7 A;  3PX6 A;  3GON A;  4QIF A;  3US5 A;  4CO0 A;  2DH9 A;  2XMW A;  4N76 A;  4C2M A;  5DDO C;  5B0E A;  3FMB A;  2M52 A;  5KFB A;  2W2M P;  3WAX A;  5A0Y B;  4N41 A;  4LBH A;  4LIW A;  1URN A;  1FX2 A;  3D3B J;  2IUC B;  3QWU A;  1U26 A;  4P7V A;  4IOB A;  1IKV B;  5D77 A;  2E5J A;  1S6P B;  2UZA A;  1D9A A;  3OHA A;  3J7Y U;  1AB8 A;  4OYM A;  2VG7 A;  4DUY J;  1JLC A;  2EG2 A;  2DD8 S;  1SQE A;  2ZUG A;  4UOG A;  1KLN A;  1KHL A;  1FK9 A;  1JXV A;  3Q8V A;  1ZM3 A;  5HMX A;  4XPC A;  1ZS6 A;  4JI4 J;  2CQG A;  2OD4 A;  3AJ2 A;  3LP1 A;  2X1A A;  3L4B C;  1Z4U A;  2HHS A;  1U0H A;  3HHE A;  4DCO B;  5K8M A;  2NPI A;  3W2V B;  3TUJ C;  2RQC A;  1KHJ A;  2ZD1 B;  3ENW A;  3I0R A;  4JBC A;  1H2T Z;  1WHW A;  2WVD A;  1FJ7 A;  2FPH X;  3TG0 A;  4M5D A;  3QIP A;  1JXE A;  3OSN A;  1WI8 A;  1URB A;  3RAX A;  1TL7 B;  4BWJ A;  3ISN C;  4NLT A;  3O5T B;  4ZPD A;  4P2X A;  4PXB A;  4KAI A;  4CQ1 A;  4LF8 F;  4ZCK A;  3KJN B;  1TK5 A;  3OTB A;  1RAG B;  5T7L A;  4LFB F;  4OQJ A;  4BS2 A;  4OJG A;  3ZTQ A;  3J7Y I;  1S59 A;  3H8Y A;  2FJE B;  1Y5N B;  4DJB A;  2AV5 A;  3KMQ A;  2Y8Y A;  2O1P A;  4MAK A;  5A8K A;  5I3Q A;  1FRI A;  3FEZ A;  2JWN A;  1IQT A;  1L3T A;  3MEK A;  2FHK A;  3ITH B;  4CLT A;  5EGH A;  4B3T F;  5KAK A;  1OY9 A;  5GAG I;  2V2Z A;  2QLB B;  1HR0 J;  2R8I A;  2HKE A;  3DI6 B;  4C4W A;  4C6A A;  4TKT A;  3OUY A;  2IYI A;  3P4U B;  4GO7 X;  4U7U K;  1JLA A;  1UEU A;  2C42 A;  4OI0 A;  1JJ2 R;  1N5Y A;  4I7F B;  2YNI A;  1MG7 A;  4IFV B;  4F0M A;  2B6A A;  2FZG B;  1ICE B;  3O1L A;  3ULH A;  4X62 F;  2F4F A;  3OR2 B;  2OEL A;  3MED B;  2X1F A;  1TKD A;  1O8B A;  4AT1 B;  1U1Q A;  2V2V A;  5KOW A;  5E33 A;  4DPO A;  2Q6C A;  2IJF A;  3H4D A;  1WWH A;  1S9F A;  4HYK A;  4LIR A;  3H7H B;  2XNQ A;  3K57 A;  3CCT A;  1KRP A;  5F0U A;  4DXL A;  5I42 A;  4C3L A;  4RNM A;  2LDI A;  3V6D B;  1LW2 B;  1N48 A;  1N5V A;  2L9W A;  2G2O A;  5A2Q Y;  1ELX A;  1U24 A;  3TVY A;  2VIC A;  5J1E A;  1UVL A;  4X66 J;  4DCP B;  2BDP A;  3QAT A;  3ETM A;  3NGD A;  3OFH A;  2C2O B;  4IDK B;  4AND A;  5KG7 A;  8ATC B;  2LQ9 A;  4UPI A;  4JI0 F;  4YR3 A;  3LWL A;  1MU2 A;  1T0T V;  3H5U A;  3R27 A;  2MQO A;  1KHN A;  1FSU A;  4DV5 F;  1X31 C;  5HP1 A;  4XAK A;  1HW9 A;  3UVJ B;  1VQ5 S;  4OZ5 A;  1JLF B;  4BC7 A;  5L38 A;  2BX6 A;  2DNR A;  1SCJ B;  2ZKU A;  3DN9 A;  4KGV B;  1QUV A;  2V4J A;  1ZM4 A;  4NLW A;  5C42 B;  3T41 A;  2C3M A;  4RLE A;  1HWU A;  2ZWP A;  3G8T A;  2W9A A;  4ZVR B;  4Q45 A;  3WC2 A;  5E3C A;  2IHR 1;  4B9S A;  4M5K A;  2VL1 A;  1Q53 A;  3POT A;  4HI1 A;  3QT8 A;  4HHJ A;  1S9E A;  1QTM A;  3Q8U A;  5DDQ C;  3GMG A;  3SMZ A;  4ZLN A;  1H38 A;  4X64 J;  2WB1 D;  5IFM A;  1BUX A;  1RAC B;  1IKX A;  2FTR A;  2FHJ A;  3ZFV A;  4JP8 A;  2V67 A;  1X5P A;  1JKH B;  4ECU A;  2UXD F;  2XO6 A;  3DDN A;  2XMK A;  1SI9 A;  3MD1 A;  2ERR A;  4KPC A;  4QPX A;  2RD5 C;  5LMU J;  1ZPW X;  1FRX A;  4JI1 J;  4G65 A;  3I4P A;  3Q83 A;  4K4X A;  3HVA A;  4LRC A;  1DLO B;  1DTQ B;  2L08 A;  2A6O A;  2UVU A;  5B0B A;  4ED3 A;  5H9E K;  1C0T A;  3HK2 A;  2YNF A;  4GVL A;  3NAI A;  1U2F A;  1E6V B;  1NLK L;  3NOG A;  2WZ1 A;  1VQ6 S;  1X4E A;  3CPW R;  3GP9 A;  2EC2 A;  2GHV C;  1CQM A;  4F02 A;  5EHH A;  1AYE A;  1SVD A;  4DL7 A;  3SDE A;  1JWW A;  4K4W A;  3PIP Q;  2ZBQ A;  3TUI C;  2XG8 A;  3DGP B;  3PTW A;  2XHW A;  2OGU A;  2QN6 B;  3FDS A;  2RDJ A;  4ILL A;  3RJM B;  2GCF A;  2G13 A;  3CD5 A;  4CNZ A;  4NX9 A;  1OYD A;  2QL9 B;  4NZ6 A;  3MTK A;  3VVT A;  4ZJL A;  1NK5 A;  3HUL A;  2MMY A;  1TVR A;  2ZVI A;  2AJF E;  4PG5 A;  2YKA A;  3OPK A;  4DV0 J;  3P8B B;  4OX9 F;  2MB0 B;  3KK3 A;  1T9Y A;  3KHR A;  2KFN A;  3WIV A;  3ILL A;  3CME S;  3DDK A;  1GTH A;  3JQM A;  1YG0 A;  4IO9 Q;  4F4K A;  4X4R A;  2HND A;  2J9E A;  1XN9 A;  5K4P A;  3DDI A;  1IR0 A;  1UWB A;  1FEE A;  5J2Q A;  2W8S A;  2KXF A;  3ONQ A;  3OHB A;  2R8J A;  3DLE B;  4EWT A;  1G6B A;  1YJR A;  1U2R A;  4UUW A;  3DXB A;  2CJ9 A;  4GRS A;  3HP6 A;  1VIO A;  4EEY A;  3F56 A;  3MM8 B;  2KVQ E;  2XWY A;  1HA1 A;  1W25 A;  3J7A N;  1XR7 A;  4ZIW A;  4PQU B;  5EX0 A;  1XMQ J;  4CYS A;  4DFP A;  3CMA S;  4KRW A;  3DLL Q;  4USV A;  2JC0 A;  4DU7 A;  2RU3 A;  3NCR A;  1SJR A;  3GWC A;  2R7W A;  4HHU A;  4I68 A;  1HBM A;  5J2N B;  1KHV A;  3CDU A;  1TP7 A;  3W62 A;  3IGZ B;  2YKO A;  5CAA A;  3KLE A;  4EBC A;  2EI5 A;  4NWJ A;  5G0R B;  5EWG A;  3OXG A;  3MM6 B;  4GKJ J; 
#chains in the Genus database with same CATH homology
 3WAY A;  3BDG A;  4LRA A;  2VQR A;  3MK0 A;  1SHQ A;  1EQJ A;  1AJD A;  5LRM A;  5DLW A;  2XR9 A;  2ANH A;  1ALJ A;  3NKM A;  2W5R A;  4KM4 A;  3BDH A;  5INH A;  3NKP A;  2W8D A;  3SZZ A;  1EW8 A;  4GTW A;  1EI6 A;  3WAX A;  3BDF A;  5K4P A;  5IJQ A;  1AJA A;  3M8Y A;  3NKN A;  5GRR A;  2IUC B;  1AJB A;  3LXQ A;  3MK2 A;  4LRB A;  1KHK A;  3M8W A;  1E33 P;  2W8S A;  1O98 A;  4UPK A;  1P49 A;  2IUC A;  1E1Z P;  3NKO A;  3OT9 A;  5TJ3 A;  1K7H A;  4KAY A;  4LR2 A;  2GLQ A;  2ZKT A;  5L0E A;  4GTZ A;  4TN0 A;  1ALI A;  1E3C P;  3A52 A;  4ZGA A;  4LRF A;  5LQQ A;  1N2L A;  4NWX A;  4LR9 A;  3IGY B;  3UN2 A;  4ZG6 A;  1KH7 A;  4B56 A;  5HRT A;  3E2D A;  3MK1 A;  4MY4 A;  2W5X A;  1Y7A A;  2GSO A;  2W5V A;  4CXK A;  4UPH A;  4LRD A;  5L0B A;  5DLT A;  3M7V A;  4UOP A;  1EW9 A;  3CMR A;  2D1G A;  4CXS A;  1O99 A;  3WBH A;  1AJC A;  1KHL A;  1EW2 A;  4KJD A;  3KD8 A;  4ZG7 A;  2W5S A;  4UPL A;  1ALK A;  3TX0 A;  1HDH A;  3T01 A;  5EGH A;  5L0K A;  4N7T A;  3T02 A;  1ELX A;  4CYS A;  1ELZ A;  1ZEF A;  4ZG9 A;  1ELY A;  4GTX A;  5EGE A;  2XRG A;  5KXA A;  1ZED A;  4LR8 A;  4LR7 A;  1E2S P;  1ANI A;  1ANJ A;  2GSU A;  3DPC A;  3NKR A;  1KH5 A;  1B8J A;  3TWZ A;  1ALH A;  3WAW A;  2RH6 A;  4UPI A;  4CXU A;  1KHJ A;  5GOV A;  1ZEB A;  1URA A;  1HQA A;  3B5Q A;  3NKQ A;  4GTY A;  4MHX A;  4UOO A;  3IGZ B;  4UOR A;  5AJ9 A;  5IJS A;  5C66 A;  3WAV A;  3ED4 A;  3SZY A;  1N2K A;  4KAV A;  4LRE A;  4MIV A;  1AUK A;  1SHN A;  3UN5 A;  3UNY A;  4KJG A;  2GSN A;  3UN3 A;  1KHN A;  1KH4 A;  4FDI A;  1FSU A;  1EJJ A;  4FDJ A;  2GA3 A;  1ED8 A;  1HJK A;  4LQY A;  4NWJ A;  3BDG B;  4CYR A;  4YR1 A;  2QZU A;  1ED9 A;  2X98 A;  3DYC A;  5LRN A;  3IDD A;  3TG0 A;  3T00 A;  3NVL A;  1Y6V A;  1KH9 A;  3Q3Q A;  3M8Z A;  5DLV A;  3UO0 A;  5LIA A;  2IFY A;  2W5Q A;  2W5W A;  2G9Y A;  2W5T A;  4QAX A;  4LRC A;  1URB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...