4LRWA

Crystal structure of k-ras g12c (cysteine-light), gdp-bound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
155
Chain Sequence
TEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
molecule keywords GTPase KRas
source organism Homo sapiens
molecule tags Signaling protein
total genus 54
structure length 155
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lrwA00
3SE0A 4M9SA 2ZJOA 5JECA 3I3SR 2GK6A 2F1IA 3TGPA 2QQEA 4LI0A 1GDDA 1LS1A 4A8JC 4LHZA 1BMFA 3BH6A 1KSGA 4Q1CA 4WVFA 5B30A 1HV8A 2ZREA 5FPSA 3CIOA 2JLRA 3K0FB 2R65A 2B6HA 1ZW6A 1W46A 2H8KA 2EFDB 1ZCBA 4CF7A 2JLQA 3LQQA 2PJRA 4JJZA 1IN7A 5E3HA 1E2MA 3LAWA 1XTIA 2GBLA 1ETUA 2XZLA 3ZQJA 4UNNA 3OEED 1ZUIA 2FDCA 2IYRA 2NO0A 2IHYA 4C0LA 3UMFA 3LBHA 5KUTA 5HKKD 1JPNA 2J5XA 2ERYA 4CEIA 3VNUA 3T61A 3T06B 2H18A 4PQFA 1I4DD 2LCFA 1J7KA 5BXQC 2YWHA 5HZKA 4HLUC 5DYGA 1U94A 1TQ4A 3DKPA 5AJYA 1MV5A 4Q48A 2R6FA 4QNMA 3QXHA 2FH5B 4C30A 5J4VA 4FD2A 2GHIA 2B8TA 1DADA 5CYPA 2WIBA 3KL4A 3T1VA 4K46A 1NKSA 2FA9A 4F7WA 2HDNB 2JIZD 4TLDA 2BCGY 5D3MB 4W5HA 4TZ0A 1ZNZA 4PFSA 1UFQA 4PC3A 4Q1BA 2AFHE 2AX4A 3DZDA 1PLJA 1UBFA 1P60A 3W90A 4BASA 3AF2A 3U44A 4DLXA 3T5GA 1CBUA 2XTNA 4XTCS 1ONBA 2XGJA 4YMVA 3AVPA 4JSTA 5AK0A 2VH5R 1YQTA 3B8HA 1CLUA 1NVWQ 4EPWA 1S1MA 3RS2A 1R6BX 1AN0A 5CJPA 1X1SA 4RD0A 4YXWD 1R10A 3CF6R 4DJTA 3LVQE 4GOXA 1ZC4A 2FSGA 4M9XA 4P0TA 1T91A 3OHMA 3AVQA 4D0NA 1HYQA 3EWAA 4A0FA 4D4MA 1HQCA 1Z5ZA 2WKPA 1KDRA 4B3FX 2A78A 1KMHA 1T0HB 4M21A 2WHXA 1I4LD 1YZLA 1LY1A 2IUUA 4X8OA 1V43A 3DOEA 4QGFA 2A2ZA 5CB8A 3T12A 3OZXA 1MRSA 4D4KA 1OH8A 1PUJA 1XZQA 1ZAKA 1E94E 4P4TA 3ADKA 1ZNYA 3V00A 2RGGA 2BJWA 1G8HA 3Q7QA 3SOPA 1JNYA 3AGQA 1SVOA 4QGHA 3TR5A 1E9EA 4PHGA 4Q9LA 2ZYVX 1GL6A 2KBEA 3RVBA 3J81k 5JJKA 4MGKR 1Z0AA 5JHGB 5EE0A 5EQTA 3LO5A 3GLIE 4UXHA 4C0AC 3ONWA 3L0OA 3L0SA 4Q7LA 1GL9B 4BGDA 1QF9A 3EWSA 1IY2A 4K81B 521PA 2FFHA 4TYPA 4M1KA 4BRWA 4OQMA 4P3YA 1AM4D 4EUNA 4UXJA 1NF3A 1JALA 2YWEA 2WMOB 1UKYA 3RRZA 4QL3A 3QF7A 2YV5A 221PA 1TNDA 1X3SA 3CR7A 3NTUA 4WBSA 3SNHA 3VU9B 1ZM4A 1OYYA 3IO3A 3VR3A 4E09A 5C46F 3I8XA 4YMUA 1LW7A 5B57C 3NKVA 1CJMA 1QZXA 4M2LA 3A8TA 1ZNXA 4D4LA 4M1SA 2ZU6A 4C2TA 3CNNA 4ZDJA 3KUDA 1Z8FA 3FVQA 4A15A 4XIGS 1EX7A 2BDTA 5L3VA 2W6JD 4UNSA 3C15C 4A6PA 5FPKA 5EP1A 4KSCA 5BW8A 1NLYA 1ZIOA 2UZIR 4KSBA 1CKEA 3OAAD 2HUPA 2FMXA 4PHHA 5J5CA 1A82A 4TL8A 4XWKA 2A5GA 3KZ1E 4FI3C 4RSGA 1FTNA 5KSPA 3RABA 1X86B 4DBLC 3AM1A 3QPVA 4KI0A 5FBQB 1P72A 3BFVA 4LJ5A 1ELOA 2QMUA 3TH5A 2NO1A 5F9FA 4XWOA 4G5OA 3ECCA 1A1VA 2OXCA 2ZR9A 5P21A 4P4SB 4CIDA 2QP4A 1OV4A 1Z0KA 3MJHA 3LFUA 4R98A 2JA1A 3QKSB 4HAXA 2ZUDA 3WYGA 4Q21A 4B3GA 1Z6YA 1JR3D 2EFEB 4S35A 4Z1MD 1Q22A 1DS6A 3MWLA 1T0JB 3ZZTA 5LB2A 4FMCF 3LH5A 3SR0A 1KO4A 4JLPA 4NPHA 3U3RA 2FG5A 1P3JA 5EP4A 1DEKA 1E2KA 1S2MA 3U2QA 1EFRD 2CCKA 2JEOA 1NJFA 3RS5A 2GF0A 1KKLA 4B71A 4PSAA 3KFXA 1BO6A 2ATVA 4ZI2A 1II9A 1NMZA 3O47A 2OLJA 5FTLA 2VL7A 4NYMR 4E22A 1HA3A 4V0ME 1UAAA 4Q1AA 1ZBDA 2XOKD 3F8TA 1FX0B 2O0JA 4BLSA 4LHYA 3T1OA 4GMDA 2WJVA 1KI6A 3EPKA 1FZQA 2GF9A 3RSLA 2ORIA 1XEFA 3A1WA 1SVIA 1PZNA 2GJKA 2OFOA 4O3MA 2W58A 1IAQA 3B9PA 3KB2A 1JJ7A 4ZDIA 2J46A 3UXMA 3IEVA 1WXQA 2CCGA 4V03A 4OBEA 1T9HA 1PLKA 2NZJA 2MMCA 4ARZA 2CDNA 2A5JA 1T5LA 2EFCB 3QPWA 4MUBA 4N0EA 4YDHB 2MSEB 1FUKA 1I4TD 4A4DA 4IEEA 4RKFA 1BKDR 4L4UA 3PENA 2BM0A 2D06A 4DUGA 2GJSA 2H92A 4NTZA 2I1VB 5HR5A 1VHLA 1Z83A 2FWRA 2WWYA 1E32A 2QPAA 2CLDX 1DARA 3T35A 2SHKA 3GFOA 2IK8A 2DBYA 4D0GA 5C4GB 2PX3A 3MSXA 4MKFA 4LK2A 1FMJA 1ZC3A 1D2MA 4FMDB 3CWZA 2BMFA 4GRAA 4QGAA 1JECA 2ZI9A 3I5YA 2ZQ5A 1NBMD 1E2GA 3FYHA 4Q02A 2Z6VA 4JS0A 4JL8A 4D26A 1R5OA 4CYMA 3FMPB 4MRRA 3ZGXA 5IK2D 3VQTA 2ORVA 1CR2A 5CJ2A 5KDOA 2PCLA 1M7GA 5GADl 4QHTA 3C16C 4PZZA 1XBTA 1ZNWA 2V6IA 4EIWA 3DZ8A 4HAWA 3QI2A 4MYTA 1A5TA 3FOZA 4PO8A 3IGFA 1GKYA 1XMSA 3P20A 5BN3A 2V1UA 2Y8EA 3H84A 5DHAA 4BLPA 1J90A 1TMKA 3SYLA 4WAUA 2Z43A 2BVNA 1NVUQ 5JJLA 2HF8A 2XNDA 3FKQA 4QHSA 5KSYA 1OXTA 1P2VA 3U7HB 3OIVA 4G01B 3VR1A 3KKOA 2WAYA 1DG3A 5KDDA 2Z83A 1SXJA 2XB4A 2BOVA 4EJSA 1E1RA 2YC4C 3PEWA 4FWTA 3AUXA 3LDAA 1P75A 2WZQA 2OG2A 2REXB 4XSGA 1ZD8A 1OLOA 2IYTA 3EZFA 1YJ5A 4FINA 4G5QA 4G5SA 4I1SA 5JWOA 1MT0A 1XPRA 2V3CC 2ZI7A 2O8DA 4KVAA 2IYLD 3CRW1 2J45A 4NONA 5BQ5A 3CR8A 2GBLC 3BJIC 1ZU4A 4KXFB 3FB4A 1KI8A 2QMHA 1IOZA 3GCGA 4URUR 4TL9A 2BBTA 2QPOA 3DM9B 4XD7D 2CVFA 3LW7A 1ANKA 1ZVQA 2AHOA 4IDQA 1P9NA 3VNVA 2ZYUX 3O8RA 1E79A 2NTYC 4GFDA 3FHTA 1XTJA 1ZYUA 1KTVA 1QHIA 3EIHA 4C0QC 4LC1A 2ZRJA 1E2NA 3Q5EA 5KHOC 4D25A 2QTVB 1P61B 4ZDWA 3GLIB 4NL4H 3AKEA 1QHHA 2WKRA 3K0EA 3LX5A 3TSOA 1OE0A 3SBEA 3CPJB 2ZI6A 5FBVB 1VECA 3MMPA 2GCOA 4MITA 1PVOA 2BEJA 4OJKA 5EUMA 4MYCA 2V54A 2IC5A 3D31A 5JWHA 1P2UA 3RS3A 2V8OA 2FNAA 3GLFE 4K8OA 1E6CA 1G20E 1S0UA 3NBYC 1DAMA 3QF4B 4NE2A 2EQBA 2VP9A 3IO5A 4G0NA 1HH4A 4NYJR 1QG2A 3M6AA 3ND9A 4DLVA 2OXRA 1W4CA 5FL7D 3CF0A 4KBGA 2PEYA 4RZ2A 1FL9A 2JLYA 2ZETA 2XJ4A 3CRQA 3VAAA 5BWMA 3KJHA 4TTRA 3EA5A 5GJCA 4TMWA 4KFSA 1KDTA 3B5JA 5EE3A 3ICQB 1P2TA 3C41J 1FMLA 4FCTA 4ZCLA 4XTRA 3OIUA 1US8A 5FH9A 5J40A 1PLLA 1XD8A 4XJXA 3B6EA 4I99A 4BFTA 4XSHA 1HTWA 1RYFA 2OCBA 2JLVA 4TMTA 2J59A 3WBKA 1IXSB 2CJWA 3ASZA 2RHDA 4ILEA 2D2FA 3SU8A 1C4OA 1DO0A 1E99A 2CL6X 4NMMA 1JB1A 1XTKA 5SZHB 3P4XA 4DDTA 3GJ0A 2X1VA 1OFTA 4YQFA 2NMVA 5FPHA 3FFBA 3V4RA 3HR8A 1XDBA 2R6AA 4IVQA 2ZE7A 2ERXA 5JJIA 2VBCA 1WE2A 1DG1G 1TU4A 2GZDA 2EVWX 3OEEA 4FMDF 3W6PA 4E07A 3QSYA 1RRGA 4C7OB 3NH9A 1GVNB 1GRQA 5HKKA 3CZQA 4JL5A 2ZS9A 1II8A 4WXPA 3VX4A 1KZ7B 2ZVQX 4GNKA 1MO3A 1XEWY 1VIAA 4B74A 3Q72A 2XZOA 1CJKC 1RJ9A 1N2CE 2VHCA 5FBRB 5AUQA 4AURA 5CITA 2W2VA 3MWJA 3IBGA 3ZH9B 2IS6A 3EC1A 3TUZC 2ZRMA 3QBVA 3AV0B 4DDWA 2YWGA 4UNRA 2F55A 1A4RA 3GEHA 4POAA 3GPLA 1FFHA 4OQXA 4P33A 4KYUA 3JZAA 1Z08A 5EE1A 5GJVC 4DCNA 4CEHB 4M8NE 5AUNB 4OI0A 5FTNA 1K6MA 2X2FA 4XVRA 1E9RA 4LCBA 1A7JA 5K8TA 2ZR7A 1F2TA 3MGCA 3QXSA 1KSFX 2J87A 3AGPA 3W5JA 1OT3A 3K70C 2ANBA 2MSCB 3ZLJA 1NVVR 4A8JB 4DCSA 1G3QA 1DAGA 4HZUA 4YMTA 1M74A 4DIEA 3GJ8A 1X1RA 5DI3A 5JCZA 1X8LA 1KDOA 4TN1A 5CYOA 4YXWA 2JCSA 2FPMA 2JDID 2VHJA 4DT1A 2CHQA 2ZIAA 4BUJA 3UMSA 1W5TA 3FWYA 5FOUA 4A92A 4WXRA 4Q4JA 1S3SA 3GJ3A 1LVGA 2J0UA 1U2RA 1G7CA 3BS4A 3TQCA 1JR3E 3B82A 4HAYA 2V9PA 5SZIA 2O52A 5JHHB 3H0KA 4B75A 2N42A 2R9VA 2YJTD 3RC3A 4U5XA 1XCGB 1E2JA 2ZJ2A 1OIVA 2F1RA 1P2SA 1RYHA 5CIQA 2BHRA 2F7SA 1JPJA 2CE7A 3K0FA 4OQNA 2IYYA 5A0FA 3NBXX 2WJGA 1CJUC 3L0IB 3VR2A 4DSOA 4PZYA 4ZCIA 4IOLA 2ZPTX 2KBFA 3TR0A 2ZJ8A 2WJYA 1KOFA 4TTQA 5C4MA 1FQKA 3A1VA 3Q9LA 1L4YA 1VIYA 3N2IA 1IM2A 2D7CA 2GETA 3K09A 3EZ9A 2XJ9A 3KJIA 4QBIA 1FQJA 3UG6A 2QQ0A 1CU1A 2ZAOA 4NYJQ 3K0CA 2EWWA 4A2PA 2P6RA 1E3MA 1LF5A 2J7PD 3W3AA 3B60A 4Q47A 3ASYA 4US1R 3KUCA 2RKOA 1P62B 2CJWB 2LKDA 5IRCD 2DFKB 4YONB 1ZU5A 3CUEF 1WP9A 2BJVA 3DVLA 3SJZA 4Q03A 3ZS9A 4D80A 4MUAA 2IS1A 2E1RA 1XF9A 5D3MA 1R5NA 3D8BA 2QL6A 4UQOA 3CRRA 4Q9KA 5SZKB 5EXPA 3AVWA 4LYFA 3RANA 2NIPA 4KU4A 1W7AA 2XTZA 2W6JA 2ZRAA 1MH1A 2PMKA 1ZM9A 1G5PA 4LDJA 2VA8A 3RWMB 1T3LA 4LWZA 3HPQA 2ORWA 2PH1A 2PT7A 2WWWA 4LJ4A 3C8UA 1C1YA 1UKVY 3OAAA 2GAAA 3QJYA 2ZAMA 4NZYA 2DCUA 621PA 3U60B 1NBME 4HB3A 4LV6A 4ESHA 4BFZA 5K8IA 1WBDA 1E2DA 4KFUA 1TEXA 4NYIQ 3V4FA 3LVRE 5L3SB 3CNLA 3RRNA 2GA8A 721PA 4LPSA 4KODA 4OK3A 5FR2A 4F93B 3BH0A 3GD7A 1F60A 2CMKA 1KKMA 1F2TB 2KJQA 2C8VA 4JYCA 1FW6A 2FEOA 4ZCMA 3WY9A 2F9MA 5H1YA 4JT2A 5J4LA 2A5YB 4LOAA 4JVMA 2AR7A 3PEVA 4Z1MA 4DC9A 2XZPA 3A4NA 3UMRA 2WWFA 2ZYWX 4ZDKA 1JAHA 2QP3A 1JEDA 2QBYB 1KSHA 1E2QA 1M7HA 3H2YA 3U7GA 3TVDA 5FOVA 1N0UA 5DYIA 2WVJA 4BFSA 1S3GA 1EFRA 1NG1A 1NVVQ 4JKYA 3MCAA 3CNOA 3I8SA 4C4PA 1M34E 2OBMA 3LD9A 4KV9A 1IN8A 1NNEA 2QM7A 4M4SA 1AKEA 1W44A 4Q9IA 2PL3A 2OBNA 1L4UA 2GCPA 1UBEA 2FSIA 2G77B 1LTQA 1F5NA 1XD2A 3SQWA 1AIPA 4URZR 1NLZA 2XOKA 3SJAA 1W36C 1EG7A 5F9HA 1IN4A 3AKDA 2OAP1 3RC8A 2G88A 3IIKA 2CEAA 1YZKA 2O0KA 3LBNA 4JBWA 3VU9A 4TQ9A 4HB2A 2RHMA 3AP1A 1IN5A 1Z63A 1G17A 1SXJC 4EJSC 1P7CA 4M22A 5JEDA 1S4QA 3CF2A 3SHFA 3RRYA 3B13B 4MRNA 1BIFA 1CULC 2FPLA 3EX7C 5H68A 1EFHA 3Q8XB 4AWXA 2O8EB 4TLCA 1KI4A 3GEIA 3KXIA 1NSTA 1MABB 2P5TB 4GMXA 1HT1E 4PANA 2A5DA 2GTPA 4JSYA 1KJZA 5CM9C 3PV0A 1W5SA 2HJVA 5FI0B 1M2OB 4C9BA 1KO8A 3KDSE 3BBPA 3UPUA 5F3WB 3TAHA 4OYHA 2ZRGA 3TUIC 2OBLA 1G64A 1OKKD 2QAGC 4E03A 2CVHA 2QP9X 4N1AA 4U7DA 2WIAA 3CLVA 4TLBA 2X77A 3SJCA 4A2WA 2JJ1D 2ZS8A 2ZTSA 3H4MA 2OT3B 1TEVA 4PHFA 3TAUA 2JJ8A 4PO9A 2GNOA 3VR6A 4U00A 4P4SA 4P32A 4ASUD 4BEBA 5IK2A 1RW4A 2QM8A 4PPFA 1R4AA 1JBKA 3NBZC 3QKSA 1UKEA 4PTLA 4Q7MB 5TARA 2ZRNA 4DXAA 3R9IA 2LKCA 5L3RA 2FGJA 5SZJA 4HLDA 3ZDQA 1OW3B 3QBTA 4HB4A 3RLFA 1N6KA 4JLVA 3A4MA 3U6BA 2DWOA 4AKIA 3IDQA 2AKAB 3NIBA 4TMZA 4B35A 4F4CA 2IXGA 3GEEA 4GI7A 4AC9A 3SZRA 3HU2A 3TIFA 4TYNA 1KNQA 2CNWD 4AD8A 1OPXA 3FKSD 3AF0A 3Q85A 3TW4A 4CEJB 2XITA 2ZVPX 1B0UA 2F43B 4TWZA 1HEIA 3KXKA 4LBVA 3CX7A 2YOFA 4MH0R 2A30A 2WKQA 4L5BA 4B43A 4X8MA 2Z4RA 3NDBB 3GFTA 1IHUA 4Q19A 4HEJA 1O3YA 1P73A 1E9CA 5FL3A 1G7TA 3NC1C 3TK1A 5J47A 1SZPA 1AA9A 1NIJA 1SVWA 1G4UR 1MO5A 3R9WA 1NN0A 1M6NA 1KJYA 3E5HA 3MLEA 2QRNA 1RKBA 1E2FA 1FX0A 1YZGA 1ZUNB 3CH5A 3IEUA 1F2UB 2A5FA 4RCYA 4DVGA 3K8YA 5JSZB 4U02A 5KSOA 1CR1A 2YOHA 3N2EA 4DSUA 2C77A 2YVUA 3OE7D 4XD7A 1J2JA 4V02A 5AUPB 4IXMA 4Q1EA 4CVNA 2GZAA 4GPTA 4LSGA 3O8DA 4BZPA 3N5CA 2QT0A 3C14C 3L2OB 1VYTA 1W49A 3JVVA 4I1UA 1N6HA 1NJGA 1SVLA 2Q3HA 5JI3E 2NO9A 2Q6TA 4IW3B 4V0LA 4LJ9A 5AR1A 2DWPA 1F6BA 1Q0UA 4FMBB 1XD2B 3OFND 3CKLA 1CEEA 2H16A 2LWIA 2RGXA 1VYVA 1W4BA 2QGNA 1GILA 2WWIA 1FOEB 1WA5A 3K0AA 4GP6A 2IL1A 1DE0A 4KAXA 2OUKA 4B34A 3LWNA 2NOAA 5DIFA 1VKJA 4M1WA 3BE4A 4JKIA 1GRRA 2W0SA 4V0KA 1KK0A 3EPLA 4A82A 3IPXA 2FSFA 4OJQA 4C2UA 1E2IA 1W4RA 2PX0A 1NVXQ 1S9DA 2ZSDA 4QGGA 4RVCA 4AG5A 2AFIE 4H1UA 4M1TA 3EA0A 4DSNA 5IHPA 3TRFA 1O87A 5DN6D 4Q00A 2WAXA 1T3HA 1XPUA 2QTHA 1AQUA 1YZTA 3QQ5A 1HE1C 2Z4SA 1U81A 4LHVA 4LJAA 4URWR 5JRZA 2GDJA 4AY2A 1FTSA 1SQ5A 1D2NA 3OIWA 5HCNA 2QENA 2V7QD 3QKTA 5E7IA 1DAHA 4EFMA 3M4YA 2CL7X 1TU3A 2G1KA 3IHWA 2Q3MA 4ZIRB 2FN4A 4W7SA 1W48A 4F4IA 2MSDB 2OE2A 2ZRBA 1XTSA 5DO9A 2BEKA 2BBOA 2ZUCA 1E2HA 1Z6XA 3Q3JB 1XNJA 1XTRA 5G53C 3LXRA 1I2DA 4RFVA 2G9NA 4DLYA 5L8VA 1XRJA 2RGDA 3EASA 5FOSA 3WRXC 3KTAA 3QNUA 1U0LA 5HE9A 2VIIA 4AIIA 1Z6TA 3PEYA 3ZVMA 2HV8A 2IBMA 2XSZD 1DELA 5B64A 3B1VA 1M7BA 4B44A 3K09C 2ZROA 4RJLA 2W83A 4Z8XA 3EPJA 4BFVA 2ZSFA 3K0CC 4PPQA 3TLXA 5ELXA 2PCJA 5GVSA 3MUFA 1L2TA 1HY3A 4Q9HA 1NN1A 2FZ4A 4JMPA 2Q9AA 1YZUA 3NWJA 1RPZA 3GQBA 2H1LA 1U8YA 4LHXA 2R8RA 1SULA 1DAKA 4HZIA 1G19A 3K1JA 5EUQB 3GLIA 4DZZA 1UEIA 3U6KA 2FFBA 3IQXA 5KNBA 2XXAB 3AQ4A 1LB1B 2YOGA 4JLNA 1FP7A 2GAOA 1IJFA 4B6EA 3Q7PA 2GEDA 2CCJA 2REBA 3EW9A 4IOJA 5EP3A 3QF4A 3TW8B 4B73A 1GIAA 2JDIA 3HWSA 2QSYA 2A3RA 4XOIA 1G1MA 2O5VA 5LB4A 4DRZA 1ZP6A 2G83A 2IA5A 2C98A 3A37A 2WWHA 1XXHE 2J0SA 5FI1B 3KQHA 1JJVA 4B2LA 2I3BA 2QA5A 1EXMA 2W2TA 1N0WA 2PZEA 3QE0A 2FFAA 3QG1A 4EPXA 2O8FB 5FTKA 1ZJ6A 2V4ZA 1XU4A 2JLSA 2VSXA 3DO6A 4TL6A 1WBBA 1DO2A 3PJRA 4YMWA 1NY5A 1OYWA 1GNQA 3ZVRA 4Q01A 3CBQA 3K0AB 1KAOA 2GKSA 1KI7A 1EGAA 2VP6A 2WSMA 2OLKA 5GVRA 3ZZ0A 5KPJA 4RD2A 4JL6A 3AKYA 1P5ZB 1KO7A 3A6PC 4QBGB 2PBRA 1AS2A 1U0HC 1ZD9A 2BCJQ 3ETLA 2KSQA 3O8BA 2HYDA 4IRUB 1U9IA 2C96A 1TX4B 1RRCA 4QC2A 1OB2A 5CB6A 4HI0E 2C99A 4C7OA 3AP2A 4C0HA 3VMFA 4KFTA 4ZKEA 2H5EA 3CB4A 2J7PA 1NMXA 3EC2A 3SC3A 4DB4A 2RGBA 3I1FA 4A0HA 4O25A 3IKJA 1W2HA 4Q7JB 1XFAA 5D3QA 2BKEA 1A2BA 2J0VA 2JATA 2QMEA 4GBMA 4TYQA 4BLRA 4LBYA 4CZ2A 1QVRA 1YZNA 2R62A 3KKPA 2DYKA 3SHWA 1VMAA 2AKYA 1CS4C 4XH9B 2O8BA 3AF3A 3BB1A 3SI7A 1OHHD 3F5FA 4LJ8A 4NCJA 2GXUA 4YC7A 4CEHA 4PC2A 1RRFA 3KQUA 1NN5A 1IBRA 4WW0A 1BYIA 4Q4HA 3AVVA 2ZM5A 4MYHA 3KTAB 2HF9A 3U3MA 2IW3A 2JJ2D 3QKRB 2OEPA 1E0KA 4BFXA 4OQLA 4AYXA 5AJWA 4A8JA 4LZZA 2ODEA 3D7MA 3KFVA 3PUWA 2J3EA 4Q1FA 4V0MA 3U61B 4QBHA 4DWJA 1QDEA 4OHZA 3NBFA 3ZIAA 1G4AE 1E9SA 2XB2A 5DI9A 2YC2C 3REFA 1YRAA 2VLIA 2WWGA 4B3BA 4JLBA 1GKUB 1ZIPA 3WMEA 2KI5A 1K5DA 4EPTA 2G0TA 3MD0A 1Q44A 2OSBA 3GLGE 2D2EA 2YWFA 1H8ED 2J41A 2HXSA 1KI9A 4P4UA 2IHBA 2FGKA 2F6RA 2ZSEA 3QEJA 1LNZA 5LBIA 1R7RA 1OH6A 1E0AA 4D0LB 2QE7A 4GZMA 1G8FA 3A4LA 4TMKA 2ZS7A 1IXZA 1VG9B 2NQ2C 5HPYB 1DBSA 4W5WA 1SVMA 1MRNA 1ZINA 2VO1A 2X2EA 4O2RA 4R9UC 4WZAE 4BWYA 1RC8A 3NHAA 5EZ5A 3C4JA 1ZMXA 3FDIA 2YZ2A 2ZU0C 4KLNA 3VTKA 3CX6A 4DLUA 2EYQA 5JFGA 3O8CA 4MKHA 2HCBA 3B9QA 3AVXA 1KNXA 1YR8A 3Q5DA 4GOKA 4O2LA 3W8RA 3FMOB 3QPUA 1OXXK 4MRPA 1LS6A 2AWOA 1YKSA 5DH9A 3NEJA 3RYTC 4TTPA 5CDFE 4DLZA 3A1SA 1UPTA 3WYFA 1J99A 2PLRA 2P5SA 3U5ZB 5KPDA 4S2EA 2C2HA 3AB3A 1E2PA 3EPHA 3PXGA 4DSTA 1XJ0A 3TE6A 3L8ZA 5JCPA 3G0HA 1VCMA 4OHXA 5DLQC 3MJRA 2IYUA 5TVKA 4DCVA 2PMDA 4NBSA 1Q3HA 3W5IA 3BH7A 2CHVA 4FCWA 4URXR 4IFEA 4WZ6A 3VKHA 2DFNA 1ZCAA 2TMKA 4QRHA 4XVQA 1WCV1 4C0BA 4CDGA 3DL0A 2ONJA 1IN6A 3MFYA 2C9OA 2GEUA 4RD3A 3THYB 1W0JD 3IIMA 3QXCA 4NCKA 5KYKA 121PA 2J1LA 2PJZA 4NYIR 3B7GA 1TAGA 3I32A 2ZRCA 1G41A 3QOFA 2I4IA 5AJZA 2E9SA 1OKKA 1Q57A 1R5BA 4QBFA 1U99A 4R2IA 4R2HA 1G8GA 4MGYR 2JIZA 2FF7A 4BFYA 2XX3A 4OL0A 3K9NA 5J4HA 1COWD 2JJ1A 2ZE6A 2O8BB 4C0JA 4KYIB 4BFUA 4G1UC 5L3SA 3B1YA 2QI9C 3W6NA 5FTMA 1R0WA 4KJZA 1S9HA 1H8HD 1YRBA 4NP6A 4Q4HB 4ASUA 4Q9JA 2IS2A 3DKVA 4AYWA 3U7EB 1OFHA 1AS0A 2ZE5A 3HYRA 2GJ8A 4WOPA 1H65A 4TT3D 1GSIA 3QUSA 1RVDA 1W36B 1LFDB 1UF9A 4HUTA 2F9LA 4ON9A 4RFSB 4A6XA 4Q7KA 4GL2A 3BK7A 4M1YA 4CRWB 2QROA 1T8TA 2QBYA 2CNWA 3BC1A 3FKSA 4LUCA 1S96A 3BOSA 3WNBA 1BOFA 2UKDA 4IJMA 2FZLA 2IWHA 2C9YA 3WNDA 5JRJA 5BYJA 4PPNA 4BEJA 4BFWA 2O0HA 2R2AA 3P32A 3GLFA 1G6HA 4EDHA 1E4YA 2IYWA 4GDFA 1XCPA 1QHNA 1WQ1R 4OI4A 1MO4A 4W9MC 3WMGA 1U8AA 4TSFD 4JLOA 1KI1A 1OFUX 2ZRFA 1Q20A 2ZI4A 2AD5A 5FUXA 1AK2A 3IBYA 4V0OA 2CL0X 1ZM3A 1XXHB 2ZI3A 3AVYA 1RRPA 2ASEA 2OO7A 1N6RA 3BRWD 4HATA 4PO1A 2VF7A 4OKSA 3P1JA 5JS8A 3P26A 5JZVA 3OE7A 4TYYA 2QAGB 4HAVA 2WBLC 2JLXA 3KQNA 8OHMA 3VX3A 3FE2A 4LX0A 1NP6A 1SGWA 3GJ6A 2BMJA 2R44A 5KOYA 3U3OA 3ZVNA 1Z2CA 1Z06A 1IQPA 1KO5A 1XTQA 2BV3A 2EYUA 3S1AB 1OIXA 3WBJA 3U7FB 5AJVB 2O8EA 3P4YA 4QXAA 2WV9A 2VSFA 5J4YA 1MABA 1KZGB 3B1ZA 1YHNA 3R8FA 4A2QA 5LD2C 2GJ9A 4JVNA 3OFNA 1N6NA 3ICEA 4OHWA 2VQSA 4TYWA 4DDUA 1FP6A 5UKDA 1F3OA 1GAJA 1T5IA 2DFLA 2KWIA 4IXNA 1YZQA 3H1TA 3I4LA 4A0RA 5B2ZA 2FX3A 2OESA 4PHTA 4Z51A 5FOTA 5H70A 4FWIB 2AXNA 4CT4B 2C03A 4EQ6B 4OI1A 2OFXA 4YLGA 4ZPXA 4W5JA 1KSJA 3K0SA 1Z0FA 4QNRA 2WM9B 1Z2AA 3WNCA 4BZQA 1GZSA 4NCNA 4URVR 5DN6A 2RMKA 1KYIA 3IUYA 3SYNA 2YINC 1CR4A 4KFRA 2VP0A 3EIEA 1JQLB 2JLWA 5FBLB 2V7QA 1CXZA 3M0EA 4PAMA 3KB1A 4NH0A 4MKGA 1W36D 1RZ3A 2GEVA 2OCAA 1R0YA 4Q1DA 3EZ6A 4F92B 4DHEA 5JI2E 2JGNA 1N6IA 1E69A 2UVQA 3WRYC 1CRQA 4CEJA 4JZKA 4EAQA 3VR5A 1OXSC 3X1XA 2F43A 3LW8A 5K8UA 2GXQA 4A1FA 1BS1A 3A58B 1XMIA 2IXEA 2P2LA 2QZ4A 1TUEA 4BLQA 3HJNA 4ERNA 2Q9CA 5FPYA 5KNDA 1B23P 2VHQA 3DOFA 3MG9A 4JLKA 4ZO4A 2YKGA 4B2PA 2F1HA 4RKEA 3QKUA 1JR3A 3CO5A 1NKTA 4KITB 1F2UA 3FHCB 4GT1A 1RFLA 2D4HA 5JSZA 2C04A 1SHZA 3B85A 1U9IC 2XSZA 5G3ZA 4G5GA 1HT2E 4H9GA 4B2IA 3FHOA 2BM1A 2G3YA 4MRVA 1Q1EA 3PUVA 3TMKA 2V1XA 3RS0A 5LPNA 1HUQA 1KDPA 2GJAA 1R0XA 3GLFB 2DPXA 2IUSA 4B3CA 2B8WA 2ODWA 4JJKA 4HLQB 3MWKA 3T34A 3UWOA 1UM8A 1G7RA 1XX6A 2RH5A 4HDOB 2F3RA 2GVZC 4KCGA 4NDZA 4ACAA 2WOOA 5EJEA 3RSOA 5EE5B 4PSVA 4TLEA 5DNYB 1UADA 2ZRKA 4HAUA 3BIFA 5IDVA 1LV7A 4PXAA 4AI6A 2IYVA 1GL7A 3FMFA 1WF3A 4I4LA 1Z0IA 4TQAA 1X8JA 1XWIA 4OHVA 4KHZA 1E0JA 1UDWA 2ZEJA 4YDSA 3TUJC 1W4AA 3GJ4A 5FR1A 5BN4A 2I1QA 3UATA 1D2EA 2F3TA 4MQBA 2O8CA 2XEXA 1Y63A 1F48A 4ITRC 2IT1A 1EESA 1QRAA 2OILA 2W6ID 5DE3A 3VFDA 3DMDA 3V9PA 1Q1ZA 3EZ2A 3LBIA 5CK4A 5CK5A 1G3MA 4JLAA 3LNCA 3QY0A 3QIAA 2WSSD 2JAQA 2G1JA 1XD9A 5G40A 5TXGA 4AKGA 2WMNB 4WIAA 3U3JA 1OSNA 2HEIA 4EPRA 4A36A 4RZXA 2VP5A 2X19A 1VG8A 5CLQA 1SVSA 2K5UA 2GILA 2R6GA 4UJ5A 2QTFA 4F91B 1JI0A 2B7CA 3KJEA 1YVDA 2P3SA 4RD6A 1S8FA 1TQ6A 2XTMA 2FJUA 4NCHA 4ZIRA 3L8YA 2XNSA 4JLDA 1E2EA 4Q5IA 2R6CA 3AF1A 4PQRA 3IIJA 5TV2A 2VYFA 4AKEA 4DLTA 4EKDA 4BLOA 4D6PA 1NRJB 2BBWA 4I81A 4FN5A 1OH7A 1NBMA 2ZUBA 1G3RA 2ZANA 4PR0A 5HZHA 5L3QA 4B3DA 1Q1BA 1D8TA 2VP2A 1TF5A 1UBCA 3BAFA 4NKRA 3PUXA 2JASA 1Z6AA 1GWNA 4Y0AA 3WHKA 4ACBA 4F4JA 3LLMA 4BZXA 3ND8A 2ZITA 4L9WA 5HTKA 3DDCA 3PUYA 3QG5A 2WTUA 2D7DA 2VP4A 2QG6A 3KKMA 4RY2A 4TL7A 4B6FA 5JS7A 3KQKA 2ZRIA 3QXXA 5JLJA 4J0QA 1GNPA 1CRPA 2C78A 3CW2A 5TDHA 4LRWA 1R2QA 1G3IA 1X8KA 5KDLA 1JR6A 4MYUA 1E98A 3FPAA 1TQDA 4TMXA 1E9AA 1OHHA 2J0QA 1XEXA 4ABYA 3WHLA 4GSYA 2VRWA 3OF5A 3R20A 3RDPA 2Q9BA 3C7KA 4OK5A 4QJ3A 3GLHE 3T1QA 5AWFC 1WRBA 5ANRB 3C5HA 4FMCB 2CXXA 4QOSA 4DLSA 5DISB 2XXAA 2JJ2A 1IONA 3R7WB 3SFVA 4R71A 1JAIA 2RAPA 5EXXA 2EW1A 1V5WA 3AP3A 1UJ2A 3UG7A 2WICA 3PITA 1VPLA 3OESA 2A7QA 2YHSA 3BFXA 5GJWC 2P65A 3GP8A 2HCJB 2DR3A 1G21E 2ZJYA 4IFBA 4PZLA 3T15A 2V6JA 1EWRA 1I2MA 3THWB 3C5CA 4BPBA 2NGRA 3KX2A 4JVLA 3UWKA 3VR4A 1N5LA 3FGNA 4TLAA 3THXB 4KLZA 2IS4A 1KY3A 3BWDD 1K5GA 1H8EA 2AWNA 1AS3A 5C1BA 2O8FA 3BB4A 5CLLA 3ZQ6A 4BECA 1E1QD 1G5TA 1YR9A 2EWVA 4G5RA 5IT5A 1DPFA 2ZRDA 4V0NA 3X1YA 3WXMA 4HB0A 4II7A 2CK3D 1AGRA 2O8CB 3CONA 3IILA 2D62A 4R7ZA 1NG9A 1U8ZA 2ZXUA 2ZRHA 1AZTA 3E1SA 4HUQB 4M0LA 1M8PA 2YYZA 4LJ6A 5FL7A 2GRJA 1K8RA 4QM6A 2HLDD 3A1UA 1C9KA 1W0KD 5DSZA 5A4JA 1VG0B 5G41A 3ZVLA 5JMTA 2QY9A 2OFWA 3HYTA 5BYKA 3QENA 5FUWA 1VHTA 2GXSA 1NMYA 5TB5A 3GFPA 3KXLA 4QJ4A 4UXIA 3DEFA 4HDQB 1N3BA 3K9GA 3TSZA 4AK9A 1Z07A 1NIPA 3L82B 3A36A 4CT5A 3IPYA 2WPDD 3NHBA 2J7KA 5CM8B 3ZS8A 4Q4AA 3SN6A 1G16A 3HU3A 3ZD6A 2CBZA 1AJEA 2OCPA 3OEHD 4CEIB 1N0VC 1U90A 1ZUHA 3U3KA 4M9ZA 2KE5A 2GK7A 3G82C 4TMVA 3ADCA 2WJJA 2CLCX 2P67A 5TY0A 2JLUA 2GCNA 5L3QB 4DCUA 4A0GA 2DB3A 3DPUA 1KAGA 3LRPA 5KNCA 3LY5A 1W0JA 3RNLA 4B47A 1NI3A 1Y3AA 4HSEA 3ZJYA 2C95A 3QKRA 2FSHA 2QSZA 1FNNA 4QJ5A 2XAUA 4M53A 3GLHA 3I62A 3D3QA 1E9FA 1NL3A 2FPKA 3D6TB 2AK3A 3X1WA 2ATXA 6Q21A 1MOZA 5J4KA 1G9XA 2PEZA 2ZRLA 1GKIA 3U44B 1COWA 5JEEA 2EFHB 3NH6A 4Y0VA 4IEIA 3RAPR 1XEXB 3RRMA 2ODNA 3DMNA 3T1TA 1EWQA 4TZ6A 2WJHA 1II0A 1Q1QA 2WOJA 1H8HA 1TF7A 2DHRA 3KKNA 2IEZA 4IDNA 4OK6A 3I92A 5DHFA 5G3YA 3NG1A 2IWRA 1JQJC 2PT5A 3QXJA 3UK6A 4C0SA 4TT3A 4D81A 1SXJE 1R8QA 4E5UA 3SDZA 2CHGA 2EU8A 2OZEA 2RB4A 1CF4A 3A1TA 1YR7A 1OFIA 1GUAA 2BMEA 2F1JA 3EIQA 4LGMA 1OH5A 1A2KC 1Z22A 2DFTA 3KKQA 1IJEA 2NO7A 1J70A 1KMHB 3HP1A 1W2GA 2FV8A 3GMTA 4PX9A 1KI2A 4DEYA 3T5DA 2OCYC 1M1YE 5FBWB 4N0DA 421PA 1BMFD 1BH2A 4TSFA 3LXXA 1MO6A 4I1OA 3VHLB 1SKYE 3EARA 4JIMA 4DIDA 2C9CA 2QU8A 2N46A 2P6NA 4JLJA 5KO2A 2D74A 4HYYA 2GWHA 1N5KA 4JYBA 4RCZA 4QM7A 2IYXA 5KSZA 1G18A 1NLFA 1N5JA 5FUYA 3B1XA 4PPGA 4MRSA 3EZ7A 5E95A 4PAQA 4AYTA 1P9RA 4GP7A 1Q3TA 1YE8A 5AJXA 3QEOA 5H8WA 4UKDA 1GP2A 1AGPA 4QG7A 1TL7C 4IOMA 5FUVA 1VTKA 3LA6A 3FMIA 3GJXC 1GM5A 4NHOA 3RS4A 3I72A 1AQYA 2B92A 5FOXA 4B32A 5JBQA 3THYA 3K70B 2IYZA 1FNMA 3X2SA 4JBYA 4B3XA 2OV2A 1DOAA 1JXMA 4Q4AB 1G8YA 1DAIA 2AXPA 2FE4A 2IF2A 1W47A 4M1MA 2N1BA 4LJ7A 3U4QA 5F2EA 1AKYA 2L0XA 2VPPA 3WYAA 2E87A 1CP2A 2BC9A 4OHYA 1EX6A 2RGNA 3MWYW 2BBSA 5TMPA 4D82A 5LDDC 3DM5A 1N5IA 5F98A 3EXAA 1T6NA 1GOTA 1S1CA 4D2IA 4BQSA 5K8LA 2DY1A 1TADA 2Q0HA 5E4FA 2NPFA 3ZD7A 2OHFA 3IQWA 3AVOA 3ZZUA 3GLHB 3HPRA 1RIFA 1W1WA 3REGA 3TJZA 1IY0A 4RFSA 3I73A 1KO1A 1CJVC 4ZKDA 821PA 4B76A 1G7SA 2ZI5A 4LYHA 2VSOA 5E7MA 3N70A 3EAQA 1FUUA 1VYUA 1XP8A 3E70C 3JVUA 4F38A 4JT4A 4M1OA 4Q4LA 5EP2A 4DLRA 2GVDC 1E0SA 1N25A 2HJGA 3NXSA 5AUOB 4I1VA 1KHTA 4FIDA 2RGAA 1Q12A 3HU1A 1XPOA 4AKHA 2VHTA 2QGZA 5LD2B 1XXHA 2ECKA 3BB3A 5CIWA 1CIPA 1QBKC 3CWQA 3AF4A 4HLUA 4PC6A 4AG6A 1Z6GA 4WA7A 5BN5A 1XCMA 5KU1A 1HE8B 1E2LA 5EZ6B 4A9AA 3BD9A 2QAGA 4DCTA 2ZJZA 4L15A 1U98A 3UIEA 2IF0A 3CPEA 1XZPA 3M1IA 4HLCA 1IXRC 2VHUA 4RD1A 2IYQA 4C0KA 2BIFA 3UKDA 3P27A 3WP1B 4L9SA 3S1AA 1GNRA 1OJLA 1X6VA 4QFMA 1E96A 3R8CA 2ZSBA 2CLSA 4LYJA 1UDXA 1EFUA 1KI6B 3CRVA 4HDCA 4NU0A 3WP0A 4DEXA 2HT1A 4IHQA 4OI2A 1VCOA 4EPVA 5IF9A 1Q21A 4OQFA 5C18A 2Z5FA 3G5UA 2IX3A 2ZE8A 1N6LA 1G6OA 2D3WA 1KJWA 3CM0A 3K53A 4NYMQ 3RWOA 4BRUA 3K70D 1R8SA 3NVAA 1Z47A 4IVPA 2EFGA 2KB0A 2J9RA 3PCRB 5DGXA 3LLUA 4ARZB 1SKQA 2WJIA 2IUTA 1GFIA 4XWAA 1JEEA 1OXUA 2B7BA 1KMQA 2HXYA 4RZUA 4EQ6A 2ZJ5A 4O0MA 1YU9A 2C5LA 1SVKA 2W6IA 3AH8A 3LQRA 4PAOA 2FFQA 2ODBA 2NZ8A 4C3ZA 2QEQA 2QAJA 4D4JA 2AL7A 4BE7B 4IDOA 4YMSA 1WMSA 2WSSA 2R6DA 3ADDA 1MR3F 3FFAA 2YNMA 5B58C 3FTQA 5C2JB 2QORA 1DAEA 4CGZA 3JZMA 3B78A 3CRMA 4G3XA 2GZHA 3EG5A 1OXVA 1J8MF 1P4SA 1NY6A 5A5GA 3U4QB 4B48A 4QKQA 1Z0DA 3DHWC 2ZYTX 3CPHA 4FXPA 4FCVA 2QN6A 1G8PA 2VEDA 4KBFA 2GXAA 3LV8A 4DKXA 1OB5A 4US2R 3PVSA 3SFZA 3X1ZA 1UKZA 1SHKA 2BMDA 3W3ZB 2VF8A 3HDTA 1D9XA 1ESMA 3GJ5A 2H57A 4P31A 3TQFA 1QG4A 3SJBA 4PSKA 5E7JA 3VKWA 2Q3FA 2PZGA 1QHYA 3PFIA 3GLGA 4DB2A 1E4VA 1NSFA 2BKUA 3H86A 1TPZA 3OIYA 4UJ3A 2FOLA 1WB9A 4IDHA 1LF0A 3SYKA 4DLWA 1GTVA 1XJQA 3ZYCA 1UEJA 2IYSA 4IVRA 1PJRA 1G291 3I61A 1SXJB 4NCIA 4EJSB 2IEYA 1HURA 1NN3A 3AEZA 1EFTA 2JLZA 4UNPA 4TQUS 4DDVA 3VKGA 1ZM2A 2O8DB 1TUIA 1XJCA 3TKLA 4M9QA 5M04A 1GRNA 2NG1A 2OM2A 3THOA 1VCNA 2X8AA 3W34A 4JLMA 3QVVA 1AZSC 5FPTA 3KJGA 2H17A 1KI3A 5HCIA 1WDTA 2ZR0A 3BGWA 1ZRHA 2RCNA 1BYUA 5CDFA 4MGIR 1XB2A 3SBDA 1SKYB 2OAQ1 2QT1A 2ZRPA 4H1VA 1DAFA 4KO8A 1G5RA 2WWXA 3PG5A 2W2XA 4Z8YA 2UZ3A 2QUZA 1ZM7A 4RD4A 4EFNA 2ONKA 1CTQA 1QHHB 4US0R 2DWQA 4Q66C 2B21A 1RE0A 3AVUA 4DUGD 2GCOB 1DTSA 2NPIA 3MAAC 4HAZA 4PC7A 4LY6A 3KQLA 2BWJA 1ZD1A 1E9BA 2Z0MA 2Q21A 2RGCA 3AKCA 1E1QA 2QNRA 4Q18A 2ZSAA 2PZFA 1R0ZA 4LBZA 4BLTA 1T4GA 4PC1A 2W0MA 3VHXA 3HR7A 3SEAA 1OF1A 1CJTC 3W8NA 1VG1A 3W6OA 4MKIA 2CK3A 3TVTA 1KK2A 4JVSB 1J8YF 3NC0C 1EFCA 1ODFA 4L16A 4XVUA 2H7VA 1ESNA 4JBXA 1N6PA 2W00A 2FEMA 3SQXA 3PR1A 4UNQA 2HLDA 1VDZA 1EK0A 1US8B 1W0KA 1VCIA 3GJ7A 5EXTA 1T3SA 4GOJA 1P6XA 3PUZA 1PV4A 4PQYA 3B2EA 4IDPA 1D5CA 2P0EA 4LBWA 3TSWA 4FW9A 3F0TA 3PIRA 2REOA 3L43A 3ADBA 5EE9A 4LJYA 1FPMA 4EFLA 1GITA 2HT6A 3CH4B 4LYAA 3RS7A 3QVUA 4X8LA 2WPDA 4LPKA 1N6OA 2QPTA 3BORA 4KVGA 4X8HA 2XNDD 3W9YA 1CR0A 4IOKA 4MDEA 1HQYE 5GJBA 1QHGA 1TQ2A 3B1WA 2P6UA 3BERA 1SXJD 3K9LA 3PEUA 3NDPA 3OEHA 3TBKA 1E1RD 1OIWA 3LX8A 4N3NA 1YR6A 4WZBE 1DVRA 1XEWX 4MDFA 1II8B 5EXSA 3TNFA 3L0PA 5KTYA 4MA4A 1UBGA 3MRSA 2GESA 3CZPA 1PUIA 1E9DA 3NEYA 3UANA 1RJ9B 1XMVA 1KY2A 4EPYA 1KIMA 4Z54A 1KK3A 3SS8A 2G0NA 1Z29A 2ANCA 1JXOA 1KK1A 4LC0A 3GLGB 1TTTA 3F3YA 1G3UA 3R7WA 1T8UA 3CX8A 3ZIAD 1QHSA 3IHLA 4LV5B 2RGEA 3K9HA 5FOWA 4ZV4A 4IKEA 2AK2A 2VTKA 1KGDA 1E79D 5FTJA 1GG2A 3PQCA 3BXZA 5HE8A 3E2IA 2QMOA 1QHXA 1IY1A 1Z3IX 2IXFA 3BFKA 4L8GA 3THWA 4QHYA 2PLFA 2AN9A 1Z0JA 4MGZR 4RZ3A 2G6BA 4GZLA 2QE7D 3THXA 4LHWA 4HZUB 4LV8B 3AUYA 3I5XA 3WMFA 3AVTA 2ZJAA 5DI3B 1L8QA 3R9XA 3X1DA 3RHFA 1Z28A 2NO6A 5FFMA 1D9ZA 4CW7A 2V55B 2FU5C 1XMJA 4DT1B 2ZJBA 4ESVA 4B33A 2HYIC 1L7VC 2AD1A 2CE2X 4Q4JB 5JWRA 2RGNC 2A9KA 4URYR 4ZI3A 2J0UB 1MKYA 1D6JA 1U0JA 2QRZA 2MMGA 1TF2A 1P9WA 1QVAA 4HUQA
chains in the Genus database with same CATH superfamily
3WGIA 2DTXA 1FS4A 3SE0A 3BYZA 3TSAA 2BI4A 4P53A 2HRZA 1Z2EA 5CJJA 5C8VA 2QQEA 4LI0A 3MTJA 4PONA 4NX2A 4KR6A 3AFMA 1UH5A 4O4HB 2HSJA 3JARA 3BH6A 2CDRA 3NS7A 1HDGO 3E7PA 3RBAA 3CIOA 2YXLA 2R65A 2SCUB 2H8GA 1ZW6A 4PN7A 4A27A 4BNDB 2FK8A 4EY3A 1V7QA 4EJMA 5JFOA 1Z4QA 3QE4A 1EVIA 4QBKA 5E3HA 4FHDA 3LAWA 1XTIA 2GBLA 5CA1B 1XDSA 2PZJA 3ZE6A 3SJ7A 2H51A 3IQFA 1ZH2A 8MHTA 3DBLA 1QGDA 3OCVA 1M2JA 2X1LA 3AY3A 1LA2A 1MC8A 2WF8A 3LBHA 3FCUB 4H3KB 3TEMA 3ZJ4A 2NVBA 2WUGA 4CEIA 2WG2A 4ZV7A 1PJBA 2QTMA 3OFSA 4PQFA 1PTKA 1TKCA 4UDYX 5BXQC 3BMNA 1Y3FE 1YRWA 2KM1A 2PX5A 1IDOA 2YWHA 1SHJA 3Q9SA 4HLUC 2C2BA 4W9RA 3DKPA 3VZDA 1MV5A 4E12A 4R8LA 1JPUA 1F6WA 2HNKA 2GHIA 4GKAA 3S2GA 4B4OA 1DADA 4BX9A 5EQJB 1OWOA 1RP7A 2W71A 2JVIA 3A6KA 5DB4A 3KL4A 1Y34E 4GBED 3WLOA 1ENYA 3T1VA 5HF5A 4CMKA 2ZJ3A 1MQSA 1NKSA 3ROKA 1JWBB 2FA9A 3LT4A 3KTOA 1VJCA 1GZ6A 2NPOA 1QMPA 4DREA 1KBQA 3DCIA 4ZA2A 3KJZA 2XYVA 3ILHA 3QHQA 3D1LA 4P9NA 4C04A 6REQA 1PHPA 5KVVA 2E0IA 5DHUA 3DZDA 1UBFA 3IAM1 1K68A 1Y3DE 3KJXA 3MCZA 2ZUUA 1WBJB 3EEIA 4PY2A 1JFSA 3G9QA 5ESRA 5LQKA 2O2EA 4PZUA 3U44A 4BX0A 3DSRA 4DJDC 3HYCA 1LDEA 1X1TA 5EUBA 1FTWA 3T5GA 4UBKA 4ZAGA 4E6PA 1PEDA 2Q3CA 3AVPA 3PHIA 5JCOC 5AK0A 3I01A 3O8OA 4YX9A 5JD6A 2DTDA 1C1XB 1DWOA 1NVWQ 3DV0A 4G4GA 4HPXB 3LHIA 1XG5A 5DGIA 1M2GA 1R4NA 5CBKA 1NASA 2JCXA 5JZSA 3KT6A 4ZRNA 5HM8A 3IURA 3MCWA 1X1SA 1P4RA 2WF6A 1SUEA 4P92A 4DJTA 3IDOA 1ZC4A 1VJGA 2YJGA 4H18A 4M9XA 4OAPA 2V9ZA 4P08A 3DB2A 1SELA 1TRKA 1Y4ZA 1YZVA 3QPBA 2OGUA 3CVJA 1YGYA 4ZQBA 3T4XA 2A78A 1YB5A 2QF7A 5ENZA 3D0RA 2BEUB 2NYAA 1RIIA 2QRKA 3MQ4A 4UEJA 3DOEA 3R3VA 1G38A 4KR2A 2A2ZA 1PWHA 4H15A 1MRSA 2E3JA 1ZAKA 1M0TA 1G5IA 3EQ8A 3NPAA 1KAQA 2Y76A 3V00A 3Q40A 3OQMA 4WY2A 3SOPA 3NVDA 3VHQA 1JNYA 3ET5A 1SVOA 2G8NA 4Q3DA 1WABA 4QGHA 2V98A 1FEZA 2IZ1A 3HP7A 1S2GA 2I65A 4Q9LA 3N28A 2KBEA 1U1IA 2DQYA 2BGGA 3HGMA 5EQTA 2R97A 1D0SA 1J20A 1QAMA 3C45A 3M83A 3ONWA 3KUKA 1ODIA 2WHPA 3L0SA 3GU3A 3O38A 5LSAA 1K7FB 3VBCA 4Q7LA 1GL9B 4P2GA 1KQGA 1QF9A 5JCJD 2Q27A 2FFHA 3HKBB 4M1KA 4P3YA 5CAEA 3VDNB 1AM4D 1NYTA 3CVUA 1NF3A 2KLHA 4HR7A 4MTLA 2ISQA 1X70A 1ST3A 3I2HA 3CR7A 3VU9B 3WIEA 5JSYA 1ODSA 3T5TA 2FZ5A 3M7IA 5C46F 5CBPB 2RI1A 5KYUA 3JQ9C 3WGOA 2ZYSA 3AIIA 4IF4A 1ZD2P 3JQDA 1TQ8A 1WUHS 1HSOA 4J2TA 5C8YB 4REQA 5JTUA 2NYUA 4QAQA 4YECA 5HSGA 1T2CA 4M2LA 4CG1A 5K8CA 1UKBA 4D4LA 5J1SB 5LL6P 2VWQA 3DLHA 5JC8A 2GPSA 1W0CA 2GWRA 4ZDJA 5KYTA 5JPIA 1JHQA 2R2GA 1E4EB 2P0YA 3ETDA 4XIGS 1UC9A 1Q1NA 1LPBB 3EGVA 3O4IA 3OKPA 3B6IA 3EWNA 4QYXA 5G1PA 3AR3A 3RYFA 4D3FA 3L4SO 1ECLA 4MJXA 5C3UA 1KAEA 1ZHHA 1FZTA 3TLGB 1UBMS 2RGYA 1JL3A 4OHUA 2D0DA 1CKEA 2B2NA 3WK7A 2NSJA 4AS3A 4DQUA 3EGCA 5BOSA 4MKRA 1S2IA 4YJ3F 2HUPA 5GV8A 1GPYA 1P7VA 1KJJA 1W9HA 1A82A 3I2YX 1XXLA 3KQMA 4F56A 4O4LB 2DPGA 4FI3C 5HBGA 2G76A 4L7VA 3LHFA 2EC5A 3CRNA 4M9CA 4Y30A 3GLVA 1P72A 4XRGA 1XZFA 2QMUA 1EK1A 3WDSA 2LW7A 2IZ6A 3BWEA 1XVTA 2NO1A 3IJPA 4HDSB 3KHKA 3ZNOA 3CSUA 3F8SA 1EFVA 2E37A 2EEPA 1XN1A 3R7LA 4EG6A 2QP4A 2R1VB 1OV4A 3MJHA 4R98A 4MS1B 1TVCA 2JA1A 3QKSB 4HAXA 5CNIA 5FD8A 3UF0A 1UC8A 2G25A 2RHWA 3K1AB 1T9ZA 3Q98A 1L8LA 2FZWA 5DSTA 2YIJA 5TF0A 1JR3D 2EFEB 2DLDA 4EDFA 3PNPA 4FFRA 1Q22A 1DS6A 2VWGA 3ZE0B 3ZZTA 2AOUB 2Q6KA 2CVQA 1AKQA 3CE9A 3DVAA 3P9IA 4Z0PA 1QH0A 4NPHA 1CF9A 3CJRA 1P3JA 2XWJI 2Q0QA 3D6JA 2YWXA 1E2KA 5DBFA 1RQ2A 3DQZA 4B7AA 4UOQA 1IHPA 1GEEA 1X7HA 3QYJA 3HYNA 4E0BA 3PA6A 3UKJA 5BORA 5JAUA 1E5DA 2GFQA 3KFXA 1BO6A 2AF3C 5ALUA 4J1TA 1U5BA 3RYIA 4ZI2A 1II9A 5DHPA 2HU8A 4MMYB 3O47A 4ZQHA 1JG4A 5G0SA 2R47A 4QUAA 5EMNA 2VKTA 2B94A 4ZVTA 2Q4TA 2Y27A 4EL0A 1ZBDA 3A32A 1TVKA 2W90A 4X7PA 3TSCA 3CS3A 4DMHA 3IPRA 2RHRA 3U09A 2FI1A 2WJVA 1SBTA 1KI6A 5E6SB 1NBHA 2OGTA 2ORIA 4UM9B 3CW8X 2HFJA 1HDZA 3CC8A 4HQRA 1N3LA 2G1UA 2QIPA 1OLUB 1SVIA 2GJKA 3A1FA 1BMQA 2CZGA 3BFPA 3FPHA 4K0RA 3AJDA 3L6RA 2V7TA 4PGMA 3UXMA 5EA2A 3IEVA 3MWEA 3U3DA 2CCGA 5AJTA 4OBEA 2RCYA 4OH1A 1XQYA 4OXKA 2XA9A 3KYDA 2NZJA 5DHTA 4L7QA 5LLDA 2EFCB 3QPWA 1T5HX 1FTQA 4NOLA 4A4DA 5AW9A 2DKNA 3H6KA 4ZYTA 3A9CA 3WYEA 3PENA 4MWGA 2GJSA 2PD4A 3KSRA 2H92A 5TJHA 3TMYA 2A0WA 1PJLA 4HEQA 2CD7A 1MJGM 2F8MA 1BRMA 1NM5A 1KEPA 3KOYA 4JUCA 2WWYA 2QPAA 3KSMA 3DHVA 1SQFA 2XBUA 2G80A 1U1CA 4M8IA 2XXJA 4H7DA 4TWBA 1V0JA 4J6FA 2COEA 3DO8A 3VMMA 5I8PA 1EJ2A 4DF3A 3ENWA 3E9EA 4G56A 4Z4HA 4XR9A 1Y5NA 1XMOB 3SDSA 3LP8A 1P0QA 3WFZA 1KP9A 1NTOA 2EP5A 3MSXA 3O3CA 4RF5A 3OTOB 3EOAI 1E3IA 1QP8A 1ZC3A 4FMDB 2O20A 1A8PA 2HX1A 2BMFA 4I55B 4DR6B 3GLSA 4QGAA 1JECA 1TE2A 1EDBA 1H4VB 2D1RA 2ZI9A 3ASVA 3IALA 4S1VA 3VR6D 1IBCA 2EQAA 1NBMD 2ZQ5A 3FYHA 4K9RA 4MWTA 3S2UA 1QVWA 4JL8A 1R5OA 1USKA 1DZ3A 1IZ8A 1PWYE 2I67A 3KC2A 3N75A 3PVZA 3DWIA 4MRRA 2ORVA 4MLDA 5DNUA 1CZKA 3DD5A 4LMRA 4W63A 1M1ZA 3HVUA 1XQVA 4MV0A 4FQ5A 1VZ2A 3HADA 3H4VA 2HDWA 1YU6A 1E5XA 1WCIB 2FX2A 3FOZA 4KGDA 4PO8A 1GKYA 2IHKA 5EOVA 1P2GA 2R1TA 3HKEB 3JWPA 4XQ0A 4J1SA 5FX2A 3W77A 2Y6VA 1ORDA 3AF5A 3RCBA 2Y1OA 3AM3A 1M8JA 4LDRA 4RENA 4NJEA 1J90A 1TMKA 2YV2A 4ZAFA 3H17A 4BLPA 4BPRA 5HX7A 1PAUA 1ZXLA 3QW2A 4AY3A 2HF8A 2XNDA 3DBVO 2B61A 5DPMA 1OJ7A 3I53A 4TKUA 1K4MA 3VR1A 2PKQO 2OWDA 3UJ3X 4QPJC 1NPDA 1LSSA 5HNKA 5K05A 5ICMA 2WT4A 3ZHBA 1Y80A 1WD5A 3HZZA 3L0YA 2OG2A 4U2BA 1ZD8A 2IYTA 2JLAA 2VT7A 1YJ5A 3FWNA 1MX5A 4FINA 4I1SA 5JWOA 1YCHA 3AUJB 4OX9Y 2IYLD 1LJ8A 3CRW1 3KT8A 4W6ZA 5IM5A 3CR8A 1W76A 2C07A 2XGGA 3BJIC 5BQ5A 1YFKA 1BCSA 4HKTA 2QMHA 1IOZA 3GCGA 3DP7A 1QGUA 2G17A 3HSYA 4TL9A 2QDKA 2BBTA 3JQ6A 2IOYA 1DC4A 3JQBC 3R5SA 4BBZA 6ABPA 3ODPA 1P9NA 2QW1A 2B20A 5K8TA 1EEHA 2NTYC 3E35A 1XTJA 3NXKA 3P8ZA 1NRIA 3FHTA 5E0KB 3P0IA 3GQBB 2ZRJA 4WI1A 2VDJA 3QHPA 2FVYA 5KHOC 4LCJA 1Y6GA 3AUFA 1T9BA 2QTVB 1P61B 2YWJA 4NBUA 4V39A 4NL4H 4RANA 1QKJA 1YVRA 3T7IA 1J24A 3W2TA 3WTBA 1VECA 4IIJA 2J3KA 4C29A 1FA9A 4MYCA 4P7GA 1E1YA 3D31A 2DLCX 2H1VA 4MTCA 3NYQA 1ONNA 3RS3A 3ZYZA 3V4OA 3DLPX 3OOHA 3PA8A 2ZT5A 4YDQA 1ZZGA 2Z9BA 3QF4B 4TUYF 1WQ4A 2VP9A 3KXPA 4RHUA 3RS8A 3S2IA 3GVCA 3M6AA 2V7VA 4DLVA 1W4CA 2H59A 3SLGA 5BP7A 1MIOB 3CF0A 2CNOA 3EK2A 4WK2B 2AB0A 4R16A 5KCMA 1QNLA 1TJNA 3CRQA 4U6NA 1UFVA 3ZW9A 4TS3A 2Y1XA 4R1UA 5EMLA 3FAZA 4O2BB 2HTFA 3RH0A 4E70A 1PEAA 3ICQB 4HDNA 2R5NA 4KPEC 1JLLA 5G0TA 5DF1A 3RTCA 3AOEC 4L6CA 1V9LA 4WCVA 1IZZA 3PD1A 4ZTZB 3ROFA 1BFDA 3B6EA 4IWYA 4BFTA 3Q9NA 5BT9A 4WWHA 1QH1A 1YONA 1YOBA 3CXUA 3DPIA 2F67A 5LOVB 4I8XA 2CJWA 2PKXA 4HTFA 3AR9A 4ILEA 4IIEA 1DQRA 1TZBA 4ZTBA 1C4OA 1E99A 5JZBA 4NMMA 1JB1A 3ZWDA 1JJIA 3P4XA 3HU5A 2J3QA 3GJ0A 4DDTA 3P9QA 4L5IA 4U7GA 4YQFA 3EIXA 4O5OA 1T2DA 1SCUA 2XT0A 1IZ0A 3FOBA 5FPHA 1PD0A 4L95C 1P31A 1T3ZA 1NJ6A 2EERA 2ERXA 1Y7PA 4MLZA 2VBCA 2EVWX 1EINA 3FPFA 5DYTA 2FQYA 3W6PA 4A1OA 5IYZB 5JXHA 1N33B 1HOXA 3F46A 3R6TA 3NH9A 4WOJA 2UV8A 3T6KA 4C76A 1REQB 3CZQA 4P54A 5BMOA 2ZB2A 1JBEA 1PNQA 4JL5A 2ZS9A 3T7KA 2BONA 1KZ7B 2BHTA 2ZVQX 4GNKA 1BA3A 5A3QA 1F0YA 4ND3A 2VUTA 1D4FA 2I6XA 2WUVA 3L4BA 3MNFA 4RV5A 4YJHB 5FBRB 3ZCPA 4AURA 4HJXA 3ZU6A 2W2VA 5JALA 2Y66A 1CD5A 1V7CA 2C5FA 3OMLA 5FV4A 4X7RA 4GKKB 3EVGA 2ZRMA 1GQSA 5KYYB 3LMKA 3QBVA 1X94A 1ZGJA 3VVMA 3PFWO 2JHPA 2I7DA 2BFFB 3GPLA 1H2ZA 4OQXA 3GELA 5B53A 3HCFA 3UK1A 5CT8A 1Z5WA 2BHLA 2ONYA 3DUWA 3H9GA 3KJNA 3UWKA 4OI0A 5FTNA 4L5JA 3MWFA 5K09A 1IK4A 2G4LA 1NWCA 2B5VA 1E9RA 2BP7A 2H1HA 4XVRA 4AXXA 1J23A 5IAGA 1HZZA 2BKXA 3FR7A 4G0QA 4K0KB 2J87A 5KNBD 2Q5HA 2GN6A 5IBPA 2INGX 3K96A 4K9LA 2MSCB 1DWPA 2PSSA 3C3AA 4HGPA 4OD0A 3OF2A 1LD3A 4NICA 4RDIA 2ZWPA 1XAGA 2VOEA 4DW8A 1X1RA 3H97A 5DI3A 3ZQ4A 1LQUA 4R9VA 1RS0A 2IE0A 1KDOA 1T0BA 1JHXA 3NCTA 3FVRA 1Y4DE 1BA2A 4QQRA 4TN1A 4ZVLA 2JCSA 2BI7A 2FPMA 2VC2B 3QTLA 1DKPA 4IIUA 4KXVA 2ZIAA 4QSMA 3UMVA 3FWYA 4A92A 1AO0A 2HQBA 1H6BA 1LZKA 2QZSA 4MB6A 1PWEA 4X63A 3UHJA 3D0KA 4AY4A 3B6JA 2J0UA 2C2OA 4R8SA 1GG8A 5CB0A 1U2RA 1G7CA 3BS4A 1FRFS 3EIOA 3B82A 3L1JA 2V9PA 4HWOA 2D5LA 1G2IA 1O9GA 2PQMA 2O52A 1E66A 2FFRA 1RFGE 3AI1A 2GLTA 1V4BA 1V25A 2BRUC 3RC3A 5FWAA 1XCGB 2ZJ2A 3EQZA 3GFQA 4O4HA 4OXYA 5JVDB 3RK1A 5HQJA 3CPSA 5EJIA 3L6DA 2Q45A 2BHRA 1SUPA 2F7SA 2ID7A 1OPRA 2O2SA 2SCUA 3N87A 4BNDA 2IYYA 5CLFA 3A7DA 3VR2A 3RHSA 2Q3LA 1MAWA 3JQFA 4GZ5A 2Y0BA 4PZPA 1AY0A 4IMRA 5B1SA 3VNBA 2OAEA 4YT4A 2V8BA 4RXUA 2DB3A 2HL6A 5L40A 1B3RA 5CA1A 5BMVA 2ZGVA 3VJMA 1YVEI 1NFRA 1U7XA 3D3NA 3A1VA 2J3IA 3Q9LA 4AJHA 1VIYA 5EHNA 1NHGA 2CHEA 5TQ2B 1LPPA 4FJ2A 4QECA 5F4ZA 1NURA 3RF7A 1ID8A 3IQGX 2QQ0A 4NYJQ 1I80A 3K0CA 3OOWA 1K6XA 1E3MA 3UICA 1G2OA 1YA6A 1EEXB 2X6QA 4HL6A 4EI7A 4US1R 1IHDA 2H9IA 4ZYYA 3NHFA 2XLBA 1JG3A 4NFYA 1UWKA 5KYVA 1YZHA 3RAFC 4CWAA 1PU2A 2NV2B 2VHEA 3BMQB 3CUEF 1BFKA 3HQ4O 1ZUD1 3R3XA 1DC6A 2YXPX 4IXDA 4OJTA 5K3AA 4DR7B 1BDIA 1YTLA 4D80A 5COBA 2IS1A 2W2LA 1V1RB 2E1RA 2JHCA 2FPPB 2QL5A 4OVKA 3ZE1B 4D9CA 1AC5A 2YRXA 2XUOA 1IM5A 2CVOA 2H31A 4P34A 2B1IA 1PCXA 3ZY6A 2OVFA 4G0YA 3CRRA 1SCBA 4FDMA 1YIOA 2JFBA 5ED0A 1A1SA 5SZKB 3F6PA 2ZT7A 3AVWA 4KU4A 4LRTB 2PMKA 1YK0A 3ACCA 1ZM9A 3IHTA 4F6RB 5AKYA 3PNQA 2QVCA 5AJHA 3RBXA 4L2IA 4LWZA 4BO9A 5H7XA 1VMKA 2PH1A 2FSVA 2PT7A 2WWWA 4TVOA 1UKVY 2JKYA 4HN9A 4KKXB 4C21A 3T94A 1C1XA 2WM2A 3K16A 4ZGGA 3WDKA 1BWRA 2CKDA 4NZYA 4TV8B 2QZPA 1RAIA 3MIZA 1ZGZA 2GLXA 4TS4A 3OZGA 4KNWA 2OXIA 4BE4A 1C8BA 3ND6A 5CFLA 5CD1A 4BFZA 1WPXA 2WVAA 3TNYA 1I2AA 1U2SA 2CNDA 3I3OA 2Z8ZA 3LY8A 3Q6MA 3UFXB 1AMOA 1Z0ZA 3IS3A 4I0WB 3INNA 4E2WA 1VJ1A 2Z5LA 3CTPA 2W2PA 4LPSA 1UR5A 2ZIVB 1F20A 2AJDA 3I0ZA 4HFNA 2I2CA 4F93B 1VM6A 4UULA 2V3VA 2JANA 2KJQA 1KKMA 1F2TB 3D5EA 3OUTA 3SHTA 2C8VA 1TCCA 2ZATA 4NESA 5FBHA 3L8GA 1VL5A 4F8EA 1LI7A 2BEUA 4ZHQF 1E2BA 3P0HA 1CUHA 2ZXEA 1VJTA 3WR5A 3WY9A 2F9MA 4ZCMA 1BHSA 3QW4B 2A5YB 3LQ4A 4LOAA 3R6DA 2AR7A 3ZWXA 3IEIA 4RKWA 2WWFA 2ZYWX 3UMRA 2YN0A 3H13A 5EIWA 1JAHA 1JEDA 5A5DA 1M7HA 2BCEA 3ADOA 3O4RA 3UEOA 2Q2VA 3EZNA 5SYAA 1ZG3A 3HWX1 4AS1A 5DX8A 5EWJA 4HX9A 5B37A 1KBZA 1VL6A 1EFRA 4DNQA 4BKOA 3A1NA 3J7TA 3I8SA 3V2HA 1M34E 3A4YA 3ISTA 3NIWA 1IN8A 4JODA 4EHNA 1NNEA 4I5GA 4AJEA 1XOIA 3RUAA 1E9VA 4Q9IA 5IARA 1FXUA 2TMDA 2OBNA 4F71A 2GCPA 2FSIA 4WPGA 2G77B 3USES 1NVFA 1V3VA 3UJPA 1LNQA 1NLZA 2XOKA 5GWXA 5IAJA 2O57A 3AKDA 4DJ5X 2OAP1 3I42A 3PNYA 4JYMA 4S3MA 4CM5A 3HM9A 3O73A 5H3LA 3HCNA 3VU9A 2XBLA 3TLZA 1QE5A 5FAKA 2CLHB 4GD3Q 1Q19A 3GUCA 1PL7A 1QDUA 1SAYA 1USUA 3TKYA 1P7CA 3N76A 4KE8A 4LXUA 3AUTA 1JTEA 3SHFA 1GTRA 3RRYA 3B13B 2ZYIA 4P84A 1IIBA 2NSDA 2IU6A 2AXQA 1BVRA 4AN4A 3Q8XB 4AWXA 2A33A 1G42A 3C97A 4W82A 1GPJA 2A8YA 1UK9A 1F8FA 2CXRA 2Y77A 4GI2A 4Z9BA 1I24A 4GMXA 4BWFB 3IB6A 2A5DA 2JCYA 1K3FA 4LZNA 4N5IX 3M3DA 3N2LA 1KEEB 4IHAA 4FSXA 4JSYA 4BKMA 2JAPA 5CM9C 5AM4A 3TLGA 4HGYA 5ES3A 3KDSE 2WU0A 3BBPA 3GEMA 3OBIA 4XI9A 3HVRA 2DULA 2W37A 3IQDB 4OYHA 1EUDB 3DT9A 4DCPA 4AUNA 3HY6A 2F00A 2RHTA 4O4LA 4E03A 4E1VA 1B8OA 4OU4A 3CKKA 4IO0A 1WJGA 2OC9A 4XD2A 2I4MA 2ZS8A 2ZTSA 2WK1A 2C54A 2OT3B 1O96B 1TEVA 4PHFA 4J3NA 4HDSA 2GN2A 2P68A 3DMFA 3MJVA 2F4NA 5AHRA 3ZX4A 4U00A 3LHSA 5K0CA 5LXTF 1M83A 1G8JA 4ASUD 2G9UA 2R1VA 4BUZA 2HK8A 4YAEA 4MS1A 1GTG1 4PTLA 3NBZC 4KAFA 3QKSA 4RPCA 4LVNA 1O5TA 3RHTA 1Z63A 2B8JA 1QOPB 1PNTA 3PQEA 2O2IA 1T3GA 3K1AA 5H82A 3UQYS 5EIXA 4ITUA 5DHRA 1V47A 3K20A 1N6KA 1WKCA 4UDXX 5DJ5A 2PZBA 5DTIA 4AKIA 4F4CA 2O7NA 3BPSA 4TMZA 4AC9A 1I8TA 4J0IA 4B35A 4IDDA 5KTRA 2YV1A 2EF1A 2AOUA 3JVIA 1GTZA 5BNTA 4LZLA 2A9QA 2BGJA 2VJAA 1OPXA 1PTJC 4AD8A 4HQLA 4BQQA 4CEJB 1GGHA 1M3SA 4WNIA 2ZVPX 4N5HX 1THZA 4LBVA 1PFGA 1AHHA 2YOFA 4MH0R 4Y6SA 2WKQA 4X8MA 1KEUA 3H7IA 2IHNA 1VFPA 3EBPA 5BRJA 3GFTA 3RTGA 2Q41A 4Q19A 5IEJA 4HEJA 4W5OA 1NRWA 1BNCA 3E05A 4IIXA 2CHFA 3WB2A 1DXYA 3T3NA 5D6NA 5HIJA 2YNMC 1PJCA 2AGVA 3F49S 1BS2A 1NN0A 4N0QA 3Q3HA 3UMBA 1K7EB 3R5JA 4C5CA 2QRNA 1KWGA 1AV7A 3KR0A 3PI6A 2CSXA 2J6IA 1NTRA 1C8LA 2AVDA 2YXEA 3CEHA 1I5RA 4V1CB 3UFBA 3K8YA 4YALA 5JSZB 4U02A 5E6SA 3RSGA 5KSOA 1CR1A 4HBGA 2OBFA 1X19A 1KARA 1AE1A 3OSUA 4PYOA 1LQ2A 2H2HA 2YVUA 5CD9A 4JI4B 1OLUA 3D2LA 4XD7A 3ZGZA 3E7FA 3KPJA 4YA6A 4KTVE 1M0SA 1Z5VA 4K6OA 2QT0A 1VYTA 3BRQA 5JARA 3JVVA 4I1UA 1NGSA 2YS6A 2QDXA 3WGVA 3COJA 2ZIWB 4GPZA 4UQPA 1O2DA 3D4PA 4V0LA 5ADWA 3QWBA 2GGSA 5JY6A 1RRKA 1NSYA 3NPMA 4MQEB 5HOQA 4X6LA 4A16A 5BQ3A 3STXA 3OJLA 2Y92A 5K0LA 4LFAB 3GZJA 1XK6A 3CKLA 2GDZA 5A7GA 3I2IA 1MTOA 2A94A 1X2EA 7MDHA 3M89A 3GYBA 4RF2A 3LECA 2O06A 4IUCS 5BN4B 2C92A 3K0AA 2PL9A 5KTNA 1E89A 3D2BA 1QPBA 2OUKA 4MOWA 3LWNA 1O5OA 2RAUA 3LQ2A 3BE4A 3I04A 3VXKA 4R1SA 3DD1A 5DULA 1A97A 2W0SA 3QVTA 4V0KA 4DS3A 3IQHX 4BMOB 4NF2A 3FXAA 2GEKA 3DQPA 1E2IA 1W4RA 4NOJA 2ZSDA 5AICA 1EDOA 3BQ9A 3O4FA 5ITZA 4B0PA 5CB4F 1J1IA 1PGJA 3NIGB 2DHEA 3GZTB 2V7XA 5A4DA 2EKBA 4N5MA 2VCHA 5IHPA 1T9AA 1OZAA 5DN6D 3CB2A 2WAXA 4M0FA 4Q00A 5AW6A 1AQUA 1YZTA 4MJLA 1XLUA 4MS3A 1HE1C 3GDHA 4LJAA 5JRZA 3AV3A 2GDJA 1FTSA 1TECE 3T9DA 4C07A 4AP9A 4CMCA 1D2NA 3OIWA 2QENA 3ESYA 2GPTA 4NNOA 4YI3A 5E7IA 1WCIA 1NATA 1YMUA 1D0IA 1UIRA 2PUJA 3NWBA 1LLDA 4L85A 4BRZA 3O4VA 4OQ4A 4A8TA 1BW9B 4ZN6A 3HKEA 3JAWB 5ENVA 4G5YA 2Q3MA 4W7SA 4LQ4A 1W48A 1Z2DA 4TXNA 2IEAA 2MSDB 1TZMA 4YDRA 4EGQA 3OHPA 5JCXA 1L5YA 3KEOA 1Z6XA 3UA3A 4Q05A 1XTRA 5LA6B 1CUUA 3UBTA 3I2JA 1PGQA 1ADGA 4UATA 1HF3A 4WNAB 2VWHA 5G1OA 5CTAA 2IH5A 3WQSB 3NMUF 3RRJA 5JASA 1D2CA 5AI4A 5FOSA 1L7NA 2O3SA 3KTAA 5A71A 5LWQA 3ETCA 1MVOA 4XIYA 5I9TA 5LYJF 4TM8A 1HE5A 1KZYC 4AIIA 8GPBA 1Z6TA 3RFVA 1M2NA 1WY5A 2B4YA 4EYEA 4G5HA 1Z7YA 1B93A 2HQ1A 4GQAA 2R86A 3B5EA 4FU0A 1CZUA 3TLKA 5KI6A 2V5UA 2JBHA 5THQA 4AX8A 2PKYX 2Z30A 4BFVA 5HYVA 5KWEA 3ACDA 5ELXA 1Z2PX 1E3WA 1GQ2A 2P2SA 1L2TA 4Y2XA 2Y93A 1BU5A 3CJQA 4Q9HA 4JU9A 4OMFG 2C4TA 3IC5A 1V1MB 1YZUA 3C1TA 1U0GA 3GQBA 2H1LA 3TQTA 1EQ2A 2R8RA 8LDHA 1C0LA 2QTVA 3ROGA 3F5QA 5BW5A 4NE7A 1K2VN 4CV2A 1UEIA 4CN8A 1M34B 3NHSA 3RG8A 2FFBA 2CJYA 3IQXA 3MN1A 4O33A 1U28C 1U7HA 1X87A 3ZDYB 3WNZA 5HP4A 3OJ0A 5I4KA 4RMIA 4JLNA 1FP7A 4RESA 4RPIA 1EVZA 2P6OA 1IJFA 4X95A 4AN0A 4B6EA 1C3EA 2COUA 2GEDA 2CCJA 4HCJA 3EW9A 3UHAA 4IOJA 3QF4A 4EF6A 2IV7A 4B3TB 3O8NA 3NORA 3DG9A 4Y1RB 1R0SA 4DR4B 4IMIB 4YBZA 4X1KB 4DRZA 1JA1A 1MIOA 2VK2A 4R81A 5AK4A 4JP3A 3SEQA 3PL5A 4L0QA 2J0SA 5E0OA 5FI1B 4B2LA 1RQNA 2I3BA 1F8UA 3DE2X 1H69A 1Z88A 3ICWA 4I50F 5GQSA 4O2BA 4W1QA 2PZEA 3QE0A 4GWKA 1ZJ6A 1JZQA 3PXXA 1Z0UA 3KSUA 4RAOA 4MWCA 2VATA 4FVTA 2VSXA 4EW6A 2B4KA 3DO6A 4OIMA 1DO2A 4ZT3A 3Q10A 4YMWA 1BXGB 1NY5A 3C7CB 3UKOA 4F5ZA 2X42A 2V65A 1GNQA 2JVKA 4Q01A 4YR9A 2QD3A 3CBQA 5IKOA 5LOVA 4TV9B 3LCUA 2V6BA 1PNVA 4DKJA 4H35A 2CFCA 3GJTA 4TWRA 1Y5IA 2OLKA 4ZOLB 4ARCA 5KPJA 1XNRB 1ZFNA 4J0FA 1J8VA 1RKVA 1Z75A 2I6GA 3KSDO 4FQ8A 4QBGB 4YHBA 5K1ZA 1LPOA 3ZWAA 1JHZA 4GICA 2CXPA 2HWXA 3ETLA 1ZITA 2KSQA 2HYDA 3L7BA 5DEOA 4K9MA 1FXWA 3CVXA 1FLDA 1H2FA 4QC2A 5IYZA 5B1IA 3OX2A 5IVPA 3WLFA 4EX6A 4ZOCA 1REQA 5FULA 4KAJA 5ECDA 1NAIA 1UBJS 4MHTA 2XTAA 1UPXA 2AFHB 3N7TA 3BCSA 1ESCA 1FE8A 1LSJA 1PR3A 3L1HA 4QOHA 4UREA 4YROA 5HW0A 2RGBA 3SY8A 1WV1A 3H18A 2FLKA 2YMLA 2OB2A 4MGEA 2CFTA 2QUHA 4YJHA 1M9NA 2NX2A 4M55A 4MW7A 3TTVA 1DIRA 1Z8DA 4GBMA 4V0RA 3L18A 3JAMA 4BLRA 1Q7TA 2X4DA 3NONA 4BFLA 1J9EA 3S1LA 3FJYA 4R40A 1YZNA 3TPCA 1KYWA 2NZ2A 3I6YA 3LHDA 4BC1A 5CLHA 5KYYA 3RVPA 1WXEA 3EGOA 1LK7A 1PSZA 2AKYA 4TMFA 5IW8A 2RG1A 5K4AA 3KFLA 3BB1A 1GGKA 1JX6A 3NAGA 1DJNA 4LJ8A 4AL4A 4YC7A 5K3DA 4UU8A 4MP6A 1NN5A 1TK9A 3OPYI 1N7JA 1HEUA 1BYIA 1WSWA 3AVVA 3NAMA 4BWGA 4B4WA 3MTAA 1Z17A 3K4PA 3SXUA 1IPFA 3V1NA 3S3TA 1KVRA 4XFKA 4EQZA 3F6RA 4LZZA 2DBQA 1U9YA 2BGNA 3D7MA 3KFVA 2R7NA 1ZCJA 2J3EA 2OO5C 5CG1A 3O1IC 3U61B 4MR8B 1SCJA 2GMWA 2ZSJA 2OTCA 4GH5A 1I94B 3PUIA 4IV0A 4CCSA 1I9GA 3JD2A 4MI9A 5HMLA 3QE2A 3U3XA 4J8PA 1I4EB 3T4PA 3BMCB 4JLBA 5E7QA 3VU0A 2WJ6A 3WMEA 4EPTA 1K5DA 1YD7A 3MD0A 5F1YA 2HJRA 3V8NA 4BTLA 5M34A 3EMBA 3RFFA 1FFXB 4KZKA 1E8DA 4ZJYA 3GLGE 4CMAA 5AVUA 2YWFA 2J41A 3QLUA 2ZSEA 1LNZA 2CWWA 4X1YB 3CUTA 5KNDH 4D0LB 4YV0A 3G0IA 5CH3A 2N9UA 4X64B 2QE7A 1KQFA 3UNXA 3A4LA 4Z9YA 4HBZA 5JVDA 2GAIA 1IXZA 1JSXA 1EWKA 3DLAA 2IPNA 2J09A 1NVKA 2NQ2C 3G8AA 4G86A 1MXHA 3BUSA 4WZAE 1RD4A 2X2EA 4R9UC 2PTGA 3QH4A 5KHAA 3G89A 5G0UA 5IN4A 4ER0A 5L51A 1RC8A 4DPMA 4EOGA 3PTAA 5F7OA 3C4JA 3PLRA 4EY7A 1ZMXA 3ONDA 1AXEA 4FSDA 5J2UB 2AXEA 2CHUA 4KX3A 4BMSA 2CYCA 2HCBA 3B9QA 3VDRA 1RZRD 4ZZ0A 1GAEO 1YR8A 5SY4A 4F86A 3K9WA 5C8ZA 3NOQA 4UBOA 3BTOA 4KPGA 4RGBA 3FMOB 4MRPA 2AWOA 4DN6A 1YKSA 4M8SA 3RYTC 8ATCA 4TTPA 1T1RA 2PLRA 4FE4A 4OJMX 4P1ZA 3T3PB 2E7ZA 3TI9A 4AJJA 5CDHA 1VPWA 1RI5A 1RC1A 3LA8A 4KXUA 1E2PA 1Z0SA 2QI9F 1HXHA 2QVLA 1XJ0A 4J4TA 2VSYA 4DBLE 3CNHA 2IXAA 5JCPA 5KHLB 1HNZB 3VZRA 2AF4C 4TZKA 3DTTA 1XJ5A 3LWZA 3MJRA 2IYUA 3BMQA 1SPXA 2ZAGA 5T64A 3O8LA 2I6TA 1JFTA 1EK2A 5CVEA 4DCVA 3PDHA 1SUDA 1J0EA 1AURA 2CFOA 1E6MA 3MJDA 1V1RA 1T9DA 4BHTA 2FPPA 5AW7A 2DEUA 3DMRA 2CHVA 2X0EA 4GM1A 2DFNA 2VAMA 4ARAA 3V48A 3QVWA 4XVQA 1Y3HA 4RJTA 3QWFA 1CE8B 3EB9A 3ZV5A 4A8PA 3KO8A 3L77A 4WLEA 3PC8C 1H5NA 3NDJA 3MFYA 4L02A 2HDOA 3UN1A 4BS9A 2PA3A 3ENZA 3A0UA 1XE3A 2PDAA 1TIKA 1I0LA 4FC6A 3ZNNA 2MSKA 4LOLA 3ODGA 2K6GA 5C37A 4WJZA 4WBNA 4MR7B 4NYIR 3LT5A 3B7GA 3G5MA 4LYGA 2XLCA 3HRIA 1UFOA 4AZ3B 4ZGBA 1C7IA 2B4AA 2G5TA 4P3XA 1IRIA 1AUVA 2QWXA 4TV8A 3ZWCA 1KTIA 2AG5A 4QBFA 1UJCA 3TLCA 1N2EA 5IVKA 2VUUA 2J33A 1UJBA 2WVHA 4FYWA 3EIWA 2C82A 2Q2QA 4R2HA 4N47A 2O2YA 2JIZA 3UFXA 4CPDA 4P35A 2JJ1A 5JNVA 3TTYA 3LK6A 4C0JA 1JU4A 4RMNA 4RAQA 4TKZA 3W6NA 1T4DA 3KK0A 1V6CA 2YWCA 2RIRA 4GE3A 2NXJA 5FTMA 2UAGA 1YRBA 2VAVA 3GCZA 3NTLA 3ONFA 3ZE9A 1MTZA 3KSZO 4Q9JA 3PX3A 2CXNA 4JGGA 5BPHA 2Q8NA 4JP2A 2ZE5A 1YS4A 3HYRA 5A0VA 2EJBA 2OSVA 4FBLA 1H65A 4HP8A 4KQHA 3KYCB 4R4JA 3W2EA 2DM6A 1UF9A 1MB3A 1SM4A 1OGIA 1VXRA 1WPGA 1ZS9A 2JGFA 4M1YA 3BIWA 4Q7KA 2G28A 3BXXA 1QV6A 4GX5A 1S96A 3V1MA 1GR0A 2IWHA 2CB9A 5JRJA 3UCEA 2RKWA 1FUEA 2O0HA 2NW6A 1JHPA 3P32A 3RVDA 4ARVA 3A70A 3K1ZA 2XNHA 2IYWA 3U31A 2PVPA 1YE3A 1P7PA 2ZW9A 3B53X 3HMQA 1LBHA 2P90A 4JROA 4OI4A 8ADHA 3WAJA 2AW5A 1YDMA 2YZGA 1ZVKA 1U8AA 4TSF