4LRSB

Crystal and solution structures of the bifunctional enzyme (aldolase/aldehyde dehydrogenase) from thermomonospora curvata, reveal a cofactor-binding domain motion during nad+ and coa accommodation whithin the shared cofactor-binding site
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
294
structure length
294
Chain Sequence
GKAVAAIVGPGNIGTDLLIKLQRSEHIEVRYMVGVDPASEGLARARKLGVEASAEGVDWLLEQDELPDLVFEATSAKAHLANAPRYAEAGITAIDLTPAAVGPLVCPPVNLTEHLDAPNVNMITCGGQATIPIVHAVSRVVPVAYAEIVAAIASRSAGPGTRANIDEFTETTAAAIEQVGGAARGKAIIILNPVEPPMIMRDTVYCAIPPDADTDAITASIEEMVAEVARYVPGYTLRTEPQYDQPRDIWKGMARVAVFLEVRGNGDYLPPWAGNLDIMTAAAARVGELLAQAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal and solution structures of the bifunctional enzyme (Aldolase/Aldehyde dehydrogenase) from Thermomonospora curvata, reveal a cofactor-binding domain motion during NAD+ and CoA accommodation whithin the shared cofactor-binding site
rcsb
source organism Thermomonospora curvata
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-2-oxovalerate aldolase
total genus 99
structure length 294
sequence length 294
ec nomenclature ec 1.2.1.10: Acetaldehyde dehydrogenase (acetylating).
pdb deposition date 2013-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
B PF09290 AcetDehyd-dimer Prokaryotic acetaldehyde dehydrogenase, dimerisation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4lrsB02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lrsB01
3HSKA 4CV0A 2C54A 1ZSYA 3GG2A 2HLPA 3L4BC 1YL6A 2A9FA 1T1SA 1YJQA 4EZBA 4RF5A 4CQMA 2OORA 4IQGA 3B6ZA 3GPIA 4E5YA 4XZ3A 1I0ZA 4K6CA 3ZV5A 3QV1A 2DM6A 5KIAA 3ZN2A 1G6KA 2O23A 1A72A 1E77A 4JBHA 2EF1A 4JNKA 1SPXA 1NHWA 4DIFA 1PEDA 4BNFA 4AJ2A 1NASA 3AUSA 3JYLA 4M55A 2Q50A 3ZNNA 1Z73A 4YJGB 3RKRA 4BNXA 2FPGA 3BAZA 3FBGA 1GADO 1AXEA 5TRTA 2VWHA 3IJPA 3UH1A 4RGBA 1LUAA 4OAQA 4TKLA 1Q0QA 3RI3A 1SCUA 3LLVA 1R0SA 3JD0A 3QA9A 2VCYA 3OJOA 4L4XA 1Q1NA 2PGJA 4BV8A 4BUCA 2YY7A 3U4IA 3ICPA 4EUEA 4TRNA 4A5OA 1ML3A 5DP2A 3W4KA 5FF9A 3SXPA 4PRLA 1WPQA 3B1KA 4MKRA 2DLDA 3K2EA 4L76A 4XD2A 2NADA 4KP7A 3NRCA 2Y1GA 3PHHA 2FWMX 3QVXA 1YXMA 5COQA 4B4UA 2AXQA 4RVFA 1XGKA 3L4SO 4Z0PA 5G4KA 4QFCA 3EZLA 1KVRA 4HV4A 3HHPA 3NEPX 1T2DA 2I6TA 3HUDA 2JAHA 1NFRA 1HE2A 1EVYA 4KTVE 4ALIA 3K96A 1I2ZA 1CEQA 2AQIA 2CFCA 3AM5A 5FI5A 2ZJ1A 4GBJA 2VHWA 2WD7B 1SEVA 3PJFA 4J6FA 3V2GA 1UR5A 2NNLD 3PGJA 3ZWVA 4BNMA 4PN3A 3ENKA 3PIIA 1SAYA 2OHXA 1DDOA 4HFNA 2VHYA 5I9NA 3WB9A 1N1EA 2C5AA 4YJDA 3AI2A 2ZKLA 4UEJA 3KXDA 3GF4A 5A4DA 3UGKA 4R41A 1B16A 4NJMB 4XB1A 4KOAA 4HFRA 5EQFA 1R37A 3OQBA 4W7IA 4MIEA 1KERA 2GASA 1R0KA 4A7PA 1A5ZA 4BKUA 3FR8A 3GFGA 3NYWA 2J3HA 1ONOA 4UVHA 3SLKA 1ZSVA 3E18A 2E48A 2UVDA 4WLUA 3Q0EA 2EWMA 2QZ9A 2C59A 2JJYA 4QTZA 1UXHA 5U1PA 4XGNA 1KC1A 1O0SA 3NJ4A 2HAEA 4CMIA 5A9SA 4Z3KA 1VRWA 3WMXA 1UDBA 5A02A 4MKXA 3CH6A 4HFMA 4NU6A 3BIOA 2O3QA 2C2YA 3QVTA 4R1NA 1RWBA 5L4SA 4CMJA 1J5PA 1HYHA 3AJRA 3WWZA 4MIOA 5G0VA 4ZJUA 3RFXA 2RCYA 2O3TA 4GX0A 2C0CA 3VPGA 3U62A 4UUNA 2WM3A 4KUGA 2Y0EA 3FPLA 3WJ7A 4FFPA 3Q2KA 5ES3A 4LMPA 1B8PA 5JNLA 1E7SA 1P31A 3W4IA 4NBRA 3IC5A 3JD4A 1ENZA 1GR0A 4L73A 2F1KA 3Q1LA 1Y7TA 2ZTVA 4WLOA 5L4NA 3MJCA 4BB5A 5CDGA 4H16A 3IDSA 5CG1A 1XIVA 4L75A 3KYDA 4EITA 3VZSA 4LISA 1V8BA 3G79A 3A06A 5BNTA 4EJ6A 4CR8A 2GDZA 3E82A 5JSFA 2ZIZA 4MVJG 1J6UA 1WP4A 2WEKA 4BMVA 3IAHA 5JYEA 3OHSX 2B4QA 4BGIA 3KSUA 1CJCA 3TSCA 4BNKA 2Y0DA 4UEKA 4PG4A 3FCOA 2JHFA 2HJSA 3VTFA 4DYDA 4FR5A 4BQPA 4PFJA 1KYQA 1D3AA 3BMNB 4FC7A 1ZKMA 2JD0A 1W6UA 4PLVA 4YJFB 1DAOA 4B3JA 4DLBA 5B37A 3SLGA 1I36A 4ONEA 5IAAA 3DWFA 2ET6A 2FPPA 2OP1A 4MDHA 4XGKA 3VZQA 3WBFA 1KY4A 5A5FA 5C3MA 4A2CA 4EYEA 1DC6A 4Y98A 1GYPA 1Q7CA 3NDJA 1BHSA 5IN5A 2WD7A 4FB5A 4IS3A 2CF6A 4O1MA 5B4VA 1T2FA 5IDYA 4CLOA 3GEMA 4CV1A 1LA2A 1OI7A 3O26A 2PKQP 1GYQA 3PXXA 3TZCA 3PDJA 1ENOA 3TDKA 4KTTE 3WSWA 1FDWA 4IJVA 1I01A 2DPHA 3JYNA 2AW5A 5F5LA 5H82A 5IF3A 3JD3A 2D4AA 2ZK7A 1KVQA 1WZEA 4QQRA 1QG6A 3S55A 1NQTA 1D1TA 2GRAA 4FDAA 4N5MA 1W4ZA 4I8XA 3GDGA 5TJ9A 3JD2A 3GNQA 1ISFA 3TF5A 4CM8A 1BXGB 1VPDA 2GR9A 7ADHA 5AVOA 2WMDA 2Y93A 1YDWA 2YUTA 1JKIA 2DVMA 3TQHA 5EINA 4WGGA 3KEOA 3DBRA 1WDLA 2DUUA 3OQ1A 3QQPA 2VOJA 4FC6A 5HS4A 5TGDA 2JD2A 4O6VA 1DO8A 2IDZA 2EG9A 3ORFA 3W8FA 3HDQA 2VYVA 3CSDA 2D8AA 1HLDA 1XR3A 2WYVA 3BMCB 1U7HA 4ZRMA 5JMPA 4AJOA 4D0RA 2NU8A 1C1DA 3GQVA 2OOSA 1XHLA 5DCYA 1H94A 4RPLA 4MIYA 1NHGA 1DJQA 4K26A 3ZHXA 3PLNA 1I32A 3QWBA 4FFNA 4WEOA 2CVQA 5JE8A 1GDHA 4IBOA 1KY5A 3F6YA 3ULKA 3WMWA 5T57A 5A1TA 4J7XA 5L3ZA 2P68A 5GZ3A 3M2PA 3C24A 4OXKA 4O63O 4RVDA 1VM6A 3PQDA 1U2DA 4U6SA 4BV9A 1Y5MA 4E33A 5ILOA 5G0TA 4CUZA 4ALMA 4OHUA 5I8WA 4BNVA 2HRZA 3U3XA 2O4UX 3MWEB 4WCFA 1E3WB 1U4SA 4Z3DA 2HQ1A 1U4OA 2YQ5A 3AUUA 1AGNA 1ZSNA 3RC2A 2UUPA 1ID1A 4Z9YA 2QZZA 3RUHA 4GL4A 4DPMA 3PYMA 4B3HA 4J16A 4RVHA 3EAGA 4OSPA 4CM6A 3BYZA 2YHUA 5JLAA 1UAGA 4DREA 4AICA 1SZJG 3QWAA 3PYLA 3RCBA 3D5TA 3OJ0A 3ZCXA 3QWHA 5F3RA 5G4LA 3RROA 4E2XA 3PJDA 4R69A 3VC7A 4DL9A 4YAEA 5DP1A 1TXGA 4IDGA 1LQTA 3GHYA 4CLHA 1FDUA 4WOKA 3T4XA 4BNWA 5KJ1A 4N7RA 5AXDA 3PZBA 1P1FA 4FIZA 3JCZA 2E49A 4GVXA 3B20A 1O95A 3IQDB 3KYCA 5HWSA 1PZFA 4BKQA 1MV8A 3OA0A 3EK2A 5JY6A 5A3JA 4GPD1 4D7AA 3WGOA 4CLEA 2BF7A 1PQUA 2CUKA 3F4BA 1ZUD1 2FPIA 1HKUA 1O9BA 1OC2A 1R66A 2JCVA 5C7IO 4BHTA 3S2IA 5HA5A 5KKAA 2DAPA 2I5PO 1GV0A 2X5KO 3LK7A 4IXTA 2RH8A 3NUGA 2WE7A 3ZGYA 1TT5B 1WDKA 4M89A 1PU2A 1IY8A 1P45A 4CQLA 2O48X 1KOLA 4I1IA 1YOVA 4PZCA 3VPFA 1WMAA 3GAZA 3KYCB 1ISGA 3L6EA 4H7PA 3RJ9A 1NVGA 1GQ2A 3ZHYA 1UZNA 3BZUA 4LK3A 5JDCA 1KIFA 3RUFA 4UUOA 3ADOA 2FSSA 2ZTMA 3ONFA 3RUCA 4JROA 3AK4A 4PG8A 4FJ0A 1AHHA 1NXQA 3CKYA 4ZN6A 4GLOA 3GY0A 2D3TA 2IZ0A 3E48A 3OSUA 1N92A 2GGSA 2P5YA 1NNUA 3IS3A 5EERA 1RM5A 4AJNA 5T64A 1PS8A 5MDHA 2TMDA 2BH9A 2D0IA 2GO1A 2P2SA 1LLDA 4UVGA 1PZGA 2HMTA 3UF0A 5C37A 4RJTA 3FHLA 2VRCA 3PQFA 2OFPA 1ISMA 4ZA2A 1UDAA 2HU2A 2AEJA 1FDVA 5DN9A 1NP3A 1UH5A 3HDYA 4M87A 1NFQA 3IL2A 1G0OA 1GL3A 4OH1A 1UP7A 5JBIA 5COAA 1C0LA 2QQ5A 3I52A 4UAGA 2CY0A 4RPKA 4NH4A 4DQXA 4LVCA 1K89A 1F17A 3Q11A 3NJ8A 4U0KA 4AJHA 5A03A 2HCTA 2PZLA 3ZWPA 1XU7A 5DCUA 1R0LA 2O4CA 4D3FA 4NFYA 4CM9A 4AJ1A 3QVWA 3ASUA 1DXYA 4UVDA 4XYMA 5JDIC 3ENNA 1CQIA 4DPKA 3PFWO 3I9JA 3GC6A 3V1YA 3DHNA 5ICSA 2CVOA 3JYPA 1FDTA 4M54A 1YH3A 3N58A 4U7WA 5EJ2A 1JVSA 5B4TA 1H93A 4INAA 1Z6ZA 3FNEA 4ND4A 1NBOA 4GWKA 4HUJA 4WJZA 1JAYA 2XPCA 4JXKA 3DB2A 4WCFC 3FI9A 4GQAA 4WNIA 1ZCJA 3TJRA 5IXSA 2ZB7A 3GVPA 4DQUA 4WEQA 3O03A 1U1IA 4WOJA 1NAIA 1HEUA 4CPDA 3CINA 1I2CA 3FWZA 3PHIA 3W1VA 3PHGA 5KVQA 3RASA 4GLLA 5KVVA 5HBRA 3RSHA 3BMOB 4MP6A 2HDHA 3QP9A 2WD8A 3L4BA 4G65A 1CRWG 3OBBA 3OQ6A 4L4RA 1I33A 5COBA 4C7KA 1ULUA 1DJNA 1NFFA 3GDOA 2B5VA 4D44A 3DO5A 5KNLA 2FR8A 5FI3A 1ZXBA 3GGOA 3KV3O 3U09A 4KDFA 1JKFA 2AG5A 4CM4B 3WDSA 2W2KB 3DAPA 1LLQA 3E03A 3ROQA 4A0SA 2PY6A 4UVEA 3JV7A 4OQYA 2GD1O 5BT9A 4YRDA 3GAFA 3GK3A 5A9RA 2OUIA 3T4EA 3GFBA 5T5QA 1V6AA 5CDSA 4YJFA 2X1HA 3EHEA 3DAGA 4NR0A 2IXAA 4BO8A 8LDHA 1MFZA 3KBOA 1N7HA 4O0LA 4Z6KA 3ANLA 4IZHA 3ZNPA 1H6AA 3I9OA 5IN4A 4JQCA 4DLLA 1ISIA 3U4DA 1SEPA 5LCXA 3VKVA 4EUFA 3RUDA 1X0VA 4RLSA 5IDQA 5AXCA 2YW9A 3BTOA 1JQBA 4WLFA 1DBVO 2W2KA 4XJTA 4NZ9A 1QLJA 4CQMB 2PKQO 4LN1A 3SC4A 3DFZA 4NBVA 3H9GA 5G0WA 3D7LA 5F1OA 5BSHA 3V2HA 4YT2A 3GVXA 2C2XA 1U8XX 2G0TA 3HDJA 3ASVA 2WWRA 1PJ2A 4LVUA 2Q4EA 3U4HA 3E9MA 4C7JA 4EGFA 5F5NA 4EDFA 2CDBA 1CQJA 1PJCA 4E4YA 4R51A 1GD1O 3HJAA 2Z1MA 3ZWAA 3U49A 1BGVA 3HG7A 2IXBA 1ADBA 2NVUA 5JXWA 3WX0A 1I3MA 4D0SA 1Y8QB 2PGDA 2YV2A 4JBGA 5FFFA 4IQ8A 3RFTA 2X9VA 2C7GA 1LXCA 1R4NA 4TRRA 4RQUA 4B8WA 5A9SB 1T25A 1U3UA 3OM9A 3LDHA 5U9CA 4YAJA 4D46A 1ENYA 3FR7A 3JQAA 2HK8A 3WXBA 3KHUA 4ND2A 1U2GA 3ZNOA 1ZIDA 3OEYA 4KWHA 3PIDA 3TOXA 5F1PA 4DWVA 1GZ3A 1LRKA 3EYWA 1EE9A 1U3VA 1M67A 1E3WA 2CZCA 1ZEJA 3C1TA 1LQUA 5JFOA 1R4MA 2I3GA 3RWBA 3JQDA 2AMFA 4CJXA 4IDFA 3RQSA 3OETA 3MCVA 3TZKA 3VKUA 3JQ7B 5JDIA 1BRMA 1AN9A 4MPDA 3AY3A 4R54A 2ZCUA 3FNGA 1GV1A 4E32A 4RCVA 1B3RA 3JQGA 4TZKA 1QRRA 1KVSA 3O8QB 3HB5X 5G4KB 1PJLA 3EUWA 1QORA 5T67A 3CZRA 1R15A 2HRBA 3ETGA 1GYRA 4GGPA 3JQ8B 4JJFA 4E5PA 4WECA 4S1VA 3KOUA 2O3SA 3KYDB 4UREA 4MVJE 4QO8A 1V3TA 4QFDA 1HT0A 2JCXA 3JQAB 2X0RA 3GT0A 2NQ8A 3SX2A 4BKRA 3WG9A 1ONPA 2NU9A 1QYXA 3AOEC 3ZW9A 3JQBA 4WNCA 1LSUA 3DOOA 1LLCA 4DYVA 1A7AA 1FXSA 4YACA 1VJ0A 4MVJA 5JCXA 1PX0A 2Q22A 3LU1A 4K9DA 1KS9A 1Y8RB 1A4UA 3E8XA 4B79A 3GVHA 2GPTA 4I5EA 1PIWA 1YOVB 3GH3A 4E2ZA 2EJVA 1KEUA 1E7QA 3ZHZA 1PS0A 3AUTA 1N7GA 2NACA 3TZ6A 1I3KA 2Q49A 4PCVA 2VNSA 3DOCA 4DIBA 2VWQA 4P4LA 1X1EA 2X9NA 3WNVA 3WIDA 2E37A 2Z1NA 1R6DA 4F6CA 2P4QA 4PLPA 4XYGA 3WJAA 4BGVA 4BNGA 3F1KA 2QG4A 2Y05A 2ZTLA 2AQHA 3E5RA 2C7VA 2EKPA 1EZ4A 1E3EA 5C7OO 1MXFA 1O8CA 2ZB3A 4WLVA 2B69A 3TNLA 1DIAA 4YRAA 4BS9A 2PZMA 4P8RA 4J3FA 1L7EA 3QY9A 1P33A 1HSOA 3EY4A 3R3JA 1BVRA 4FJ2A 1LBEA 3MJVA 4B8ZA 1EUDA 3LT1A 5DF1A 1GEEA 3AOGA 2NLOA 1PQWA 4OMUA 4N54A 3QWIA 4YAIA 4IGFA 4R01A 1KC3A 2Q2QA 4J4BA 2QIOA 3AU9A 1X7HA 1GPDG 3LQFA 3I3OA 4HX5A 4XQGA 3OECA 4XA8A 3BHIA 5IZCC 2OBYA 1RM0A 3DMYA 2D5AA 3ICCA 5A04A 4JP2A 5U4QA 3HWRA 4D42A 2EV9A 4EI2A 2FZEA 1VC2A 2P5UA 4DC0A 2VHVA 2EW8A 3K31A 4JCOA 4BO3A 1YO6A 4OM8A 3CPSA 1EQUA 2QYTA 4FJ1A 4E5NA 1EDZA 1A9ZA 1JW9B 1NTOA 4EEXA 5I9LA 2YFHA 4WE3A 3TWOA 2V6FA 4R3WA 3R3SA 3H9JA 1K5HA 1BXKA 2VTEA 2H1SA 4BO7A 4AJJA 2Q2WA 5IZCA 2I66A 1XQ6A 4PIVA 4HNHA 4IMRA 2LDBA 4J4HA 3GEGA 2CVZA 4Y6RA 5HS6A 3LC2O 1LEHA 5AQ1A 3L07A 4YCAA 4CL3A 2G76A 4F46A 1E1MA 5TT1A 1HF3A 2X4GA 4OYRA 4FFLA 3IUSA 3NX4A 2G1UA 4PZDA 1HZZA 5C5IA 1P1IA 1P1RA 5GY7A 5KWEA 3GDFA 5DBGA 4FFRA 3S2GA 3NT5A 4NHEA 4RVUA 4C4OA 5L51A 4DPLA 2A4KA 3GN2A 1MC4A 3NTOA 5DBIA 5KCZA 1IE3A 1FK8A 3CEAA 2CDAA 3PPIA 1D8AA 3AY6A 1MGOA 3HFGA 2X6TA 1V0JA 2NSDA 3H65A 3K6JA 4J4TA 3UCXA 3DMTC 2EP5A 2QW8A 5JO0A 1W73A 2O7QA 4BNYA 4CMGA 4HKTA 3OJFA 1R4NB 3I6IA 3PYXA 1HLPA 2NWQA 3U4CA 5AOVA 3OH8A 3F5QA 4L0QA 4YBZA 5JPIA 4BNZA 1HSZA 1NWCA 3K2BA 3WGGA 3OP4A 1M76A 4F3YA 2GN9A 4AG3A 1S7CA 2J3IA 1ZH8A 1U28A 2UYYA 4OKIA 3DBLB 3GGGA 2VYNA 1NVTA 3FRJA 3QVOA 1TT7A 1YGYA 4FOOA 3LZ6A 3JD1A 4FN4A 5TNXA 4EJ0A 1P0FA 4WPGA 3F47A 4UEOA 2GN4A 3DEYX 3NAQA 3LT2A 4TWRA 4OQZA 2GZ2A 4R9RA 4RVSA 2HK7A 1UXIA 2Q46A 3LSYA 3D4OA 2OL4A 2AEFA 3OMLA 3LF2A 2BI7A 2X9GA 1DC3A 2FMUA 2Y1OA 4OXYA 5G0UA 3KRTA 4QSMA 2UV8A 3TPCA 2CNBA 4FFMA 3AUAA 4TMFA 4I5FA 2YDXA 3X2FA 1JDJA 1QV6A 3I23A 1GZ6A 1K3TA 1E7YA 4XR9A 2NTJA 2IEBA 1YBMA 1Y9EA 3G1TA 4MP8A 1QYCA 1EVZA 3AW9A 4PLTA 3M1AA 5CEEA 3WR5A 5HRUA 1RYEA 1ENPA 1NPYA 3GZ4A 4GI2A 3DZHA 3I4CA 5I7EA 2O50A 3VHRA 1Q0LA 3H2ZA 2NQTA 1PZEA 1I5RA 2O2YA 5DT9A 1Z45A 3PP8A 3GMSA 3EMKA 2R6JA 1PGPA 3D4NA 5IG2A 3JQ6A 1BXGA 4YRBA 2JHGA 4BNNA 1ULSA 5L4LA 5EIOA 1ZO8A 4JP3A 4RLHA 2J5KA 3WGIA 3DHYA 1EVIA 4MVJM 1WMBA 1XWFA 3HN7A 2PKRA 3V1UA 2PH3A 3VH2A 2YQ4A 1M2WA 1IB6A 3H9QA 2PD6A 3L77A 5CHEA 1F12A 1GCOA 4IDDA 1P9LA 5IDWA 1E3JA 4GMGA 3PK0A 1OZAA 1JA9A 4RZIA 4EEZA 3FN4A 1ZK1A 4KQXA 4YQYA 2AE1A 5JAZA 4GSKA 3EW7A 5DDIP 1K6JA 1T1RA 2BKAA 2GN6A 2X7HA 4ROSA 1TVEA 1LDNA 1DLJA 3TOZA 4HBGA 2DBRA 3VOSA 3FF4A 1MX3A 4LCJA 4D3SA 4IZIA 4Z9FA 3UVEA 3KTDA 1FMCA 2I9PA 3FSRA 4OXNA 4ITUA 4IXWA 1YBAA 4LSWA 4CUJA 2OXIA 2B36A 1L1FA 3RC9A 5THKA 4WCDA 1XQ1A 2A92A 1CWUA 5I9MA 1HE5A 5IFLA 1CYDA 2AQKA 4JK3A 1E3IA 3FPCA 4Z9XA 1HDGO 1YQXA 2BD0A 1E5QA 4PG7A 3C7AA 3ON5A 1BW9A 1V9LA 4BO1A 5GZ6A 5DBFA 2J5RA 2RHCA 3ROPA 1ZVMA 5EMHA 4FW8A 4JJIA 5KVCA 1CIVA 4PLWA 1I8TA 4GX1A 4OSOA 2H6EA 4O5OA 4ZRNA 3STHA 1H9BA 1B7GO 1EUZA 3V5NA 4QX6A 4H3VA 5BQFA 1IYZA 5K6AA 1TA4A 4CV3A 3ZWMA 1OBFO 1DFIA 4N5LA 1PTJA 1TLTA 1VSUA 3PEFA 4NDNE 4QECA 3F3SA 5TT0A 4GX5A 3HQ4O 4JX8A 2I76A 3HN2A 1GY8A 2HMUA 2XXJA 4RPGA 1OAAA 1SB9A 4ND5A 2GZ1A 4ALJA 4RPHA 3ZWOA 4E5MA 3PI7A 1HTBA 1AXGA 1M75A 3MTGA 4I5DA 4E12A 3PGXA 3R0IA 3A9WA 2EXXA 2PZKA 4AJKA 1BG6A 1A9YA 3LYLA 1O89A 3HFSA 1X0XA 1LTHR 3VVBA 1QKIA 4RF2A 4TROA 4U6QA 4DGSA 1UDCA 4BQRA 2YHIA 1X14A 3OFSA 4YT4A 1C0KA 3QHAA 3M2TA 1ARZA 1LDBA 4W6ZA 3UXYA 5ER9A 1C1XA 2PD4A 3MWDB 2GN8A 3KB6A 2VT3A 1VLLA 4R5HA 4R5MA 1DIBA 1K0UA 3GR6A 4XQCA 1YL7A 3DDNA 1OOEA 1WW8A 4LRSB 3P19A 5DOVA 5EL0A 5CDUA 1DC4A 2BFOA 1E3SA 2JCYA 2RBEA 2P9GA 4DA9A 1U3TA 4TZTA 5AYVA 3ZHBA 3ONDA 5KJ6A 1ADFA 2PWZA 3RU7A 3ZV4A 5I7SA 4IMPA 4IM7A 2FSVA 3DMTA 3K5PA 1XKQA 4OL9A 6LDHA 2YV3A 1O6ZA 4KMSA 4PVCA 3FBTA 4ALLA 2I3AA 4FFOA 3JYQA 2H5LA 1QR6A 4A10A 4CMIB 1YQGA 3ZWBA 5CFZA 5A05A 1Y8RA 1E1NA 4OO3A 5A06A 2WYWA 3G17A 3NDRA 3GG9A 3DBLA 1DPGA 4HXYA 3WYCA 3S2EA 4J1NA 4RQTA 3EDMA 3DC2A 4KWIA 3ITKA 3E5MA 3BTVA 3L6DA 4PRKA 1UZMA 1C0IA 3DBHB 2VHXA 4K28A 5L7YA 2PZJA 2NM0A 4Q3BA 3DTYA 5JAQA 3KEQA 4J43A 1GAEO 1QP8A 4CLRB 3KVOA 4ILKA 2RAFA 3R6DA 3V1TC 3COSA 4GWGA 4JIGA 1KVUA 4YVFA 1RJWA 1MC5A 2Y67A 3W8DA 4FGSA 4E21A 1D4FA 2TMGA 1KEPA 2PH5A 2DFDA 4U0JA 2NV6A 4ESOA 2C07A 3SBOA 1E6UA 1R16A 1BMDA 1ZFNA 3CMMA 1MG5A 5F1KA 2PD3A 3HE3A 3JQ7A 4ND1A 2OZPA 1F8GA 2B35A 4RPJA 1PR3A 2DPGA 1WDMA 2AE2A 4UUMA 1NVMB 1EMDA 1ZBQA 5L95A 1WNTA 2W2LA 4BNLA 4A03A 1W0CA 1NQ5A 5K0ZA 4PLGA 2X86A 3GEDA 1VJ1A 7MDHA 4L9RA 3QRWA 1MA0A 4BKOA 3WLFA 1N1GA 2VTDA 1F06A 3CXRA 1BTOA 1TI7A 4XCVA 4F45A 3I9MA 5H81A 2SCUA 5IJZA 2Z5LA 2FHSA 4P38A 4GVLA 2EJWA 3EVTA 4IINA 4MVJD 1DRVA 4Q9NA 3DR3A 1ZXLA 4K6FA 2Y68A 1DLIA 4BKPA 1QYDA 4QO7A 2XXBA 3BMQB 1C1XB 3GA0A 1Y9AA 2P9EA 1V35A 3FTNA 1DSSG 4CM4A 4HY3A 1NPTO 4J7CA 4XDYA 2DFVA 5THQA 1YVEI 3DZBA 1A27A 4XRRA 1PGNA 2ZQYA 2EGGA 3A4VA 4GGOA 1OC4A 3AFNA 4XGIA 1E6EA 1NR1A 3WGHA 1CF2O 4NU5A 1CERA 1N9GB 2J5QA 5H83A 3KM0A 4R4JA 3FD8A 3NGXA 3NT4A 3VDQA 5BSFA 1ZNQO 1R4MB 3BMNA 2GSDA 2YYYA 1LX6A 3TN7A 2IZ1A 4J0FA 1PL7A 4YT5A 4W9NC 4BB6A 2Y1CA 4IDAA 4DLAA 5FWNA 3U5TA 2DBVO 1BWSA 3LT0A 3AI3A 1VKNA 1U9JA 3NT2A 4ZHSA 1H0KA 3KSZO 2GNAA 2OGUA 4NG5A 1LLUA 4CLRA 5HM8A 2X5OA 2J3KA 4M8SA 3LC7O 4FCCA 2VWGA 4G81A 2DQ4A 5BNFA 1YQDA 2VUUA 3JQ8A 9LDBA 2UUOA 4BIIA 4ZQEA 5G2OA 5JYDA 3C85A 1N9GA 5I7VA 2J8ZA 4AJLA 2EEZA 1C0PA 3PRJA 5CDTA 3O8QA 3WICA 2Q1SA 1JVBA 5EN4A 4OKNA 4NK4A 3KZVA 5TSDA 1P74A 5C7LO 2HMSA 3WGQA 1C14A 1HYGA 1SC6A 4WUVA 2OBNA 3A14A 3AFMA 4FBGA 4BO5A 1YKFA 1HZJA 2W8ZA 2PTGA 4S3MA 3HNPA 1NAHA 2WSBA 3S8MA 3PVZA 4IDEA 2GERA 3RVDA 5ENVA 1VE9A 2EKQA 3HDHA 1UAYA 1SNYA 1RKXA 4B4VA 4YXFA 1JWAB 4NMHA 3AM3A 4ZQHA 1PGQA 4AJEA 3S2FA 4CM1A 3OA2A 2F00A 3CMCO 1UUFA 3ROKA 3JQEA 4RF4A 4B4OA 1T4BA 2J3JA 2V6BA 1QSGA 4I9NA 2CDCA 1MUUA 1TB4A 3MTJA 3A1NA 3G0OA 3GMDA 1E1LA 3F46A 3G1UA 2NU7A 3GZNA 3VDRA 3R1IA 4J9VA 4Y6SA 1DIGA 2BFAA 2H9IA 4PLYA 1IPFA 2H63A 1SBYA 3MJEA 3K30A 2WJPA 1RM3A 3H5RA 4MKZA 2X8LA 1WWKA 3INTA 1TEHA 1V3VA 2R2GA 3NDIA 3L6OO 2I99A 4M49A 5KKCA 3OICA 4DIOA 3OF2A 4YJHB 3T7EA 3VZPA 2VZ8A 4FPXA 4ZQBA 3PWSA 3AWDA 2NUAA 3KLMX 2Q2VA 3E9QA 4XDZA 3TFOA 2VZ0A 1T4DA 3I4FA 4MINA 1ISJA 3H3FA 2PK3A 4B7UA 1KBZA 1HDRA 4XB2A 4MO2A 1B8VA 3UAGA 2R00A 4ZQFA 1NQOA 1HE4A 4PLCA 4R16A 3ZNQA 3UFXA 2A35A 5BSEA 3AY7A 5KJCA 3MOIA 1ZEMA 4GAEA 4RORA 1XYGA 4J1SA 1HXHA 2VNAA 5L7TA 2YHIB 4BGUA 1Q7GA 1N8KA 5FEUA 4FQ8A 3JSAA 4ZICA 4YPOA 1HDOA 4OIMA 4RF3A 3GHHA 3IP3A 1P1HA 1UJMA 5TLSA 2B4RO 4NNJA 5GMOA 3SC6A 4Z0HO 1PJBA 5KOIA 1H6BA 2E6UX 4YQZA 4OGWA 4I9HA 3UUWA 3EC7A 2FOIA 4NBUA 3Q2IA 2A94A 3WBBA 1LDMA 4Q3AA 1EVJA 4D41A 1XSEA 4W7HA 2DT5A 1X7GA 4YWJA 3LLSA 2GUGA 1N2SA 1EBUA 2C5EA 2CSUA 4A73A 4MOWA 2QRJA 3WTBA 1OFGA 3BMCA 4CMEA 4E5KA 3DHEA 2G82A 3TZQA 3QW2A 1YB1A 1PWXA 1PS9A 5L9AA 4LGVA 3RIHA 2B5WA 1ONNA 3BXXA 3LC1O 1B26A 1QYWA 2ILTA 4O59O 3OJEA 2D59A 1LDGA 4BO0A 1ISHA 3WSVA 2V6MA 1JLLA 3MJ4A 4D79A 3IJRA 4J91A 5J23A 3WYBA 5A9TA 2WTBA 3OIGA 4U8GA 4CQMD 5M6DA 4E0BA 1LC3A 1ZMTA 1YRLA 2IEDA 3BTSA 1F8FA 4CM9D 2FP4A 4PGFA 4WCFB 4WLEA 5GZ1A 4BVAA 3RBVA 3RC7A 1HDYA 1GUFA 2RH4A 3LVFO 2BELA 3DZGA 3Q3CA 4FD3A 3D3WA 3ZZNA 1EQ2A 4CMEC 2V65A 2WE8A 3O4RA 2NVUB 1AE1A 3P7MA 1GQQA 3D3EA 4RZHA 3E1KA 4BNUA 4CM7A 3RJ5A 2JFFA 2RHRA 3HADA 1IZ9A 1V3UA 1ADGA 3WNQA 5BNIA 5CPBA 4IIVA 4B7CA 4IIUA 4DMLA 3K8ZA 1J0XO 2VRCD 2BFPA 1H5QA 2VYVD 4Z0TA 4BO4A 3Q6IA 1DRUA 1PJQA 4LMRA 1U3WA 3NTRA 3VH4A 5EQDA 3D1LA 4CLDA 1Q7BA 4WLNA 4YR9A 1HDCA 2AHRA 2CF5A 1VKOA 5B12A 3B1JA 3MEQA 1DIHA 4R9SA 2CD9A 4NJMA 4CODB 2VRBA 1JTVA 1ZK0A 4E2WA 3O9ZA 1YONA 2Q45A 1PJ3A 1PJ4A 2D5CA 3MZ0A 2P91A 3UKOA 4RL6A 4YAGA 2POQX 1KETA 2JFGA 1VSVA 5TX7A 5CP8A 3TRIA 1AHIA 3BHJA 2ZTUA 3AU8A 3ZW8A 4LRTB 4BNIA 3UW3A 4AJPA 3ZH2A 1M6WA 4XX0A 1GUZA 1X15A 1JAXA 3KUXA 2P9CA 4ALKA 5JW6A 4PLFA 4DC1A 1XCBA 5G0SA 1L7DA 2PV7A 4NK5A 4E31A 1EFLA 1K2WA 1XEAA 2DC1A 3JQFC 5TC4A 1VL8A 1IL0A 3H8VA 3WQRA 5K9ZA 1MP0A 9LDTA 4X54A 3GLQA 3ZU3A 4P4GA 1Z74A 3I9NA 1SOVA 5B4UA 2X0IA 3WFIA 5BR7A 3PFFA 1A4IA 5J9GA 1I30A 1NQAO 3WGYA 4P4NA 3ADPA 2BMAA 1Z82A 3D5QA 3ZI0A 3PHJA 5DCWA 2QRLA 1JN0A 1IOLA 2FR0A 3CUKA 1BVUA 1I24A 2PR2A 5L53A 2W90A 4L4SA 2BGLA 3GOHA 4DTIA 4R1SA 3ROMA 2Q1TA 1Z7EA 1LDEA 2AG8A 4NQZA 5KJEA 3TL3A 6ADHA 3DZFA 2Y66A 2C29D 3H3JA 1WLYA 1HRDA 3V2UA 2Y0CA 1T26A 4IGEA 2J6IA 3JTMA 1JKJA 3GN1A 4FSHA 3UOGA 4LW8A 2NTVA 4CMAA 5CG2A 4B3IA 1NWHA 1RM4A 1ZW1A 4GH5A 2FN7A 4Q3DA 3JQCA 4G5HA 3UHAA 3PDUA 3GVIA 3PJGA 4KZPA 1BW9B 2OO5A 1MXHA 2EGHA 1EEHA 3C7CB 4YDRA 1HDZA 1EK6A 2EP7A 1K6XA 1SB8A 4BNHA 4DXHA 3D4PA 3E6AA 2BI8A 1P1KA 3MOGA 4E2YA 1H9AA 4J49A 1B3BA 1E5LA 1EE2A 2G5CA 3H6KA 2VUSA 5ITWA 2EIHA 4TSKA 2YDYA 1UZLA 4YT8A 3ONEA 1ZMOA 2DTXA 2PA3A 2VWPA 3DBHA 4CMCA 4BGEA 1H2BA 5A5EA 4NIMA 4MVJH 1BSVA 4D45A 4YAKA 3F4LA 3VTZA 1IULA 4QT0A 5DZSA 4CMBA 4M86A 4XEHA 3EVNA 1PWZA 1Y6JA 4CR7A 4XWYA 2R00C 3VPSA 2QX7A 5IXYA 5JAMA 1UXKA 1SOWA 3IKVA 4II2A 3GRKA 1I2BA 4MVJF 2DU8A 3U0BA 1T2CA 3G49A 2WYUA 3SVTA 3ZU5A 4EJMA 3B1FA 2LDXA 3UCFA 4IJKA 5ITVA 4XRGA 3H7AA 2EKLA 4PG5A 3DTTA 4MVJI 1N5DA 1DIRA 4XKJA 3H5AA 4ZVVA 2FZWA 2D2IA 3UN1A 1Y1PA 1Y5RA 1LU9A 3I83A 3VH1A 4BNJA 5DULA 4BO2A 3C1OA 3QE3A 3CIFA 3QJ5A 2ZCVA 2G17A 1K6IA 1LJ8A 1DC5A 4AFNA 4CLXA 1BDMA 1IHXA 3O38A 3ZV6A 2HUNA 2B37A 5EESA 1TT5A 2YJZA 1GCUA 2ZYAA 1QYVA 4GKBA 5AXAA 1LNQA 2BLLA 4ZQGA 5T8KA 3RD5A 4D43A 1GZ4A 2Q3EA 4AJIA 1I10A 3L0DA 2EERA 1IPEA 5JYAA 2AQ8A 3C8MA 1E6WA 2ZYDA 4HFJA 4R68A 2IYPA 3L9XA 3OEWA 3ZWXA 1P3DA 4ZGWA 4Q3CA 3IKTA 1UP6A 1YWGO 1EDOA 1ZJYA 3C3XA 5JDCC 2VT2A 2AA3A 1B8UA 1E0DA 4R3NA 1B2LA 1Z7BA 2Q1UA 4RVGA 3NGLA 4CQLB 1D7OA 4DVJA 1GFSA 1NM5A 1EFKA 1ORRA 2X58A 4W4TA 1U7TA 4URFA 3KETA 3GUYA 1GUYA 4J2OA 4R1UA 3QIVA 1PQPA 5L40A 3VPXA 4YB8A 4FS3A 4DMMA 3ANNA 4XQ9A 1QMGA 4Q3NA 2JKVA 2QRKA 3JQBC 2XOXA 3W6ZA 1YE3A 3FTPA 3QVSA 4NJOA 4AJ4A 1NPDA 1E92A 3I1JA 3MJTA 4YJHA 2QYSA 5CAEA 1YB4A 4ZD6A 2UAGA 3SEFA 2VYND 3DONA 1U5AA 1LRJA 3IIEA 3V8BA 3D0OA 1JU9A 3W6UA 4ALNA 3MJSA 4M1QA 1M6HA 1HETA 2D1YA 2GCGA 3JQFA 2VZ9A 2ZATA 4DBVO 1D1SA 1A7KA 3FNFA 4G2NA 1NR7A 2JAPA 4W99A 1B0AA 3GVCA 3NKLA 4YEDA 1PL6A 4E3ZA 3PZRA 1ZJZA 3JQAD 1E7WA 5JO9A 1C1DB 3D3WB 1B14A 1P77A 5KVSA 2I67A 3PWZA 3M1LA 5ER6A 2HK9A 3TFQA 4J90A 2PLAA 3RFVA 2XAAA 2BGKA 2ZYGA 3BMQA 5TF4A 1X7DA 3F5SA 3Q9NA 2X5JO 2Y1EA 4TRJA 3M6IA 2X0NA 4IUYA 3ZDFA 1LRLA 4QUKA 4DUPA 4QXMA 1LSSA 1KEWA 1EK5A 5T6BA 4MJLA 4ND3A 4BMNA 1A71A 3VH3A 4XR4A 4JLWA 3WTCA 2E4AA 5JY1A 3WWYA 1E7MA 2HMWA 4P22A 4WK6A 3W4JA 3JQGB 5TQVA 1GU7A 2ZQZA 1HE3A 2UDPA 1I3LA 4FOSA 2EHDA 2QHXA 4TVOA 1Y81A 3WYEA 4W82A 2DTDA 2NTNA 3WQSB 4NFSA 2HMVA 1CETA 1YL5A 1DEHA 4I5GA 3VPHA 3JYOA 3CZMA 4L8VA 2O3JA 5JS6A 3HZZA 5A3VA 1PJSA 1DOHA 3RBZA 3X2EA 1O5IA 2GF2A 3CE6A 1J4AA 5FYDA 2AEMA 3DL2A 3WGZA 1YBVA 3KYBA 5JC1A 4YTEA 3DFUA 1I3NA 3N74A 4W9NA 4D3DA 4B7XA 3RAJA 4LCEA 3I9LA 2Y1DA 4TQGA 1VJTA 4IS2A 1PL8A 4BOYA 3FNHA 5AXBA 2I65A 4HP8A 3BHMA 3C1AA 3FWNA 1GQYA 1XLTA 5LDHA 3VAZA 3SJUA 3VZRA 3ZV3A 1XDWA 4TKMA 8ADHA 4HNGA 5K6AC 2B83A 1S6YA 1XELA 3GRPA 5JC8A 4L74A 4BO9A 2JFHA 3INGA 3ANMA 3P2OA 4OOFA 2V6GA 1T2EA 1XU9A 4I08A 3I6QA 4MP3A 3PWKA 4CMHA 2HO5A 5IDXA 2OMEA 1LSJA 3DXFA 1P44A 4OJNA 1ADCA 1LI4A 5ADHA 5JCJD 3S1LA 2IZZA 3TZHA 1GEGA 4E6PA 4PG6A 4ID9A 4AVYA 1F0YA 4B4WA 1M66A 4A27A 1P1JA 4E13A 3DAFA 5EPOA 1Z75A 3WOHA 2OP0A 3WLEA 3WGTA 1MG0A 4BO6A 1E7RA 1YDEA 4LSMA 5DOZA 3L9WA 2V7PA 4YA6A 1O94A 5BSGA 1YS4A 1PZHA 1VL6A 3D64A 3K73O 4N5NA 1CDOA 1GTMA 1WZIA 2FY8A 3RUAA 4Y8VA 5I8ZA 4RDHA 1OMOA 1ZK3A 2W2LD 4IDBA 1IZ0A 3ZWNA 1U5CA 4BL5A 1HYEA 1B15A 2B4TO 1VI2A 1ZZEA 2B0JA 1YB5A 2E82A 1PJTA 3BMOA 3H4VA 4CM8B 1BDBA 4XQEA 2HJRA 1QLHA 3RC1A 2W4QA 1IUKA 5JMWA 1PR9A 2CMDA 5TIIA 2EW2A 3ZWYA 3AI1A 2ZB8A 3WIEA 3PTZA 3ST7A 1QXSA 3GPDG 4GMFA 1H2HA 3W8EA 1FF9A 2X23A 1HL3A 5MGBA 3SJ7A 2GLXA 5TS3A 1KEVA 2JL1A 1RPNA 3IMFA 4RDIA 4UUPA 2C82A 1MLDA 4J9UE 1DFGA 2PGLA 2O3RA 3K92A 4CR6A 1EBFA 1UXJA 4HADA 2HKIA 2PFGA 4PVDA 2IE0A 4XYEA 2WDZA 1LC0A 4TVBA 1PGJA 2VQ3A 3Q9UA 4KUEA 4CM5A 2JD1A 1HWYA 3WFJA 1PGOA 3GNTA 1P0CA 1DB3A 3G3EA 4KUHA 5CDYA 2BFMA 1X1TA 3PQEA 4J7UA 3P2YA 1VL0A 3GZNB 3I5MA 4IJWA 2YZ7A 4FGWA 1E1KA 4II3A 4K1LA 2IODA 3AM4A 3H9EO 1QV7A 4PZEA 3EGOA 4PLZA 4UULA 3H5NA 2FRDA 1YJ8A 5KJFA 1LDYA 3BTUA 3DZIA 3DZJA 3ETDA 4Q39A 2Q4BA 5B1YA 1E3LA 3C7DB 2Q1WA 2O7SA 4UVIA 2W98A 1MFPA 1UP4A 1DFHA 3E9NA 4Y9DA 4CM3A 1DHRA 2VHZA 3AOEA 5TJHA 5L7WA 4NBWA 1DAPA 2NVWA 2FR1A 3U9LA 3ZU4A 3IOYA 1ZK4A 2Y99A 3RUIA 2Q99A 3LF1A 4U5QA 4WASA 4R1TA 2DKNA 4A26A 1F14A 3JQ9C 3OJLA 2O3UA 4JJGA 4F6LA 4DRYA 1HDXA 3F1LA 2YFQA 5KTKA 5IZ4A 5ILGA 4JN6B 3JQ9A 2Y1FA 4CMKA 5CEFA 1C3VA 2NVBA 3B70A 4GX2A 1J49A 4GSLA 3BA1A 2XF8A 1W8DA 2X22A 3GNSA 3CTMA 1G0NA 3GUCA 2DBQA 4Q3EA 4XYBA 5JCJA 3UCEA 4QEDA 2RIRA 3ABIA 1AUPA 4CUKA 3UICA 2GZ3A 2DUWA 4Y67A 4IQ0A 4J2HA 4J0EA 1RYDA 1WVGA 4JBIA 5F21A 3DBVO 1T24A 2DBZA 3OIDA 5CPFA 4EW6A 1U8FO 1KVTA 2P4HX 1X13A 3F9IA 4YJGA 4I9UA 3VVCA 3ZU2A 1XG5A 1WAMA 4NI5A 4N18A 2O2SA 4EUHA 3I9KA 3A28A 4PLHA 1WXDA 4XJSA 3LT4A 3DQPA 4CLOB 4TRMA 2GYYA 4E30A 3KO8A 3PHLA 5L45A 3WS7A 2PNFA 4OOEA 2BRUA 1SMKA 4JGBA 3RBXA 1ZK2A 3EZYA 3H2SA 4IY1A 4XIYA 1FJHA 2YV1A 4KDEA 5T8KC 5JAIA 5HTOA 3ZWWA 4NPCA 3KLPX 5ENDA 3K9QO 1PSDA 5LC1A 1Q0HA 3KSDO 2ZJ0A 3ZWCA 3WQQA 4ZU3A 3HB4X 4IJUA 2BGMA 2VUTA 3H9UA 4DQVA 2ZB4A 3N7UA 2IYOA 3RU9A 4HWKA 2IRWA 3P5SA 3NTQA 4J1TA 4WKGA 3IP1A 3TL2A 3INRA 3NV9A 3ETEA 1DHTA 4CL8A 3OIFA 1BXZA 3GGPA 1SO8A 4MVJP 5DNAA 1EUCA 5LDGA 3QSGA 1G1AA 5T73A 1NX6A 1LSOA 4RO0A 2DTEA 4DBZA 3RKUA 1Y8QA 2VN8A 2HSDA 2C20A 3PLRA 3RUEA 4EBFA 3DOJA 1DRWA 4IDCA 2NU6A 5I7FA 2X0JA 4H15A 4GKVA 1FDSA 4IPTA 1NYTA 3DBRB 5CEJA 1MB4A 3QWFA 4J1QA 4BNTA 4KQWA 1XA0A 3PJEA 3IUPA 4RV9A 4NFHA 1H6CA 5ICMA 5JYFA 4XIJA 1UXGA 4AL4A 1T2AA 4XYLA 1GPJA 1H6DA 1Q2XA 2Z95A 1IHYA 4BMSA 4YYZA 3QLJA 2VOEA 1R12A 1JWBB 4Y6PA 3DZKA 2BHLA 4NBTA 3ITDA 4CV2A 3T7CA
chains in the Genus database with same CATH superfamily
3PE3A 5JSZB 3OD5A 1N0WA 1M54A 3GG2A 4EZBA 5CNMA 1PG2A 2A9FA 2RGDA 4RCZA 1K6EA 3K0KA 4IQGA 4KLZA 4OHFA 5BUQA 2O59A 3D6JA 3RS8A 5KYWA 2A58A 1ZNWA 2E0IA 3AGPA 3N2ZB 3ES9A 1VKJA 4IYRA 1KIMA 1M0WA 1NVKA 1A72A 1E77A 2DPMA 2Q3JA 3M3PA 3VBEA 2EF1A 3A0UA 4XM2A 1PYGA 1SPXA 1D0IA 3DV0B 3NETA 4XUEA 1NNSA 1OLXA 2N42A 3E84A 1PEDA 5HJ5A 5EIXA 4WBNF 1Y1TA 4P4UA 1JI0A 3OTQA 5EWLB 1W36B 3JYLA 4M55A 2Q50A 3LQYA 1EWVA 2VAXA 2DOKA 4UU8A 3BAZA 1V16A 4P83A 2AC4A 3GLRA 4FW9A 2WJWA 4LJ4A 1T5IA 3H1GA 1L7XA 3EXFA 4G23A 4TKLA 5KC8A 1Q0QA 3RI3A 2BGIA 3LLVA 2IHBA 3K0CC 4UBMA 1UBTS 3TM4A 4HVTA 3R7LA 4IYJA 1YQEA 1W34A 2BJWA 4G0OA 1NJ6A 4ZAGA 4BUCA 5KYWB 2RGNC 3KOYA 5AVJA 4AUMA 1YDMA 2D7JA 4F8EA 4YHBA 2F1JA 3K7EA 4BNDB 2J30A 3D2LA 2P2CA 5EPUA 4ZT4A 4E07A 5DHFA 1WPQA 1PQ4A 3BL5A 4ETIA 1D2HA 1G4AE 3BMXA 2WNHA 4RHUA 2OCKA 2I6QA 2XUAA 1KWKA 1Y63A 4QYIB 5MFZA 3NVMB 1YXMA 5COQA 4B4UA 2AXQA 1NNLA 4G0WA 5G4KA 3TW6A 1NI5A 3MRXA 1XQWA 5ALZA 5KDOA 3EZLA 4HV4A 4JLVA 5JQGF 4AX8A 2FN8A 3T15A 1Z4MA 3NEPX 2RB5A 1T2DA 3HUDA 4YV0A 4PBRA 4HMOA 1L5ZA 1QK3A 2WYHA 1E2KA 3LDGA 1GDTA 4KTVE 5DU2A 1E8NA 2FN9A 4JR1A 4HMQA 3F3YA 5ED4A 1CEQA 2AQIA 1XLTC 5FB3A 1DO0A 2PN1A 4MQ5A 1OW3B 3RO7A 1NVDA 3CIOA 4J6FA 1SEVA 1UJ5A 3PJFA 3V2GA 3ZWVA 2NNLD 4R1MA 5F78A 3FMGA 3MAGA 1E2MA 3QVUA 2P0AA 1J90A 3IUBA 4HFNA 4WK4B 2KI5A 1DX6A 2XWJI 4M2LA 2JIBA 1L4EA 1XMVA 3E8SA 4M60A 5FI0B 1NVVQ 1O7JA 3AETB 5IJWA 1CVRA 2R4QA 4QUHA 3LGAA 3WKDA 2W2VA 3PSHA 1RHKA 4QU0A 4UEJA 4UNPA 4F91B 2QVBA 3KXDA 3U4AA 5A4DA 2J7PA 2QG6A 4QWWA 3UGKA 5FUQA 4ANFA 1WUKS 2F7SA 4X20A 1I7MB 2Z5VA 2UKDA 3OQBA 3KZKA 3PFHA 1KH1A 4C06A 4MIEA 2XBMA 4RLQA 3ZQ4A 2PANA 2R8BA 1BE6A 3NXKA 1X1AA 4A7PA 1A5ZA 1Z5WA 3ILHA 1XN4A 2WKWA 3AR9A 3VU9B 2DECA 4H77A 4MAMA 2ZSHA 4AMZA 3I0MA 3I72A 1RQPA 1FDOA 2J3HA 3QXGA 1W2WB 1N1DA 3IRVA 1KDRA 4W9MC 2QYOA 1KY2A 1Q3TA 5IM4A 1FU4A 1ZI9A 3E18A 1TEVA 1Z0SA 3SZMA 4F3KA 1AJEA 3K9FC 4PZZA 5CMLA 2QOEA 1JIQA 3RE1A 4EJFA 2QZ9A 3L7DA 2A86A 1E1QA 3ZLBA 3ASZA 3IX7A 4S04A 3C70A 1ISSA 2YUIA 5A4MS 3EPAB 2HAEA 3HMKA 3MCUA 4TXNA 5EEHA 5SY4A 3TB6A 2AWOA 4BVLA 2PZGA 2PM8A 4B46A 1UDBA 4TVKA 2XB9A 5EHZA 4G25A 5C32A 4WH0A 3QVTA 1QTIA 3EF1A 3U9TA 1KJ9A 3IT0A 1J5PA 4C5AA 1HYHA 2DY0A 4C05A 1DP4A 3F6PA 4P32A 5JJCA 4GX0A 1IN1A 1HTTA 4YRRA 4FLEA 3NYIA 1XVAA 1P5JA 2C0CA 4TSFD 1CR1A 4HAXA 3EGWA 4HH3C 4AYXA 4BLQA 1UPUA 3I04M 1KAOA 3OOJA 3IV9A 4QGAA 3VRHA 1BX0A 4DCUA 1NQVA 2I2CA 4LJ6A 5ES3A 3SGLA 2P5SA 1U98A 2A6PA 1CS4C 2AN4A 2Z2JA 4M0FA 4NBRA 3W4IA 1SXQA 4O2AA 1J22A 3QUTA 4J0JA 4M7OA 4XJVA 5ARBA 2C3OA 2ZRFA 3FGZA 4PRYA 5F7ZA 2WK1A 3L0ZA 1EP1B 4BB5A 2O2XA 3GEIA 4EGQA 5CDGA 4YCCA 3D6TB 3IDSA 1WCYA 2G9ZA 4TL8A 4OQLA 4CDGA 5IJXA 1R6AA 1QP0A 3GRRA 3OQVA 1AXRA 1U31A 2VAWA 1V8BA 3G79A 3A06A 2OCDA 5KQSA 3RHZA 5GVSA 1ZU4A 2JA1A 2QENA 4KXXA 1M6NA 2ZIZA 4X66B 2FFRA 4LE0A 2I7CA 4JI7B 1PVOA 3AVOA 3CZ5A 1WDTA 4BGIA 3KSUA 4X62B 1CJCA 3TSCA 4U02A 2OUKA 4IV8A 3VTFA 2HJSA 3B1ZA 3BGVA 4DYDA 5B64A 3L40A 2GJAA 4D1YA 4G63A 1XB2A 4LMBA 1CR2A 2WR8A 3EXG1 4UBKA 3N75A 2ZBGA 4CG0A 4AI6A 3VPCA 2C5LA 3PUYA 3LUFA 4RMJA 3IIKA 5FOXA 1X7ZA 4AS3A 1ZL2A 1KOJA 2J08A 4K5QA 1OTHA 4B3JA 4DLBA 2FEAA 4XGKA 1XJQA 2ET6A 1WCIB 1N6KA 2OP1A 2VUIB 2VUHB 2G07A 2OHVA 1AQJA 3IALA 4P9NA 3VX4A 5KWVA 5A5FA 3N5CA 2GPJA 2FRXA 1DC6A 1LPBB 2ECPA 3ZEIA 1Q7CA 4F86A 1BHSA 5HQ3A 2JJ2A 2WD7A 2BN4A 4D8XA 3PRKE 3EODA 4I50B 3NEYA 3ODPA 2CHUA 1MR3F 1T2FA 1XNHA 4PNEA 1A4RA 1JVNA 1JHYA 4YQEA 1OI7A 3PXXA 4DZZA 4YRMA 4CLOA 2JFUA 3NVKI 3N8HA 5ISMA 1FLDA 4KC0A 1SD1A 1T3GA 1QH1B 4RIHA 3MMSA 3RVPA 1BQEA 1ENOA 3FZNA 1JR3E 4M98A 4UTXA 6REQA 1FDWA 4IJVA 2AFHE 2W6CX 1RXUA 1I4TD 3EZ9A 4QGHA 3JD3A 2BT4A 4QC2A 4RY2A 1RHUA 5BRNA 1KVQA 4KPUA 4BLPA 1GFWA 1O6CA 2BL4A 1NBEA 3VZDA 4FYIA 2GRAA 3RTEA 1M2OA 4JI2B 1W4ZA 2FSVC 2CHEA 4R05A 3U7JA 4HYQA 1GKIA 2FETA 3FDIA 3GNQA 3JD2A 4PICA 5ALUA 1VPDA 2GR9A 2QTGA 4GOLD 2GFHA 4BFYA 2WMDA 2Y93A 1XO1A 1JMKC 3NHWA 5CA1B 3SZ3A 4D9CA 1U2DC 1H23A 1EPUA 4IO1A 1JQ5A 3BDAA 4BX2A 1VFPA 5B1HA 4Q7QA 3CUVA 1K63A 2IPMA 1E3TA 1IRXA 3W8FA 1SU6A 1TNDA 2QTMA 2OCGA 3EQ7A 2YJ4A 3BICA 3OUUA 1NVFA 4LZJA 1X92A 4L4UA 4ZAFA 1MA3A 1Z6TA 5BOVA 2CXSA 3TAHA 1EESA 2RGRA 3GFOA 4H18A 2NXEA 1XR3A 2GI4A 3BMCB 4GEKA 4ZRMA 2QM0A 4TMKA 1Y3IA 3GQVA 1EU1A 3QHQA 3Q3VA 4C7VA 2OOSA 5EJ8A 2ZZMA 4L72A 1E62A 5GAJA 3LBNA 3OZAA 1H94A 4RPLA 5JOQA 1J33A 3G85A 3NIBA 5SZJA 3U19A 4K26A 3EYAA 1WY7A 5K3SA 1VHLA 1C4XA 3PLNA 3ZHXA 1I32A 4B75A 4YLYA 3B5IA 3WNDA 1X8XA 3RU2A 3QWBA 4FFNA 4WEOA 2DFKB 2OC9A 4Q82A 2O8FB 5K0BA 2H06A 4IBOA 1KY5A 1FX1A 2P6UA 3WMWA 2V5UA 2A5GA 4FWIB 4J7XA 4PC6A 4UTRA 2G3YA 4RETA 3C24A 1UT8A 2ZI6A 1VM6A 3HHEA 5TXGA 4UTZA 3GJ0A 5G0TA 2HIMA 1ML4A 1L7BA 4IG9A 4OHUA 1KXJA 2HRZA 3OCZA 1U90A 1JTFA 4MQUA 3REFA 2XTZA 2O4UX 3STUA 5JU6A 2FLKA 1PI3A 4Z3DA 2HQ1A 1U4OA 3AUUA 4M9UA 5CK4A 3KZXA 3N1UA 4Q9DA 4IKEA 1EKXA 1TZ2A 1ID1A 2QZZA 4HGPA 3RUHA 2GHIA 5IJ0B 1RYMA 4B3HA 5F7OA 1AS2A 1F6BA 2C2WA 1JGTA 1X1QA 3QYFA 4MRAA 4UPDA 4REMA 5FH9A 4DREA 4JSYA 3PYLA 3KDPA 3D5TA 5F3RA 2CMFA 4L08A 2CLKB 3O91A 3V4PB 3VC7A 3L8MA 5TGZA 4DL9A 1TXGA 5HCNA 1U04A 4CLHA 1FDUA 3T4XA 4Q9LA 1NN5A 4LZZA 5AXDA 2V0CA 4HDAA 3RADC 1MOSA 1P1FA 1NIPA 2J5XA 4KZKA 3DHWC 3JCZA 4RIEA 4GVXA 4OJMX 3ESQA 3HCCA 3GJ7A 4JZKA 1FPQA 5DWDA 3UV6A 3DPIA 4C87A 1NF9A 1UFRA 3BXPA 3KQQA 3VFDA 1PZFA 3P0RA 4L4YA 4BKQA 3T9EA 3B7WA 1ONSA 1IBCA 5A3JA 5JY6A 1QDLB 2QX8A 4Y2QA 4D7AA 2XCIA 2A8YA 3CLVA 3OT1A 5BNWA 2X4LA 3SYMA 4NKRA 3VYTB 2XA2A 2IOQA 1VKRA 2FWIA 3WLPA 1ZUD1 2H2DA 4F4IA 1O9BA 1AQNA 1AKQA 1WSWA 4LS3A 3TIFA 3S2IA 5HF5A 3OZXA 3SYTA 4PHHA 2GEKA 5JSZA 3RANA 3GJQA 3W5BA 4RULA 2DAPA 1GV0A 3IVGA 1C7QA 1G3MA 3T99A 5FV7A 3SNKA 4V02A 4HQFA 4CXMA 3FDZA 2BDUA 4IJ5A 2CXUA 1J8YF 1U9IC 1F4VA 1XD9A 3QKUA 1P45A 1OASA 5E4JA 3ZWDA 3E3NA 1KOLA 3ET4A 5JMOA 4PZCA 1NATA 3KYCB 1U9IA 2XKBA 1RWKA 2B30A 2QAGA 2J33A 1FS4A 4NFLA 5JDCA 1RFGE 2HXYA 5AKKA 3SI7A 4CTJA 4ZOLB 4UUOA 5IAKA 3HZOA 3KIPA 4Q4HB 2OYSA 2XSZA 4MDYA 3WK9A 3VKHA 3GEBA 4C4AA 3MNFA 4R1QA 1V37A 5H80A 3FM9A 3KZMA 3ONFA 4JROA 1DBQA 5ALWA 1N0IA 5CFQA 5K0TA 1GKYA 1RHRA 1T6XA 4MLCA 5EJGA 5LWHA 1XPUA 4ZN6A 1JAHA 2OV2A 4BTLA 1L3BA 1MRNA 1FS5A 2GO7A 1WD5A 5TQ0B 1L5SA 3RRZA 5KNBA 2QW1A 2Z2YA 3SDZA 2GM3A 3HB7A 1U63A 3IS3A 3MINB 1WPRA 3IXMA 4J0CA 4R0NA 3EH1A 5MDHA 1LPPA 2RHMA 3P0HA 3QX8A 4IOJA 1XXHB 1PR0A 2P2SA 4UVGA 1WOMA 1PZGA 2WU4A 2YWGA 1EX1A 1CS0B 2XITA 2VF7A 4H3KB 5E4FA 1ZD2P 3VPBA 5IBQA 2PG3A 2FV8A 4JLNA 3ROTA 2CFRA 1UDAA 3WGLA 2HU2A 5FA5A 1FDVA 1G8PA 2ECOA 1A8HA 5KSPA 1ZAYA 1XRNA 1SVNA 3A58B 5C3UA 3GLSA 5BN5B 1BS2A 1RVDA 1NW3A 2YVQA 3FFBA 3K9CA 1QP7A 1H8HD 1NW8A 1G0OA 2BHTA 3PEEA 3M4ZA 4BP1A 1FB5A 5EIFA 1S2OA 2QQ5A 1KOFA 4XWWA 4UAGA 4RPKA 4NH4A 1K89A 1XTVA 4O4JF 2W2MA 5LYJB 4HDCA 4RLFA 1F17A 4AMUA 3CT4A 4HG2A 3B38A 5LZ5A 4ZYUA 5A03A 3FBWA 3ZWPA 3AQIA 5DCUA 1A9SA 4D3FA 4OD0A 4M3NA 2C9OA 3G88A 4JYMA 4QHTA 2AJLI 5GINE 4X9XA 4Y1FA 2UZ1A 2VJDA 4NTZA 3QVWA 2P4UA 5JDIC 4YPFA 4OHYA 1OKKA 3ZE9A 1PSWA 5IT4A 3S1SA 2EP8A 5JR3A 4Q4LA 1R74A 1E1QD 2Y0PA 2CVOA 2GN0A 4KKXB 1PD0A 4U7WA 2C8LA 1S2IA 3FNEA 4ZDIA 3IIJA 5HZMA 1QQTA 1R8YA 4PWZA 3EVZA 4EQ6A 3GVPA 4IH4A 4CGYA 2GPSA 1U1IA 3O03A 1NAIA 4C0BA 2VBGA 3TW0A 4LTMA 3OLWA 4FSXA 3PHGA 3SF8B 5KVQA 4W1RA 3RASA 5JEDA 1U0EA 5BV1A 3RSHA 1Z5OA 5CVVA 3EDRA 2ZPAA 3EARA 1VLVA 4MP6A 4WY8A 1Z18A 1OB5A 2WD8A 2XB4A 4G65A 1DADA 4J76A 2LVBA 3VUEA 3DLTA 1ZA1A 3KZNA 4PZAA 4D96A 1DJNA 3BL8A 3GDOA 2VT7A 3T7DA 3O31A 3T0IA 5HZGA 2NQ2C 2WWIA 4QXOA 2FR8A 4RV4A 4BE4A 3QE0A 4NH0A 5PGMA 3C16C 1QFSA 3W78A 3MTBA 4F4HA 5HF8A 1FMLA 5SY9A 3U09A 3I05A 1KOGA 4UW9A 3WA6A 3V32A 4CM4B 5INTA 3RK4A 1BA2A 4PO3X 1Y1KE 4KR2A 3BIFA 1YDFA 3INNA 3KQPA 3ROQA 4FD2A 5FAXA 2EKBA 1JDVA 4HATA 1IN7A 4RS3A 5BT9A 2A3NA 4YRDA 1JDBB 4FE3A 2AVDA 2ZUTA 2ODPA 2OUIA 3D8BA 3FMVA 1RC0A 3GFBA 5AQEA 1QOQB 4PZYA 4ZVLA 1JYSA 1W5AA 5ICGA 1JEAA 2ZITA 3MBOA 2NSLA 4J2TA 4YJFA 2VPIA 2GYVA 1P5ZB 4HRVA 2AK3A 4P53A 4F1JA 4I4LA 3GBSA 5FFMA 4NR0A 3ETCA 4TWBA 2IXAA 3HFJA 3M1IA 3ZS8A 4JXZA 1N7HA 1C7EA 2PYIA 4R7TA 4O0LA 4I4CA 2CBZA 2XZOA 3OHMA 1H6AA 3I9OA 4F3CA 2NPOA 4M8LA 3WRWA 1AKVA 4PSKA 5IN4A 1FS6A 1TMKA 5LXTA 3SIRA 4MHSA 4DLLA 4CQNA 1LV8A 1ISIA 3MTIA 1J07A 5LCXA 4EUFA 3DEJA 1X0VA 2JLSA 4RLSA 4TYQA 5LWQA 5IDQA 5M5BA 2QJRA 4KX3A 4LPSA 1JQBA 2PV0A 3PUZA 3ZE2B 3F97A 5KMGA 4IVQA 1DBVO 4WLFA 2Q8QA 1QLJA 4ND8B 1VDMA 4TLDA 1R5NA 2B99A 2RAVA 3UMSA 4MX8A 1P9OA 3RIEA 4A0GA 4MW6A 5DIFA 2W6NA 5BSHA 2P7HA 2Q9BA 3C6ZA 3DS8A 4YT2A 4HNRA 3CFYA 3GVXA 4NL4H 5FT9A 2Z5GA 2FKAA 1VL2A 1YGPA 2WWRA 1PJ2A 3SS9X 2HR1A 1YR1A 2FMIA 3ETJA 2I87A 3IJ5A 3U4HA 1IN4A 4EDFA 2YN2A 3M89A 3CB4A 3UMMA 2BSXA 2Q9UA 2X8AA 2AH5A 3MF4A 3SNHA 1XZDA 3HJAA 1CIJA 2Z1MA 3HBFA 4LJ5A 3U49A 2H54A 1N6OA 3HG7A 2IXBA 1CJTC 1QB8A 4TV9A 4XFJA 5IBPA 5JXWA 1E5VA 2XT9A 4FXPA 1CZOA 2F8MA 4NQRA 5DISB 1KL7A 5FFFA 4JQYA 3SMQA 2Z1DA 1I4LD 4JMLA 1EUDB 1TYAE 3JU3A 4TRRA 5A9SB 5CIWA 3A4TA 3LDHA 3M5DA 1DRJA 3T7JA 4LJ8A 3WXBA 3JQAA 1V16B 4GE3A 2A5FA 3BE6A 3ZE6A 4YJ3B 3BRSA 4IRUB 3ZNOA 2I33A 3OEYA 4FYPA 3P4UA 1LRKA 2PCLA 5FQOA 1EE9A 1IXRC 5JWHA 1G2IA 1KKLA 1P2VA 3V8NA 1LQUA 1KHTA 3AUJB 4UEWA 4D4JA 3LFTA 4NZPA 1PUXA 3KLOA 1G8JA 3VGPA 3IKJA 2AMFA 1K3FA 4PY2A 2JEOA 3ZLTA 1CZRA 1WXGA 4YFVA 3N2NA 4MPDA 4WK0B 2QAGC 3FNGA 1WMEA 3OZCA 8MHTA 4U3JB 3ZLUA 4EKDA 2AFIE 2FWAA 4GRAA 5CW1A 1KVSA 3O8QB 4PANA 3ZLVA 5BSKA 3B9RA 4F04A 5G4KB 1PJLA 2R1VB 5T67A 2M9MA 1E9CA 2V4UA 3JW8A 4MLPA 3U7QB 4EFKA 1R9NA 1X77A 3JPYA 3UATA 2OHHA 3GLVA 3L49A 5A3QA 3JQ8B 2GZAA 3FKJA 1LB1B 4E5PA 4N1AA 3TGLA 4S1VA 2I0FA 4IKPA 1SQ5A 3AVYA 3F6EX 4QO8A 1TZKA 1S2NA 2V9PA 1V25A 3FWYA 4PBSA 1AMOA 1SHLA 2YVUA 4ECEA 1MD9A 4KX5A 4A1FA 3A4MA 3WG9A 4P08A 1E3DA 1VJ5A 3B1WA 4ITRC 1CNFA 1GZ5A 4JI4B 4HWPA 1LLCA 5SYAA 1DCFA 3OPYA 5A0TA 2BH2A 3ESZA 2GCOA 3GCXA 5JCXA 1PX0A 3PGMA 1T15A 3QX9A 3LU1A 5AESA 1KS9A 3ROGA 4B79A 5HQJA 5KS2A 1TPYA 1DARA 1PIWA 1AM4D 5CDHA 3P2JA 4ZIRA 4RTLA 3VOBA 3BX1A 2LIPA 2PSHA 4OFWA 3NDBB 3AUTA 4UOZA 3OZBA 2CBXA 2H4FA 2ZYIA 4KO3S 3HVRA 3DBIA 4EG5A 4XVUA 1KWGA 1JL3A 2E37A 4Y6OA 5EJ5A 4F6CA 3TO5A 2Q5OA 3ZWQA 4XYGA 3IWBB 3IP9A 2QG4A 3DJFA 5C0OE 2Y05A 3C43A 3KU4A 2C7VA 3LXUX 1EZ4A 1HURA 5FKJA 1E3EA 1M8PA 1MXFA 1O8CA 2ZB3A 3C3DA 4WLVA 1B93A 5DE3A 3TNLA 3WGUA 4ZGGA 1Q20A 4P8RA 4WOCA 1Q17A 3UOAB 3I61A 2ZT7A 4OBEA 3EP7B 1E1DA 3OJCA 4MTCA 1LBEA 1XXLA 4B8ZA 2J6CA 4UHFA 4BJHB 4DN6A 4ENRA 1HZZC 3OZEA 3PD7A 4FYJA 4G4JA 3RREA 3RT7A 2HW8A 4CZ2A 2B82A 2JF0A 2O7RA 4N54A 4AYWA 2QL7A 3KPUA 4EB0A 4IGFA 5K0CA 2WIGA 1TIKA 1VB3A 2H2FA 1KC3A 2E4XA 2Q2QA 1VCIA 5JQGB 1AGYA 1POXA 5T4FA 1C1HA 3LUJA 5BV2P 4HX5A 1N9ZA 5DTMA 3A3NA 4LIPD 1KDZA 3V1MA 4EB8A 2KPOA 5IZCC 3DE5X 3GOQA 4DT1B 3BL6A 2D5AA 3ICCA 4NONA 1KYTA 1N2CE 2YWHA 3HWRA 1XFAA 4TWZA 4V0ME 4X6XA 4JI1B 4PAGA 1N36B 3E22B 4KXMA 1UMDA 3L0SA 5AW1A 2FZEA 3TUXA 1VC2A 3ANYB 2P5UA 2OM2A 2VHVA 2YR0A 2RHJA 2EW8A 4JCOA 4RL4A 4TUYA 4BFZA 2QV0A 2X14A 4IUDS 2W11A 4YMHA 2W6JA 2ZRBA 1DPFA 1RADA 2CNLA 1EDZA 2H2AA 3P71T 4MEJA 1Y1QA 1GCIA 3O1IC 2PRJA 4QU8A 4EEXA 4W1QA 1SQGA 3STWA 2G72A 2OV4A 4R3WA 2QAIA 4B80A 5TPZA 5KTOA 1K5HA 2Y6UA 2VTEA 4LV6A 4X1KA 1GM5A 1U0BB 1EWTA 3RYIA 3W7BA 2A7XA 1Q1QA 4RE5A 3ZI4A 3ORQA 3D3JA 4MYDA 3AEKA 4IMRA 1MIHA 4UCXA 2SKCA 1S8NA 1UANA 2W6JD 1KYXA 1L5QA 4Y6RA 2UZ3A 3TFWA 1HPLA 2EX0A 1R9JA 4IOMA 5AQ1A 3K2IA 2NO0A 3PHBE 1YR3A 2WF5A 4I66A 4JLBA 2HF8A 4YCAA 4F46A 1P2FA 2Z43A 3E2MA 5CXSA 2R8XA 4FFLA 2NU7B 1WS6A 3G13A 3PUJA 4OGFA 1YT5A 2ILVA 5FRDA 5IS2A 1HZZA 1YZGA 4TQUS 1XV5A 1W19A 1XZAA 3BF8A 4R6XA 5C5IA 1DBWA 2ANBA 1CHNA 1EJ2A 2I6UA 1KJWA 3GDFA 5DBGA 2D13A 5JISA 4NHEA 3P26A 4RVUA 1TA0A 2NIPA 4LMAA 1FFAA 1DC7A 3IIIA 1MC4A 3NTOA 4PQGA 5DBIA 5A71A 3L0IB 1ODKA 1L4HA 3V7WA 1FK8A 3PPIA 4F12A 1JG4A 3FHJA 3KB2A 5F7JA 3WZMA 3HFGA 1ECPA 1KI6A 4RSMA 3U56A 2OO3A 3K6JA 1IXYA 1RKBA 2FZ5A 3F4KA 1YA8A 4JP8A 1PRYA 1KJQA 1C5KA 3UB2A 4CMGA 4YWHA 5HG0A 2BP7B 4HEA1 3LOQA 3IT3A 2NWQA 3GT3A 4OK3A 3OH8A 4EYKA 4AZSA 1EFVB 4L0QA 4DOMA 4YBZA 2V3CC 1BEEA 3S81A 1G5HA 3UAYA 1GOTA 1R8JA 3S1AB 1KAMA 2XYGA 5K3FB 1JE1A 2VBCA 3CVOA 2GN9A 1C7JA 3DQZA 4W7SA 1D6NA 2ID8A 2VF5X 2H2WA 5LR6A 2IT1A 2J3IA 4I9FA 3D0KA 4LRWA 2GDJA 1CY7A 1U28A 3C3BA 4C3ZA 4CF4A 2DR3A 2ISQA 4NE2A 2UYYA 5GADl 3DBLB 1HRKA 3OCJA 3I3SR 3QVOA 2HFJA 3U39A 1KMNA 1N2EA 4KJZA 1H2ZA 5KBYA 5GVRA 3IT2A 4ER0A 4NZZA 2B5OA 4GM4A 4UEOA 2GN4A 3TSYA 3K9WA 4UOQA 3DEYX 3NH9A 5FOVA 4NAVA 1IK4A 4R9RA 3RSQA 1VI5A 2QMEA 1M74A 3DEKA 8OHMA 4P3NA 2Y2VA 1KO5A 2QU8A 4RKRA 2ZAMA 5ITZB 5AJZA 2CMGA 2ZZKA 1F6DA 2ESRA 3LF2A 2J9XB 5FLEX 2FMUA 4NLLA 2XVZA 1GLNA 4QSMA 1GUAA 3TRHA 4V03A 3I2FA 1T36A 1R4ZA 3CNHA 1PZNA 4BFUA 1QV6A 3RT9A 3CG0A 3E8MA 1QPGA 4LYYA 1QH8B 1YZVA 1K3TA 1EFUA 3FPSA 3GU3A 1T5OA 2IEBA 1YBMA 2NTJA 1H1LB 4MP8A 4PLTA 3VI3B 4AZVA 1V8OA 2PCJA 4FHDA 4HYTA 2H1FA 1THGA 2DWQA 3M1AA 5DCLA 3U13A 1EDDA 1ENPA 3SIXA 3WR5A 1ATIA 3F8SA 3DZHA 3I4CA 2R1ZA 4TQ9A 3PXEA 1MB9A 2O50A 3LLMA 2OZLB 3QLVC 4LXYA 3VHRA 1Z5ZA 2NQTA 3N8NA 3O2NA 5CB6A 5JVDB 3BCUA 5DX0A 4EMBA 1XEFA 1Z45A 3PP8A 4R9NA 2PS0A 5DT9A 1HT1E 3HCNA 3RT1A 4EFNA 3B12A 3EMKA 2BDEA 2G71A 4GUAA 4HB4A 5CJJA 3X0DA 3EZ2A 3OQJA 1A3CA 4E22A 2RGAA 3K0BA 1X8JA 2J85A 2WHQA 3CUYA 3PRHA 2CHFA 2QE7D 4UU0A 1ULSA 4GYYA 3VO1A 2WWHA 4ZOLF 2CNKA 2GHQA 2XVYA 3JARA 3NNDA 4CF3A 4KN9S 2O19A 5L6LB 1JECA 2GAJA 4YRIA 1G17A 5AMXA 4OHCA 3UFBA 4C1NA 4LTDA 2BEWB 1EAMA 3QW4B 4YGXB 1RI1A 2I2FA 3L77A 4YXWD 1F12A 4M1OA 2FB9A 3HKCA 3HXLA 2XRYA 1BYIA 1E3JA 3HXKA 1EFRD 4KBFA 5EKTA 2IS6A 1VPLA 1OZAA 2X1VA 1P17A 4DADA 4RZIA 5HRAA 2OT3B 1S0UA 1T4CB 2QTLA 2VXBA 3P5BA 4UHDA 4OTZA 5D85A 4ZKDA 1AY0A 3RJTA 4KQXA 3PNLA 2PUVA 4F7WA 4FVTA 4EAAA 2N3ZA 3ZPXA 3TSZA 3EW7A 1BU5A 1K6JA 2X7HA 2GN6A 4ROSA 1IBKB 1MW9X 2Y71A 4B87A 1GTG1 2R1UA 1LDNA 1DLJA 1UBSB 2N47A 3ODGA 4HBGA 3NQ41 3ZR4B 1G59A 3CF4G 4EFDA 2ZI3A 5AM2A 3W77A 3O5AA 5AJXA 2XUKA 1G60A 1FMCA 1LPSA 3TUTA 3UM9A 2JEYA 4B9EA 1SELA 1RW4A 3PQ5A 4WSOA 5BT8A 1GT91 3AEYA 4L9SA 1T8SA 2L2QA 3JS5A 3ZGNA 2WHXA 4X8HA 2G0AA 2A92A 3OMXA 2AEEA 5LLTA 2VJQA 3ER6A 3H2JA 5I9MA 1WBDA 4Y6GB 5IFLA 1CYDA 4ARUA 4JK3A 4O02B 1E3IA 1TCBA 1HL7A 3L8GA 1HDGO 1LBSA 2BD0A 4M8IA 4Z9XA 5EXTA 1A76A 1AQYA 4PG7A 2Q7XA 3CZQA 3QPDA 2GJKA 2XYRA 5DBFA 2YMPA 2OCLA 1DCTA 1A8PA 1U8EA 3KDAA 4JJIA 4QNRA 3ZX5A 4PLWA 3L7LA 1SVKA 3U7GA 1OI4A 4GOOD 2AK2A 3EOAI 5LOVB 4Z3OA 5EIBC 4IDHA 5IAJA 1OGIA 3IE1A 5E2AA 3L8YA 4ZRNA 1BH6A 3DOFA 2J67A 4MS1B 1XZKA 3KKLA 2JLQA 1ILWA 3V5NA 5BQFA 4H3VA 5K6AA 4LF9B 4CV3A 3KKEA 1FFEA 3N2KB 1E4EB 3PV0A 5AOAA 4IIXA 1L9KA 3V6LA 5B3JA 2QLMA 4G26A 4NDNE 4ZZ3A 3R3YA 3DDSA 4GX5A 4KXNA 5HUQA 3VSAA 3EPBB 1VPVA 1WSAA 2JLCA 1GY8A 2I4NA 2AN9A 1H2EA 3EULA 5LQSA 2EARA 2R8ZA 1UBCA 1SB9A 1GNTA 3R0VA 5FO0A 4AP9A 1ZCFA 4BFXA 1FQWA 3ZYCA 3OT5A 1PQYA 3MTGA 5EP2A 2I4TA 5CFOA 3V6MA 4YP0A 5HKAA 4PYOA 4P3KA 1LTHR 3VVBA 1ZISA 1LJLA 2FPXA 1KEZA 1N5LA 2UYGA 3CZCA 1RLJA 4H0NA 4U6QA 5ELMA 5AVXA 5CVEA 2YHIA 4DY6A 1ARZA 3VA7A 1TQ8A 2PEZA 4U8HA 3UXYA 4RTMA 1CR6A 3LXRA 1UMKA 1PT8A 2GN8A 1B6SA 3L7NA 1NDHA 4U63A 1D09A 2VT3A 3SP1A 3W5AA 3BQMB 4BBJA 4R5HA 4R5MA 2NAPA 1K0UA 1IM2A 3SK0A 3UAZA 4B76A 5DKFA 3WL6A 1NU6A 3BH0A 1QHNA 3DD5A 3HR4A 5EL0A 2FZ4A 2CWWA 2P9GA 4YX9A 4MR7B 1E6LA 1U3TA 4TZTA 4BQSA 3ONDA 5AWFC 5KI6A 3A2KA 1KU6A 4ZYYA 5I7SA 4FGJA 4UXJA 1KF0A 1Z68A 2HLDA 3K5PA 1R6XA 4HS4A 3PJRA 2I7TA 1O6ZA 1V8PA 4JUDX 1TD1A 2NXCA 3JYQA 3H5VA 1YQGA 1CQJB 1JE0A 2AXEA 4G41A 4KACA 4UXIA 5B1SA 3T7AA 1WSBA 1P8JA 2JARA 3GPCA 1RDFA 3AHFA 1OXKB 5EVCA 4HXYA 2R6ZA 4RQTA 1ZP6A 1QHSA 4KWIA 4NY1A 10MHA 2NV0A 3AC0A 3N6VA 4PRKA 3HJFA 5CYGA 1UZMA 2CWDA 3AGQA 3DBHB 4AC9A 2RD2A 3LZCA 4YP1A 2PGAA 3KEQA 1N6IA 4OHZA 1XJCA 1NRIA 4UFOA 2NV2B 2QGZA 2O2EA 1CJSA 3IQZA 1KQFA 3V1TC 4TYNA 1UPXA 4YGYA 3MCAA 3ML1A 2YS7A 1Z6YA 4JIGA 2ZRLA 4TQAA 5C4IA 5IFKA 1X1CA 1ZMBA 4Q12A 2RG1A 4F4DA 3M1YA 3JQPA 4AU1A 2HGZA 4B34A 5KQMA 4LHWA 5CFNA 2IQIA 4ZO6A 4ZZ1A 2PH5A 1QQAA 2IUTA 1E59A 5IT0A 5DN6A 5CEEA 2H17A 3GELA 2KBEA 4X0EA 4ESOA 1Q15A 1C8VB 3SBOA 4BATA 1A5SB 3ND9A 4KPYA 1WCWA 4EMSA 1I1NA 3OZSA 3BIJA 3TQSA 1U65A 3CVUA 3ZCRA 4G84A 2ZSUA 1V5EA 3CWQA 3IH5A 5KNCA 1M1XB 3PNQA 2DPGA 4J0IA 5TQ2A 1TQ6A 2AE2A 1HMPA 3QVVA 2A0UA 4ISBA 4UUMA 1G64A 1EMDA 1LX7A 3KC2A 4KNWA 4MPTA 4DB2A 2W2LA 3DZ3B 4BNLA 1NQ5A 4D9NA 4L51A 1J21A 3BWMA 4PLGA 2UZ1B 4AKIA 2QBYA 4L3OA 3DE4X 1Q6ZA 4X1OA 4DSOA 1GG9A 1MA0A 3TTXA 1GTSA 1KA9H 5HF9A 2X3UA 4RMHA 4IIEA 3JY6A 1GAQA 1XRJA 1YSCA 2KQUA 4QTTB 4QYWA 4XLLA 2QN8A 4YV2A 5TPWA 4I3HA 4F45A 4TYPA 1KDPA 4MRVA 2IYWA 2C3YA 5DTIA 3WYGA 1RZVA 2FQ1A 2EJWA 1M2VA 1U3GA 3AEZA 3A11A 4IINA 5ALEA 2I3ZA 3IAXA 4RK5A 3ZIAA 4Q9NA 4TYYA 3BIXA 4MCJA 5LBUA 3HK2A 1GGHA 2QTHA 3RB8A 1BXRA 5CBPA 2MSEB 3SF8A 4BKPA 1CJMA 3H2IA 4F5EA 3IWDB 3I9V6 5CJPA 2CJPA 4N3NA 2JJQA 1V35A 2YC4C 3SIWA 2FG5A 1N5KA 1PNVA 4GUDA 2MSLA 3AKYA 1RBMA 1XZNA 2PSSA 1TAHA 1KJ8A 4DAEA 1CEYA 2YOHA 5AK5A 1XRMA 1YVEI 3DZBA 5C8YB 2JVKA 4PX3A 2WJYA 1M8FA 3PXGA 3DZ2B 3WIUA 3C1UA 4QYTA 3HYTA 4EHLA 3AFNA 3Q4GA 3U3ZA 3C3JA 1OH7A 1K8XB 2Q3LA 2QV7A 1CERA 2GBFA 2H52A 2JFOA 4IIJA 4JFAA 3TLAA 3AWIA 5H83A 5FWDA 5BQ5A 4ZYTA 1QG0A 4CE6A 3JALB 3FD8A 3JZMA 2FFBA 3NGXA 4N3CA 1J0DA 2RBKA 2ZUDA 1JQKA 4AN1A 1OT3A 4WNAB 1D6MA 1KR2A 3O4JA 3AHDA 3RRYA 1LX6A 2VVTA 1IVSA 2IZ1A 4OQNA 2O06A 1GZSA 1M2HA 4YCSA 1CIPA 1PL7A 2D7DA 1RYYA 2Y1CA 2K2QB 4IDAA 4Q9JA 4DLAA 2DBVO 5FWNA 2N75A 1YRHA 1ESMA 1J2YA 3AI3A 2WDPA 2ODQA 4EPTA 3NT2A 4ZHSA 4CLRA 3KSZO 5HM8A 2C98A 2QVCA 4MTLA 4OXXA 4US1R 2X0KA 4WMLA 4ZOQI 3EA5A 3THOA 1R6TA 3OOSA 5BN3A 4C3UA 2K87A 3LC7O 1UKVY 5KVAA 4B35A 1BHO1 1D5CA 1U1CA 1UK6A 2UUOA 1KAGA 4RTJA 4L8FA 1IOWA 2RARA 1O97C 1U2SA 1N9GA 5C5CA 4DV7B 4NZNA 1ZESA 1FTGA 2LKCA 4AZ0A 4HDNA 1FFDA 1XRLA 3OCXA 2XCRB 1DAIA 2Q1SA 3EG9A 1E63A 1JVBA 1LV7A 1SKYE 3EVCA 5EN4A 2BZSA 3EQZA 5CIQA 4NK4A 3LCVB 4B40A 4OREX 5KCMA 5C7LO 4YRZA 1XTPA 4MLZA 1JZSA 5E95A 4EX7A 4JKOA 1TW2A 3G6KA 5FWYA 4M0CA 2JDID 1RYNA 3B3AA 3A14A 4BO5A 3AFMA 4FBGA 1E5TA 1YKFA 4YI3A 1QIHA 4JEMA 3TR6A 4OI0A 3HNPA 1NAHA 3NBZC 3S8MA 4E08A 5ENVA 2NZJA 4GYKA 3T7TA 5LP6B 2SKDA 3LNTA 1SIUA 421PA 4IQ4A 2F1RA 3A1UA 1RZRD 5D86A 3FSGD 3SCZA 4FGZA 4AJEA 4EA9A 1A9PA 1IEXA 3LK6A 3QVJA 3EQ2A 1GUDA 3CPHA 1T2VA 3OQIA 3MGBA 1P6QA 1RXEA 2J9ZB 2F3UA 1OHHA 1UUFA 2P9HA 3RF6A 5J63A 3IBCA 4RF4A 3G2KA 4TMYA 3T1NA 1REQB 5A4KA 4QSHA 3QOXA 5JALA 4MR7A 3LPAA 4N8DA 3RTDA 2CDCA 1PTJC 1MDBA 1S01A 721PA 1Z4KA 1B2RA 1W4AA 5LMZA 5EUCA 1JIIA 4DV4B 1E1LA 2ETVA 3G1UA 2ABWA 3EXHA 3GZNA 3R1IA 4TLCA 1DX4A 1T43A 2H63A 3MJEA 4ME6A 3W0LB 2VATA 3BERA 1DWUA 1G3QA 4G4SO 4LJSA 2IOFA 3JRWA 4FCTA 1D7AA 1WWKA 2X8LA 2R2GA 5H0IA 3C15C 4EA7A 2BYTA 5EZSA 1XJ5A 2JK1A 2WSIA 2MSCB 4M49A 4XGQA 4MUYA 3OICA 4DIOA 3OF2A 3T7EA 3T6KA 3NLLA 3C4QA 5BR1A 2AR0A 2VJNA 2XNDA 3ZWAA 5AW7A 3A3KA 2ATIA 3GD7A 4UPEA 2PX0A 3A3OA 2D1RA 4G8DA 4WXYB 3TFOA 3R0XA 1T4DA 3H83A 4I2VA 4YASA 4GZ3A 1HBJA 2AZMA 3Q72A 4B17A 1KMHB 4XB2A 1C4WA 4IVPA 4MO2A 1KI9A 1OBHA 1PSZA 2HU5A 2YRWA 1KQPA 1NQOA 4OGGA 4PLCA 3ZNQA 1IN8A 2BM8A 1IXSB 1M2JA 1XP8A 2A35A 3GCZA 4C9BA 1BD4A 3SJAA 4QAQA 4BX0A 2WC1A 4LQCA 3EE6A 1E5DA 1UQTA 3EPKA 5JPCA 2Q3DA 3ZCUA 2GNOA 2JJMA 3OOHA 2YBDA 1I2MA 1M6VA 3GZTB 3GNLA 2CDNA 4J29A 1EJ6A 2QJWA 4MW2A 3RGWS 4EVQA 5L7TA 5DMXA 2ZRGA 4Z7NB 4TTRA 4E5DA 2CL5A 1H5UA 3DVQX 5AM1A 4FQ8A 2BZGA 3OQMA