4LRWA

Crystal structure of k-ras g12c (cysteine-light), gdp-bound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
155
Chain Sequence
TEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase KRas
total genus 54
structure length 155
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lrwA00
3NDBB 3ADDA 1FP7A 4Q9LA 2O8DB 2IHBA 3MGCA 4FD2A 1QG2A 2JLXA 1E9SA 4CIDA 4URXR 2GKSA 1MH1A 3H1TA 4PAMA 1ZVQA 2MMCA 5GADl 5JJKA 3V4RA 3ZS8A 5JRZA 1FX0A 3EIHA 4LC1A 4URYR 4R71A 4Q4LA 1XU4A 1SVOA 1T3LA 3MG9A 4LK2A 1FNNA 2EFEB 5JWRA 4HAVA 3W6PA 3MRSA 5FBRB 1U0HC 1MT0A 3EX7C 1GOTA 4RCZA 3I92A 1DOAA 2OXRA 5AR1A 5DGXA 4BQSA 3D6TB 4A92A 5B57C 1GWNA 3IO3A 4C0JA 1GILA 2I1QA 1E99A 3DPUA 3IBGA 1Y3AA 3ZYCA 4PAOA 5FOUA 2F1JA 1Z0KA 5J4HA 4ZIRA 3UG6A 3PUXA 3B9PA 4DLSA 2DY1A 3THYA 2HT1A 4DXAA 5JS7A 1W0KD 3SBDA 2E9SA 1ETUA 1GNRA 4HYYA 2QP9X 3QKTA 3FHOA 5TY0A 2Q9AA 1E69A 2VYFA 4QM6A 3X2SA 1ZAKA 4TSFA 2XXAA 4GBMA 1U8AA 1S3SA 3BFVA 2V55B 3UKDA 4B73A 2DFNA 1WQ1R 2X2FA 3CF6R 4B6EA 3HPQA 2GRJA 5K8TA 2B6HA 2HF8A 3BH7A 1E0KA 2P65A 3GLGA 1P75A 4TYYA 3LX8A 2ZE5A 1G3IA 1YKSA 3AVYA 1Q22A 3K8YA 1EWQA 2QSYA 4EJSC 3OF5A 3AQ4A 4A0FA 2YVUA 3UATA 2IYRA 3KUDA 2WAXA 4LY6A 4BZQA 1X6VA 3QXHA 2XTNA 5BN4A 2V7QA 2G1JA 4FMBB 4GMDA 4B3DA 2BBOA 1VPLA 3VNVA 2F9LA 3B85A 2GAOA 4XSHA 2QZ4A 1G7SA 4ON9A 4XTCS 4YMTA 3GJ0A 4CEHA 3D31A 2FWRA 2QSZA 2GDJA 2XB4A 1D6JA 1E9EA 1CJKC 2GNOA 3ZVLA 4ZIRB 3K0SA 1G17A 3R20A 4F92B 1B23P 2GA8A 1G8FA 2J0UB 2KBEA 1LVGA 4I1VA 2JDIA 4TMXA 1Z28A 5TARA 5GVSA 3RDPA 4RFVA 3ADBA 5HTKA 1XPUA 2WAYA 5KNCA 1XMJA 3UMRA 3X1YA 2J87A 3LWNA 1E32A 3CM0A 4M9ZA 1XEXA 5JJLA 2H16A 2C96A 4FMCF 2B92A 3MWKA 3SHFA 5TDHA 1Z6XA 2RCNA 4URWR 3QY0A 4Q1FA 2ZE7A 2YYZA 4Q00A 3R8FA 1SXJE 2JDID 2HCJB 1N0WA 3TR0A 4QBFA 1QF9A 2PH1A 3B7GA 2OG2A 2NG1A 2IUUA 3FB4A 4EUNA 1SZPA 4Q4JB 2JLQA 1E0JA 3VHLB 1Z6AA 1ZC3A 5FOTA 1XZQA 1KDRA 2VSOA 4POAA 4TMTA 3U2QA 821PA 4OHYA 2ZU0C 1G3RA 1E1RD 3ZS9A 4QOSA 3PCRB 3I5YA 2JJ2D 4NCHA 3VKGA 3KL4A 3IO5A 1DAKA 1DADA 1R0XA 2EWWA 2WSSD 3FMFA 2AD1A 2JLVA 2IXFA 2BC9A 3RNLA 1Q1EA 1QDEA 1KDTA 1OYWA 1OYYA 3C16C 4Q66C 5LB2A 2ODNA 2OFXA 1DTSA 5EE9A 3RC8A 3PENA 1IN4A 2CVFA 1ZCBA 2JASA 4KYUA 1ZIOA 3VR5A 4EQ6A 2GAAA 5DHAA 4W5WA 3K70B 2ZI6A 2JGNA 4TT3D 1GRRA 4H1UA 3BERA 1UDWA 1QHHB 2Q3MA 4GFDA 1LS1A 1Z0AA 4M1SA 3FKQA 3K0CA 4LWZA 5FUWA 5GVRA 3W8NA 2TMKA 3HR8A 5F9FA 3QG5A 4GP7A 1KY2A 1KJZA 1N6RA 4PANA 4BZXA 3VR1A 4IHQA 3KQNA 1E0AA 1DAFA 3ECCA 3VFDA 4DRZA 4BEJA 1QHGA 2ZI4A 3TAHA 1DE0A 1T3HA 5TXGA 2Q9BA 5JZVA 2IK8A 3ADKA 5LDDC 4NMMA 3K9NA 1F5NA 2VLIA 2HYIC 2RGDA 4C0AC 1SULA 3FMOB 4B2PA 1KTVA 5GJCA 1MO4A 2W58A 2W2XA 5CYOA 3AVUA 4ZV4A 3THWB 1E2MA 4DCVA 4B33A 3EZ7A 2GF9A 3OEEA 2GCOA 4MRNA 5EZ6B 1FQJA 2UKDA 5IT5A 1NN5A 2NO1A 3O8CA 2D62A 4ZCLA 2CL7X 1Z6TA 1J90A 3CH5A 1M7BA 2WJGA 2VPPA 1OW3B 2F6RA 1GL6A 2W6IA 5KPDA 3OZXA 3LBHA 4D4MA 4Y0VA 1OFTA 2O8EA 2NZJA 2Q6TA 4CF7A 4C7OB 4EPXA 2JLUA 3I8SA 2DCUA 3LAWA 4LHYA 5FTMA 2IWHA 3FGNA 3GCGA 1GKUB 4B3GA 2ZU6A 1HQYE 1GUAA 2VBCA 1CULC 3BH0A 3K0AA 1CIPA 2DWPA 2Q3HA 4NBSA 3QF7A 1IQPA 1KO8A 2EFDB 5EZ5A 4A0GA 2IT1A 1XRJA 4HAUA 1E9AA 2ZI5A 3FMIA 2FSHA 1OXSC 4O2LA 5E7IA 1T6NA 1W1WA 4RY2A 2VP6A 1RW4A 1LF0A 5HKKA 3LXRA 2AKYA 2CJWB 4G3XA 4OI0A 4RFSA 3ZDQA 3PJRA 4LCBA 3H4MA 1XD9A 3IEUA 1G6HA 3CWZA 2DFKB 2OBNA 2ZS7A 1Z0IA 4BASA 4LBVA 2BOVA 4TLCA 1KO1A 2IC5A 3AP2A 3CRVA 3AKYA 4GZLA 1TMKA 4PPFA 2ZEJA 3VR3A 2O8BB 5IHPA 2B7CA 3KXLA 1MRSA 5G3YA 4WOPA 3T61A 4CEIA 3ZLJA 1OB5A 2OAP1 4DDWA 1ELOA 5A4JA 1MABB 4LYFA 1PLKA 1P9NA 2IYXA 2XTZA 3VMFA 1YQTA 3T5DA 4AI6A 2IYWA 4RKFA 5KDLA 2Z0MA 1XTKA 1P6XA 3CRQA 1ZD9A 3WMFA 2XZOA 4O3MA 3CPHA 4PHGA 2HXSA 2A5JA 5EJEA 5DN6D 1W2HA 4N0DA 3AGPA 4NONA 1E2DA 1KI4A 4Q4AA 1FMJA 4QBGB 2RMKA 1Y63A 2J7PD 4AKGA 2ERYA 4BFXA 3H86A 4OJKA 3VQTA 1OXUA 4C0BA 4ZPXA 1XMSA 2AK2A 1FP6A 5A5GA 1D9ZA 4MYUA 3K0FA 1QHYA 1OIXA 1YZGA 5FFMA 3VX3A 3GEIA 2BKUA 1JR3A 2J7PA 4B6FA 4DLYA 3KKOA 5BQ5A 3CRMA 5EXTA 4HUQB 2G0NA 5ANRB 5GJVC 4Q1AA 5JJIA 2FFAA 3PEVA 1GL9B 4MA4A 3NBZC 1OKKA 2WWFA 4FCTA 4DLXA 4LJ8A 1UKVY 1GNPA 2WPDA 2PMKA 2FGJA 2V3CC 4TYNA 2J0QA 1Q0UA 3RSOA 5LBIA 4KSCA 3RHFA 1VHLA 3ZZUA 3SN6A 1XJQA 3AVVA 4JL5A 1QVRA 4A4DA 4C2TA 1YZNA 4CT5A 4PSVA 5KNBA 2VL7A 1AGRA 2H92A 4UXHA 1M2OB 3HPRA 5KNDA 2XZLA 3AF4A 1XPRA 4BLSA 4F4JA 1XZPA 4AYWA 4ZDIA 4IRUB 1E2KA 2WWIA 2XNDA 3AP3A 4BFWA 4C0HA 4F4IA 2PCLA 4ESHA 1FX0B 4ASUA 2N46A 4RZUA 2GZDA 3A4LA 3Q72A 3W3AA 3HP1A 2HJGA 2A3RA 3EZFA 4KV9A 1OH8A 1G291 1KSFX 5J4YA 4MRSA 1WF3A 1ZUHA 2YOGA 1NN1A 1OHHA 5DHFA 4ILEA 4RD4A 3SNHA 4B76A 1FW6A 1G8HA 4MDFA 1I4TD 3DMDA 5JI3E 4NZYA 3QXXA 4JMPA 4IDHA 4PTLA 3OEED 2FOLA 2OCYC 3SFZA 1JAIA 1RJ9A 4NYJR 5J5CA 1PVOA 4KCGA 5TV2A 4US0R 2G88A 1OT3A 1COWA 1UFQA 5HZKA 4DSOA 2GJSA 2R6AA 3AM1A 2DWQA 1X8JA 2RGNC 2PBRA 4WA7A 2KB0A 2CBZA 4I1OA 3RVBA 2QBYB 1DS6A 2IL1A 2IS6A 1NBMA 1T5LA 4X8OA 3B9QA 4OQLA 3P20A 4OHVA 1U90A 2B7BA 4KLNA 1T8TA 4FW9A 1TX4B 2BJVA 2FV8A 2AD5A 3B13B 3K9GA 1TU4A 1V43A 4AKIA 1LNZA 1F48A 4RZ3A 1ZBDA 3SOPA 3Q9LA 4MKFA 2QPTA 4GMXA 2MSCB 3LX5A 5FBWB 1RYFA 2YOFA 1NVVR 3GLHA 4GP6A 2ZRGA 3CUEF 4LI0A 2JLZA 1FQKA 5UKDA 4D26A 4Q1BA 1JQLB 3FTQA 3GLHB 4NPHA 1CJVC 3IQWA 3BE4A 1E79D 4M2LA 4UXIA 4JLVA 2YNMA 5FOSA 4ZI2A 3O8DA 1KJWA 1E2IA 3VU9B 3HJNA 5JEEA 4B3CA 1KO7A 2YWGA 2HJVA 4AURA 1XTJA 2ZSAA 5HZHA 2VIIA 5BW8A 2E1RA 3PIRA 4Q19A 3PEWA 3LVQE 3EASA 3SR0A 3EIQA 4IW3B 3TUIC 1VYVA 1XEXB 2PJZA 4BZPA 2GEDA 2O8FA 2QTFA 4TMVA 4JT4A 5FUVA 1AK2A 3BC1A 5DLQC 5EP4A 4E22A 3SU8A 4OK6A 5JWOA 5K8LA 4TLAA 1JR3D 2NO6A 4LHVA 1CEEA 1Q44A 2QRZA 4D4LA 1V5WA 3KTAA 1E2HA 4NYMQ 1E4YA 1SVMA 2FX3A 2RGBA 3CX6A 2ZETA 1TTTA 4GDFA 1W2GA 3AF2A 2XZPA 3CRRA 3ZIAD 1LV7A 4D2IA 2NZ8A 4P3YA 4LPSA 3RRNA 1Q20A 3CKLA 4IXNA 2QP3A 4MUAA 4DLZA 1TF7A 4UNSA 1LS6A 3K70C 5IRCD 4FXPA 1N6LA 4AG6A 3WP0A 3UMSA 5E7MA 2O8DA 2QENA 4DCTA 4KBFA 3LVRE 5KSYA 2YINC 4KFUA 4ABYA 4OK5A 2BIFA 2P5TB 2QM7A 1W0KA 1R7RA 2W0MA 621PA 1IJEA 2XXAB 3EA0A 2OV2A 2VHJA 4E03A 3K0EA 4P4SB 3F3YA 2QGZA 5H8WA 1UF9A 1AN0A 4JLMA 4IJMA 3GMTA 5J47A 1PJRA 3W3ZB 3DOFA 2XOKA 3GJ5A 1YVDA 3MUFA 4M9SA 2HYDA 3B78A 3CR7A 4RZXA 5FPTA 2RGCA 1ONBA 1LW7A 3Q5EA 4ARZA 221PA 721PA 2CCKA 1XTQA 2EWVA 4LRWA 1IY2A 2CLSA 4II7A 3DOEA 1RKBA 2Z83A 1E9CA 2C2HA 3E1SA 5FBQB 2WICA 2JJ8A 5H1YA 1L2TA 1M6NA 2QY9A 3HR7A 4PQRA 4RKEA 4FI3C 1VCOA 2IEZA 2CXXA 3R7WA 4XWKA 4XWAA 4D81A 2CHVA 4TLDA 3NBFA 4ZKDA 3GP8A 1ESNA 4DLRA 2XB2A 4EJSB 3QXCA 3GJ8A 2JJ1D 2BVNA 3BK7A 4L15A 3GLFE 2A7QA 1US8B 4NDZA 4UJ5A 2J41A 4XIGS 5CIWA 4KITB 5HE9A 2VO1A 1KIMA 3MWYW 2VHQA 5JS8A 4HLUC 2O8FB 4EAQA 4RZ2A 1NNEA 4E5UA 1SVWA 1Z08A 5FPKA 1Q21A 2IXEA 4TQUS 4L4UA 4V0LA 2IS4A 1ZM2A 4LBYA 3WYGA 4G5GA 1N0UA 4BWYA 1EK0A 4C2UA 5C1BA 3T1QA 4PX9A 1W4RA 4EDHA 2VEDA 2QU8A 4LPKA 2XJ9A 4Z1MD 1H8EA 3GQBA 1E1QA 1JAHA 4D4JA 3WNCA 2IS2A 1HY3A 5DE3A 3W34A 1MABA 1SVKA 3I8XA 3C41J 3QNUA 1Z29A 3CR8A 1A7JA 1BKDR 4OBEA 1N25A 1LTQA 4LX0A 1P4SA 2ZYWX 2HUPA 3EPHA 2BBWA 3BB3A 4OYHA 2IUSA 1FTSA 1SKQA 2XAUA 4B44A 2RAPA 1F2UB 4B43A 3LQQA 5EE1A 4HAZA 1S3GA 4LHXA 1N5IA 3RS3A 3TQCA 4AWXA 4TTQA 4BLOA 1YR6A 2YZ2A 4PR0A 1XCGB 2Z5FA 1XEWX 4XWOA 3FHTA 5GJBA 1KDOA 5FUXA 3OAAA 1C9KA 5TB5A 2ZSBA 1CR4A 3FVQA 2EFHB 4MYHA 4Q9KA 2QPAA 1KI1A 1ZW6A 2G9NA 3RS2A 3THXA 1DG1G 3RS7A 1U0JA 4M0LA 3OIWA 4IFBA 2WMNB 2EU8A 2F43B 1W36B 2AL7A 4QJ3A 1E2JA 1XD2A 2HXYA 1GRQA 3EA5A 1KK2A 4YXWA 2ZRFA 3EZ2A 1E98A 3BJIC 4DUGA 4B47A 1K5GA 4ZDWA 1YU9A 2ZIAA 5EUMA 3PEUA 4TMWA 1GITA 3W5IA 5SZIA 2BDTA 2CEAA 1UEJA 5JECA 2GF0A 1RIFA 3IIJA 1DO2A 4LJ4A 3EC1A 1PV4A 2JLWA 1DELA 3TNFA 4B2IA 1UBFA 2DFTA 4HZUA 1QHNA 3GFOA 2IEYA 4JLAA 2AKAB 2ZUBA 4V0OA 5IDVA 3W90A 2IX3A 1GP2A 4U5XA 2ZSEA 2Z6VA 3QBVA 4KU4A 2GTPA 2QAGC 4YDHB 1KMQA 1E2NA 5EP1A 3A1UA 4MRVA 4Q47A 1SVSA 2RGAA 4MGIR 4Z8YA 4YMUA 1X1RA 4JL6A 2P67A 5KDDA 2JIZA 4X8HA 2C9CA 4ARZB 1U99A 4A15A 4LJ6A 3ZJYA 2QQ0A 4C0SA 4V0MA 1WB9A 2BMDA 5JHHB 5CITA 1N6IA 2WJYA 1R10A 4AKEA 4FCWA 3GLIA 4TYQA 3U3KA 5H68A 2PMDA 2YWHA 2W00A 4XVRA 3TH5A 3AF0A 2QAJA 4KXFB 4WXPA 3QIAA 4G5QA 2ZE8A 3WNBA 3T15A 5JBQA 1OXVA 4P4TA 1CF4A 4KLZA 1VHTA 1II9A 4EPYA 1BYIA 4IVQA 4YMVA 1KDPA 1RE0A 3M4YA 4PSKA 1QHSA 1JNYA 1ZYUA 3T5GA 5EE0A 2KBFA 4WBSA 4DEXA 2A2ZA 1EFCA 3G82C 2J3EA 2O8CA 1QBKC 4NCJA 4DDTA 5DNYB 4V0NA 1FUUA 4N3NA 4JBYA 3OFND 1AS2A 2WKQA 5E7JA 1FFHA 5DSZA 5TVKA 4OKSA 4PFSA 3RABA 3AF3A 2PLFA 3H2YA 3N2EA 5CLLA 3MMPA 3O8BA 3C5CA 4A36A 1PLLA 5B64A 1KSJA 2BCGY 3PQCA 4BFSA 1XJCA 1EFRA 5FTLA 1NSTA 1U94A 5C4MA 3U3RA 4PZYA 3T06B 3CW2A 1AM4D 2OHFA 3A36A 4OK3A 1ANKA 4K46A 4TL7A 1NMZA 1ZUNB 1QG4A 4DZZA 2RGGA 4P33A 1YZUA 3OEHA 2OESA 1UKZA 3NVAA 4ZO4A 1FOEB 1Z0JA 3HU3A 1F2UA 2VP2A 5AUNB 4A8JB 4B3FX 1XBTA 1A4RA 3S1AB 5DI9A 1TEXA 4V0KA 3TSOA 2G1KA 3ND9A 3ND8A 4FMCB 3B60A 1E1QD 3I72A 1Z6GA 3OEHD 5B58C 1N6HA 1OKKD 2C78A 2KSQA 4QNRA 2GXAA 1I2DA 2BKEA 5B2ZA 3FKSA 4GT1A 1NJFA 4AK9A 1E4VA 3X1WA 2LKDA 4D4KA 2R6DA 4TMKA 4ERNA 4MYCA 5F2EA 5FOXA 3KTAB 1II8B 2WZQA 2JLRA 2WWHA 5HCIA 3C5HA 1BH2A 5AJVB 2GXSA 5DISB 1ZJ6A 5CM9C 3TAUA 3UK6A 4BGDA 5EXXA 2ZRDA 4NHOA 3ASZA 4LJYA 3KQLA 4EPTA 1FUKA 3UANA 4PZLA 4US2R 4KFTA 2OE2A 3U3JA 1HT1E 1S2MA 1JJVA 5BN5A 1ZMXA 5JEDA 1W5SA 2GCNA 4ASUD 1MR3F 2F1HA 3BB1A 1YHNA 2D7CA 1DBSA 2JLSA 1WA5A 1ZIPA 3IGFA 3N70A 1YRAA 2ANBA 4TT3A 4CEJB 4DKXA 5CDFA 4R7ZA 4IDQA 4FWTA 4NP6A 3JZMA 1CRPA 2OM2A 4CGZA 3NEJA 3Q5DA 2WHXA 4HLDA 2RH5A 4P4SA 1J8MF 1A5TA 2K5UA 3PUWA 2ZI3A 2R44A 2V1UA 1EESA 3F0TA 3RC3A 2ZTSA 2GJ8A 4LSGA 5FR1A 2V8OA 1OPXA 3Q85A 2IYVA 4JBXA 3P26A 4C7OA 5FPYA 3QBTA 3LD9A 3MD0A 3WRXC 4G5RA 4D0NA 1AQYA 4D82A 3TR5A 2ZR9A 2GILA 3BORA 3U7EB 4LV8B 1DAGA 1KKMA 1NVXQ 2IXGA 4OI2A 1E2GA 4K8OA 1NN3A 4HAXA 2OFWA 4RD2A 4JVSB 3EWSA 2PX0A 2QPOA 3H84A 1ZNWA 4M21A 4BFUA 3DVLA 2CNWA 1DEKA 2WV9A 1KSGA 4Q7MB 4PQFA 1KI6A 3OHMA 3ETLA 5AK0A 1N6PA 121PA 2A30A 2P5SA 4Q4HA 1MV5A 1EXMA 3AV0B 5FOVA 4LBWA 2YWEA 2WBLC 3BD9A 2IUTA 2IYZA 4XD7A 2ZRBA 1TF5A 5E95A 3A8TA 3CPEA 4E09A 2ZJ2A 3CH4B 1T3SA 4RD6A 2F1RA 2KI5A 1KKLA 1KI6B 2NQ2C 2P2LA 3AVOA 3C15C 1XF9A 1W4BA 2C95A 3WXMA 1KAOA 4M1YA 1HV8A 4MQBA 5C4GB 4AD8A 2F7SA 2ZJ5A 2P3SA 1QVAA 1Z63A 2FE4A 1NG1A 2ZS9A 3FYHA 1E2LA 1TQ2A 2WWWA 4RD0A 2W6JA 4DHEA 2ZREA 3I61A 2A5DA 1GNQA 3VR4A 4DBLC 2HLDD 3KQUA 1K6MA 2MSDB 3SEAA 3A37A 1UBGA 1W44A 3GFPA 2WTUA 2WSMA 1E3MA 4QHTA 1J70A 3KJIA 3AKCA 2HF9A 1QRAA 1SKYE 2ONKA 2WVJA 2W2VA 5AJZA 3ZZTA 2EVWX 4V02A 1MKYA 2GK6A 1GAJA 2VP4A 4RJLA 2OEPA 4FWIB 1TAGA 3HDTA 2WSSA 1P9WA 3QSYA 2FZ4A 1S8FA 1N5LA 1KMHB 2IF0A 4B3BA 1CP2A 2F43A 2QL6A 2XSZA 1AZSC 1M7HA 2FJUA 2P0EA 2X2EA 3AF1A 2AN9A 3LH5A 1NKSA 1Q1ZA 3CIOA 4JVNA 5SZJA 1XXHE 8OHMA 3THXB 2QT0A 4WZ6A 1KZGB 4ACAA 1J99A 4GNKA 4S35A 3UG7A 1U98A 1JXMA 5AJYA 2AX4A 2J9RA 2VF7A 4AYTA 2FNAA 4CEJA 4UKDA 3MSXA 3QKSA 1KSHA 5FBLB 2J0VA 4GL2A 2JEOA 3V4FA 4JLPA 3BIFA 2GJ9A 3UWKA 2ATXA 1LF5A 4Q4AB 4M53A 5FH9A 3QENA 1F6BA 4OI4A 4QJ5A 3IBYA 4UQOA 3EARA 3S1AA 1HH4A 3TMKA 5JLJA 4UNPA 1KO5A 3DKPA 1JXOA 3OE7A 1WMSA 2C98A 4HEJA 2XOKD 4N1AA 4DSTA 1AKEA 1P7CA 1Z47A 3VTKA 3MJRA 4UNQA 5D3QA 5CIQA 1G4AE 1IN8A 3CNLA 3D8BA 3RS5A 1J8YF 4ZCMA 5C46F 1L4YA 2ZYTX 1RVDA 1N6KA 2YV5A 4JL8A 5FTNA 2V1XA 3THWA 5CJ2A 2PCJA 1N6OA 1ZU5A 1KZ7B 1OIVA 1CJMA 4NU0A 4UJ3A 4IFEA 3WHKA 4MGKR 1ZM9A 1N6NA 2VP0A 1GFIA 4A82A 2ZUCA 2R2AA 3FFAA 4M9QA 1W0JD 2BBTA 3W6OA 5KSOA 2QNRA 4Q18A 1KO4A 2ZI9A 3QUSA 1H65A 3W6NA 1DAMA 1P9RA 4LV5B 4M1MA 1R5OA 4C0QC 2AWNA 2IYTA 2WJHA 1YR8A 2GVZC 4A6PA 2WIBA 1I4DD 2GCPA 1BOFA 4OQNA 1A82A 3U6BA 4LDJA 2A78A 1AJEA 2ZSDA 4WVFA 2GXUA 2VHTA 3R7WB 3HU2A 2PT7A 5FBVB 1AKYA 2AFIE 1M1YE 3CNNA 3A1TA 2C9OA 3PUYA 3WNDA 2J59A 4XD7D 4PZZA 5CYPA 1RRGA 1VCMA 2WOOA 4UXJA 4BFYA 1BO6A 3CZQA 1T0JB 3NG1A 1UPTA 2R8RA 3EIEA 4F93B 3QPWA 2JAQA 1U9IA 2QP4A 2RHDA 4CT4B 1G20E 4JLKA 5FL7D 1L7VC 3UXMA 4YXWD 1EFUA 3LRPA 1AS3A 1G7TA 2FEMA 3ZIAA 1WE2A 4Q1EA 4PPNA 4Q7KA 4OJQA 4I81A 4PC2A 3I62A 4TYWA 1RJ9B 1M34E 3AKEA 3QQ5A 4JS0A 1PUJA 2D4HA 3C14C 4GI7A 3T35A 3PUZA 3IEVA 4JSTA 4PHHA 2OSBA 1OH5A 5CB8A 4IOKA 1RRPA 5CM8B 1ZINA 3EPLA 3JVUA 2NO0A 4C3ZA 1GTVA 4L5BA 3X1XA 4G0NA 4Z54A 3ZVMA 1G5RA 3CBQA 4NE2A 2VP5A 1CBUA 2QTHA 1YR9A 2C03A 5TMPA 3QEOA 4R9UC 4A0RA 3SI7A 4PHFA 1G3MA 1ZNXA 1ZCAA 4XH9B 2RGXA 2I1VB 2QMHA 5JCZA 1E79A 5L3QB 3K09C 3C4JA 1JR3E 5AUPB 2WWGA 3RWOA 3V00A 1DARA 4M1TA 1M74A 3TUJC 3WBKA 1OFUX 1KI3A 3WP1B 1O87A 1S1MA 3REFA 2OUKA 3WMGA 2OAQ1 1TL7C 5SZHB 1Z3IX 2BM1A 5J4LA 5DYGA 2FDCA 1JEDA 2H57A 1VECA 5D3MB 1CR1A 1ZNZA 2IF2A 2MSEB 1Z06A 4JVLA 3ASYA 1RZ3A 2ZROA 5AJWA 4TN1A 4AKHA 4QGAA 1J2JA 1EFHA 1JJ7A 4TMZA 3I5XA 3QXSA 4YMWA 3HU1A 3UMFA 1GSIA 1T5IA 5KHOC 4FMDF 2OCAA 2L0XA 1JALA 3AVPA 2ZR7A 3HYRA 2GCOB 2BEKA 2O0JA 2RB4A 3GJXC 4RVCA 4XJXA 3KXIA 3I73A 1UKEA 1W36C 3Q3JB 1XFAA 2BEJA 1NJGA 3VR2A 2R9VA 5L8VA 4PAQA 1G6OA 2ORIA 3QKUA 2QMOA 4TL6A 4F91B 2FA9A 1K5DA 5CLQA 3SFVA 2ODBA 4LJ7A 5AUOB 2P6NA 2EFGA 3B6EA 2GZHA 3AVTA 4Q02A 4JLJA 3TW4A 3NWJA 2OCBA 1D2NA 2REBA 4PO8A 2A5GA 3R8CA 2GVDC 1NMYA 1G16A 2QA5A 1QZXA 3LXXA 4PXAA 3F5FA 4MGZR 5ELXA 1C1YA 1OV4A 2QG6A 2VF8A 2BMJA 4PC1A 2CK3D 3OFNA 3W9YA 1IY0A 3NH9A 4EQ6B 3ZD6A 1SQ5A 1F2TB 4R2IA 1IN7A 1N3BA 2ASEA 4C30A 1OFIA 2H1LA 2IHYA 3L0PA 1IAQA 1XMIA 1AA9A 1HT2E 3U6KA 1L8QA 1S9DA 1VKJA 5K8IA 5KPJA 3TJZA 5EE5B 1T8UA 4L8GA 2CL6X 3B1WA 2CJWA 3IIKA 3CNOA 1E2QA 1G9XA 3NDPA 1NF3A 1SXJD 3TBKA 2NPFA 4JLDA 4EKDA 4DVGA 2EFCB 2JA1A 2ORWA 2YWFA 4Q4JA 2H8KA 4JVMA 3R9IA 3U5ZB 3T1VA 4MKGA 1VCNA 1RYHA 3SJBA 2ZJ8A 2VHUA 1IOZA 4CW7A 1A1VA 3LLUA 1DAHA 1P72A 1RPZA 2MMGA 1SXJA 3UPUA 3AH8A 2BM0A 3U44A 2YHSA 3BFXA 4BFZA 4KAXA 1R6BX 1IHUA 2CLCX 3IILA 4TZ0A 4H9GA 3TUZC 3VKHA 3RYTC 4LC0A 1JQJC 2OFOA 4WZAE 4URVR 2YKGA 4HB4A 1SKYB 3SE0A 4GSYA 1IXZA 4LUCA 2QQEA 4Q01A 4LJ9A 1Q1BA 1S9HA 4HB0A 3OESA 3NHBA 4DCSA 1HURA 5KDOA 2B8TA 3P32A 4A9AA 3KFVA 1XEWY 3L0OA 1HTWA 3IIMA 2FPKA 2XITA 4Q5IA 5B30A 5CJPA 1KNQA 421PA 1WBDA 4LJ5A 3P1JA 4P4UA 4Z8XA 4TLBA 3KKQA 1MO6A 1P73A 2D3WA 1KY3A 1T9HA 3L0SA 1GDDA 4IDNA 4DIDA 3AEZA 3EW9A 4JKIA 1E6CA 3LW8A 4NYIR 3L8ZA 2FZLA 1OH6A 4A6XA 3A4MA 2WMOB 4PPGA 5JMTA 1XTIA 3P27A 5HE8A 4G01B 2BWJA 1Z0FA 1AS0A 1VG8A 1WDTA 4GRAA 2JCSA 1GVNB 1IM2A 5BXQC 2IYUA 1FPMA 1E9DA 1SHKA 2F1IA 4W7SA 2O52A 1D9XA 2ZQ5A 2ZYUX 4KHZA 1CR0A 1NY6A 4W5JA 5LB4A 1P2UA 2DR3A 1NLZA 1NVUQ 4QGHA 4DB4A 2GBLC 2NO7A 4MUBA 2ZVPX 1G21E 3SJZA 5AJXA 3RWMB 4U00A 1E0SA 2J46A 3KKMA 1E9BA 4LHWA 5HPYB 4IEIA 2NGRA 4QHSA 5JCPA 3FWYA 2WJVA 2QUZA 1P2VA 3B1ZA 4QNMA 5H70A 3R9WA 3RAPR 3T12A 4PO1A 1NKTA 2D74A 4I99A 2NIPA 3WRYC 4IOLA 2FH5B 3NH6A 3TE6A 3U7GA 2Y8EA 2LKCA 3SYNA 2REOA 3A4NA 4D80A 3A58B 4Y0AA 4WZBE 1G3UA 3GJ7A 4Q9HA 1KI9A 4B2LA 5DH9A 3THYB 5FUYA 2H17A 4QBIA 1AIPA 2C99A 4DT1B 1GRNA 3SYKA 2QMEA 3QKRA 4QGFA 4Q9JA 4LGMA 3L0IB 1NIPA 5L3RA 1AZTA 4IXMA 4N0EA 4ESVA 2CE7A 1NLYA 1TPZA 4HSEA 2QN6A 3QPVA 3AP1A 3K0AB 5EUQB 3H0KA 2ZAOA 1U81A 4JBWA 1RRCA 2OLKA 2CL0X 1MRNA 2ZRIA 2ZRMA 2NOAA 4EJSA 4D6PA 1DAIA 1XMVA 1UKYA 1KNXA 4LOAA 4CZ2A 2ODEA 1OJLA 2B21A 2PLRA 4TTRA 3HWSA 5L3SB 2X1VA 3D7MA 3SS8A 1EFRD 4X8LA 2HCBA 4ZDJA 2QBYA 1G41A 4IVRA 3NBXX 4LYAA 3W5JA 3GLGE 2UZIR 1VDZA 1WRBA 1NSFA 2W0SA 2GXQA 2AK3A 3QG1A 4B34A 4CYMA 4JLNA 1LB1B 1OXTA 1XXHB 2WKRA 1Q3HA 1HYQA 3QJYA 4WAUA 2PT5A 4C9BA 4HUTA 4KO8A 1VYUA 1Z22A 3ZVRA 2DHRA 1CJUC 2OXCA 2VHCA 3DDCA 4BEBA 2LCFA 2QORA 4HDCA 4TTPA 1YJ5A 2GJAA 3OIYA 3DEFA 2GEUA 4BLTA 3NBYC 1U8YA 2GK7A 1R2QA 5IK2D 5FOWA 1L4UA 1CRQA 2ZVQX 3B2EA 3GEEA 1KI8A 3DZDA 3TKLA 2ZI7A 2KE5A 2V6JA 3ZGXA 1PZNA 3Q7PA 4K81B 4TQ9A 4ZI3A 3K9LA 3GPLA 1H8HD 3P4YA 4ACBA 5L3SA 521PA 3QEJA 4AIIA 2V4ZA 3U44B 5DIFA 2CE2X 1GG2A 3EC2A 1R0WA 1DG3A 4G5SA 3FHCB 2FGKA 3MWJA 3M1IA 4JLOA 1T91A 3DM9B 5LD2C 1G8PA 3TGPA 5EP2A 4DUGD 4HDQB 2AHOA 1II8A 4JKYA 4JYBA 4JIMA 1N5KA 1UEIA 2FFQA 5DYIA 2E87A 2IS1A 2ORVA 2Q3FA 1QHHA 4Q03A 2RKOA 3OAAD 3ICEA 4NTZA 4O25A 1NVWQ 2VA8A 2DFLA 3DHWC 4FINA 2J7KA 4LV6A 4A8JA 2RGNA 5D3MA 3B1VA 1EWRA 2GESA 3KJGA 2BCJQ 1F2TA 1TF2A 2BV3A 3VU9A 1MO3A 2Q21A 5JFGA 4DLTA 2ZRKA 3BAFA 4IDOA 4C0KA 3CWQA 1HEIA 3Q8XB 4QG7A 4DWJA 4HDOB 4JZKA 3QVUA 2YC4C 2JATA 2A5FA 4QXAA 3KB2A 2JLYA 3GLIE 4P31A 2QROA 1T4GA 1ZNYA 2IYYA 4F38A 1OSNA 2OLJA 4QGGA 4R98A 1HA3A 3PR1A 4JT2A 3FPAA 4RCYA 3RRYA 1D2MA 3QE0A 4OL0A 1BYUA 4ITRC 2PX3A 1GIAA 4EFMA 4DIEA 2DYKA 4BFVA 1E2PA 4M22A 2ZRCA 4DLVA 2FEOA 5E4FA 3W8RA 1XTSA 4KODA 4IVPA 2VH5R 3KFXA 2Z4SA 1TQDA 4MGYR 5FI1B 2GEVA 1IN6A 3CO5A 2W6ID 1N5JA 2F9MA 2V7QD 5JSZB 1R8SA 2D7DA 1G3QA 3CX8A 3Q7QA 2FG5A 2P6RA 5DI3B 2OZEA 3BB4A 3LV8A 2C04A 1NY5A 3FDIA 5BYKA 4CEHB 2FFHA 2PEYA 4OQXA 4RFSB 3PXGA 1FTNA 1KI2A 5CK5A 3LW7A 5C18A 1II0A 2WM9B 3BH6A 2CLDX 4IKEA 2VRWA 2W6JD 3B1XA 4W5HA 2AR7A 3CF0A 2LWIA 3T1OA 1VCIA 4NL4H 2HLDA 5AUQA 3C7KA 1CU1A 5E3HA 1UM8A 2FFBA 3GD7A 3R9XA 4Q4HB 1OLOA 3CX7A 2VSXA 1D2EA 5C2JB 3NTUA 5FL3A 2BMEA 3BBPA 3RANA 2CCGA 5JHGB 2PL3A 1YZQA 1P61B 2B8WA 2DB3A 4TL9A 1SXJB 4WXRA 2ECKA 4YDSA 2PJRA 3PEYA 3U3MA 5SZKB 1XB2A 3TIFA 1YE8A 3X1DA 3MFYA 4EFLA 4G5OA 1KYIA 1OH7A 1EFTA 3EZ6A 1UJ2A 4S2EA 1O3YA 1D8TA 2X8AA 5BN3A 1RFLA 5FTKA 5HCNA 1KOFA 1IXSB 1KAGA 2G83A 2I4IA 3CZPA 3FKSD 1XEFA 1TADA 4AG5A 3AKDA 1S1CA 2QAGB 2GETA 2O5VA 4D0GA 4LYJA 5A0FA 4XVQA 2QI9C 1M7GA 4DCNA 3KDSE 4TWZA 5F9HA 4R2HA 2OBMA 3ZQJA 3IHLA 3BXZA 3O8RA 2HT6A 3ZVNA 2ZRPA 3EPKA 4HUQA 4M1OA 4EPWA 4F4CA 3TK1A 1U0LA 1CR2A 3I3SR 3QF4A 5KSZA 4QRHA 5EQTA 1T0HB 1FL9A 1ZP6A 1TQ6A 5G53C 5M04A 4NH0A 3FFBA 1G5PA 2QE7A 3FOZA 5BWMA 3CONA 3G0HA 4PHTA 1W5TA 2GBLA 4P32A 2J1LA 1UADA 4YONB 2X19A 4B48A 2ZXUA 4B32A 2F55A 3QKRB 4L9SA 1EGAA 2ZPTX 1G5TA 1JEEA 2GZAA 2EYQA 3GEHA 3RS4A 4FN5A 4PC6A 2QE7D 3FE2A 3U3OA 1XD2B 1P2TA 2KWIA 3U7FB 3OIUA 3LDAA 5CK4A 3L82B 1YRBA 4GZMA 4JSYA 2VQSA 2WPDD 1KJYA 3QKSB 1X8KA 1E2FA 3KZ1E 3U4QA 1RC8A 5EE3A 2EYUA 3CLVA 3GFTA 4QHYA 3NXSA 2PZGA 4HAYA 4CVNA 3OE7D 5FPHA 4XSGA 1E94E 3TW8B 1F3OA 1SHZA 4Q21A 1VG0B 3EPJA 2F3RA 2PZEA 3BGWA 3DL0A 3UWOA 5FI0B 4L16A 3K70D 4M8NE 4B74A 5F98A 3EXAA 1R5BA 4US1R 2QGNA 2EW1A 1N2CE 1J7KA 3IUYA 1CKEA 4GOXA 1G4UR 1K8RA 1W4CA 4WIAA 1TNDA 4URUR 1FZQA 3LQRA 4M4SA 5J4VA 4JYCA 3WMEA 4QM7A 1XDBA 5AWFC 2NPIA 4MYTA 4TLEA 2VP9A 1NP6A 5G40A 4Q7JB 1VIAA 2GHIA 4KJZA 3GLFA 4KSBA 3VX4A 3IKJA 4PPQA 4KBGA 4V0ME 1OHHD 2CVHA 3BFKA 4L9WA 1NVVQ 2ODWA 5JI2E 3TSZA 1NLFA 4JJZA 4A0HA 4OHZA 1U9IC 1IY1A 1VTKA 3EZ9A 4Q1CA 2ZRJA 5GJWC 2QT1A 4DDUA 3P4XA 5FPSA 4D25A 5F3WB 2HDNB 5EP3A 2R6CA 2AXPA 2ZJYA 4TSFD 4MH0R 4OHXA 3T34A 4DSNA 5HR5A 4DSUA 4IOJA 4LJAA 3FMPB 3K0CC 1OFHA 3A6PC 2CNWD 1Z2AA 1EX6A 2WOJA 4P0TA 2SHKA 4QJ4A 3G5UA 4QC2A 1NRJB 4NCKA 4AYXA 1E2EA 1NBMD 2ATVA 5HKKD 1OF1A 4I4LA 3AVQA 3K1JA 5P21A 3J81k 1NBME 2A9KA 5FL7A 3ZH9B 1G64A 3BOSA 3E5HA 1P60A 3LA6A 4DB2A 3A1WA 4I1UA 1S4QA 2VSFA 2UZ3A 1GKYA 2OT3B 4XTRA 5KYKA 4W9MC 5FTJA 2ONJA 2BMFA 5LPNA 4M9XA 1VYTA 3GLIB 3V9PA 3AVXA 3GLHE 1AGPA 3WYFA 1PLJA 3K9HA 2O8CB 4ZCIA 3UIEA 3IPYA 2QAGA 1A2KC 2IA5A 4NKRA 1KI7A 4Z51A 4Q7LA 5L3VA 4LBZA 4BLQA 1NIJA 1TU3A 2O0HA 3NKVA 3SC3A 2FSGA 2ZRLA 3EAQA 1WP9A 4YMSA 1M8PA 1SGWA 4M1WA 1DO0A 1G7CA 4QL3A 1YZKA 2XEXA 2HEIA 3TSWA 4A2PA 2PEZA 2CMKA 2ZJAA 2V9PA 1XNJA 3A1SA 2WIAA 3BRWD 4EPRA 1NN0A 5IF9A 5LD2B 1Z83A 3KKNA 4PSAA 3SBEA 3NHAA 2J45A 3RRZA 3VKWA 2XSZD 4BECA 2ZRHA 3AUYA 1RRFA 1PUIA 3GJ6A 1W36D 2R6GA 1XWIA 4Q48A 5G3ZA 1G18A 1R4AA 4MRRA 2P6UA 4A1FA 3KQHA 1C4OA 3QI2A 4A8JC 2YOHA 3AGQA 2EQBA 2UVQA 4U02A 1KK1A 3N2IA 2ZR0A 3QVVA 3HYTA 2REXB 3QOFA 1ZD8A 3C8UA 3B82A 1CTQA 1QHXA 1MO5A 2W83A 3RRMA 3B1YA 1LY1A 2C5LA 4I1SA 1W7AA 4RD1A 1KHTA 4IEEA 4BE7B 1ZRHA 4CRWB 1ZU4A 4HZUB 1JECA 2Z43A 3O47A 1XJ0A 2WJJA 3E2IA 1OXXK 1TQ4A 2FF7A 1HUQA 2C8VA 4OQMA 5CDFE 3U4QB 2ANCA 1F60A 4LYHA 4OQFA 1SVLA 4XVUA 4OHWA 4YC7A 2NTYC 2FU5C 4MKIA 3KJEA 2J5XA 4TZ6A 3SJAA 3IPXA 3TVDA 1WCV1 1NMXA 3SDZA 2IWRA 4BPBA 2ZE6A 3MAAC 1ZM3A 4NYJQ 5EXSA 1VG9B 4GOJA 4DEYA 2ZANA 1COWD 4C4PA 1Z07A 4JLBA 3CB4A 5G41A 3ZD7A 2YC2C 1Q3TA 4RD3A 1LFDB 1W0JA 2QEQA 1HQCA 3BWDD 3I32A 1YZTA 2G77B 3SZRA 4DLWA 2AWOA 4KFRA 1SVIA 1GKIA 3MLEA 3ADCA 2R65A 4HB2A 1S0UA 3KKPA 1S96A 1VG1A 4FMDB 1JPJA 3RLFA 6Q21A 1R0YA 5KUTA 3KXKA 3PFIA 3SQXA 1R0ZA 4FCVA 2O8BA 4NCIA 1HE1C 3TLXA 1W47A 2CK3A 4HLUA 5JRJA 3SYLA 1HE8B 2PZFA 4MRPA 4B71A 4YQFA 3PUVA 1JI0A 2Q0HA 2R62A 3VHXA 2IYQA 2A5YB 3DM5A 4UNNA 1Z5ZA 3IHWA 1IONA 1EG7A 2ZYVX 2O0KA 3DKVA 3PG5A 1US8A 2H18A 1N0VC 3D3QA 4B3XA 2D2FA 1DPFA 3I4LA 1E9FA 3KX2A 3ICQB 1NI3A 4B75A 2QM8A 3AUXA 3WY9A 2CDNA 3LFUA 1QHIA 4XOIA 2QMUA 2GJKA 2XJ4A 4C0LA 2ZUDA 2ZJOA 3GJ3A 2XX3A 4A2QA 3CRW1 4GOKA 1FNMA 2WWXA 4J0QA 1G8YA 2IYSA 4KFSA 2G6BA 1H8ED 2O8EB 3ZZ0A 3MCAA 4PO9A 4YLGA 2NO9A 2OO7A 1W4AA 1Q1QA 1XCMA 3NC0C 4QKQA 1DVRA 1Z6YA 4DCUA 2ZS8A 1TEVA 3X1ZA 1Z2CA 1OE0A 1BIFA 4MKHA 3U7HB 2CCJA 3K09A 3KB1A 3LBIA 5KU1A 4RSGA 1P62B 2NMVA 1A2BA 4BLRA 2FN4A 3LY5A 2IYLD 1VIYA 3REGA 1B0UA 3TVTA 4GPTA 3SJCA 3QF4B 3AVWA 2FSFA 1JPNA 4M1KA 4Q1DA 4NYIQ 3E70C 3NIBA 1TUIA 3EG5A 4KYIB 4TQAA 4ZKEA 4NCNA 1JBKA 1KK0A 3MWLA 1IBRA 4O0MA 2X77A 4FIDA 5DN6A 4NYMR 4PQYA 5CB6A 1UDXA 1UAAA 3LNCA 1ESMA 2ZSFA 3LO5A 1BMFA 2IBMA 1ZM4A 2G0TA 5FR2A 1VMAA 1P3JA 1WXQA 4ZDKA 3VNUA 4MITA 1JR6A 2BJWA 1YR7A 2WKPA 2XNSA 2FSIA 2RGEA 1Q12A 1R8QA 3KJHA 2D06A 2ZAMA 2Q9CA 2ZITA 3GJ4A 3JVVA 2XGJA 4LZZA 4BFTA 1U2RA 2ERXA 1OB2A 4WW0A 3B8HA 5KTYA 1E9RA 1AQUA 3K53A 2N1BA 2BHRA 2JIZD 2ZRAA 2OCPA 2ZRNA 4D0LB 4HATA 3I1FA 5KSPA 3LLMA 1CJTC 2OILA 4UNRA 4DC9A 3U60B 2G3YA 2GWHA 1XP8A 2YJTD 3NC1C 3DO6A 2CHQA 1EX7A 2Z4RA 3QPUA 1IXRC 1I4LD 2H5EA 2J0UA 3A1VA 1XPOA 5KO2A 4DT1A 3L8YA 4HLQB 3LBNA 1XD8A 3OIVA 3SHWA 1XTRA 2XTMA 4KVGA 1W49A 1I2MA 3JZAA 5DI3A 5DO9A 2WWYA 4AC9A 2JJ1A 2XNDD 4EIWA 2ZJZA 2C77A 3WYAA 1IJFA 1Q57A 2AFHE 4JJKA 1G1MA 5JSZA 2IW3A 5BYJA 1OIWA 4V03A 3RS0A 3GLFB 3BS4A 3M0EA 1UBEA 3L2OB 1IN5A 3ONWA 3GLGB 5KOYA 1WBBA 1U8ZA 4LHZA 4U7DA 4H1VA 1W46A 2BBSA 4A2WA 4TYPA 2ZJBA 4BLPA 3N5CA 4O2RA 4DDVA 1CXZA 2N42A 4DLUA 3WHLA 1P5ZB 1KGDA 1FMLA 3DMNA 3PV0A 1KK3A 3PVSA 3KQKA 3WBJA 3VR6A 1NL3A 1KMHA 3RSLA 1W48A 1YZLA 5J40A 3ZQ6A 1ZM7A 3TQFA 2OBLA 1X1SA 5IK2A 2FPMA 3PITA 1DAEA 4IOMA 1UBCA 2DWOA 4E07A 1XX6A 1ZC4A 1R5NA 1SXJC 4CEIB 3THOA 1ZUIA 3IQXA 1H8HA 1X86B 2C9YA 4EFNA 4URZR 2HV8A 2JJ2A 3CPJB 1CS4C 4HZIA 4OI1A 3F8TA 1GL7A 2H7VA 2J0SA 4IDPA 4BRUA 1BS1A 3M6AA 3TRFA 3KUCA 4HI0E 4BRWA 3DZ8A 3QXJA 2WJIA 4AY2A 1ODFA 1MOZA 2DPXA 1G19A 4HAWA 1XXHA 5L3QA 1CLUA 1TUEA 1Z8FA 1D5CA 3B5JA 4Z1MA 4F7WA 2ZM5A 1XCPA 3MJHA 2DBYA 4QBHA 5K8UA 5JWHA 1JB1A 3NEYA 4QFMA 3L43A 1NG9A 2R6FA 2W2TA 1ZD1A 5EXPA 1P2SA 2QTVB 4G1UC 2FMXA 2V54A 2D2EA 4X8MA 4MDEA 4HLCA 4TL8A 4Q9IA 1GM5A 5J4KA 2V6IA 2F3TA 3CF2A 4BUJA 4CDGA 1Z0DA 1G8GA 2FPLA 4HB3A 1BMFD 1E1RA 4EPVA 2VTKA 1G7RA 1X3SA 1X8LA 3EWAA 3K0FB 2AXNA 4B35A 1GZSA 2RHMA 4PC3A 4DJTA 3IDQA 3T1TA 2I3BA 3VAAA 3SQWA 3AB3A 1E96A 4KVAA 4PC7A 2CHGA 4KI0A 3U61B 2QRNA 2KJQA
chains in the Genus database with same CATH superfamily
3NDBB 3ADDA 4GF5A 2O8DB 2QQ5A 1JUDA 3PVCA 1YR1A 1FTYA 4FD2A 5E4YA 1YA4A 1NAHA 4KQCA 4K9MA 2JLXA 1YVPA 2I4LA 3GP3A 1MH1A 4HGPA 2O3TA 3DE6X 5LBUA 3KKLA 4PAMA 1ZVQA 3ADOA 5LP6C 3N0XA 5GADl 5JJKA 5CEFA 4DC0A 3QMWA 5B12A 5JRZA 1YTLA 2XZTA 3EIHA 5JSKA 4Q4LA 4KQFA 1T3LA 2OK7A 3MG9A 4L50A 2EFEB 4GOND 4HAVA 3V34A 3W6PA 4I4TB 5DHPA 3Q8WA 5FBRB 3T3GA 3ZCRA 3U19A 5DM60 1MT0A 1DL5A 1GTMA 1EK1A 1OX4B 1Z8DA 2MSLA 1QH1A 2G8NA 3E0QA 3FWPA 1NR1A 3I92A 3PF9A 4NBLA 2OXRA 4RCZA 3WJ1A 2HR1A 1TECE 1AGYA 2WTNA 4EG7A 1DUVG 1YRHA 7REQA 4A92A 3L77A 4BVAA 1GILA 3DPUA 3M3DA 3UGQA 3FPCA 5JAOA 4PAOA 2O1EA 5FOUA 4HF7A 2DUUA 4E2YA 4HNUA 4PY2A 5TMDA 1RC0A 5CB4F 1T25A 4TV8A 1Z37A 1ACLA 5DBEX 1WZUA 5A4DA 3B9PA 3CZCA 5FUBA 1RWOA 4PE5B 1YK0A 2HT1A 3OLYA 4QDZA 2DPMA 2DZDA 2E9SA 3TS1A 2JBHA 4E3WA 2PD4A 4HYYA 1SQGA 5CUQA 5TY0A 1RI4A 2IZ1A 2H08A 2QLMA 1GNTA 4I6JA 1ZAKA 2ATIA 2WU4A 3I45A 3IP9A 2F3UA 2ID9A 2K2WA 1GKLA 3ND6A 4UZEA 5DSXA 3ZY3A 2VZLA 1RWXA 3BFVA 3UKDA 3RAJA 2V55B 1N36B 2DFNA 2IEBA 1Q0SA 2HU7A 1J42A 2OD7A 3UVEA 5C7IO 5EIXA 2HZBA 4ZT5A 2EJBA 2P65A 1XL1A 1P75A 2ZE5A 2I62A 1YKSA 4UM8B 1SIBE 4BMCA 4UE2A 4ZU1X 4AO6A 4NU5A 4EJSC 4YN3A 3D9QX 3OF5A 4U3JB 1PWYE 4C6HA 4Z7NB 2XVXA 3KUDA 2WAXA 5LQSA 1P39A 3VC2A 4R54A 4NOKA 4BAUA 2Y67A 3L1HA 5BN4A 4DR1B 2BRUA 4GMDA 5C1IA 4RA6B 4ENVA 4LK3A 3U7HB 1VPLA 2QRJA 1QPZA 2F9LA 1RWKA 1RQPA 4XTCS 4BC1A 4MO2A 5ALKA 3D31A 1G66A 3JASB 2FN7A 3KJNA 2FPIB 4DBVO 1I3LA 4E94A 3SEZA 4E5NA 2GNOA 1C9YA 3ZOKA 2GBGA 1HFEL 3GXBA 4EAAA 2J0UB 4I1VA 2ZBPA 4IDBA 5GVSA 1LRLA 4JDUA 4YEDA 4OGKA 2A9QA 1G59A 5EJMA 4KE8A 4D9GA 9LDBA 3RVLA 2O5RA 1U7DA 4FX2A 4M9ZA 1UZUA 2C7PA 2C96A 3UQYS 2B92A 3MWKA 3DE7X 3CEJA 5L40A 2CGEA 5CNIA 1H2BA 4UBLA 1CY2A 1XRRA 3L7CA 3TR6A 3QY0A 1MAAA 9ABPA 2ZE7A 2YYZA 4O2BF 3KOXA 3O93A 4GYJA 3II6X 4QEZA 1A4IA 4I1YA 1MP0A 5BV7A 3K05A 1J09A 2IUUA 1VJ1A 3IVXA 1SZPA 1Y80A 1IXKA 4Q4JB 2JLQA 4N6GA 5CX1B 1K4MA 1Z6AA 1ZC3A 4L07A 5FOTA 4UVEA 2YXPX 3QUAA 1E1RD 1KRHA 2OCLA 1YL6A 3PCRB 3VR5D 5AVYA 5K20A 4IICA 3QX8A 1ZONA 3L7NA 1DAKA 2WSSD 1R0XA 2VJMB 1Q1EA 5CH5A 1FY2A 1KDTA 2W71A 5LB2A 1Y98A 3QU2A 5LXTA 1U0OC 3PQ4A 1AURA 1W88A 4QGSA 3RC8A 3DFIA 1OWPA 1QYXA 2CVFA 3OPYA 3K30A 3PUHA 4O4IF 5AFSA 5KVAA 3QFRA 2DQZA 1KC3A 4KO2S 4WVLA 1C5KA 1MB4A 1PAUA 4G07A 4W5WA 3TEFA 4H1UA 4PXYA 3ABIA 3I1JA 4R7GA 1LS1A 1Z0AA 2PVPA 1VKNA 4LWZA 3QNMA 2C4MA 3D1LA 2TMKA 3DV0A 4UATA 4RDXA 5F9FA 2RAFA 2GN2A 4AZVA 5C31A 1T2VA 1B2RA 2XUIA 1DAFA 3Q98A 2X0DA 3L4BA 2PMCA 2XCUA 4QOFA 4ZRMA 3BKWA 1I4WA 1J2RA 1X2BA 2Q9BA 4JUBA 4J3JA 1NQAO 3I05A 1HEYA 5A71A 2AOUB 1P1KA 3OSZA 2QJTA 3UV6A 5BSEA 4HRYA 4RGVA 1B43A 1SO8A 2WZCA 1T5OA 5EXEA 1YJXA 1AG9A 1XLUA 2RKWA 1C3JA 1KTVA 1VJ0A 4B2PA 3Q9SA 5JSHA 2JD1A 1MO4A 2W2XA 3ITNA 4P4GA 5CYOA 4ZV4A 3UMYA 1E2MA 3I9V6 1FE8A 1LPMA 5GQSA 2VQ6A 2AYXA 5IG2A 2GF9A 1DV2A 1Z9BA 2VDLB 2GCOA 3CZ9A 3BJZA 4MRNA 5EZ6B 4E6PA 5FEMA 4M86A 2QLNA 5U4QA 5JLAA 2QTCA 3AUTA 2D62A 4K9PA 3O8CA 3A6KA 1TJNA 1YGPA 2MHCA 3DS8A 3HJCA 2CL7X 4G8BA 1Z6TA 2NYUA 3AZPA 1S3IA 1ODKA 2B34A 4G4SP 3IPCA 3F5MA 5EKTA 5AW3A 4Y0VA 1OFTA 3M7IA 3HVJA 1KQGA 2NZJA 4PLTA 3ZGZA 3LS2A 4XYMA 3P9XA 4EPXA 5AJHA 1HTBA 2O1WA 3I8SA 4QAQA 4RJJA 4EGJA 4EHHA 3KKKA 4L73A 2ZT7A 2FVXA 2ZU6A 1RE1A 3EMVA 2VBCA 3T1TA 3DUWA 4E1AA 3M3PA 3K0AA 1XZ8A 2Q3HA 2I6TA 4KFCA 4B0PA 3QF7A 4BNVA 1FW8A 1IQPA 2EX1A 3MK31 2LIVA 3W9UA 3SLRA 2HCTA 1N2JA 4A0GA 1XRJA 3KE8A 2YJ5A 2ZULA 3E6AA 5A0TA 3GR6A 1OZGA 2I6GA 2NSHA 1VLMA 1ADCA 5E7IA 1T6NA 3ZBPA 2BGRA 2ZSJA 4CTNA 3GELA 4BZZA 4OQQA 3LXRA 4UUPA 4FBGA 4PYJA 2CJWB 3OLCX 4RSRA 4LEIA 4EEXA 3A11A 1INLA 1DC6A 3VR6H 5C1PA 2OBNA 4WFKA 5BT8A 5DWVA 1T29A 2PUGA 2CLOB 1Z5PA 4BV3A 3JALB 4F5ZA 4K6KA 1GAXA 4PPFA 2DM6A 3VPDA 1AMUA 4KR3A 1MJFA 1RWMA 2FW6A 5C8YA 5GV7A 3L6BA 3LYLA 3C3BA 1PQWA 3D8RA 3FYUB 1E59A 3JW8A 3CZ5A 2V7GA 4ZOQI 1W73A 4CEIA 5A4JA 1O97C 1X0XA 1Q95A 4RKYA 4C2BA 4E1BA 5LQRA 5DNAA 5A9SB 2Z30A 5K4HA 1XWWA 1YQTA 1BU5A 1CY7A 2A0FA 3C3WA 3LOPA 3L6RA 2FMTA 3Q7SA 4EHKA 5BR8B 1XTKA 1KIFA 2HSGA 3FWZA 4IF6A 2QTNA 1SUAA 2PZLA 4YAJA 3NPAA 2EQ5A 3X3HA 4HBGA 1ZD9A 2W2KA 2DTEA 4PHGA 4DQ0A 5C1OA 1I7PA 3KPVA 4ENSA 1KI4A 4G81A 4MV1A 1SU7A 1QC5A 1BGVA 1EX9A 4GXRA 4QBGB 4BKMA 1RHKA 2RMKA 4CLEA 2J7PD 3IP5A 3H86A 1XNGA 4LJSA 4BO4A 4C08A 1UXGA 3JR3A 2DBZA 4C0BA 4ZPXA 1R0RE 3HYSA 3M6IA 1L1QA 4IZ6A 1FP6A 4KWHA 1VE5A 3P5SA 4D9HA 4IUCS 4DLBA 3T5CA 2PVCA 3IAS6 4QD3A 3FNHA 3SD7A 4DHWA 1U5AA 1CLEA 5LQUA 5BY2A 1TIBA 2EJTA 1BHO1 1PKXA 2MYPA 3ESBA 1A9TA 4B6FA 1NUUA 3K5PA 1E4EA 1ZJ4A 5EXTA 2G0NA 1DDOA 1T35A 3FFTA 4ONEA 5DCLA 5ANRB 5IN5A 1DBVO 1GQ2A 2FFAA 1GL9B 1X70A 3NBZC 4MYDA 4R1TA 1OKKA 4FCTA 4RIFA 2HA3A 1IC6A 1UKVY 1XA4A 3CCBA 5DX0A 3AJRA 3C1TA 4JFAA 2PMKA 2FGJA 2V3CC 4TYNA 3HH8A 1Q0UA 1J0AA 1Q92A 1ZKMA 3RSOA 4DR7B 4KSCA 4J29A 4ZQEA 1F14A 1JNXX 3SN6A 3WLFA 1SCKA 1IVSA 2I80A 5LKAA 4YIHA 3GLTA 1N5RA 3L8DA 1THGA 1UOOA 3EHEA 4AJHA 2W6ZA 2LZ0A 3DFKA 5I3CA 3THSA 2HMWA 4ZAWA 2NZUG 4ETMA 3QTTA 5G0WA 4WLEA 4N5LA 4UXHA 5HGXA 1N2CA 3HPRA 4Z3DA 2XZLA 3FCEA 2DG2A 3NZEA 4AYWA 3E7XA 3H5WA 4ZDIA 3ZEAA 4BFWA 2GD2A 4EO9A 2HSEA 4WBNA 1FX0B 4ASUA 3HVKA 2HA4A 5JNTA 3QW2A 2N46A 2GZDA 3A4LA 3Q72A 3ZCTA 5IN4A 2VN8A 4JI3B 3UO8B 3TRHA 3UQZA 3G0OA 4ENRA 4KV9A 2PD6A 3B6JA 3H99A 3CF4A 4HTFB 1AKUA 4NATA 4CM6A 1F12A 5K0BA 3VU0A 4Q93A 1NN1A 1TC1A 4F96A 1W1UA 2C4UA 2Z1MA 3PHCA 2YWRA 3BILA 3RV3A 3SNHA 1P3DA 2C54A 2JAHA 3NU1A 1MC4A 3IAAA 3SICE 4Z9BA 4NZYA 5I8WA 3QXXA 1LC0A 4JMPA 1JMYA 3HLTA 1RYDA 3OEED 4HFNA 3UJ9A 4KQ6A 3VU1A 2WF7A 2BF7A 2OCYC 4IWNA 2ZB3A 3SFZA 3WA7A 3AUKA 4N7BA 4F1KA 1PVOA 2WTEA 4F86A 2XDQA 4Q6WA 4RTQA 1K89A 5HZKA 2DBRA 2QDXA 2FZCA 2FPRA 3L18A 3WL6A 5JXJA 3AM1A 1PF7E 2CXOA 2QTLA 4FK8A 4RQUA 3TIXB 3EFOB 4YRAA 4WA7A 2KB0A 3C3JA 4I1OA 3RVBA 1PFYA 1WMAA 1VI2A 3QW4B 2DC1A 1NBMA 3I76A 1T5LA 4X8OA 3BSWA 3I9FA 1FDOA 4IJVA 3PFCA 3P20A 2PWYA 1ZL0A 2QJOA 5CNKA 2OD2A 4EGSA 5JS1A 2BJVA 2DFPA 1VHJA 2AD5A 2P91A 3B13B 4BDSA 4GUAA 4EI9A 1CB0A 3F47A 3JAKA 3SX4A 3VU8A 5LJIA 3BUSA 3ZWYA 3E5MA 1ISJA 3LCRA 1QGZA 3TOXA 3LX5A 1RYFA 4LTNA 2YOFA 3QX7A 1EP3B 3G2QA 4HXEB 3AHGA 1W30A 2HJWA 3GLHA 3VR4H 4BVFA 2AJ8A 3V1MA 1EJ2A 2XQIA 4WZAB 5UKDA 3DC2A 5KTRA 4NPHA 2PU5A 1B1AA 1CJVC 1QK5A 4ZI2A 1H2AS 4JLVA 2PUJA 1WV1A 2P2DA 2G5GX 2YWGA 3O4RA 4LXUA 3LCMA 1FYFA 4EGAA 2YXNA 1P77A 3MNFA 2VIIA 3GAAA 4KMOA 5AVVA 3H5OA 3PEWA 5BN4B 1SVUA 3VR3D 4ZI7A 2CV0A 1BAPA 1LPPA 2KLBA 3SR0A 3GDGA 3OT5A 1OTYA 4W8OA 1VYVA 1X7YA 1JS1X 1XEXB 2PJZA 2I6FA 3NTRA 5KTMA 3EGDA 2Q99A 2QTFA 4TMVA 2HKIA 3UMJA 4C0XA 2W5UA 5CH3A 3RAGA 1QYIA 3UXYA 1JX6A 5K0FA 1CEEA 3TTUA 4LFBB 3TCXB 4NYMQ 1PUXA 1P29A 1OWLA 1P7YA 2NQ8A 4CM7A 4KNYA 3BMQB 3G2PA 3GT0A 1KBOA 3B48A 1TTTA 1U2QA 1W5FA 2DU8A 4YRTA 4BTEA 1LDBA 1RXIA 3D02A 4JUIA 1W2GA 2V9ZA 1NJ2A 3G1TA 2XHEA 4LQLA 4TSKA 1O4VA 5FUMA 3ZIAD 1LV7A 4I4CA 2NZ8A 4P3YA 4OIFA 2FPOA 3ZGYA 1Q20A 3CKLA 3ZR4B 5CAEB 4N41A 4KX5A 4YT5A 2QP3A 2QSJA 1QIFA 1LS6A 1Q6YA 4PPYA 2QLBA 4TV8B 4QPDA 4AG6A 3KVVA 3WP0A 4IRMA 5L95A 1M2NA 2JGMA 2O8DA 4KVFA 1DC8A 3IDAA 4NABA 5KCZA 3QVGA 4YUWA 1NXSA 4XPIB 2YINC 4GHWA 2OQVA 1CUGA 1RNLA 3HBAA 1AKTA 2FPXA 4OK5A 2C4KA 1A97A 3R3YA 2F2TA 2QM7A 1UK9A 4YYEA 1IG0A 4K9OA 4FEEA 2BRUC 4JJAA 1W35A 2NADA 4RORA 1YAHA 3ZXYA 1FRQA 4NZ9A 2VPXA 3RK0A 1JDUA 2VHJA 3SLGA 2VJAA 4G0XA 2RAVA 3QMVA 1XP5A 2QGZA 1J2EA 2R86A 4Q15A 5AT1A 5H8WA 1AN0A 3CCCA 4CQMA 2ONCA 4IJMA 1PJRA 3AUSA 4QYTA 2BHTA 2EDCA 2XOKA 1YVDA 3MUFA 3T7SA 3B78A 3GU3A 1O4WA 4GWGA 4YJDA 2IIPA 5DULA 3U56A 3C3KA 2H9YA 2H2HA 4N76A 4F5DA 1W5EA 1QIIA 1ATIA 3JATA 3QYPA 3N7TA 1ZXBA 4ARZA 4TXHA 721PA 4FT2A 1XTQA 4BCCA 1I6MA 1ZLYA 5BN5B 1IY2A 1SHUX 2ZBRA 1XZNA 4G0OA 2B99A 1E9CA 2C2HA 2FUEA 2IQ5A 2V03A 3INYA 3DCNA 4MVJH 5FBQB 4NBRA 1GAQA 5IJWA 3G0IA 2QY9A 2JFBA 3A04A 3HR7A 4RF4A 4Z4CA 1OILA 1SH7A 1VCOA 2I29A 2CXXA 4KDEA 1PP4A 4TM7A 3S4YA 3EIFA 3OFSA 3U9SA 3O4VA 3R7AA 1NTRA 3GOQA 2R1VA 4FC7A 4RLQA 4ZKDA 3GP8A 2RGUA 4H7KA 1EFDN 3D54D 3IIIA 1XDDA 4L72A 4UE6A 4WK0B 4Z3KA 5CB4A 4CMBA 4XCXA 4LHSA 2AB0A 1K97A 1Q5PA 1US8B 4NDZA 4TSRA 4XIGS 3OURA 3LPNA 5CIWA 2YZNA 3MWYW 2VHQA 4GM0A 4MWEA 2GLXA 3I37X 3X1MA 3HVHA 4B6JA 3KRTA 3OE1A 1A5BB 1JG3A 3VO2A 1SVWA 1T43A 3DWFA 5LQMA 1Z08A 5FPKA 2IBSA 4V0LA 4KAAA 2HIAA 1UMDB 4LBYA 3OCZA 1H4VB 1QONA 4I5IA 4L74A 1GQRA 1H2RS 3ZZ1A 2GEBA 4M8IA 1FDRA 1M6YA 2B5WA 5BWBA 3ZQKA 3GQBA 1DUIA 1PT6A 1POWA 1T5HX 2XCOA 2XQKA 4IYRA 1JAHA 4LMAA 5CYFA 5L3ZA 1F4VA 1FB5A 1PGNA 4LXHA 4HDNB 5AI8A 4BO9A 4C3VA 2IS2A 1MABA 3VO1A 4N54A 1H85A 4CMJA 3WK6A 1ULZA 3Q8MA 1NGSA 2J33A 3CR8A 1A7JA 4P4LA 3LUDA 4HNGA 5ECDA 1JDBB 5IHPA 5AW6A 3FDZB 1O89A 2QVBA 1N25A 3TQHA 3SIPA 4HDKA 3R6DA 1U7OA 3CE9A 1P4SA 5A9RA 1YOVB 3GPIA 4FDTA 2HUPA 4O29A 2YQ5A 4ZYUA 1G5IA 3PX2A 2BBWA 4AS3A 3BB3A 1N9ZA 4JU8A 4OYHA 1F51E 3CLUC 5J9FA 2P6MA 3LQQA 1S3GA 1NP3A 1P19A 2C3MA 2L82A 3E3OA 3RS3A 3HADA 2C3YA 3TQCA 2Z5FA 1MC8A 1J00A 2YN2A 2JLAA 1XXLA 3OAAA 3OTGA 4YXWD 3ZIAA 2EFHB 4Q9KA 2G9NA 1XVAA 3RS2A 3TRDA 3FD8A 3IB6A 4P3XA 1RPTA 2QGFA 4XGIA 4Y9RA 4K2HA 1VA4A 2V4MA 3L6CA 4DM3A 3RS7A 1I3CA 4UQLA 4M0LA 3OIWA 4OQ4A 3RSFA 1P0MA 2F43B 4Y1RB 1TZ2A 1L3IA 3GRUA 3VOSA 1W36B 5B7PA 1J7JA 5ULLA 1ZWLA 1E2JA 3HUEA 5LDHA 1FDTA 2VEOA 1GRQA 1QIHA 1KYTA 1QYRA 3QOWA 3WLNA 1KK2A 2BM9A 1I9GA 3EZ2A 1E98A 3BJIC 1RXWA 4K9NA 2WU0A 1MQ9A 1YU9A 3ILSA 4RHUA 4ZDWA 3PEUA 2EG5A 3QEMA 1GITA 1JQ3A 5FIUA 1X42A 3M49A 3BKXA 1UEJA 4XKJA 2GF0A 1RIFA 1DO2A 2AOXA 3IHKA 3VUFA 2WQ7A 2PGXA 1DELA 2J6CA 2XYGA 2TRSB 3TNFA 2DFTA 2FWJA 5FBHA 2FWPA 4RL6A 3TCKA 1PN3A 2PO5A 2XBLA 2ZK7A 3J7TA 4FFBA 4M98A 4MIYA 3TTYA 4BQQA 1WNTA 4U5XA 5ICGA 3R24A 5IJ9A 4U0KA 3QBVA 3DBIA 1VHDA 4KU4A 3C85A 2QAGC 5E1DA 4LKRA 4CF3A 4ZV7A 1BS2A 1CG6A 1KMQA 2WIDA 3PPWA 1I2BA 2NU9B 1E2NA 2F1KA 5BVGB 1OV6A 4MRVA 1TJ3A 3L8MA 1MOPA 5K6AA 1SVSA 2RGAA 4DWVA 3K0SA 2WC1A 1EM6A 1X1RA 2VF2A 3WBFA 1K7XB 4FLFA 2C9CA 3G49A 4ARZB 3I53A 3CLKA 3ZJYA 3JATB 1N57A 2O19A 3GPBA 2F9FA 3QBEA 3A2KA 4IS2A 3UK2A 3D3WA 1CJSA 5ALMA 4EGQA 4LRXA 4TYQA 2Z9BA 4PGGA 4L4XA 3OC0A 4M0FA 3C7TA 1GTZA 1L7DA 1XI2A 2EWMA 1YC5A 2IZ6A 4KUGA 2OV8A 5LYJF 1L4MA 4KXFB 4CV1A 3E0XA 3T7AA 3OPNA 2ZDQA 4G5QA 2RC6A 2RG1A 3T15A 5JBQA 1Z38A 5JQWA 1II9A 4Y2YA 1BYIA 3WSVA 4EPYA 1DI0A 3EW7A 1KU0A 3M4YA 1R3UA 1UC5B 4PSKA 1JNYA 2YWJA 4UVHA 3NW9A 3MELA 5EOVA 3IS3A 3EZXA 3L1KA 3P2YA 1YKGA 2B4TO 1U9YA 1KJ9A 2E4YA 2PYZA 1EFCA 3PICA 5EWMB 2J3EA 4JL5A 5KAMA 3BZWA 3GT4A 2QM0A 5GP1A 3KVYA 1QK4A 2UYYA 4JBYA 3L4BC 3OFND 1AS2A 2WKQA 3JPYA 4OGLA 1YXMA 4OKSA 3W7VA 1I7NA 3F7MA 2Z8XA 4RF3A 3ZU4A 3KT6A 3RABA 3L1IA 2GDZA 2XCSB 2X0IA 5L7YA 4GGMX 5JDCC 1BA3A 4O2BB 5B64A 2BCGY 3PQCA 3R6WA 1XJCA 1W52X 2PH3A 3TQOA 3VNAA 3UK0A 3L8HA 2XMBA 2O8CB 1AM4D 1XTZA 4IDCA 4YB8A 1TE2A 3DLBA 4LY3A 3UMBA 1ZO8A 2C5GA 1ANKA 5BQPA 2V3WA 4G84A 4GOOD 1L4EA 5A5VA 5B6IA 1N2OA 1H0SA 1PZGA 1YZUA 1EYZA 4X6UA 4EJ6A 4XVCA 4HDAA 2FEPA 1QDUA 3NVAA 4B4UA 2AEEA 2L2QA 5C37A 1VI6A 2O5CA 4HH4A 4GI3A 3N87A 1PZHA 1ULHA 3AJDA 2CYCA 1Z34A 3EVBA 1F2UA 3HU3A 4RCVA 5AKGA 5B4TA 5I47A 1I51A 4B3FX 5K09A 2IYPA 4F1JA 5DI9A 1TEXA 1IZ0A 1OZFA 3NT4A 3ZUGA 2G1KA 3RYHA 3CLTD 1I7QB 3X1JA 1Y1KE 3I72A 1YS9A 1BHJA 1WCWA 5B58C 1OKKD 1GGKA 4ZT6A 1SURA 3VVLA 3IR7A 3W5CA 2RHBA 3AI3A 3OOYA 3BF8A 4GT1A 2XCQA 2P3QA 1NJFA 3WIVA 1E4VA 4BWGA 2YXDA 1PHRA 4X5OA 1W9MA 2R6DA 4IRXA 4DLAA 5J2TB 5IP5A 2YY6A 5HVNA 5A3VA 2Q1XA 2GFHA 1II8B 1BNCA 2WZQA 2MR5A 2OC9A 2JLRA 2BSXA 2GCGA 2WWHA 4MOWA 1C9NA 3URMA 4CDMA 1BH2A 1G8SA 4RJTA 1WS6A 3GZNB 4L2IB 1DCTA 3TAUA 4OFZA 2C8LA 3QEMB 3KLMX 4NK5A 3RB8A 3GRFA 1YDEA 5FV7A 4EPTA 1GPMA 1LUAA 2V96A 2XTAA 3U3JA 1X92A 4JUFA 2KW5A 5CA0B 1ZMXA 4QPJC 4JJ8A 2RCYA 3RTBA 4Y1RA 5J2TF 4ASUD 1EEXB 3D6UA 3BB1A 2D7CA 2Q41A 3KD3A 2XVZA 4MWSA 4WCFA 3R9KA 3ZNQA 4Y9DA 5F1KA 4CEJB 3AK4A 3DOHA 2AE2A 4DKXA 1SMKA 3AR8A 1ZMTA 1PI3A 2EJCA 3O2JA 4EF4A 5F4BA 2OM2A 4CGZA 1JHAA 1HYGA 2ZYRA 3S1LA 1MIOA 3ID6C 3Q5DA 4ZZ3A 2BFAA 4F3TA 1MVOA 2ZIXB 1Y3FE 3DHEA 2ZI3A 1ZJZA 4CT0A 1EESA 2HN9A 2XADA 5CRIA 2DJIA 3IQIX 3WGUA 5HUJA 1T26A 2FZKA 4ZVUA 3PDIB 4CBVA 2AI2A 4C7OA 4RY9A 3F3MA 5FPYA 3G6KA 2EG9A 4OG2A 3KV1A 4IXTA 2JAWA 2BFWA 2REQB 4D0NA 3AESA 1F8XA 4D82A 3BAZA 1ZA1A 2H06A 1KYYA 2GYYA 2JAUA 4QYWA 2V7UA 1YJAA 3OZCA 3SYMA 3PC3A 3LY9A 4X93A 1DAGA 1KKMA 2NO5A 5CHEA 2ACWA 1FMTA 2BDEA 3LT0A 4HKTA 1LDMA 1EGMB 2QKYA 4DJAA 1U1FA 3EAGA 2HHCA 3IURA 4P80A 1NPTO 4LRQA 1YV9A 2PX0A 3K6SB 1EK6A 3GUCA 1JXAA 5BSTA 1DJPA 4WOCA 1H3NA 3SHTA 1MVLA 3A1CA 4KL8S 3DVLA 2P2ZA 4C1NA 8ABPA 3PC8C 2PPVA 5JMPA 4M1EA 4XQ9A 4X94A 1TVKA 4UU1A 1JIUA 1OCEA 5TJHA 4BJ5A 4QARA 2FKNA 4HX5A 2OORA 3R6GA 5AK0A 2YW9A 3A3OA 1DIBA 3T1YB 1N6PA 3DDOA 2A30A 4Q4HA 4DCCA 1TVEA 5C81A 3K94A 2IUTA 3EEIA 1TF5A 3KZMA 4E09A 2G72A 1ZHHA 1SCBA 3FCXA 4MIEA 1XALA 1KMNA 5H4GA 2C31A 2PSHA 3C15C 4ZPJA 1VYHA 3MMNA 1NPDA 2G25A 3VDNB 3D2BA 3NCHA 2H2FA 4I8DA 2R6R1 4M1YA 4X84A 1HV8A 2FN9A 5IARA 4H31A 4PM4A 4BP1A 2FP4A 5FNVF 1YF3A 3OTOB 3CUYA 4X92A 2C5AA 1NG1A 2FPWA 1LX6A 1VSUA 1UL1X 2A0UA 3PGMA 3RJ9A 3S2UA 1IMJA 2ZREA 4ZQFA 4DHEA 2BFFB 2A5DA 4RKRA 3M5PA 4KR2A 3QTLA 2HLDD 2BEVA 4AJEA 2MSDB 4L22A 4R8MA 3WJAA 1ILWA 1JDJA 1MRZA 3IBCA 3GFPA 1JFTA 4ARVA 3K32A 1ZITA 2WVHA 3ONNA 4KIJA 1J70A 2JCXA 4Q7EA 3RJZA 2HF9A 3D4OA 3JYQA 4HS4A 1QRAA 2ONKA 3ZZTA 4EH1A 2W2VA 5AJZA 4V02A 2GK6A 1GAJA 3A3YA 4E32A 1QC5B 2OEPA 3DW3X 4FWIB 1TAGA 5EMNA 4B7ZA 5K6AC 2UU9B 1DJMA 1GAEO 4AZ3A 1IHYA 3O3MB 1S8FA 2P9EA 5CLJA 4IXWA 4WKCA 3HVRA 2F4VB 4KLCA 4B3BA 1AZSC 5TMEA 1ZJJA 4PLHA 4O2AA 3TD2A 2FJUA 4DA0A 2J5BA 4QVGA 4Z0NA 2D2IA 1QBGA 1RM0A 4ZJYA 3THXB 2QT0A 3VTFA 4GNKA 4S35A 1U98A 1XVIA 5AJYA 4ZVSA 5JAIA 1M0EA 4GKJB 4J94A 2FNAA 4XPIA 3H2KA 3TNLA 4YV2A 2NSDA 4L7VA 1UK6A 1ZW1A 1KSHA 3RU2A 4YMHA 2CLFB 2J0VA 2NX2A 2JEOA 3K4PA 1LF5A 2EKPA 3EJWA 3R0VA 4Q4AB 4BVJA 2IEDA 1E7MA 1Z75A 2VFAA 1F6BA 2XGOA 5LFAA 1AXEA 2IU4A 3TMKA 1K6EA 3NBMA 5JLJA 2GFQA 1ZGBA 4WMLA 1H23A 2Z09A 4DAEA 3PRJA 2XOKD 3V4SA 1Z47A 3K6KA 1O95C 1RHJA 2WHPB 4UNQA 3WK9A 5C32A 4REQB 1AKNA 3CNLA 4R0NA 3RS5A 1TLLA 1RVDA 3RS8A 4JL8A 1TYCA 3E05A 1VMKA 2C0QA 1U02A 3T95A 1NVTA 5CJ2A 3HA7A 1I1OA 5KNDH 1N6OA 2O0MA 3ORSA 4UTXA 1OIVA 1IUKA 5EJ4A 4GRDA 2PGIA 2IU6A 4JASB 3WHKA 2C2XA 1KVSA 3GRKA 4MGKR 1ZM9A 1N6NA 2VP0A 4RHCA 3DEAA 4A82A 2ZUCA 2I6SA 3FFAA 2JB9A 4J8PA 4W9NC 2F00A 1KFKB 4D9IA 3INTA 3NANA 4WOJA 2Q7DA 2BELA 2GTIA 3O8QA 3RRBA 3QUSA 1H65A 1YS6A 1ZGJA 2NU6B 3TSYA 2CSUA 1P1BA 3I4CA 4LV5B 4Q4DA 4RKWA 5CTJA 2AW5A 5E2BA 4GKKB 4C0QC 1NUSA 1EA5A 2AJBA 4UDNA 3UJAA 5DK6A 5JYDA 1GR1A 4JBIA 1YR8A 2MDTA 4YPFA 2ARKA 3SHQA 2XHZA 2GCPA 4Y6SA 4WI1A 1BOFA 5KTPA 1WMFA 4OQNA 4UEJA 4EW1A 3U6BA 1HR0B 1QG0A 3TZEA 4ZVQA 3W3AH 5BV0A 2WM8A 1AJEA 3EDRA 2E5LB 2O2ZA 5KU7A 2RBKA 3ZX4A 4C04A 3WADA 2Q8QA 3HDJA 2Q2NA 2SKDA 3TQIA 3U39A 4A03A 3QIVA 3A1TA 1NHWA 1CW2B 2B1RA 1R8JA 3QVSA 2DTDA 3MF4A 2ZUSA 4PZZA 4C22A 4COOA 1C1HA 1I3MA 1VCMA 4NFYA 3UEOA 1JAZA 3A27A 4EB3A 4MYSA 4XJVA 2R8RA 3U9TA 2WLSA 4CI9A 5MFPA 1C3OB 4MUKA 1I30A 1BGWA 3ICVA 2QP4A 2RHDA 4XYGA 3TBFA 2QW0X 3KSDO 1M6HA 1V39A 3IKVA 4AW9A 5G0UA 1SFRA 3UY4A 4Q12A 2VDWA 1J21A 2XXJA 4GQAA 1L7VC 1YQXA 3KDAA 4HGRA 2WIJA 2VZ9A 5FLYA 1EFUA 4R51A 4Z0TA 4QDJA 5CFMA 1QM5A 3PGVA 3WGQA 4KB5A 4PC2A 3TFQA 3RO7A 4TYWA 3BL5A 4JS0A 4CFYA 4Q3LA 1PUJA 2D4HA 3E9MA 3IEXA 4GI7A 1D8AA 4ZCSA 1XYYA 2R5WA 4MLDA 1Z35A 2OSBA 2XMPA 3K9BA 5CLIA 4AL4A 4L27A 4K6OA 4FFOA 3T5BA 2WTMA 1QP7A 3EPLA 3JVUA 4NY1A 5BOSB 3HDYA 4TT8A 4G0NA 3PWKA 3SP1A 3C3AA 1RLUA 5DTQA 4PBRA 3MAJA 3ZE7A 5IABA 1UBOS 1YR9A 1F7VA 1E5LA 1JLHA 2JGEA 4MR9A 3C3XA 3VZSA 4A6EA 4R5HA 1XZLA 4IH9A 1SB9A 3OJWA 2IHVA 2TS1A 2CDBA 3NHPA 1ST2A 2GNAA 4KR7A 2I1VB 2QMHA 5JCZA 1E79A 4QBKA 3ZIDA 2VJCA 4JWTA 1NQTA 4WKGA 3AL2A 5AJUA 4KR9A 1ISRA 5E4TA 4DFDA 1IWPB 3KQOA 4F56A 3M5DA 2GAIA 2WZBA 2RI6A 4UCXA 5TF0A 2BCEA 1GDHA 4M60A 1M34B 3W8EA 3WWZA 1QFJA 2OOSA 3N0RA 4HS9A 4S1OA 2P2GA 3BQ9A 5LA6B 3TUJC 4U3JA 3DC7A 1WPRA 1OFUX 3I6MA 4TWJA 3WP1B 3BVPA 1V3QE 1XZHA 3MHPA 3EEQA 3G2LA 3MMSA 2OAQ1 4MULA 1TL7C 2BLLA 3FCYA 1Z3IX 4MVJF 3OUZA 1GRVA 4GW3A 2XUOA 5J4LA 1VECA 1BVHA 1UJBA 2ECOA 1TT7A 3EVCA 4K9QA 2MSEB 1HKHA 1Z06A 3Q12A 3B12A 4H1HA 4WESB 1DC7A 4G5HA 5HZMA 1PSDA 2YRFA 2YZMA 2PYDA 1RZ3A 3V8VA 4NHEA 2AEJA 5PNTA 3EIOA 1J2JA 1PV1A 2B83A 4DIBA 1JJ7A 1V4VA 3UUEA 5LA6F 3VR5H 1XDUA 1JEOA 4F84A 1XTBA 1RP7A 2I22A 2L0XA 2OCAA 1KRWA 2WJ6A 2ZR7A 2ID7A 2DJ5A 4MUGA 4RIHA 3FB1A 2P9JA 2O0JA 2WF5A 4ER6A 3SM3A 4RVCA 1PWHA 1DFGA 2HTFA 2PS0A 3I73A 3HEBA 3P2JA 1B1CA 2FLVA 5COAA 1XFAA 3SSAA 3WLAA 1M1UA 3AFOA 3FCOA 2BEJA 3TW6A 1BDMA 2P2SA 4TM8A 1VPVA 3VR2A 1T9GS 4Y7DA 4ZFNA 2BEWA 2NVWA 4WXMA 2HBRA 2QMOA 2WFZA 4Q3OA 4WK6A 2FA9A 1QYDA 1E1DA 1ZOOA 4C4YA 2FZGA 3VO8A 3Q40A 1JTVA 4TKVB 4YP0A 2G1AA 2XE8A 3RKRA 3W6ZA 3WKBA 2P2YA 4KOAA 1K6IA 3NWJA 4LXQA 1Y3IA 4QTTB 2HA5A 4PO8A 4FOOA 4KQEA 2XV1A 4YRQA 1NMYA 3LYAA 1TM2A 3OF2A 1IQRA 4ADSG 3WISA 1G16A 1JGTA 1X7WA 2RHTA 2W6MA 3BXXA 3K0HA 3LXXA 4JXKA 2B78A 3STTA 2XUZA 3KQPA 4NV3A 2R3SA 2BMJA 3EA4A 3TDNA 1OZAA 3I6YA 2F17A 3FYUA 3OFNA 1ECBA 3HO6A 4EP1A 1F2TB 2WK1A 3BZBA 1IN7A 1N3BA 4C30A 4BNYA 3AR9A 3D8HA 5DT2A 1XRSB 3FPSA 1EFAA 4EFDA 1XK7A 1IAQA 1XMIA 1K0FA 1AA9A 2D8MA 3NWBA 2HK6A 3ZWCA 3U6KA 1L8QA 3IT2A 1PYOA 3ROEA 2HREA 3LI2A 4ZT7A 3W0LB 5KYTA 2O2JA 4CLOB 5KPJA 1T8UA 4PZCA 2W6PA 1P2BA 3ONDA 3PQ6A 1PJ4A 2CJWA 3C1UA 3IIKA 5B1IA 3R74A 2PUDA 5ERXA 2YJ6A 1SXJD 2C4TA 3T1HB 4JLDA 4YV1A 3WGIA 2G4LA 2VBIA 3VXKA 4B6PA 2CNBA 4DQXA 4GECA 4KWTA 1G8AA 5CYGA 4NOLA 3AEUB 3SF0A 4JVMA 2IXTA 2YYAA 3LF1A 1R9NA 2H2IA 1PFKA 3JYOA 2IGBA 5COQA 5HIAA 1BA2A 1R50A 3F3KA 5BMVF 4ZVPA 1DAHA 4RA9A 4W5OA 2HJRA 3R6LA 1RPZA 4BNXA 2BM0A 4WNIA 3ZDZB 2WG0A 4CR7A 3CVVA 2HNBA 1EXWA 3B3AA 1YJBA 1R6BX 2C1XA 5K3BA 3IILA 3M8KA 4TZ0A 1HK7A 1A5AB 1V0JA 1F6DA 1C0LA 3NLLA 5ILQA 5A5FA 1NDQA 1IDOA 3E3AA 1GD1O 5J59A 3RYTC 4ECEA 3TUZC 1Z2OX 1MEOA 1VE1A 1S3FA 2YFHA 3N05A 4UMVA 2NSLA 1IXZA 3IAXA 5GAJA 3I64A 1UOQA