The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
101
|
sequence length |
295
|
structure length |
295
|
Chain Sequence |
HMGKAVAAIVGPGNIGTDLLIKLQRSEHIEVRYMVGVDPASEGLARARKLGVEASAEGVDWLLEQDELPDLVFEATSAKAHLANAPRYAEAGITAIDLTPAAVGPLVCPPVNLTEHLDAPNVNMITCGGQATIPIVHAVSRVVPVAYAEIVAAIASRSAGPGTRANIDEFTETTAAAIEQVGGAARGKAIIILNPVEPPMIMRDTVYCAIPPDADTDAITASIEEMVAEVARYVPGYTLRTEPQYDQPRDIWKGMARVAVFLEVRGNGDYLPPWAGNLDIMTAAAARVGELLAQA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal and solution structures of the bifunctional enzyme (Aldolase/Aldehyde dehydrogenase) from Thermomonospora curvata, reveal a cofactor-binding domain motion during NAD+ and CoA accommodation whithin the shared cofactor-binding site
rcsb |
molecule tags |
Lyase/oxidoreductase
|
source organism |
Thermomonospora curvata
|
molecule keywords |
4-hydroxy-2-oxovalerate aldolase
|
total genus |
101
|
structure length |
295
|
sequence length |
295
|
chains with identical sequence |
D
|
ec nomenclature |
ec
1.2.1.10: Acetaldehyde dehydrogenase (acetylating). |
pdb deposition date | 2013-07-20 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF01118 | Semialdhyde_dh | Semialdehyde dehydrogenase, NAD binding domain |
B | PF09290 | AcetDehyd-dimer | Prokaryotic acetaldehyde dehydrogenase, dimerisation |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Dihydrodipicolinate Reductase; domain 2 | Dihydrodipicolinate Reductase; domain 2 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | NAD(P)-binding Rossmann-like Domain |