4LRVA

Crystal structure of dnde from escherichia coli b7a involved in dna phosphorothioation modification
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
Knots found
sequence length
107
structure length
107
Chain Sequence
SMLPNRMALSRQTEDQLKKLKGYTGITPNIAARLAFFRSVESEFRYSPERDSKKLDGTLVLDKITWLGETLQATELVLKMLYPQLEQKALIKAWAAHVEDGIAALRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into DndE from Escherichia coli B7A involved in DNA phosphorothioation modification
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords DNA sulfur modification protein DndE
total genus 31
structure length 107
sequence length 107
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
other databases KnotProt 2.0: K -31
ec nomenclature
pdb deposition date 2013-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 4lrvA00
4LRVA
chains in the Genus database with same CATH superfamily
3SFUA 2WVFA 4D8JA 2WVEA 3G5OA 4NRTA 2KELA 2A2BA 4QPXA 2JXIA 4ME7E 2H1OE 2BSQE 2GPEA 3BSNA 2H3AA 1SH0A 3IR7A 3NNEA 2HZAA 1PARA 2AN7A 1NLAA 2K29A 3OD2A 2BJ7A 2BNZA 2KOEA 2CA9A 1B01A 2Q2KA 2BJ8A 3UQSA 1MNTA 3UPFA 3LJPA 2UUWA 2WVBA 3H5YA 2CAXA 3VEBA 1Q5VA 1ARRA 3H5XA 1MYKA 3FMTA 1MYLA 2BJ9A 3BSOA 1BDTA 2BJ3A 4HV0A 2K9IA 2ADLA 1QTGA 1B28A 2JBVA 2CAJA 2RBFA 4AAIA 3NAIA 4NRUA 2WVCA 3VW4A 2K5JA 2B43A 1X93A 1BAZA 2AY0A 3QOQA 1EA4A 3H87C 4FXEA 3SFGA 1IRQA 1OHNA 2BNWA 3FT7A 4LQ3A 1Q16A 2BA3A 2K1OA 3QIDA 1OG7A 3LGHA 2HZVA 1SIWA 3NO7A 3UR0A 2CKWA 2UUTA 2WK4A 2KKEA 4MJWA 4O4RA 3GXQA 1ARQA 3NAHA 2K6LA 2BJ1A 2CPGA 1SH2A 1U9PA 2JXHA 1BDVA 1SH3A 2JXGA 2CADA 3VEAA 2WVDA 1P94A 4LQ9A 4LRVA
chains in the Genus database with same CATH topology
1SIWA 3SFUA 2KOEA 2JBVA 3NO7A 3UR0A 2CKWA 2Q2KA 4AAIA 2UUTA 2WK4A 3UQSA 3NAIA 4NRUA 2KKEA 4MJWA 3UPFA 3LJPA 2UUWA 4O4RA 3H5YA 2B43A 3NAHA 3H5XA 3G5OA 4NRTA 2A2BA 3SFGA 1SH2A 4QPXA 1OHNA 3BSOA 1SH3A 3BSNA 2H3AA 1SH0A 4LQ3A 1Q16A 2ADLA 3IR7A 3NNEA 3QIDA 4LQ9A 2AN7A 4LRVA 1OG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LRV A; 
#chains in the Genus database with same CATH topology
 3SFU A;  2WVF A;  4D8J A;  2WVE A;  3G5O A;  4NRT A;  2KEL A;  2A2B A;  4QPX A;  2JXI A;  4ME7 E;  2H1O E;  2BSQ E;  2GPE A;  3BSN A;  2H3A A;  1SH0 A;  3IR7 A;  3NNE A;  2HZA A;  1PAR A;  2AN7 A;  1NLA A;  2K29 A;  3OD2 A;  2BJ7 A;  2BNZ A;  2KOE A;  2CA9 A;  1B01 A;  2Q2K A;  2BJ8 A;  3UQS A;  1MNT A;  3UPF A;  3LJP A;  2UUW A;  2WVB A;  3H5Y A;  2CAX A;  3VEB A;  1Q5V A;  1ARR A;  3H5X A;  1MYK A;  3FMT A;  1MYL A;  2BJ9 A;  3BSO A;  1BDT A;  2BJ3 A;  4HV0 A;  2K9I A;  2ADL A;  1QTG A;  1B28 A;  2JBV A;  2CAJ A;  2RBF A;  4AAI A;  3NAI A;  4NRU A;  2WVC A;  3VW4 A;  2K5J A;  2B43 A;  1X93 A;  1BAZ A;  2AY0 A;  3QOQ A;  1EA4 A;  3H87 C;  4FXE A;  3SFG A;  1IRQ A;  1OHN A;  2BNW A;  3FT7 A;  4LQ3 A;  1Q16 A;  2BA3 A;  2K1O A;  3QID A;  1OG7 A;  3LGH A;  2HZV A;  1SIW A;  3NO7 A;  3UR0 A;  2CKW A;  2UUT A;  2WK4 A;  2KKE A;  4MJW A;  4O4R A;  3GXQ A;  1ARQ A;  3NAH A;  2K6L A;  2BJ1 A;  2CPG A;  1SH2 A;  1U9P A;  2JXH A;  1BDV A;  1SH3 A;  2JXG A;  2CAD A;  3VEA A;  2WVD A;  1P94 A;  4LQ9 A;  4LRV A; 
#chains in the Genus database with same CATH homology
 1SIW A;  3SFU A;  2KOE A;  2JBV A;  3NO7 A;  3UR0 A;  2CKW A;  2Q2K A;  4AAI A;  2UUT A;  2WK4 A;  3UQS A;  3NAI A;  4NRU A;  2KKE A;  4MJW A;  3UPF A;  3LJP A;  2UUW A;  4O4R A;  3H5Y A;  2B43 A;  3NAH A;  3H5X A;  3G5O A;  4NRT A;  2A2B A;  3SFG A;  1SH2 A;  4QPX A;  1OHN A;  3BSO A;  1SH3 A;  3BSN A;  2H3A A;  1SH0 A;  4LQ3 A;  1Q16 A;  2ADL A;  3IR7 A;  3NNE A;  3QID A;  4LQ9 A;  2AN7 A;  4LRV A;  1OG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...