4LRWA

Crystal structure of k-ras g12c (cysteine-light), gdp-bound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
155
Chain Sequence
b'TEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 54
structure length 155
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lrwA00
3AEZA 1PLLA 4ILEA 3RAPR 2VH5R 3B1XA 3R7WA 4ZDIA 4WOPA 1MABB 2FX3A 3BBPA 1Z2CA 2Q3FA 3U7EB 2QBYB 1XXHA 4TL7A 5HCIA 4PFSA 2WMOB 1BYUA 3QXCA 3UPUA 4MH0R 2J7PA 3L43A 1MO3A 1WXQA 1XJCA 1YVDA 2KB0A 3OIUA 3GJ0A 3Q8XB 3QVVA 4GZMA 4BFWA 3SN6A 2VP4A 1KSGA 4KHZA 3HPRA 3VKWA 3CH4B 4KITB 5KNCA 2XZPA 2YWHA 2WKRA 3RSOA 3QBTA 4PR0A 3ICEA 2BBOA 4DCTA 2O8EB 2QG6A 5CB8A 1E9DA 1P6XA 4DT1A 4NCNA 3TSWA 3A8TA 1E4VA 3KXLA 4Z54A 4P32A 1II8A 2G83A 2N42A 3C14C 1SHZA 1SXJC 3P20A 4BEJA 4BFZA 2ZJZA 3ZIAA 1JXMA 1S2MA 3GLHB 3LX8A 3QJYA 2C77A 2IYLD 3KB1A 1L8QA 4JIMA 2ZE7A 2C96A 1E2QA 2ONJA 2OAQ1 1E2GA 2IYVA 4M53A 5FUWA 3K0SA 3DKPA 2PJZA 2J0UB 1P3JA 3WBKA 5IK2D 1IM2A 1OB2A 3NBZC 1GM5A 1WP9A 2GRJA 1COWD 4ZDJA 1G20E 4P4TA 2ZJOA 1NNEA 2CCJA 3VKGA 1DPFA 1KK2A 3WRYC 2GJ8A 1Z6TA 1SVKA 1U94A 2O8BA 5KOYA 4C0LA 4HYYA 1W7AA 3RS4A 1LB1B 2IS4A 2QY9A 1QHSA 4IVQA 3UMSA 3GLFA 1QHHA 3K0CC 2R44A 3BIFA 2SHKA 4TT3A 1RPZA 2GVDC 3WBJA 1UBGA 4GFDA 4LJ9A 1QHNA 3D8BA 1KGDA 1YZUA 4LWZA 4BWYA 2GAOA 2ZE6A 1G5TA 5AUOB 3K9GA 4UXIA 1NN3A 1UKEA 4Y0VA 2QZ4A 5FPHA 3WNCA 3TQFA 4KSCA 2KI5A 1AS2A 1M6NA 3FKSD 4JLAA 1KI1A 3CO5A 2JLYA 1TL7C 2GZDA 2YWGA 1XX6A 1GKIA 1R0WA 5A5GA 1M2OB 4PC3A 1U81A 3DPUA 4YC7A 2F6RA 1E69A 3K9HA 4KYUA 1E2HA 1X8LA 3BB1A 1OKKA 3VFDA 1GG2A 1RIFA 2H16A 3F3YA 2F1JA 1JR3D 2A30A 2ZUBA 3SEAA 4A2WA 4EPWA 4Q4HB 1A7JA 1NJGA 1W44A 1G1MA 2GBLA 5CK5A 1XBTA 1VCOA 3ASZA 4Z8XA 4XD7D 1Z5ZA 1CR0A 1KI3A 4F4IA 1ELOA 2GK6A 3T15A 4EPYA 1HT1E 1QG2A 3QKSA 1VIYA 4URXR 5DYGA 1EXMA 4LHWA 3REGA 1KNXA 3A1SA 3T61A 1NN0A 4DLZA 5KSZA 2IS2A 1G8HA 3UXMA 3C8UA 3EA0A 2V54A 1NG9A 4E09A 4F4CA 3B82A 5TV2A 1KO1A 2ZI9A 1P4SA 3K09A 1D8TA 3H1TA 5DO9A 2QM8A 4TMTA 2QT0A 5J4LA 1XD9A 2ZJYA 3N70A 4DLRA 2UZIR 1ESNA 2VHCA 5H8WA 2DYKA 3P4YA 3QF4A 2RGCA 1NVVQ 2W6JD 1S1CA 2ZI6A 4OI4A 1GRRA 5CYPA 3WMGA 3KFVA 2V9PA 3VAAA 5L3SB 4LBZA 4EQ6A 5BW8A 4HEJA 1VG9B 4MRPA 2EWWA 4IEIA 1G9XA 3SE0A 1KYIA 4HAVA 1IN6A 2ATVA 8OHMA 2VBCA 1GDDA 2RB4A 1G6HA 3CF6R 2J5XA 1OFUX 2G0TA 2EVWX 2NO0A 3HU3A 3ND9A 4MGKR 4LGMA 2ZSEA 3GEHA 1CRPA 3LH5A 4XVQA 4F92B 5EQTA 4ITRC 1IY1A 3O8BA 3GMTA 2ZRLA 3SHWA 1J8YF 4A9AA 2AXNA 3IPXA 2C9CA 4BGDA 1YZTA 2ZJ5A 2CNWD 1GIAA 1E32A 3AVYA 2IEYA 4DDUA 2H57A 2AFIE 2AN9A 1XMJA 2CL0X 4NHOA 1UEIA 3RNLA 4B74A 3ADCA 3REFA 2IYQA 1XEWY 3S1AB 1US8B 2OBMA 1CP2A 2NGRA 4L15A 4PPGA 4B6FA 3UMFA 2ZVPX 1TMKA 5DNYB 3GLGA 2VSFA 4XIGS 1XFAA 2LKDA 3TE6A 5JECA 5CLQA 2QEQA 2KBFA 3PVSA 2ZU6A 2G88A 2CJWA 4PANA 4S2EA 2QENA 3QOFA 3Q9LA 3LV8A 4PQYA 4ZKDA 2WIBA 1R4AA 2Q21A 1LW7A 4H1VA 4Q1FA 1FP6A 1SVWA 4PAQA 2OLKA 4LJ5A 3P27A 2J0VA 4Z1MD 1EFUA 2C8VA 3ONWA 2QN6A 4EJSA 4BFTA 4FW9A 2RGNA 3NDPA 2RGBA 1KKLA 3ECCA 1SGWA 1UF9A 4PQFA 4NPHA 3VX3A 4B76A 3GJ3A 2LCFA 5SZJA 4MUAA 1XCMA 4OK6A 4GI7A 3KQLA 3WYAA 1JR6A 4G5QA 1OXTA 4OQFA 2A5DA 2E87A 4NYJQ 4IXNA 1RJ9A 1DVRA 4FIDA 3CRMA 4ZI2A 4BRWA 4UXJA 3V00A 3U2QA 2NZJA 3A6PC 3BORA 5B58C 2I4IA 3GLIA 3OEEA 3VKHA 1S3SA 3K0AA 2CLDX 4PC2A 4TSFA 2DWOA 5FOTA 5FOSA 2VEDA 2JLWA 4A0HA 2JCSA 3PUWA 2GVZC 1TADA 4JZKA 3I62A 3RRNA 2QROA 1NKSA 2GDJA 2F1IA 3T35A 5B30A 2TMKA 5DE3A 4V03A 5L3QB 2EFGA 4P3YA 4IOLA 2O8CB 2ONKA 2VTKA 2NO1A 3QKUA 2J0QA 4A36A 2C03A 1KDPA 3NKVA 2GHIA 3W3ZB 2E9SA 1KK0A 4TQUS 4B32A 4LYJA 4QHYA 2JJ2D 3U4QA 4XSHA 3HP1A 1IJEA 1C4OA 3DZ8A 1NN1A 5TMPA 3FMIA 3VHXA 1G41A 2VSXA 3B85A 2VL7A 2ZRGA 1VKJA 1AQYA 4GP6A 1IAQA 2PZEA 4L9SA 1AGPA 2IS1A 2YVUA 4OHVA 4XTCS 1Q1ZA 2OZEA 4ZI3A 4P4SB 1L4UA 1EFTA 2ZREA 2PMDA 1CU1A 2BJVA 3VR5A 5DI3A 3RRMA 5C1BA 2ZR7A 5FPKA 2Y8EA 4MKFA 3RS2A 5JWOA 3R8FA 4PHHA 2MMCA 2CMKA 3DDCA 4CT4B 4URYR 1CR4A 1X6VA 1UDXA 1G3QA 5HZHA 1JPNA 2QE7D 4B3DA 3ZVNA 2IWHA 3N5CA 1AGRA 2PX3A 4HB4A 3VU9B 1JR3E 1W49A 821PA 3QQ5A 1YKSA 3D6TB 5FOVA 4PZYA 3I3SR 1GVNB 1F3OA 2OHFA 3F8TA 1NBMA 1KO5A 4DCSA 2EW1A 3FHCB 4PZZA 1JBKA 1W48A 2QRZA 2FFAA 2ZR0A 3V9PA 4DSOA 1W36D 2B7BA 1OIVA 2JDID 1G8GA 5JI3E 3WYFA 2B21A 2W2VA 3Q3JB 4BLQA 1XTJA 4UJ3A 3FHTA 2JLRA 2V6IA 3SJBA 5JFGA 1G3IA 1H8ED 1XTKA 5J4HA 4MKGA 1UBCA 5KSOA 2JATA 4O2LA 4RSGA 3U3KA 5FUXA 5JRJA 2OFXA 4DHEA 3QBVA 4QGFA 2BEKA 4G0NA 2A78A 2IYUA 4R9UC 3QPVA 4I1UA 2D2FA 5FTNA 5JJIA 2V55B 2CHVA 2J87A 3IQXA 1NVVR 3AUXA 1S9DA 2BJWA 1G8FA 2VO1A 2HDNB 2JJ8A 1HTWA 1PJRA 4UNNA 4ESHA 3LLMA 1E4YA 4RZ2A 4KXFB 1YR7A 4PC6A 4B47A 2XTZA 3H4MA 4PHFA 4AYWA 2ZAOA 3B6EA 1UKYA 2YOGA 5KSPA 1NF3A 1P5ZB 4GOXA 1TQ4A 4AC9A 2P67A 3EX7C 2GETA 4JL6A 1D5CA 4KAXA 1E2MA 3QVUA 1ESMA 1XEXA 1M7BA 2GKSA 4TQ9A 1MO6A 4LJ8A 2EYUA 2QPTA 4MKIA 4P33A 1WQ1R 3IEUA 5L3RA 1N5LA 3JVVA 4OQLA 2VHQA 1GP2A 1LS1A 2DB3A 4LSGA 1W2GA 4JYCA 2IXEA 2WIAA 3U60B 3DMNA 1ZM4A 3B2EA 3TUIC 4CYMA 4KLZA 3K9LA 2GJ9A 1F2TA 3THYA 1Z0AA 4WA7A 3SYNA 1MO5A 1E9AA 4Q00A 1GWNA 1F60A 2FU5C 3SZRA 5CDFE 1AS0A 2ZRBA 3MLEA 2UVQA 2EYQA 2ASEA 3KJGA 1U90A 3ZZ0A 3CNLA 4US0R 2ODWA 3RRYA 3THXB 1NSTA 1E1QD 4B3CA 2GEDA 2ORWA 1LV7A 4D81A 4QBHA 3ICQB 2MSEB 5F2EA 3L2OB 4YONB 4JVLA 3PEVA 5IHPA 4TLEA 4OHXA 4CEHB 3ZGXA 1D6JA 1E9RA 1OHHA 1FX0B 1N6HA 3BE4A 4DUGA 1R8SA 4ASUD 2HJGA 3DEFA 3TBKA 3ZLJA 1GNPA 2ZUDA 4TWZA 2BOVA 2O8FB 1T3SA 2ZANA 1WCV1 1LTQA 4NCHA 1Z8FA 4QFMA 3TSOA 3NEJA 2H7VA 2NOAA 3PUXA 4G1UC 1KMHA 3IIJA 4I1SA 4YMSA 3FFAA 2PT5A 1XEFA 4TLDA 3GJ8A 2NO9A 2QP3A 2GXUA 3NHBA 3RDPA 1ZU4A 2F1RA 1W4CA 2Q3HA 1IXZA 4NYJR 5KDOA 5C2JB 5DN6D 1E1RD 1SVOA 3AP3A 3AVWA 4DLSA 1VIAA 2C9OA 2QQ0A 1HYQA 1OH7A 121PA 2BDTA 1JECA 4YMTA 2JEOA 2V7QA 3VQTA 2QORA 4PQRA 3LW7A 4KFTA 2V1XA 4HZUA 2OBNA 1ZM7A 3TNFA 4BEBA 3T12A 5G3YA 4BE7B 5JS7A 1CULC 3RVBA 3IUYA 1W36B 4F4JA 1LF0A 1RRCA 3NWJA 4GOJA 1RZ3A 2DBYA 4FN5A 3FMOB 4Q4AB 3VR6A 1E2FA 2WHXA 4NMMA 4CEIB 2BMDA 1E0KA 1YZKA 3EZ2A 3QXJA 1FZQA 4DWJA 3KUDA 5D3QA 3BERA 5TXGA 2VP5A 4GP7A 1E9CA 5HTKA 1KK1A 4ERNA 1IXSB 4CF7A 2JLZA 4B3GA 2GCPA 2C04A 2B8WA 4RD0A 1DELA 1ZD8A 2J45A 4I1VA 4HLUC 4Q66C 4DEYA 2RHDA 1XPRA 2VP9A 4B3XA 2BHRA 3MWJA 1R10A 1SXJA 2AL7A 4PO1A 5FL7A 3THOA 4DCNA 5TY0A 1G3MA 2KWIA 4IDOA 1MH1A 2XJ9A 2ZYVX 3BS4A 2FMXA 2YWEA 5JI2E 1KDRA 4C2UA 1X1SA 1OFIA 3PFIA 4TQAA 5IF9A 1Z29A 2CK3D 3BFKA 4QGAA 1C1YA 1J8MF 1R6BX 3NC1C 4E03A 5AJZA 4UQOA 2ZXUA 2VP0A 1XCGB 3KX2A 4OI2A 4V0LA 1W47A 4QG7A 2AK2A 1N0VC 1LVGA 3IKJA 3K8YA 1OFTA 3KTAA 4Q1DA 3AB3A 3CF2A 4BLTA 4FMBB 1JB1A 1V43A 4OHZA 4EFNA 3V4FA 3L0SA 5C18A 2FNAA 3CNOA 4JBXA 3SQXA 4DDVA 1W36C 4FCWA 3U3OA 4XJXA 2B6HA 5GJVC 5C4MA 2FFHA 4LRWA 1RVDA 4I81A 4UNPA 4H9GA 1UAAA 1E2IA 1E9SA 1S4QA 4JLDA 4PO9A 2OG2A 2RHMA 1AM4D 1ONBA 2CEAA 1ZRHA 1S9HA 3SBDA 4AYTA 3U44B 1FQKA 1ZYUA 2P0EA 4M9ZA 1W0JA 4F38A 1DTSA 2XJ4A 3X1XA 2ZETA 2W2XA 2OCYC 2V4ZA 5E7MA 4R71A 4JT2A 1W0JD 1AQUA 4DC9A 3MUFA 4FWTA 4CEJA 2R8RA 4LBWA 2WJJA 4WZBE 1OIWA 2YV5A 5G41A 1G17A 1VG1A 3GLHA 1XZQA 4YMUA 1OPXA 1RW4A 1B23P 3CRW1 2BEJA 2J0UA 5KHOC 1G7RA 2FFBA 4BASA 3I73A 2ZI4A 2KSQA 4Q9IA 2ZR9A 2ZS7A 3ETLA 4M1MA 4AURA 3KFXA 5C46F 4ZKEA 2FEMA 1CEEA 2QTHA 1E9FA 3A58B 2YKGA 1T8UA 2IS6A 3UANA 3U5ZB 2FG5A 3CX6A 5KUTA 4PXAA 1P62B 4EIWA 5E3HA 5B57C 1HH4A 4QBIA 1U9IA 4UXHA 2FN4A 3CNNA 4PAMA 3ZVLA 1HE1C 3SJCA 2HT6A 1AZSC 2FSFA 3UG7A 5JSZB 2GZAA 1KKMA 2ZPTX 1KHTA 2F7SA 4Q4JB 4LHZA 2HCJB 1UDWA 2ZRNA 4Q1AA 4DLXA 3NXSA 4JYBA 1N6PA 1TPZA 4C0JA 3FMPB 1JQLB 2LKCA 3B78A 3E5HA 4V0MA 1CJVC 3SHFA 1Z0JA 1D2EA 1GL6A 2GAAA 2CLSA 2PCLA 2FEOA 2JAQA 4BLRA 1JAHA 3OE7A 3VNUA 4TMWA 2PEYA 3ZDQA 1NMZA 1I4LD 1LFDB 4HLQB 4C4PA 2XXAA 2P3SA 2J3EA 2F3TA 2GXAA 4EUNA 3H2YA 4TTPA 2A5JA 4B73A 1Q1EA 4Q4HA 1G3RA 4A8JB 3OAAD 2R6GA 5CYOA 4KU4A 3RSLA 3UWKA 2PLFA 1N6OA 2I1VB 1P2TA 1QVAA 1N6IA 1NVWQ 4OQMA 3GD7A 3UK6A 1VCIA 3DM9B 4HDQB 4D6PA 1YZLA 5LPNA 3VR3A 3CR7A 2NPFA 3QXSA 2F9MA 3PITA 2OESA 4E5UA 2ZUCA 4CW7A 3VMFA 4CRWB 3B60A 4IW3B 3SS8A 1XTIA 4ACAA 3AM1A 4D26A 1A2KC 5FTKA 3LNCA 2ZJBA 2W83A 1XTQA 3B1ZA 1KSHA 4TMVA 5EUMA 4XSGA 3AVQA 2ORVA 3PXGA 2J7PD 1KZ7B 5EZ6B 4LCBA 2IWRA 4TL9A 4LBYA 1G8YA 4TL6A 2RGXA 4RZXA 4DDWA 3TSZA 5FFMA 5D3MA 4JLMA 2W00A 4TZ0A 1OH8A 1OH5A 4P31A 2WWWA 3CWZA 1XTRA 2DCUA 621PA 1OYYA 3HYRA 3IBYA 4ZIRA 2XZLA 2IK8A 3L0IB 5AJWA 4L8GA 2IXGA 1WRBA 3ZIAD 2BBWA 3EC2A 3RANA 3C5HA 4A8JC 2HLDA 4M9SA 2ZE8A 1OSNA 2WMNB 1JI0A 2V1UA 2X1VA 5H68A 3SJZA 1OXXK 3ZVRA 1US8A 4BECA 3J81k 1OFHA 1SHKA 1JEEA 4IOMA 4GSYA 5P21A 4DB2A 4HB3A 2CHQA 2O8DB 2IT1A 2ZVQX 3BJIC 2R9VA 1OXSC 2WWIA 1HUQA 2F1HA 4B75A 4G3XA 1KY3A 2H18A 1OT3A 4JT4A 4EPRA 2CE7A 4QHSA 4W9MC 2X8AA 1Z6XA 1IN7A 3LD9A 5F3WB 4MYHA 1T4GA 5DI9A 4E07A 4ZCLA 4QM6A 3QG5A 4TT3D 1J99A 2QUZA 1R8QA 4D2IA 5J4KA 2NPIA 2GWHA 3VHLB 4YMWA 1MRNA 2XEXA 2BWJA 4LX0A 3KJIA 3QXXA 4E22A 1I4TD 4ZO4A 1IQPA 2QP4A 3OF5A 3GP8A 1H8HA 3PEWA 4BFVA 1FTSA 3Q5EA 2FSIA 5DHAA 2BC9A 4C0BA 3KQNA 3K70B 1G7CA 1F2UB 1H8HD 3L8YA 2J1LA 1G5RA 1OKKD 2ZSBA 3LW8A 3TAUA 5KU1A 3GJ6A 3U3JA 4WXRA 3MJHA 4DEXA 3DKVA 5GADl 1HQCA 3A4LA 2R65A 2IYXA 3QPWA 2CXXA 1R5BA 3KKNA 2CHGA 3AF3A 5EE3A 1DG3A 4JMPA 3PEYA 2J7KA 1XMIA 3IQWA 4LV6A 4US2R 5KNBA 3KDSE 2WKPA 1NJFA 4TYQA 1TQ6A 3SU8A 1YQTA 2PX0A 5L3QA 2NO7A 4HLDA 1Q0UA 1FPMA 3TK1A 4TTRA 1Z0DA 2WICA 5GVSA 4DLVA 4WZAE 1NMYA 2GXQA 4PC1A 3BOSA 1BS1A 1PZNA 3EIEA 2NZ8A 2G0NA 2BBSA 4NP6A 4C30A 2CE2X 3Q85A 2AWNA 2L0XA 4FMCB 1U2RA 3IPYA 3T1OA 1O3YA 3EAQA 4OQXA 3QKTA 5FUVA 4QJ4A 4O0MA 3OESA 5GJCA 4P4SA 5EXTA 2REBA 4YXWA 3RS3A 2OFWA 1FMLA 1P2SA 1RYHA 1Z83A 1KY2A 1XF9A 3WHLA 1I2DA 5K8IA 1SVLA 4TMKA 2G1KA 3EIHA 1CR2A 1TU3A 2HF9A 1D2MA 4JLOA 4EAQA 3K70C 3EW9A 3VU9A 3SOPA 4B2IA 5KYKA 4WZ6A 2Q3MA 5E7JA 4B2LA 2OCAA 3WNDA 2BM1A 3R20A 3NG1A 3MG9A 2JIZA 1IN8A 1EFCA 3RS5A 3DZDA 3GFOA 2E1RA 2HUPA 2W6IA 5KSYA 3WMEA 4X8OA 1KTVA 4KV9A 1R5OA 3ZZUA 2NIPA 4AKHA 3P26A 1XJQA 5FBLB 5J47A 3K1JA 4M4SA 3BH6A 3VR1A 4V0NA 4DCVA 4M0LA 5TDHA 3TW4A 4PPNA 1T5LA 1YZGA 1FW6A 1C9KA 1Q1BA 2CDNA 2HV8A 2ZU0C 2BBTA 1NY5A 3MGCA 2REOA 3KQKA 1XXHE 2W58A 5DYIA 2CVHA 1P9WA 5FUYA 1ZU5A 1QBKC 1NIPA 4DXAA 1SVMA 3JZAA 1NG1A 5BN3A 5ANRB 1BOFA 4M8NE 4TZ6A 1I2MA 5JCZA 3V4RA 4GDFA 3AQ4A 3OFNA 3W5IA 2C78A 4IDPA 5JHGB 1Z3IX 2H8KA 2RGDA 2P6UA 1FOEB 1OYWA 2QPAA 3O8RA 4CDGA 3KUCA 1UEJA 2C98A 2YOHA 2FF7A 4QM7A 5JWHA 3GLFB 1E0JA 2QGZA 4N3NA 3CZQA 1TAGA 4PHGA 4B2PA 2ZRPA 4MA4A 3C7KA 4FI3C 1ZM3A 1XWIA 4XVRA 4M21A 2GZHA 3MWLA 2Q9BA 4D4LA 5JLJA 1M1YE 2JLSA 2ZAMA 4M22A 4NZYA 2IBMA 5EXXA 3ADDA 1NP6A 4A0GA 1N5IA 1M74A 2GF0A 2R6AA 3JVUA 2VQSA 1K5DA 3ZVMA 3OEED 1NI3A 3EWSA 3LVRE 4MQBA 4C0SA 3T06B 3KQHA 1CLUA 1TU4A 3AUYA 4TSFD 5FBWB 3BK7A 3P32A 4R7ZA 5J4YA 4EFMA 1K6MA 1NLZA 2BCGY 3GPLA 4NCKA 1GZSA 1KJZA 3TMKA 2OSBA 3AH8A 3I8XA 4IFBA 1MOZA 1N6KA 4QGGA 1J7KA 3ZH9B 4RCZA 3VNVA 3GLFE 2CBZA 4LZZA 4X8MA 3GQBA 4JSTA 1BYIA 4JJKA 2AR7A 4KLNA 4GMXA 3THXA 4AYXA 1RYFA 3I72A 1W0KA 1W4BA 2XOKA 2ZRJA 2FOLA 3QKSB 4D4MA 4QJ5A 5AJVB 2HEIA 5FR2A 2OO7A 3B1YA 4FMDF 4LJYA 3ZYCA 1HEIA 1ZNXA 2XOKD 4KJZA 1Z2AA 3TIFA 5TARA 3LBHA 1FX0A 1E0AA 2MSDB 1HQYE 4GNKA 4PTLA 1GUAA 1ZNWA 3WMFA 4OJKA 4TYNA 4KVGA 3LO5A 2O8FA 1G291 2ZEJA 3HWSA 2OUKA 3BD9A 3AP1A 3EPJA 5DHFA 1FFHA 4L4UA 5DISB 4M1SA 1SZPA 3GFPA 4NYMQ 3GCGA 4EQ6B 2IL1A 4MKHA 3W9YA 3PENA 4V0OA 2PH1A 4HAYA 5EE1A 2O5VA 5FR1A 3DO6A 4OKSA 4ZDWA 1R2QA 1E2NA 4UNRA 3UMRA 1MT0A 2IF2A 3PQCA 2HYDA 2IXFA 3HPQA 2CCKA 4GPTA 4NCJA 1NBMD 4Q9LA 2HYIC 4CVNA 3NBFA 3PJRA 5DH9A 2DPXA 3LDAA 2UZ3A 1XMSA 3H0KA 3LQQA 1ZM2A 1IY2A 4Z8YA 2ODEA 3AF4A 5EP4A 4F91B 1S1MA 1Z63A 1UJ2A 4HDCA 1GOTA 3WXMA 1VG0B 3FPAA 3W6PA 3A4NA 3QSYA 3Q72A 1UM8A 2HXYA 1Q1QA 5BQ5A 4G5OA 3TH5A 5EE5B 1EGAA 1U8YA 5LB4A 3CH5A 4PAOA 3AKCA 4Q4AA 3EPKA 1K5GA 2FE4A 3ZD7A 1E98A 1CJMA 3GJ4A 2FJUA 4RFVA 2CL7X 4XWAA 3QXHA 2GCOB 1VCMA 3TR5A 2QTFA 2PBRA 4W5WA 1X8JA 3LVQE 1TEXA 3LQRA 1KSJA 1NSFA 3B7GA 1Q3TA 5JMTA 3SJAA 4US1R 1A82A 4YLGA 3THWB 5FI0B 2BMFA 1FTNA 1XTSA 3KKQA 2R6DA 4A1FA 1WDTA 1EX6A 5AR1A 4BLOA 4EJSB 1Q20A 4RVCA 4FD2A 3ASYA 4N0DA 4Q48A 4A0RA 1ZINA 1HA3A 1GITA 1KO7A 4PX9A 1SQ5A 3AF1A 1UKZA 5EE0A 1A2BA 2J41A 1RJ9B 3KL4A 2ODNA 5AUPB 3PCRB 5K8TA 3AVVA 3GLGE 1CS4C 1SVSA 3BRWD 1PV4A 2N46A 1XMVA 2WAYA 3I5YA 1UFQA 1P9RA 1E96A 2VIIA 4C0HA 1G64A 3K0AB 2ZQ5A 2NO6A 4IXMA 2YZ2A 3KJHA 3ZD6A 5HCNA 1AN0A 3W6NA 3O8CA 2JLVA 1OF1A 3A37A 1JEDA 4NCIA 4BRUA 1P7CA 2IF0A 2YC2C 2DHRA 3B9QA 3A1VA 1DOAA 4Q5IA 1DAKA 3LY5A 4G5RA 4QRHA 1R0ZA 2G77B 2OFOA 4DB4A 1HURA 2NTYC 2QT1A 4XH9B 1X1RA 4A2PA 3X1WA 3U44A 4TMXA 5BWMA 2QRNA 1OHHD 4RD4A 1YHNA 3B1WA 3KZ1E 3QENA 1E2KA 4UKDA 4DUGD 1CIPA 3WHKA 2BKEA 5FOXA 2YJTD 2QA5A 3EASA 2D62A 4I1OA 2YHSA 2VSOA 2WPDA 4LJ6A 3B8HA 4EJSC 3CKLA 1FQJA 3Q5DA 4AD8A 1N0UA 1GL9B 4JLBA 3D31A 2FSGA 1D9XA 5A0FA 2WPDD 2MMGA 5FI1B 1D9ZA 3GLIE 2AK3A 2VLIA 1GFIA 3C5CA 1A5TA 2VP6A 1KNQA 2BKUA 5EZ5A 4Z51A 1BH2A 4DSTA 1V5WA 3N2EA 1P75A 2C99A 4TL8A 2WWYA 2VRWA 1J70A 5A4JA 2V7QD 3A1TA 3RYTC 3OEHA 2VHUA 4QGHA 3CUEF 1KDTA 2DFKB 3OEHD 2D74A 1J90A 3FB4A 3W90A 4DSNA 3E1SA 5F9HA 2IUUA 5HPYB 3W5JA 2DWQA 3QKRB 1W5TA 3OIVA 1DO0A 2H92A 4KODA 4K46A 3AV0B 1N3BA 1SVIA 1ZUHA 1TUIA 2AD5A 2QM7A 1IN5A 1Z0KA 4DLTA 4J0QA 3I4LA 4FWIB 4S35A 2ATXA 2EFEB 1HT2E 3L0OA 6Q21A 4X8HA 3KJEA 2B92A 2HXSA 3Q7QA 1FP7A 3FGNA 2WZQA 4F93B 1KZGB 1N2CE 1PUIA 2C5LA 5JRZA 5FL7D 4LBVA 1SXJD 1ZC4A 1GRQA 1ZVQA 3GFTA 3SDZA 4NYMR 2O52A 4QNMA 3CR8A 2O0HA 4HAWA 4B3FX 4C0AC 4A8JA 1IXRC 4GL2A 2BM0A 3QNUA 5TVKA 1NBME 1QHXA 1E2EA 2JJ1A 1Z28A 2D7DA 2XGJA 1E9BA 2WSSA 1DAIA 2A5YB 4KVAA 1Y3AA 1KI2A 1XPUA 3BFXA 2XTNA 3IIKA 3OIWA 2QQEA 2FFQA 2HCBA 1AKYA 5FTJA 2NQ2C 3HU2A 1XEXB 1MABA 3K0CA 2QBYA 1GRNA 2X2FA 4URZR 4LDJA 2AFHE 4NE2A 3U61B 1X86B 3CM0A 3MAAC 1SKYE 2FZ4A 3A1UA 4K81B 4ARZB 2XB2A 3LWNA 1EESA 1JJ7A 4QL3A 1KO4A 3P1JA 3BFVA 5AWFC 1Z6AA 2R62A 2PLRA 3CRVA 3QPUA 3PEUA 3QI2A 3SFVA 4KCGA 3THYB 1LF5A 1NY6A 3CW2A 3AGQA 3GJ5A 5CIWA 2O8EA 1XD8A 1YRAA 1G7SA 5EP3A 2J46A 4PZLA 4AWXA 3L8ZA 2IYYA 4LYFA 721PA 3Q7PA 5B2ZA 5DSZA 5E4FA 4B43A 4G5SA 2JGNA 1ZAKA 2ZE5A 4HB2A 1U99A 1CF4A 2ZTSA 1XP8A 2ZRDA 1ZD1A 1G18A 3C16C 3DMDA 2ZRKA 5ELXA 5J40A 2OE2A 2G9NA 4D80A 1BKDR 1E6CA 2XSZA 3K9NA 4PC7A 3RHFA 2XNDA 3RLFA 3LRPA 3QY0A 4DRZA 4MRVA 2DFTA 4URWR 4DLYA 2XSZD 3KKOA 4KFSA 4W5HA 4C3ZA 4ZV4A 1QG4A 1EFHA 1VG8A 4KFUA 5SZKB 3NIBA 1RRFA 3LBNA 3TR0A 5JHHB 3MWYW 3I5XA 4MGIR 2O8DA 5CJ2A 3PR1A 1AK2A 4YQFA 3CB4A 5JEEA 4DCUA 2Z43A 3LXXA 3MJRA 4P4UA 4C9BA 3TVTA 2V6JA 1DAEA 1I4DD 2QSYA 4WW0A 3W8NA 1OB5A 1ZW6A 2WJYA 4GT1A 2JLUA 3HU1A 3SQWA 1G4AE 4FMCF 4CIDA 4IHQA 4B6EA 4IDNA 2GCNA 3TRFA 5HKKA 5EE9A 4B35A 4BLSA 3RS7A 1GL7A 3B13B 4LV5B 4B3BA 4RFSB 1OW3B 2IYZA 2OV2A 3B5JA 4LHYA 2C9YA 4ZDKA 4Q4LA 5EXPA 2B7CA 3UKDA 4JBWA 3DL0A 5SZIA 3U3RA 2GEVA 1N6NA 1W1WA 3NH9A 4JVMA 1F2UA 3E2IA 1N5JA 2JA1A 1AKEA 1E0SA 2QAGB 2ZS8A 5JBQA 1AS3A 3OE7D 1KAGA 4Q19A 4RD1A 4OBEA 2OLJA 5KO2A 1KI6B 4II7A 2EWVA 1YR6A 2IHYA 1VYVA 3QG1A 2V8OA 2ZRHA 2VF8A 2GESA 1W2HA 3PG5A 1OIXA 2C95A 2ZI3A 2IX3A 4LC1A 2IA5A 4LOAA 1WB9A 2FPMA 1G3UA 1XD2B 4DSUA 1N6RA 4EKDA 1BMFA 5EJEA 1L2TA 2ANCA 2YWFA 2PT7A 1EFRA 1OXVA 2GJSA 3CRRA 4GBMA 3VR2A 4BLPA 1E2DA 1HE8B 3AKDA 3AGPA 3LXRA 2JASA 1KI7A 1BMFD 1A4RA 4OJQA 1FUUA 3AVTA 4MRRA 4MYTA 2P65A 3PIRA 2VPPA 3A1WA 1AJEA 4LPSA 1YE8A 1VYUA 4MITA 3OHMA 1XDBA 2QI9C 2PZGA 3FYHA 5L3SA 4Q47A 3L0PA 1T8TA 1QHIA 4M9QA 3KTAB 1Z22A 4AI6A 221PA 4LYHA 1DAHA 4B48A 3FHOA 1JXOA 3N2IA 2QTVB 2EFHB 1G5PA 4DDTA 2RGGA 3CF0A 2YYZA 2CVFA 4HAXA 1D2NA 4IOKA 4LJ4A 3P4XA 2QMHA 3KKMA 5AJXA 1SULA 1SXJE 1G4UR 4GZLA 4IJMA 4IKEA 2OXCA 1UBEA 5K8LA 4DIDA 2QAGC 1BIFA 4URUR 3BWDD 4PSAA 4WVFA 5K8UA 3MWKA 4HUQB 4M1YA 5CIQA 5H70A 4RD6A 1U8AA 3ZQJA 1E2JA 5KDLA 3S1AA 2D7CA 1NLYA 5AK0A 2HLDD 4WAUA 1ZCBA 3IBGA 4CEJB 2D2EA 3LA6A 1QRAA 2DR3A 4O3MA 3EPLA 5B64A 2ANBA 2F9LA 5IK2A 1GTVA 3G5UA 2ECKA 4IVPA 4G01B 4N1AA 4N0EA 3CONA 5JS8A 1N25A 3I61A 3R9IA 5UKDA 1COWA 4ZCMA 3TAHA 2BIFA 5BN5A 5L3VA 4EPVA 4FCVA 4JKYA 4P0TA 5FPYA 2Z6VA 3AF0A 1GSIA 5CJPA 3BGWA 3WNBA 2ZRCA 4JJZA 4LC0A 4JS0A 1JJVA 4JL8A 2WBLC 3MD0A 2IYTA 1OJLA 2BMJA 1FNNA 3AVPA 3D3QA 1M34E 1P61B 5JJKA 1KAOA 1U0LA 4EPTA 1G19A 2PJRA 1M7HA 3QE0A 2IYRA 1MR3F 5G40A 5JEDA 4Q18A 4DLWA 1EWQA 3BH7A 1ZBDA 3ADBA 4C7OB 1GKYA 2XZOA 2CL6X 4LHXA 1TEVA 5IT5A 2F43B 2WM9B 4RY2A 4EDHA 3FKSA 3QF7A 2PCJA 4YDSA 3M0EA 3SFZA 3CLVA 3GLHE 5DIFA 1G7TA 4NYIR 3G82C 4M1KA 4WBSA 4ZPXA 3IILA 5CB6A 1P73A 4O25A 3FDIA 1JAIA 4MDEA 3I1FA 1JR3A 4Q7JB 1CTQA 3AVXA 3O47A 2XXAB 3T1VA 2Z4SA 1XEWX 2A3RA 2O8CA 4A15A 2QPOA 3X2SA 4XD7A 4UNSA 2A5FA 4CZ2A 3CX8A 4XVUA 1IONA 2ZYUX 3K0FB 5EXSA 2Q9CA 1J2JA 5CK4A 3MSXA 1EWRA 2BCJQ 4MYUA 3T1QA 4D4JA 3OZXA 2ERYA 3AVOA 3CZPA 3AKYA 3TUJC 4AY2A 4BPBA 1CKEA 1Q3HA 2B8TA 2ERXA 3C15C 3R7WB 3R8CA 3VTKA 3QEJA 1KSFX 2IUTA 1XXHB 1IBRA 3KKPA 1LY1A 4Q7MB 3PUZA 2G6BA 2K5UA 2W6JA 2RCNA 4D0GA 1M8PA 5KTYA 1U9IC 4V0ME 4YXWD 4MGYR 4HAZA 1EX7A 4DVGA 1DADA 5E95A 2X2EA 1DEKA 1LS6A 1QVRA 3BAFA 3ZQ6A 4WXPA 2GILA 1VHTA 4ZCIA 3T34A 4Q01A 4DT1B 5D3MB 2RAPA 3X1ZA 2ZRFA 4Y0AA 1VPLA 2J9RA 1II8B 2JIZD 4XOIA 4C2TA 3CRQA 1LNZA 2W6ID 4NU0A 4HZIA 4ZIRB 3CPHA 1OXUA 2CNWA 1GILA 5FTMA 5HZKA 2DFLA 2P2LA 2RMKA 3AVUA 5F98A 3TQCA 2FA9A 4QBFA 3H86A 1PUJA 3SNHA 1T3LA 1NVUQ 1HY3A 3UWOA 2ZM5A 2FPLA 1S0UA 4KBGA 5FL3A 2IEZA 2XAUA 2W2TA 2REXB 3TVDA 1DO2A 4RJLA 3RC3A 1A1VA 2O8BB 1MKYA 3UG6A 2GCOA 2KBEA 3BC1A 1KJYA 2IHBA 5CDFA 4POAA 5FBVB 3OFND 1R7RA 1QHHB 1ZD9A 3B1VA 3GEEA 1RRGA 3U6BA 4HAUA 1BO6A 3PUVA 4MRSA 3B9PA 4Z1MA 3FOZA 2WWGA 4JVNA 2ZROA 4URVR 3THWA 3ZS8A 1DAFA 2F3RA 1IHUA 4OK5A 1YZQA 4HB0A 4LJ7A 3E70C 2C2HA 3FE2A 3ZZTA 3DHWC 3EZ7A 4LHVA 1JQJC 1S8FA 3KXIA 1E9EA 1VHLA 2WJIA 2I1QA 1OH6A 3DM5A 2A2ZA 4G5GA 3TLXA 5EP1A 1T3HA 2GEUA 2IYSA 5FH9A 5CLLA 2WWHA 4TTQA 4QJ3A 2AKAB 4PPQA 3RABA 3EIQA 1CJKC 2H17A 5J5CA 1VCNA 2ZI5A 1TF5A 4AKEA 1W4RA 4YMVA 1TQDA 4KI0A 4ABYA 5BXQC 5KDDA 1ZNZA 1KIMA 1T0HB 1T0JB 5FOUA 4JL5A 3IEVA 4BFXA 5KPDA 2PZFA 2O0KA 3CPJB 4B33A 2P6RA 1ZJ6A 1R0YA 2ZITA 5FPSA 3MCAA 2DFNA 3WYGA 2FH5B 2I3BA 2OILA 2UKDA 5KPJA 1W0KD 1AIPA 1QF9A 4CEHA 2GXSA 2OT3B 2RGEA 2PMKA 2FZLA 3LBIA 4HSEA 1GKUB 4LY6A 5FTLA 1EK0A 4Q03A 2ODBA 4DKXA 5DGXA 3M1IA 4L16A 2JJ2A 4K8OA 1GNQA 2WJVA 3GJ7A 4HLUA 3QF4B 1TF7A 1IOZA 4B34A 2MSCB 4A0FA 4WIAA 4DZZA 4XWKA 1QDEA 4W5JA 3FKQA 1YJ5A 5DLQC 1NMXA 3DVLA 2ZSFA 2W0MA 2Q0HA 5KNDA 2ZSDA 3U6KA 5EP2A 2JLQA 1FL9A 3I92A 3IHLA 1R0XA 4OQNA 4AK9A 4KYIB 5GJBA 2D3WA 1KO8A 1T6NA 4LUCA 2V3CC 1ZUIA 2YNMA 1ZP6A 1TF2A 4PSVA 4TLCA 2EFDB 2QE7A 1YU9A 4R2IA 1PVOA 2X77A 3NC0C 3CWQA 1JNYA 3NVAA 2PL3A 1NRJB 2WJHA 2RH5A 4D0NA 4LPKA 1GNRA 4HDOB 2AKYA 5C4GB 1RE0A 5EUQB 1E2PA 1F5NA 4R2HA 3IGFA 1P60A 4JVSB 4RKFA 1R5NA 4A82A 4XTRA 1NVXQ 2RGAA 4BFSA 1VTKA 1RKBA 2GBLC 2JDIA 2QU8A 4Q02A 3W6OA 3FMFA 1XCPA 2J59A 4IOJA 2WV9A 3HR7A 1ODFA 3LFUA 1H8EA 1XU4A 4Q9KA 1U8ZA 1VDZA 5LD2B 3GLGB 1WBBA 4BFYA 4CEIA 1IY0A 3QKRA 4LI0A 2ZRAA 3T5GA 3IO5A 3RC8A 1Q12A 4NH0A 2CJWB 1ZIPA 2ZJ2A 3K09C 4KSBA 1NIJA 4AG6A 1Z08A 1XPOA 3A4MA 4HUTA 1ZUNB 4UNQA 3W8RA 2CCGA 4ESVA 1U0HC 1X8KA 4D25A 1DBSA 3EZFA 5HE9A 2EU8A 1ZC3A 4JLPA 1TNDA 3M6AA 4DJTA 2FV8A 2BVNA 2NMVA 4JLJA 3QUSA 3TJZA 1AA9A 2J0SA 1NL3A 2BV3A 4IVRA 3OIYA 4M9XA 2RKOA 3KXKA 3NTUA 3U3MA 4OK3A 5G53C 1Q57A 4DIEA 4M2LA 1ZM9A 3C4JA 4IDQA 1W46A 2GK7A 4NL4H 1NN5A 1YRBA 3R9WA 1KI8A 2XITA 2QMOA 4MYCA 1CRQA 4EFLA 3EA5A 4RZUA 2OXRA 4Q1BA 2W0SA 4Q21A 4D4KA 2AD1A 1E3MA 5AUQA 4RD2A 3GLIB 1CBUA 1F6BA 1DG1G 1ZMXA 2EQBA 2IYWA 4U02A 2VHJA 4F7WA 5FBQB 4PO8A 1X3SA 2QNRA 3AP2A 3SR0A 1G21E 4ARZA 5TB5A 1CR1A 2D4HA 3FTQA 2HT1A 2EFCB 2ZIAA 5E7IA 3T5DA 2H5EA 5LD2C 5FOWA 2A9KA 2ZS9A 2OCPA 2WOOA 4FXPA 4DLUA 1WA5A 4TMZA 4BZXA 3U7GA 3NDBB 4LJAA 1RC8A 5BYKA 3W34A 1E1QA 3CX7A 1QHGA 2CLCX 3ZS9A 3U4QB 2WJGA 3M4YA 4MDFA 3DOEA 4B44A 1UPTA 3KQUA 2ZRMA 3WP0A 1WE2A 1DARA 1CJTC 3DOFA 3NBXX 2FGJA 3PV0A 1DAMA 4IFEA 1KK3A 2FWRA 4Q9JA 2ORIA 1UKVY 4Q1EA 4ASUA 2OAP1 2RGNC 3LAWA 1KJWA 2ZSAA 5DI3B 4TYYA 1DAGA 5HE8A 1G6OA 2GJKA 1ZNYA 3IO3A 1P2UA 3EG5A 2VA8A 3ADKA 4TN1A 4MGZR 2AX4A 4KFRA 4BQSA 5GVRA 3BB3A 4JBYA 2OM2A 4AG5A 4OYHA 3RWOA 1NLFA 5M04A 1II9A 5DN6A 1E1RA 4CT5A 1Q44A 2H1LA 2VF7A 4L5BA 4NDZA 4CGZA 5FBRB 3TUZC 4GOKA 1NKTA 2QGNA 4V0KA 4LYAA 3GJXC 1VECA 3JZMA 1P2VA 5JJLA 4BZQA 1UBFA 2WKQA 3SC3A 4GRAA 2Z0MA 4RCYA 1YR8A 4OI0A 4PSKA 2Q9AA 5LB2A 1S3GA 4QHTA 2Z4RA 1ZCAA 1Z47A 5JWRA 2GNOA 1N6LA 5JZVA 5JSZA 4Q4JA 2G1JA 2R6FA 4JKIA 3TGPA 1E94E 1CXZA 4A6PA 3AF2A 3U7FB 1GAJA 2HJVA 1KDOA 4IRUB 4QC2A 3TW8B 2WSMA 3F5FA 3NHAA 5AUNB 5CM9C 4LV8B 1EG7A 2ZI7A 1T9HA 1SKYB 1WBDA 2GA8A 3GEIA 3X1YA 4RFSA 2DY1A 4BUJA 2IW3A 2R6CA 1S96A 3EWAA 1JALA 4JLNA 1WMSA 4OHYA 4IDHA 3EC1A 4A92A 1MRSA 4FMDB 1DE0A 1PLJA 2OBLA 3D7MA 4JSYA 5SZHB 3TKLA 2YC4C 2QAGA 2XX3A 4A6XA 2QAJA 1JPJA 2GF9A 1II0A 4DBLC 3BB4A 1KI6A 1Q22A 1E99A 1Z6YA 4PPFA 1WF3A 3RWMB 5F9FA 2IUSA 4AKIA 3L82B 2ZJ8A 3FVQA 3MRSA 4GMDA 2JJ1D 3O8DA 1KOFA 1XD2A 3A36A 2FDCA 2QMUA 1N5KA 1XJ0A 2WSSD 421PA 4ACBA 5G3ZA 3SYLA 2CK3A 2OEPA 2PEZA 3MMPA 4QNRA 4D0LB 2FPKA 2P6NA 3U7HB 2P5SA 2NG1A 2VYFA 1OLOA 3EARA 1VMAA 2YINC 1M7GA 4NTZA 5AJYA 3RS0A 1P72A 4MRNA 4O2RA 4QKQA 3EPHA 2FGKA 3NH6A 5LBIA 3IHWA 2A7QA 4QXAA 1F2TB 1W5SA 2XTMA 4AIIA 3NBYC 5JCPA 1DS6A 1QZXA 1G8PA 1KI4A 4W7SA 1TTTA 3CPEA 5FPTA 4JLKA 3K0EA 4IEEA 3I32A 2WWXA 4HI0E 4H1UA 4RZ3A 4FCTA 3QEOA 4Q9HA 3BXZA 5BYJA 1N0WA 2ZJAA 1Z6GA 4U7DA 2D06A 4HLCA 1E2LA 3I8SA 4Q1CA 1T91A 2X19A 3CBQA 4TLAA 2QL6A 3UATA 3VX4A 1XRJA 1SKQA 3EZ9A 3R9XA 4U5XA 4Q7KA 4XWOA 3IDQA 2FSHA 3C41J 4NYIQ 3EZ6A 3SBEA 3SYKA 2ZYWX 1Z0IA 4C0QC 1B0UA 1OE0A 4KBFA 1XB2A 3HR8A 2IC5A 3NEYA 3ND8A 2HF8A 2ZYTX 3LX5A 4HUQA 2XNDD 1TUEA 3PUYA 5J4VA 4V02A 1MV5A 1U0JA 1KMHB 2BMEA 2WAXA 3K53A 4TLBA 2WTUA 3HDTA 2LWIA 4RD3A 1H65A 4A2QA 3UIEA 3LLUA 3WRXC 1CJUC 1T5IA 4R98A 2QMEA 4UJ5A 4YDHB 2WWFA 3RRZA 4NBSA 2WVJA 4TYWA 1G16A 1KMQA 1L7VC 1Y63A 2QSZA 1Z06A 5LDDC 4HATA 1FMJA 1RRPA 3CIOA 2ZRIA 2F55A 1ZIOA 5CM8B 2JLXA 1Q21A 2P5TB 2XNSA 3FWYA 4BZPA 1XNJA 3ZJYA 4LK2A 1VYTA 4HZUB 1PLKA 1TQ2A 4NKRA 4QBGB 1KI9A 2A5GA 2WOJA 3WP1B 5IDVA 4NONA 4M1OA 5HKKD 1ETUA 3HJNA 1OV4A 1QHYA 3IIMA 5IRCD 4MUBA 1W4AA 3H84A 2DWPA 3G0HA 1Z0FA 1F48A 1IJFA 4FINA 5CITA 4C7OA 4B71A 3HYTA 5L8VA 5HR5A 1FUKA 2R2AA 2F43A 2AWOA 2AXPA 3T1TA 1L4YA 5BN4A 2GTPA 2AHOA 4PHTA 3K70D 2OCBA 4EPXA 1XZPA 1E79A 4TYPA 4D82A 3EXAA 1YZNA 3X1DA 3SI7A 2O0JA 4C0KA 2N1BA 2XB4A 1IN4A 4QOSA 5H1YA 1E79D 1SXJB 3AKEA 3KB2A 2GJAA 521PA 2VHTA 1AZTA 1Z07A 2YOFA 3MFYA 4OHWA 4U00A 2QP9X 1K8RA 4RKEA 3OAAA 4I99A 4OI1A 1HV8A 2Z5FA 4OL0A 4KO8A 1YR9A 2G3YA 2Z83A 4BFUA 1RFLA 4JLVA 4X8LA 4AKGA 1U98A 3F0TA 4I4LA 1EFRD 4M1WA 1ANKA 1UADA 3QIAA 1P9NA 3VR4A 3FFBA 2KE5A 1MO4A 4L9WA 3BH0A 2KJQA 4Q7LA 2Q6TA 3K0FA 1O87A 1FNMA 3WY9A 4A4DA 1TX4B 2VP2A 5GJWC 4ON9A 3W3AA 4M1TA
chains in the Genus database with same CATH superfamily
1K75A 4YB8A 1S2NA 3HCFA 3NTVA 1LQ2A 4MUNA 3OM9A 3RAPR 2VH5R 4WOPA 3FAKA 3RUPA 1RWMA 2FX3A 2NNWB 3VU0A 4PFSA 4MUMA 1EWVA 1MMFB 4MIKA 3EGXA 1BYUA 3I2YX 3T0IA 3W0LB 4X1OA 3HYSA 3MM4A 2RI6A 3HN2A 1NI4A 1WXQA 1XCLA 3Q8XB 4UNIA 1CF9A 2I6TA 3OOSA 4D9NA 3CJRA 1ZCJA 4KQ1A 4NJEA 4XCVA 4X90A 4RZHA 5BW4A 1NR7A 3I05A 1NVAA 1GQSA 4E5SA 3ICEA 1SZJG 2BBOA 3JQ9C 4QEKA 3V8PA 2QHXA 3AJDA 1M34B 2H9IA 2PKWA 3EA4A 4FWBA 4NDNE 4CLHA 2DOKA 2DKFA 1XZHA 2QYHA 5IH3A 4J3JA 3WLEA 3OSZA 1UZUA 3OQJA 4HEHA 4CV2A 1E4VA 4Z54A 3ZHXA 3L8EA 2G83A 3VNQA 3C14C 2RAVA 3E9CA 3RLIA 5T7BA 1KZ4A 1SHZA 3F6RA 3ORSA 1M1YA 4AROA 2ZJZA 5TS3A 2PSEA 3IHKA 4RHUA 3EEBA 1S2MA 4PZAA 5KVAA 3VOSA 3K6SB 2A88A 3R3SA 1RYNA 1JL3A 2C96A 2MTBA 2OGWA 4JIMA 2ONJA 4YRSA 3NVMB 2PJZA 5IK2D 1P3JA 4YP7A 1IM2A 2ZSHA 3DWGA 3NBZC 3FWHA 4DSZA 3LJKA 5F5LA 3L01A 5ITZB 2GRJA 2ZTMA 4HNUA 3OU6A 3CJQA 1G20E 3HGTA 3H2IA 1BHSA 3FCXA 3HVJA 1SAYA 4P4TA 1NNEA 4DGSA 1DPFA 1KK2A 1A7UA 4FYIA 5G2OA 4DR3B 2PU5A 2AMFA 1V8FA 1L7EA 3OQBA 2HLPA 3YASA 4YRAA 3DDUA 4C0LA 3DXXA 5GGXA 4I2NA 1LB1B 1JU3A 1LBTA 1CB0A 1L7RA 1NMQA 3UCXA 4D81A 3UMSA 4M0CA 3K0CC 3MIIA 3BIFA 3OZVA 1VE9A 1LKZA 1V7QA 4KR6A 4LXGA 1MVOA 1LH0A 1L4LA 1JWAB 2GVDC 2ORED 2R66A 4HDSB 5TQVA 4GFDA 1CZHA 5FOQA 1I6WA 1YZUA 2Q9UA 4LWZA 5ARBA 1BD3A 2GAOA 4HVTA 2OQVA 3C1UA 3ENWA 2PV7A 3A9UA 1UKEA 4UXIA 1DXQA 4Y0VA 4J4BA 5DM4A 3G79A 4YRNA 3O1HB 2I1WA 1RQXA 2H1SA 5AM1A 3KJNA 3Q3CA 2KI5A 4XLTA 1AS2A 3COSA 3M4JA 4XX0B 4P6VF 1KI1A 3VPFA 5CLIA 1PUXA 1TL7C 3H3XA 2JLYA 2UU9B 1N3YA 2YWGA 2YJ3A 5A5GA 1IK6A 1M2OB 4OMCA 2AW5A 5A7GA 4JOCA 1YGPA 1QGOA 3KHTA 4P8RA 4IIHA 3NAMA 1OKKA 1NUSA 1RLOA 4UBOA 1R0RE 3BE6A 3I4FA 2IRWA 4ONEA 2XWBF 4F96A 4Z4EA 1N2IA 1THGA 4KLAA 1JR3D 4YCCA 1OASA 1SQ0A 1UC8A 3K31A 4E30A 4EPWA 4Q4HB 1INLA 1SRQA 3RT7A 2GBLA 4NABA 4AW9A 1PW7A 5L53A 2Y1KA 3MGGA 1M1UA 3ASZA 4XD7D 4YJFB 4Z8XA 3U0BA 1Z5ZA 4AN4A 3O90A 4FE3A 4BWVA 1ELOA 4C89A 2GK6A 3MUNA 3T15A 3MWEB 4RYLA 3T3GA 1NN0A 4KXLA 4EJFA 5LIRA 3OQOA 2IS2A 3UXMA 1ZISA 3C8UA 4PEVA 3AHDA 4EW1A 1NG9A 4WD3A 2DQYA 2VDNB 2ILTA 4N47A 3V8NA 1KQOA 2B4KA 2WK1A 2BJHA 3WJ1A 3ZWOA 1E8DA 5BMVA 4EYKA 4ZT7A 5TIIA 4TMTA 2WLSA 1FUYB 4P92A 4ZCRA 4DLRA 3RTDA 1ZCFA 2Q4EA 1YDFA 5H8WA 5I47A 1CUYA 3ABZA 3QF4A 2RGCA 1JJBA 1DKUA 1S1CA 1A9ZA 3JD2A 2I29A 5CYPA 3DYBA 3IPAA 5EZYA 3AF6A 4B84A 3VAAA 5L3SB 1TMYA 4DNPA 2O0MA 3WLJA 2ATCA 1VG9B 4HEJA 4J29A 5BW8A 3G8CA 3C70A 3H9CA 1U31A 1KYIA 2EGUA 2X86A 4MS1A 1E2UA 3QPAA 2MWMA 4QVGA 1BNCA 2KLBA 3AY7A 4KRGA 4EEZA 3VGPA 2R751 1AQIA 3CF6R 1L5QA 2J5XA 1K63A 1UL1X 4PLVA 4AF6A 4B4DA 4E5YA 3BL8A 1CERA 3NGMA 4REOA 2ZSEA 4F92B 1X13A 1LBQA 5J2UB 3ZV6A 2A9VA 1CY8A 3QBJA 4PR3A 4RVFA 5FBHA 3AJ8A 4OA5A 3O8BA 1L4KA 4ZCTA 1VKHA 1RWKA 2AXNA 5LFAA 1CYDA 1KC1A 1LDNA 3AZPA 1W0CA 5A06A 3RUHA 4H16A 3IVXA 1REQA 4AZ0B 4KSYA 4XEUA 5F23A 1NUAA 4DSAA 2B1GA 3IQIX 4YCSA 3REFA 3GGJA 2IYQA 3S1AB 3ZE0B 2IP4A 5HHTA 1IZ7A 5TX7A 2W4MA 4FIZA 4TPKA 2PX6A 2PLNA 1U1IA 3N39C 2HMWA 3TPCA 4KUGA 1IZZA 2Q41A 4EG6A 1JLLB 1XFAA 2LKDA 2W6NA 3TBHA 4WLUA 5MDHA 2VPXA 1J2YA 2FWMX 1ZQ1A 1SPXA 4UBJA 3TECE 3U7QB 3QOFA 1HOTA 3Q9LA 2OSVA 4GR5A 3LV8A 3BXPA 4PQYA 1PFWA 2WIBA 2Q21A 1YR3A 4RL6A 3UOAB 4BQIA 4Z0PA 4Q1FA 2EW2A 1RLMA 1WNFA 1ZUNA 3CUWA 3P27A 4LJ5A 2X0FA 4QYIA 4Z1MD 1O94C 2WU8A 2AH5A 2C8VA 4GLLA 4I5GA 4XGIA 2QN6A 1LZKA 5DT9A 4EJSA 2WU0A 1W93A 3RT1A 3H16A 3NDPA 4GX0A 4JLUA 2RGBA 1KKLA 3SKVA 4CF6A 1F5SA 2IPAB 3MPOA 5DHSA 1K27A 3IR5A 4OYRA 4XWWA 1SGWA 2OAGA 3IAS6 2PHZA 2VDWB 1JDTA 5K0CA 2PX5A 1Y82A 3IXQA 4RA6A 4RAOA 3E1KA 3TW6A 4OQFA 3MUOA 1T8SA 1GLNA 2E5LB 4NYJQ 4IXNA 4FIDA 4MPTA 4KLCA 3I04M 3R7NA 3UC9A 1AF7A 2PRZA 4GVXA 3SZOA 2VDPB 4DYVA 4BVGA 4ZI2A 4BRWA 5A6SA 3GAMA 1ODSA 2I4IA 4UUMA 3OEEA 3AHGA 5KNCH 2CNOA 1MFPA 2PMEA 3KQTA 2FR8C 4FR0A 4BO9A 2HAEA 1U9ZA 2DWOA 1XI2A 2JHFA 3PNOA 5FOTA 1FLDA 1RQGA 2QW0X 5FBZA 2JLWA 2YXPX 4JQOA 4DQDA 4A0HA 3PUWA 4PLYA 2YJ5A 4OVKA 1TADA 1IHYA 4DMCA 3GRVA 3DEKA 3R5FA 2GARA 3ENZA 4UREA 3CZCA 2GDJA 4NE7A 5B30A 2HNAA 2TMKA 4JYZA 2XECA 1MDFA 3F2IA 1VJ0A 1V0JA 3OCZA 1FXSA 1VHWA 3UJAA 1YRHA 2VTKA 1XQ1A 3RHZA 1RYZA 4IJQA 4KP7A 2J0QA 4NARA 1KDPA 1JFFB 4XFKA 4DMMA 3W3ZB 2RCYA 4B32A 3OQVA 4LYJA 1IJEA 1C4OA 1O95D 1NN1A 3FMIA 3B85A 1V5GA 2C9MA 2I4OA 4WUTA 4QARA 1AQYA 4UZSA 4S1WA 2IS1A 2YVUA 3C3YA 3DL2A 4XTCS 2OZEA 4ZI3A 1YI8A 3IALA 3UMYA 3RYCA 2ZREA 4HPJB 2IH5A 2PMDA 3G49A 3RRMA 4EABA 3DFIA 1D5WA 3MNFA 5JWOA 2HWYA 1T3GA 4RU1A 3CCFA 2MMCA 4I5IA 2CMKA 4FFWA 4N7RA 1YC5A 4CT4B 1RT9A 3DXYA 2YNMD 3JXEA 1ZK1A 1TW2A 1UDXA 2VQDA 1G3QA 1AZLA 1J7JA 4PRKA 1KZ6A 4AF8A 1AGRA 4RUKA 1XK7A 3BXXA 3GOHA 1W49A 821PA 2V3WA 1H4TA 2XMRA 1UBOS 3KUUA 2P9JA 2Q4RA 4HWRA 2JLAA 3EK2A 1VL5A 4CKEA 3QQ5A 1UKAA 4TS1A 1GEGA 4G8CA 5FOVA 3ZHTA 1A9OA 3F8TA 4RSHA 1XL0A 1FYDA 2QRZA 1S8OA 2FFAA 2Z57A 3HABA 2OBFA 4HY3A 1RFGE 1QE0A 3LXMA 1E5LA 4DSOA 2PS0A 1G8GA 1C3OB 1QPGA 2W2VA 4BLQA 4KBYA 2BHLA 4ZJUA 3FHTA 1VOTA 5CT4A 3SJBA 5JFGA 1IDOA 1H8ED 1XTKA 5J4VA 3EUAA 1O58A 2Z8ZA 3O3MB 2RHWA 3PC8C 2Q7XA 2ZBPA 3KPVA 3MMSA 3QBVA 1JG6A 4FOTA 4GOND 4QGFA 3CVJA 1V1MA 3OUUA 4X6LA 3TSYA 1Q3KA 4LCEA 4F71A 4R9UC 3ODGA 3QPVA 1OPRA 2VOJA 4TZTA 3W2FA 2D2FA 1L5SA 3L7LA 2V55B 3HSSA 4U2GA 4OUKX 1FP4B 3IQXA 1NVVR 1PD1A 1EVYA 1XZAA 2HGSA 1Z4PX 1YXMA 1CS0B 2VO1A 2HDNB 2A4MA 2RONA 1ECCA 4IPTA 1A77A 2PIAA 4ESHA 3LLMA 2R0QC 4TXJA 2DHCA 5CEEA 1G2OA 3B6EA 1WOYA 1RCTE 4JYAB 4BC1A 4KX5A 3DZHA 4P5EA 4IHKA 4UD6A 1JE1A 1QLHA 3NNDA 4FEYA 4FYJA 3UT0A 2QTBA 4YY3B 1J00A 1JA0A 3M4ZA 1YZVA 2XMQA 3BIXA 3ZX4A 3AT1A 1RWOA 1ILEA 1MX3A 4BV3A 4KAXA 4FSDA 1UFRA 5I45A 1XEXA 3MLAA 5E38A 3AL0C 2VYNA 3RC9A 4WOCA 4BE9A 3FOEC 4B3TB 3IEUA 5L3RA 2EEZA 3JVVA 4MROA 2HTFA 4OQLA 5JPDA 2HDOA 3P0IA 4LDAA 2OK8A 4ZAVA 5G0VA 2EXXA 3VU3A 2WIAA 3FWPA 5BY2A 3DMNA 1QVWA 1ZM4A 3B2EA 2XRYA 4ES6A 3KOMA 2VRNA 3LDGA 1H2XA 3I2KA 4MKXA 4QU8A 5I51A 4FGWA 4WA7A 2B5VA 2W2KB 1MO5A 5AXAA 4FDUA 4S1OA 4Q37A 2NVUB 16PKA 1ZR2A 3KBOA 4WESA 3T5AA 2O3JA 4ZRNA 5HMLA 2Z8XA 1F60A 2FU5C 3FFTA 3T9DA 2VZEA 4LI3X 1BFDA 2EYQA 3WQHA 1FXWF 2IZ0A 1U90A 3B1FA 4R9VA 3I2GA 2VG8A 3PC2A 4YALA 1T1JA 4YFYA 4B6JA 2D2VA 1OR8A 2ORWA 1CRZA 1K3UB 1LV7A 3HY6A 1QGUB 4LISA 4W1SA 2MSEB 4F12A 1P31A 2NT4A 3ICQB 1P7VA 4JVLA 1HFEL 3BJZA 1RHUA 3H9JA 3UMGA 1FSPA 1V95A 3CLTD 2NZYA 1PJSA 4OHXA 1OHHA 3GF4A 4GS5A 3BE4A 4Z2AA 3DTVA 4C43A 5IPFA 1MAAA 4DUGA 3Q41A 1R8SA 1TECE 2X9GA 3IQZA 3WYBA 3LLCA 3UJ3X 4MUEA 5KINB 4OB7A 3LC0A 4NCHA 1W2WB 4QYTA 1Z8FA 3WIUA 1N0HA 3IIJA 4YMSA 2RI0A 3HRKA 2DQZA 1XEFA 3VO1A 5AVXA 5LP6F 2GXUA 2DPYA 2J07A 6NULA 5KDOA 2VA9A 3NONA 2W6QA 3EEOA 2PGXA 1X3LA 5EJFA 1RWWA 3UMVA 1HDZA 4MR7B 3ESBA 5BSFA 3NWPA 3Q3IA 1Y0BA 5K7SA 1GNLA 1VIAA 2BGJA 2BI7A 2C9OA 2HMUA 4NQRA 4E5DA 5FLKA 1FP2A 2F2TA 1UWCA 4EF6A 4QSMA 1NF9A 2JGJA 2X13A 2FPGB 5DWDA 3R75A 2JEOA 3DBLB 4BS9A 1CC1S 2V7QA 3RQSA 4INOA 1P0MA 2ZIWB 4CJXA 2IU0A 4MQFA 1X7XB 2OBNA 1RWQA 2XIJA 4WFKA 3FKJA 2C88A 4U8GA 4CFZA 5ECWA 1M2VA 2ID9A 3FNFA 1LF0A 4FHZA 1SG0A 2RG1A 2Z56A 3PKZA 4GOJA 4O08A 1ZR4A 5ADHA 1P3DA 4QYWA 4W1PA 4FN5A 1Y1PA 3P9YA 4FZ5A 4LDNA 4H3VA 3VR6A 5DTMA 5CA1B 1E2FA 3ILYA 3KSMA 5EMMA 1L4MA 2QW8A 1FDTA 2CC2A 3RYIA 1M6VA 1WZIA 1E0KA 1A4UA 1GYQA 2RC5A 1PT9A 1MRZA 3C5WP 2ODPA 4K6OA 4LDRA 2QRMA 2HMTA 3A6EA 4HMOA 4O29A 1AKRA 1JIJA 1FZQA 1YULA 3HYLA 5D3QA 3ZWQA 4EGJA 4L9RA 1HSOA 4ENTA 3SYMA 1KIAA 1E9CA 5HTKA 4KQCA 4CF7A 2I34A 3S1SA 2B8WA 2ZPUA 4RD0A 1DELA 4Y9TA 3IAM1 4KQFA 1R6DA 1ZI8A 4Q66C 1HZZA 1OWPA 4B3XA 5HZKA 1Y4SA 1N9KA 2AL7A 2BHRA 2WTXA 3D3JA 3JD4A 2O6HA 3NUGA 2OPHA 3ZCUA 1G3MA 2KWIA 5LZ5A 2Q5IA 2XJ9A 4K2HA 1UFOA 4X3OA 3VI3B 4ENQA 4Q3NA 1M73E 2NZXA 1KDRA 1R27A 3F7TA 4GU5A 4YRQA 5DTRA 3NJ8A 4LRQA 4C2UA 4TQAA 4YDQA 2JGRA 1PFQA 2L2QA 2CK3D 2M6SA 3T3DA 1ISPA 4P7KA 1GARA 2CD7A 3IQFA 1C1YA 3V48A 4H7HA 1J8MF 3NFRA 4QU5A 4GM1A 4E03A 5K03A 5F1KA 2W6ZA 2ZIXA 3VR5H 5C37A 1XCGB 3KX2A 2ZXUA 1S2IA 2LUOA 2Q3DA 3U56A 2ATIA 5HA5A 3ZBQA 1FVFA 2AK2A 4C4YA 3DLBA 3IKJA 2GSWA 2EOAA 3K8YA 4Q1DA 3EULA 4X1YB 4BLTA 4AUMA 4P9NA 4NZNA 4ZVSA 4I3GA 1Q84A 3JZDA 5DGCA 1V43A 4OHZA 2ESRA 2V5VA 4GC5A 3L0SA 4GPBA 2X2PA 3K0HA 3V4FA 2FNAA 2GM9A 3PR3A 1Z4KA 1E5VA 1P1CA 2GFHA 3DDZX 4FCWA 4OHOA 2B6HA 3WAKA 1SCNE 4MYDA 3OZBA 1E8MA 1MQ9A 1FFWA 4LRWA 3M3HA 4F6RB 5JXJA 2MSNA 4H35A 4O63O 1JT9A 2OZVA 3K9BA 4X61A 4Y2HA 2VUSA 2QG9A 5ICGA 1UAAA 3WIEA 1ISFA 4HFJA 2B1JA 5T4EA 2WFMA 3WK9A 4QLBA 3NCHA 1AM4D 4YPVA 1X92A 2I7TA 3I52A 3VDMA 1ZRHA 3SBDA 1STOA 4AYTA 1FQKA 1ZYUA 3FPSA 4QGBA 4F38A 2XJ4A 1PKEA 1L3CA 2RDMA 3Q15C 4KKVA 4EL0A 1USIA 4JBLA 2W2XA 5LP6C 3DLHA 1DG9A 3VVLA 5A2GA 4ICIA 3TS1A 1HEUA 1X1CA 1UT5A 4E5MA 5KYWB 1SURA 1U3GA 3Q0IA 1GTL1 2H51A 4P53A 5EPUA 2XAAA 3ROEA 1S2DA 2CXQA 1Q0SA 1W96A 2GD0A 2WJJA 1B3BA 2XF2A 3L1KA 3UW3A 4WZBE 3EISA 1EK5A 1OIWA 3ZCTA 2J6CA 4QXOA 1RWVA 1VG1A 2JGIA 3VSAA 5D5QA 4FC7A 2VQ6A 4JI8B 3MHPA 4ARBA 2ZUEA 1BWSA 3JWEA 4IIBA 3UEOA 4BNUA 3H5WA 4YMUA 1RW4A 1BCSB 3AHHA 2J0UA 5GZ1A 4RMGA 4G9BA 4Q15A 4UVDA 3RIEA 3OLCX 1RTTA 2Q28A 3BCSA 1EE1A 1WCIA 5EAIA 3IUQA 4Q9IA 3OO1A 2H1VA 4MW6A 5ALGA 1KOLA 4M1MA 4NCBA 3KFXA 1U2TA 4ZKEA 4ID9A 2CUTA 3TEFA 5KVSA 4AJPA 3U5ZB 3CLHA 2DF8A 5I7RA 2VAMA 1FDVA 2DFPA 3A10A 4MRMA 2QL9A 3WDSA 3OFJA 4KXYA 1HH4A 2CXNA 2F67A 3SVZA 5LNK1 1J0AA 2B1RA 4TTSA 3GNQA 1RXVA 1IPHA 1ZOLA 3A28A 2ODQA 4PAMA 3D9QX 1MAHA 1AZSC 3TLKA 3ZVLA 2XWJI 3T4EA 1U9YA 1OX5A 2GZAA 4XB6B 2DH5A 4CTNA 4LHZA 4TXHA 3E22A 2AQIA 2BGRA 3KVNA 4ENWA 2ZRNA 2P4QA 3ZY4A 5AW1A 5DM0A 2IP1A 1IG3A 1UIRA 1PQUA 1N6PA 1V6CA 3FYUB 4AJOA 1J25A 3O93A 3FMPB 5AKJA 3B78A 1GQ2A 2WNHA 3CZMA 1GUBA 3EIFA 3IUMA 4D6XA 2EKBA 4LFBB 4F3TA 1JHDA 4N8DA 4O33A 3W8EA 1CJVC 1D1SA 4WN9B 1L5ZA 3PD1A 4ZYXA 1QE5A 2DP4E 2R11A 2CLSA 4HO1X 3S40A 2FEOA 2JAQA 4HNQA 4B1FA 3AK4A 4PNHA 3KV1A 7GPBA 1D03A 4E6EA 3OE7A 4NC9A 3CLTC 2PG3A 1FTWA 4H4DA 4S12A 3ZNPA 3EQ2A 5AVSA 1NMZA 3JQBA 1Z4LA 2ZJ0A 2P3SA 2QRLA 2F3TA 3O8QA 2GXAA 5IZCA 3E4CA 3H2YA 4EUNA 5CFOA 2A5JA 3NTQA 3GU3A 3R41A 3G68A 5AD1A 5CYOA 4YRRA 3T5BA 3OEYA 4M0PA 1KDYA 2R47A 2X6QA 1TM3E 3IERA 1I3MA 3AEXA 4XI9A 5TRTA 2BRUC 1VPEA 7MHTA 3DM9B 2HWUA 2YJGA 3NRJA 4D6PA 3QKIA 2YVKA 4R6WA 4AQDA 1PS9A 3VR3A 5LPNA 1QFMA 3KEOA 4FLMA 1ZKDA 4D46A 2F9MA 4CW7A 1RWXA 3VMFA 2FAXA 4UDOA 4C6TA 4UUOA 3SS8A 1KEZA 4LWOA 2C4TA 1CNEA 1F4VA 4F85A 1DMSA 1VL8A 3ZY6A 3I6YA 2ZJBA 3FOWA 4HDRA 1JG3A 4Q3CA 4K9SA 2E85A 3MJDA 3Q1LA 4C1NA 1YHZA 1WY5A 3MAGA 5D84A 2W48A 1YV9A 3EQ9A 4YIKA 1G2IA 3ER9A 3V4PB 5EZ6B 3LOQA 4OIMA 1Z35A 2VCYA 3V1LA 4TL9A 4LBYA 5F35A 1I1OA 1XU7A 4MW5A 2RGXA 1PDVA 5GWXA 1FSSA 4NIMA 3TEMA 3RFXA 5FFMA 2ET6A 4GYWA 5LOVB 3WK8A 3PLRA 4OAPA 1QRSA 1PF7E 2W8ZA 1P1BA 1SXHA 1OH8A 1BG6A 3I6IA 2WFLA 3WIDA 3X1MA 2E49A 621PA 4X24A 3IBYA 5KOJA 2PFKA 2PR2A 1MH9A 1O9BA 5CX4A 1KEEB 1O4WA 4MZDA 4Y2YA 5K45A 2XZLA 1Q77A 4TKLA 4BQQA 2IK8A 4FP9A 4NFYA 2IXGA 3C24A 5EQDA 4JWTA 3ELUA 1MA3A 3DEIA 4NK5A 1IHDA 5EKTA 2BBWA 1TC1A 3C5HA 1F20A 2QW1A 2PTHA 3UWPA 2UXCB 2X1VA 1OXXK 4UM5A 3ZVRA 4D02A 2BEVA 3J81k 1OFHA 3F3SA 1J20A 4RAQA 4W99A 2JD1A 5HRUA 2AMYA 4G0OA 3A31A 4HB3A 4TKMA 2FQQA 4PG7A 2QUKA 3URMA 2O8DB 5AI9A 1KC3A 3L1IA 3UKJA 3UJ6A 3QUQA 4ZALA 4C4RA 4G09A 3IOBA 5BWLA 1Z75A 4F2DA 3I6QA 4G3XA 2ADOA 1LK7A 2H18A 2R1VA 4IO1A 4QHSA 2J9FA 2X8AA 1KDVA 4KR9A 1FRQA 3IELA 4NOMA 2HN9A 4JEHA 3OE5A 5F3WB 4NECA 1XCOA 4E07A 4F4DA 4UM8B 1VLMA 1YB2A 4K1XA 5KVQA 3OICA 4TT3D 4BXOB 4U3JB 4MS4A 3B36A 3PNVA 4DJAA 3N2KA 4KGZA 4X91A 3QVGB 4YREA 1X39A 3VHLB 4B87A 3ER6A 4DLBA 4YMWA 1MRNA 2XEXA 2BWJA 2YXEA 3PT9A 4BLWA 2WVHA 4LX0A 4PLTA 1PQ4A 4E22A 3AWDA 2QS9A 3KALA 1I4TD 2QY6A 4J0EA 5KYYA 3OTOB 3BUSA 5MFZA 3B70A 4NJMA 2QP4A 2ILVA 4TV8B 8ADHA 4O2AB 2HR1A 3UJCA 4S04A 2XMDA 4KHPB 4UVIA 1DGQA 1WUIS 5JAUA 4AMUA 1UIMA 4LZNA 1HLFA 5JCOA 4MULA 3RU3A 2IIVA 1CHDA 4C0BA 3M5WA 1OWNA 2W8BB 1H8HD 1V4NA 2CYAA 4KG7A 1GA4A 4Y2SA 5IYZF 1TCCA 3KWMA 4YCMA 5A6VA 4JC5A 2ZSBA 3TAUA 1U8TA 5H9WA 1XRQA 3U3JA 4HS4A 4WXRA 4DEXA 5COQA 5GADl 4JI7B 4GLFA 1OAOC 2D0OB 4UVEA 5IAKA 4X6UA 3SKYA 1BD4A 1K6EA 3FTFA 3D8RA 5F1YA 1H22A 1P4GA 1U5CA 1G8KA 5EE3A 1XDWA 5K3SA 3BL5A 1VLZA 3OKAA 4WKGA 3V8BA 5JATA 2J7KA 1XMIA 5C53B 3L05A 3FSGA 1SCDA 5KNBA 1Z8DA 1Z12A 1Y33E 1Y9JA 3Q7IA 1ZKMA 2XLCA 2WKPA 1BX1A 2A0WA 1RHJA 2HHAA 4LJKA 4W8HA 1TQ6A 4ME6A 3GH3A 4UDYX 4DCJA 2NO7A 1Q0UA 1E3EA 2YW9A 3TK1A 5KZMB 4LYDA 3SSNA 2WICA 3IC5A 4WZAE 2C4UA 3M1AA 1NMYA 2GXQA 4PC1A 3VVMA 3WGTA 4EB6B 3ZHQA 1BS1A 5H16A 3DEYX 1WZCA 3C8MA 4JEIA 4DILA 1ZGGA 4NP6A 3FVVA 4PLCA 1GDHA 4C30A 1HEYA 3AOEA 2FVXA 1BA2A 1FFEA 2AWNA 4OGLA 2L0XA 3IR7A 2KMLA 3IE1A 1X7WA 2WNSA 4BWGA 4FFOA 2ALJA 2QD2A 5FUVA 4EDFA 5FP0A 4I9FA 5AK3A 1QXSA 2DT8A 3TTVA 1E6MA 1ORHA 1V2HE 3OESA 4P4SA 5IN5A 4JHXA 3L8GA 2QQGA 3DVAB 3PDUA 1DLIA 1A04A 5JVDF 1SG9A 5JZOA 1BE0A 1SU4A 1Z83A 1RYHA 1KY2A 1BQ3A 4JD5A 4D9GA 4KMRA 3I5AA 2G1KA 4R83A 2HF9A 4I5FA 2HCTA 1NQOA 5IYZA 4RTPA 5AUPB 3JQEA 1VI5A 4IHAA 3RYFA 4QJBA 5JYBA 3FAZA 2NXNA 3K70C 2AI1A 3KQWA 5AOVA 3VU9A 1M66A 2KHZA 4JKOA 4WZ6A 4OYYA 2BDUA 3HO1A 2C7VA 1U0NA 2OCAA 1RYEA 2BM1A 2O07A 4AJIA 1QMGA 3B53X 3MG9A 4OU5A 5FAXA 4YRGA 3OM0A 2V5AA 1T8WA 4L6CA 5BUSA 4KMOA 4EM6A 5CFQA 1TI7A 1AKQA 4M88A 4D4GA 2E4ZA 5FXMA 1DXOA 4KV9A 3ZZUA 1ODIA 4PZEA 5F76A 4Z6KA 2PLAA 1M1YB 4QWMA 2OY0A 2HU2A 1K86A 2GX6A 1MNQA 3ABOB 4FGLA 2QZSA 4N39A 4DCVA 4HSGA 5TDHA 2ZZMA 5IVPA 4UCWA 1YZGA 1Q1BA 2HV8A 4M3NA 3N76A 2ZU0C 4K9PA 1TYEB 1NY5A 2BFPA 2LE0A 1QIGA 5I9MA 2Y3IA 1XXHE 3FDFA 2H1OA 1V11B 2B61A 1SPBS 1ZMRA 4FTWA 1SVMA 4DW8A 1AHPA 3L0DA 3NUQA 2XEDA 1GCOA 1I2MA 3NT5A 4RHFA 1KWGA 3V4RA 1OZ0A 3D6NB 3AQ4A 3OFNA 4QU0A 1OI3A 2C78A 5JHGB 2WKSA 3P2YA 1FDOA 1ID1A 2H8KA 2RGDA 2P6UA 2RHOA 3GJYA 4NESA 2QPAA 1MX5A 5DGHA 5EJIA 3I8OA 4OAOA 4KPFC 1AK1A 3DE1X 3C3EA 4QM7A 1CRLA 2FF7A 5JVDA 3EQ8A 2ZJ4A 1CQXA 1JH9A 3SC6A 3DS8A 1JKIA 1CJBA 1OC2A 1TAGA 3GWZA 2ZRPA 3QTTA 4OXQA 1ZMBA 3C7KA 3SZMA 3AY6A 1XWIA 2TS1A 3JQRA 4LIPD 1FTGA 4XVRA 1AKNA 1L7MA 3L0BA 1QK3A 3O3OB 4HBZA 4NZYA 3WWZA 2ACWA 1DRVA 2O2GA 3OLVA 2KS6A 1N5IA 3Q7SA 1DRUA 1M74A 1T6BY 3DEJA 3H1EA 2R00C 5ENVA 4MDYA 2VQSA 4YCLA 4CT0A 2QVZX 1K5DA 3ZVMA 2DERA 2BEWA 1NI3A 1NW7A 4MGHA 1YB4A 1ZA1A 1I13A 2OHHA 4P58A 2XT0A 3AUYA 4R8LA 2RFLA 3FNHA 4BO4A 4DDMA 4R7ZA 4V0QA 5J4YA 4EFMA 4G0UA 1O6FA 1W35A 2BFMA 3GPLA 5KREA 4AB1A 1NZJA 4NCKA 3EEIA 3RHSA 1GZSA 1KJZA 1DIOB 4J0CA 2HQRA 2OSBA 3AH8A 3GHYA 3EVFA 1SBYA 2I3DA 1C0EA 4DCMA 4IFBA 3E05A 2CBGA 2ZM6B 4RCZA 3UMBA 3WB9A 5DBGA 3W06A 2AR7A 4KLNA 4AYXA 3I72A 1W0KA 2Q3BA 2ZRJA 2X76A 1SWWA 4RADA 1EZ4A 3X1KA 4LZOA 1V5FA 5AHWA 2DR0A 4FMDF 1MEJA 5AMXA 2C00A 1Z2AA 4ZEOA 3X2EA 1X1QA 5C3UA 3Q3HA 4TRNA 2A14A 1FX0A 2NSHA 1K5HA 4GWKA 4NK4A 1HQYE 3GMIA 4GNKA 1JKFA 3BJRA 4QDJA 4R2KA 1DBPA 1K6XA 3KT8A 3OCCA 2EATA 1HDYA 3V55A 2O8FA 2ZEJA 1N7JA 3BD9A 5REQA 5HOEA 1HM5A 4OQPA 1FFHA 4XYMA 1TVEA 1R4NA 3PHLA 1KH1A 1E60A 1MB3A 1ZK4A 1Q2XA 1YE5A 4L4UA 4MSUA 4RK5A 4RC9A 5EZYB 4BKQA 3NHZA 4BQEA 1JEJA 3HB1A 4FVTA 1UFKA 4IQ8A 2BGMA 3W9YA 1VKOA 1QRDA 5EIBD 3F71A 4V0OA 1RWNA 4RXTA 4CTOA 1IPEA 3LLVA 4Y6PA 4HGNA 4ZDWA 1GG5A 4AS1A 5EIWA 1T6ZA 4TUYB 2IOFK 1F8YA 3LMKA 1KQ3A 1WDLA 3H04A 4GLOA 4J4HA 1L5NA 1PR5A 3QA9A 1MX9A 1HG0A 3HB7A 4GGMX 1IOLA 5EIFA 3HPQA 5BXYA 2AJTA 4AMVA 1WHTA 1NBMD 3LFHA 1L5HA 4CVNA 3NBFA 3OP4A 5TNXA 3MCUA 5DH9A 5LVAA 1TAUA 4KIJA 4J1TA 2UZ3A 1XMSA 3H0KA 3FW1A 2QNIA 3FXAA 1YDGA 2ODEA 3LQQA 1LC0A 3MJFA 3Q0EA 4RF5A 1MOPA 1DL5A 2O7RA 4FYVA 3AONB 5ALPA 1I10A 2ICAA 5ALZA 3LZ6A 3OZ7A 3FPAA 4GMFA 2PM8A 1I7QB 2IITA 4G4JA 2ECFA 2C92A 3I5MA 4KPGA 5CVJA 4AJ4A 3QSYA 3Q72A 1UM8A 5FIUA 5HF6A 5BPFA 4DBZA 5LB4A 1EGAA 3UHJA 4DFDA 2C58A 3MN1A 4YV7A 5GIOE 4H7IA 3EPKA 5IAGA 3FRJA 3ZD7A 5I7AA 5DYTA 2QVGA 5B1SA 1V9CA 3GJ4A 4RFVA 2FJUA 3UN1A 4FNMA 4BO7A 5L6MB 3VOBA 1YDEA 3FBWA 3P2IA 2D1FA 4B4WA 1ZWKA 1DOHA 3GDHA 5KTPA 3CCCA 5AKKA 3EZLA 3C3JA 4JI5B 1L1FA 3EW7A 1TEXA 2R6R1 3SG0A 2FWJA 1KEKA 3C3CA 1QH8A 3V4VB 4GBED 3E3LA 3JRWA 4JUDX 1PX2A 1D0SA 2I5PO 2FMHA 4FHCA 4ZAYA 2CNNA 2FPPA 4QYIB 3V1NA 3BIOA 3KKQA 5M7EA 4C6RA 4EJSB 1WDTA 4Z4FA 2PAAA 3CH7A 4X1IB 2WU3A 3HXLA 2FRDA 4BE4A 5C52B 2Q2WA 2ETXA 2GB4A 4NU5A 4Q48A 1YVUA 3FGZA 3VKUA 4P0QB 4D3SA 2QXUA 2Z5GA 3S7TA 1ZGCA 5F5XA 1Q15A 1Y4UA 1RKXA 4Y1EA 1JFVA 4MQLA 2ZBEA 4RA6B 2H2GA 1SQ5A 1YTLA 2XYGA 3T3NA 1UKZA 1A2BA 2WFAA 2YYSA 3KL4A 2ODNA 3CUTA 4CMHA 5T4FA 1EXWA 2R8ZA 2I80A 1IWBB 3HA7A 3BRWD 1SVSA 3LG2A 1T36B 2G1AA 3GLGE 2N46A 4PY2A 1PV4A 1W5FA 4Z86A 1DXHA 1IATA 2VOEA 2WAYA 3EBLA 1Y5NA 1KXZA 1P9RA 2HJWA 1NM5A 1I9GA 1R37A 4RLQA 3ED1A 5KQGA 1QLJA 2C5HA 1ADCA 1RCFA 3OOYA 2OXIA 3TLBA 1N4AA 1W6UA 3V8QA 3WGIA 1OF1A 1I24A 1ZRSA 3O9VA 4KNVA 2DSNA 3NB0A 4ARAA 1YTUA 2OFOA 2OD2A 3K0KA 2QT1A 3R3UA 3R6LA 4DA8A 1ZVJA 3X1WA 3U44A 4TMXA 2X5KO 1B42A 3STVA 3KSZO 5ICMA 1NXWA 3C98A 4UMEA 1U7PA 3B1WA 1E2KA 3DDHA 1V16A 2B1IA 3MPUA 2FG7C 2YJTD 2QA5A 3R0IA 1M76A 4QDZA 2I8AA 3R7AA 2BTOA 5LZ4A 1XZCA 2WUDA 4L4RA 4MV4A 5HQ3A 1DIGA 1L5MA 3PYMA 3V7WA 1FQJA 1SC3A 1H6BA 2CF5A 3FI9A 3OCYA 3Q5DA 1GL9B 5KC9A 2P1DA 2FSGA 3D31A 3EMVA 5DBHX 3HB4X 2N1MA 3F90A 1RM3A 2PVSA 3GLIE 3KZVA 2VLIA 3BE8A 3OWXA 1A5TA 4HGRA 5AW5A 3UAVA 4JQCA 5KOIA 2EL9A 2FR0A 5JU6A 2BKUA 4F2WA 4YMLA 5EVCA 4BO3A 5KX5F 2UV8A 1JDUA 1NX9A 4G5YA 4LSMA 1FCJA 4MGEA 4PRLA 2I2XB 2KPOA 1XZLA 2VRWA 2XWQA 1J70A 2Q5FA 4S2UA 2O54A 2F62A 1CDEA 5FNVF 1LSSA 3OEHA 4MUKA 5LQKA 2Y1GA 1JNXX 1NONA 1T25A 2VHUA 3E9QA 4NS4A 3S28A 4CUJA 2IXBA 1P2FA 1GHTA 1O1YA 4LC9A 1LW6E 1H1DA 1DJLA 3SK0A 1T0UA 4HGOA 1EHYA 2QDXA 2D74A 1J90A 5DOZA 4DSNA 5CCXA 3E1SA 1FRFS 2QQ5A 5CB4A 5CM2Z 2DWQA 1PL8A 2FR1A 2N75A 3H0EA 3OE4A 3R0QA 2I7CA 2YWBA 4R8VA 1W5TA 5D6OA 1DO0A 1VJ5A 4S1NA 2H92A 3JQFC 4FS3A 5EQJB 5A4AA 2AE1A 3T7JA 2I3ZA 1ZUHA 4K9NA 4I1YA 5L4SA 3B3FA 1JDSA 3O9ZA 2O2EA 1ONSA 3A11A 4PYRA 4BX0A 4D96A 3FCUB 3I4LA 5EEGA 2IH4A 1HT2E 3N9IA 1Q92A 3L0OA 8LDHA 6Q21A 1FMFA 3BMNA 5IJAA 3V34A 4UNRA 2WT9A 1DQNA 3CF4A 1TUGA 4F93B 1PUIA 3CKMA 3CVVA 3H83A 5JRZA<