4LRWA

Crystal structure of k-ras g12c (cysteine-light), gdp-bound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
155
Chain Sequence
TEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 54
structure length 155
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lrwA00
3GD7A 2ZS7A 1ZNXA 1CKEA 2R2AA 4ITRC 4EIWA 1N6OA 2YKGA 3P4XA 5JEEA 3NHAA 4NYMR 2F1JA 5HCNA 2WV9A 1N5LA 3FKQA 4QC2A 1JNYA 1G41A 1VIAA 4Q5IA 1R0WA 3K9LA 1JR3E 4TMTA 2FGJA 2JLQA 2QUZA 2VRWA 4JYCA 5BWMA 3CR7A 2D7DA 1RYFA 2AXNA 1D9XA 4IFEA 4NDZA 3KL4A 3GLFB 2J5XA 4D4JA 2P0EA 1GKUB 2ZUCA 1FX0B 2CHQA 1A1VA 2HYIC 5GJWC 5UKDA 1NF3A 1KSGA 3EZ9A 5IRCD 2QP3A 3EIQA 4HATA 1G19A 1ZC4A 2WMNB 3AV0B 4AK9A 1ESNA 1NRJB 3NBXX 1D8TA 3U7HB 3I73A 4JLMA 4Z51A 5DISB 4KLNA 4UXHA 2GCNA 3RWMB 1T8TA 3SC3A 3KJHA 4HZIA 3IEUA 2J7PA 3AF1A 3R7WA 2O8CA 1AKEA 1NIPA 3AEZA 4F91B 3VU9B 4BUJA 1E99A 4OK3A 3HU1A 4Z8XA 3NH6A 3WHKA 2NG1A 2C78A 3LA6A 3LX5A 4Z8YA 1ZIOA 3SFZA 4B71A 5BN5A 1QF9A 1T8UA 2REOA 3TUZC 4RSGA 3QNUA 4QXAA 1OXVA 4O25A 1OFHA 1Z0DA 421PA 4D26A 1YZQA 4M1MA 4JJKA 1TL7C 4XTCS 3IO5A 3SYNA 1E2FA 3FOZA 3PVSA 2BCGY 3UWKA 4D0GA 2A30A 3LH5A 1OH7A 2DHRA 2QG6A 2W6JD 3B1YA 1PUIA 5G53C 2FZ4A 2OFWA 3UWOA 3W8RA 2IHYA 1Z06A 1G1MA 1ZAKA 2IYWA 4AG5A 2DR3A 4RD1A 2GXUA 1G3RA 3F3YA 4M9SA 4M21A 3WYFA 1ZBDA 2FFBA 4B3XA 1F5NA 4QL3A 1RRPA 3HPQA 2CCJA 2GJ8A 2V1UA 2N46A 4TMZA 5AJZA 5L3SB 3I1FA 2IYQA 3U6KA 3EPJA 5E4FA 3U3RA 2OAQ1 3HR7A 4B3FX 4Q4AA 3PJRA 1KZ7B 4DLTA 1K5GA 4XOIA 2WPDA 4PHHA 2QBYB 4DWJA 1AGRA 4LSGA 5CLLA 2G6BA 2J0VA 2QEQA 4AD8A 5BYJA 3QUSA 3WXMA 5C18A 5JWHA 2X8AA 3OFNA 2CK3D 3QXJA 3HYRA 2VP9A 4BFUA 5BW8A 4YQFA 5JLJA 2YC4C 3PUVA 3Q3JB 4BFVA 3THXB 2J0SA 1QVAA 2BEJA 2DWOA 3SYKA 2WWXA 3QPWA 2QT0A 221PA 2EFHB 1JECA 2FGKA 1COWD 2GEUA 2A5FA 5GVSA 4NCHA 1TF5A 2OFOA 4GL2A 1OH6A 2F6RA 2IWRA 3HWSA 3GJ8A 3E2IA 3ADCA 1R5BA 4ARZB 1KSFX 3ND8A 5KDOA 3FKSA 1RRFA 1E96A 4NBSA 4B6FA 3A37A 5JCZA 2J45A 2AX4A 4R2HA 4HAXA 5HE9A 4F38A 3W5IA 3ZVLA 1EFRD 1MO6A 2GA8A 1ZD8A 2BMJA 1X6VA 3VX4A 5J5CA 4MDFA 2EFEB 3OAAA 1TEXA 2IS6A 1J8YF 1W44A 1W47A 4RKEA 2F1RA 4WXRA 1L7VC 3UMSA 4OK5A 4KITB 5CITA 2F3RA 2ZJZA 1G6HA 4D6PA 4A0GA 2P2LA 1NY6A 2C98A 4QFMA 4LV5B 3SDZA 4TQAA 4JKYA 3GLFA 2WWIA 4DLXA 1A4RA 2J7KA 3B9PA 4D25A 1JEDA 1JJVA 1FX0A 2YZ2A 1Z28A 2PLFA 4JLJA 4N3NA 1Q1BA 1TF7A 5LPNA 1G5TA 1CR2A 2CVFA 4O3MA 2CL6X 2PMKA 3RSOA 3VKWA 1ODFA 4RFVA 1SXJE 2ERYA 2LKDA 3LO5A 3IGFA 4RZUA 4FMCF 4F4IA 3JZMA 4NHOA 4DEXA 1G16A 3D3QA 4IKEA 2O0HA 2JJ1A 3B1ZA 1ZNYA 1H8EA 2KB0A 2QTFA 3RRYA 4GT1A 4YXWD 5B2ZA 2F43B 4AURA 1N6PA 2P5SA 3EPKA 1H8HD 5FPHA 4PZYA 3GJ4A 4RY2A 1XJ0A 1G4UR 1CRPA 1G3IA 2EQBA 2IUSA 2Y8EA 4JLDA 2OV2A 3AUXA 1AM4D 1G5PA 2B7BA 5DE3A 2WKPA 2BMEA 2VSFA 4OQNA 3U7GA 2JATA 2HYDA 4NYIQ 2ZITA 1WB9A 4ZDIA 1JBKA 3KKNA 2GCOB 5FOUA 2RMKA 1J99A 4PPFA 4M9ZA 3EPHA 3BK7A 2WZQA 4KU4A 4CW7A 5EE1A 4PC7A 4ZI2A 4DCSA 4Q4HA 1M6NA 2ECKA 1XJCA 3AKYA 4JBXA 4LYFA 5FUXA 3ZDQA 3IQWA 4MUAA 3C15C 3SBDA 5AR1A 4B2LA 4B2PA 3K0FB 1AQUA 5CYPA 1C4OA 5L3SA 1LY1A 3ASYA 4J0QA 1A82A 3CRQA 3LWNA 1QHYA 4AYTA 4DT1B 4DB2A 5DGXA 4BLSA 5AJVB 2BMDA 1Z0KA 2IYXA 3C5CA 4BLOA 2QBYA 2UZIR 5DI3B 4W5WA 3OEHD 4S2EA 3UANA 4KYUA 3BRWD 1W5SA 3KJEA 4F93B 2QAGC 4ESHA 2V7QA 4IEIA 1KAGA 3VHXA 1N0WA 3ZVRA 2RGXA 1E2HA 1DARA 2CLCX 3FMIA 3CF6R 1YZLA 2QPTA 1NNEA 3MRSA 2YINC 3THXA 1XTIA 2RGDA 1GOTA 2Q9CA 3C41J 3OEEA 3NBZC 5EP3A 5G41A 3FYHA 2X77A 3FTQA 4DLWA 2ZSEA 4ZDJA 4LHWA 4UXIA 5DYIA 5HR5A 3AVTA 4IDPA 3MFYA 3EZ7A 2ZRAA 4ARZA 4HB2A 4K81B 1J7KA 2CL0X 2JCSA 1JPNA 1XEFA 5FTMA 4EFNA 2AR7A 3P1JA 1BYUA 2HUPA 2YWFA 1AN0A 5FBLB 4PANA 1KDPA 4DIEA 4EJSC 5JRZA 1KHTA 2VA8A 5F98A 1ZCBA 4N1AA 1HURA 2DWQA 4HAWA 4IVPA 3U3OA 2ERXA 2ZRPA 1XDBA 1KTVA 3THYB 1G8YA 3B78A 4RFSB 4AG6A 4DRZA 1TX4B 3B1VA 4UXJA 4A2QA 1XTRA 3PITA 4KFUA 3CF2A 4I1UA 4L9SA 4PTLA 5IT5A 3TBKA 2XB2A 1GITA 3HU2A 4U00A 3TIFA 4BASA 2W0MA 5FFMA 4XJXA 1ZVQA 2ZRBA 4GZMA 4TMWA 2GWHA 2O0KA 2ZJAA 3TUJC 4XVQA 5FUWA 1I4DD 1XX6A 2EYUA 2FJUA 5KOYA 5FUVA 1XFAA 5BYKA 3CNLA 1DELA 2PL3A 2ZRIA 4RD6A 1U94A 5EP4A 1W0KD 2CDNA 1S8FA 1XBTA 3I32A 4KSCA 1CR4A 1DBSA 1VCNA 4XSGA 4CT5A 4YMWA 1UEIA 1KI7A 3KUCA 2IT1A 4PPNA 1II0A 4JSTA 1JR3A 1RKBA 1FP6A 1LTQA 4GBMA 4O2LA 3R9XA 3DOFA 3V00A 1Z08A 5JECA 1Z6XA 2ZSAA 1P2TA 1MABB 2V6IA 2WOOA 3ZJYA 2XSZA 1VDZA 2LCFA 2X2FA 1S1MA 1KJZA 5KNCA 2RGNA 1V43A 1OW3B 3CBQA 3V4FA 3KKPA 1IJEA 3LX8A 4PQFA 3QG5A 2H5EA 5AUQA 1GIAA 1IXZA 2F9LA 4UNNA 3GP8A 2EW1A 3H4MA 1SULA 3KTAB 3SYLA 1CTQA 1P73A 3W6NA 2VHTA 5TMPA 2GCOA 3EC2A 1SXJB 2J41A 3PEYA 2V4ZA 2V54A 4L8GA 4IJMA 2IXGA 4AKHA 1KI8A 2ZE5A 3IBYA 1X1RA 4FIDA 2KBEA 4LHXA 3FFBA 3H84A 2VHJA 5CIWA 5JZVA 4PO1A 2IYRA 2MMCA 4A0RA 5JHHB 5BN3A 2ZYUX 4PSKA 1VYVA 3VKGA 1T4GA 4CT4B 3K0FA 2GETA 4DZZA 4Z54A 3JZAA 4QM7A 3MAAC 3AGPA 1VIYA 4TQUS 4ERNA 1F2TB 1UEJA 3RS3A 2QZ4A 4DT1A 4H1VA 1VG8A 3T34A 2WWGA 4MKIA 2FFHA 1JAIA 1U0HC 5JBQA 1W36D 1Z2CA 4Z1MD 3M0EA 5DI3A 3K70D 1MO4A 4TT3A 2JJ2A 3AVQA 3RYTC 5L3QA 1KK2A 1BO6A 3LLUA 4JT2A 2XTNA 3IDQA 1LW7A 1YQTA 3T5DA 1IONA 1EGAA 2J0QA 2OCPA 5DSZA 1OIXA 3FKSD 4MRSA 4M2LA 4LBZA 1NLYA 2F1IA 4R2IA 5IDVA 1GL9B 2OSBA 1O87A 4KLZA 5K8LA 1TEVA 1KI6A 2AHOA 4XSHA 1AJEA 1OF1A 4D0LB 2XOKD 4FWTA 1KO7A 4MA4A 4WZAE 1AZTA 2RGBA 3EZFA 4NYMQ 4AYWA 1S2MA 4FINA 1Q1ZA 3FVQA 2N42A 3TNFA 4QJ5A 2GESA 1NJFA 1Z29A 4PO9A 2V8OA 2OCBA 5HE8A 2KI5A 4XTRA 3SFVA 1DOAA 1QHIA 4EFMA 5DH9A 1ZCAA 3M1IA 2H16A 4GMXA 3WBKA 3ZH9B 4BE7B 4C2TA 2R65A 3I92A 4HLQB 1GNPA 1HV8A 1N6KA 2ZRDA 5DO9A 4KVAA 2ODWA 4KHZA 1NP6A 5LD2B 5HKKA 1PV4A 3TW4A 3THYA 2OM2A 4RFSA 4TYNA 4GOKA 3PEUA 1E2GA 1KJWA 4NYIR 2IF2A 3U44B 4A9AA 2F7SA 4Q9KA 1P75A 3HR8A 3WRXC 4KV9A 3A8TA 4EUNA 2B8WA 4EPTA 2QMHA 4DCVA 2VIIA 3H2YA 2ZR9A 3L0SA 2XEXA 1W0JD 1T6NA 2ZIAA 3QEOA 1G7TA 5E7MA 3QQ5A 1E9AA 4IOKA 2ZM5A 4OHVA 2H1LA 1BMFD 2FOLA 3LNCA 1KSJA 4LWZA 5JSZB 2O8FB 1G64A 4URYR 4FI3C 3PG5A 3CO5A 2IUTA 4TYPA 2ZSFA 2GCPA 2QGZA 2BBSA 4IDNA 4NTZA 2ZANA 4L9WA 1T3SA 1OSNA 5KNBA 1AQYA 4B3DA 2ZRFA 2BM0A 2F9MA 3C4JA 1G9XA 2CNWA 2ZJBA 4FWIB 4A8JB 3C16C 3JVUA 1N5KA 2ZRGA 4DDTA 1N6LA 3OE7D 4IDQA 2XXAB 1CJTC 3AVUA 1IXSB 5J4VA 3B6EA 3MGCA 2P6RA 4U5XA 3KTAA 4PQRA 5JWRA 3GLFE 1G8HA 1YHNA 5ELXA 4XH9B 1XCGB 1ZC3A 1ZYUA 5TDHA 1VHTA 4KCGA 1SXJA 1XMSA 4P0TA 2QU8A 3AF2A 1GILA 3K9HA 3L0IB 4I1VA 1LV7A 2P5TB 1R8SA 4LI0A 4EPVA 3U4QA 1E9BA 3KXKA 4CDGA 4ZKDA 4PFSA 3J81k 4QM6A 2XJ9A 1HQYE 1SZPA 3SJBA 5FOXA 1T0JB 2PX3A 1E9SA 4JS0A 3MG9A 1KAOA 4LRWA 1C9KA 2HLDA 2HXSA 1OPXA 1M7GA 1F2TA 4LBWA 3QXSA 2BEKA 3DM9B 4PC2A 5LBIA 5H8WA 1GUAA 2ONKA 1G4AE 2D3WA 3PUWA 4QGFA 2WTUA 4TTRA 5B30A 1X8KA 1ZMXA 5KNDA 1ELOA 2BM1A 3FMPB 3ZQ6A 3G0HA 1XEWY 4M9QA 2ZE8A 1I2MA 3A4MA 4LUCA 4JMPA 1U9IA 1FL9A 1HTWA 3MSXA 1BIFA 5GJBA 3ADBA 1OB5A 3T61A 2AKAB 2IXFA 2IYLD 2VLIA 3CB4A 4US0R 1GTVA 3CM0A 3AH8A 2G9NA 3GEEA 3B7GA 4TMXA 3KZ1E 3QG1A 2OCAA 3BS4A 1KO5A 1VYTA 2FG5A 2QMUA 2BBTA 3DL0A 3IPYA 4W5HA 5GJCA 3CKLA 3TLXA 2WKQA 2QRNA 1Z0IA 4DLRA 1R0XA 4R71A 4EPRA 5EE3A 4IFBA 1B0UA 2VH5R 4LYJA 1M74A 3WMEA 1OIVA 2HEIA 4RD2A 2ZJ8A 1WF3A 4AIIA 4YMTA 4OYHA 2OO7A 3C5HA 1E1RA 3F8TA 4OQMA 5FH9A 1T0HB 2REBA 4NE2A 1XXHE 2XNDD 1OHHD 1Z3IX 2A7QA 5L3VA 4RZXA 8OHMA 2EFCB 1KMHA 2D7CA 2G1JA 3RHFA 4FMDF 4Q48A 4R7ZA 3WRYC 4CVNA 2EWWA 1HQCA 4NKRA 3FHTA 1KY2A 2YHSA 2PT5A 3U44A 2GZDA 5KU1A 1TPZA 4FMBB 1N0UA 1MOZA 2DFNA 1QHXA 3MJHA 1Z83A 1NY5A 2RAPA 1II8A 2OHFA 2OUKA 2XAUA 2NO9A 5IF9A 4C9BA 4PHTA 1E0KA 5EQTA 1NG9A 2R6GA 4OK6A 4UJ3A 1PVOA 5EUMA 2IBMA 2WJHA 2WAXA 5JSZA 3I5XA 2O8FA 2GEVA 1E9EA 2HJVA 4JVLA 4NCJA 2MMGA 2ATXA 1IY0A 1SVMA 2CHVA 2GJSA 2FDCA 1ZU4A 4GFDA 4JJZA 1QHHB 3KDSE 5IK2D 1UKVY 1ZD9A 2PZEA 4IXNA 5JI2E 1CBUA 2GHIA 3OESA 1DG3A 4TTQA 4OBEA 3TMKA 4A8JA 1OFTA 3CR8A 3QBTA 3ZIAD 4DC9A 3VFDA 1VECA 1KYIA 5JS7A 1N6IA 1MT0A 2FPMA 4B2IA 4B73A 2XXAA 1S3SA 1AS2A 3OIUA 4OI4A 3OIVA 2CLDX 4W5JA 1GSIA 2WJJA 4B43A 1EESA 1VG9B 4PPQA 1M2OB 1FZQA 2D2FA 3LQRA 3N70A 1XWIA 4EKDA 2JLUA 2IXEA 3SR0A 2PT7A 5E7IA 4BFYA 1J90A 2IL1A 2XTMA 2ZI7A 3E1SA 2N1BA 1Z07A 5FBVB 3NKVA 2OBNA 4IRUB 3MJRA 2CCGA 2VF8A 3KKQA 3T1OA 2YWHA 1WQ1R 4OQFA 1Z0JA 821PA 1L8QA 1OXTA 2V6JA 3BJIC 3GLIE 1II9A 3BB1A 2GXAA 1S4QA 2OESA 1ZINA 5JWOA 2YJTD 2YOFA 4DXAA 1Q12A 4Q47A 2P65A 2ASEA 3HJNA 4BQSA 1RIFA 1U99A 1XPRA 4PXAA 4TYYA 1OFIA 1VPLA 5A4JA 1GAJA 1R5NA 3I4LA 4HYYA 4JLOA 1E2DA 4MGZR 3T12A 4BLPA 2RKOA 4TLAA 1U98A 1XD2A 4PC3A 4BWYA 5CM9C 3M4YA 4PX9A 4TLCA 1K5DA 3AVWA 1E69A 1LFDB 2I3BA 2VHUA 2JDID 4A0HA 1WBDA 2GEDA 3GQBA 3GMTA 1YU9A 4ACBA 3ONWA 2OCYC 2EFGA 4RCYA 3TJZA 2ZVPX 2QQEA 1NVUQ 1YZNA 2FNAA 2FN4A 2SHKA 4MKHA 2O8BB 2IW3A 1SHKA 2HF8A 4MGYR 5DN6D 2Z4SA 2I1VB 2KSQA 3CPJB 1ESMA 3T15A 4XWKA 3ZZTA 4PHFA 1OKKA 1Q44A 3KFVA 2X19A 5C46F 4P3YA 3UATA 1SVOA 1A7JA 2C5LA 1DE0A 3FFAA 2GVDC 2ODNA 4Y0AA 5J4KA 2GJAA 3E70C 1VTKA 3Q7QA 5EUQB 4MYCA 4HAVA 2ZREA 5G3ZA 4MRPA 1BYIA 1E2QA 4UNPA 4WBSA 1HEIA 4Q4HB 4JLAA 4Q9JA 1IN4A 2HCJB 4FMDB 4ZKEA 4C0JA 4L4UA 1ZP6A 4TLBA 3A36A 1UDXA 4Q1EA 2CHGA 3EA0A 3G5UA 1F2UB 1XXHB 4WA7A 2ZSBA 1DAEA 1YZKA 3ETLA 5FBRB 4FCTA 4UJ5A 2BCJQ 4ZCMA 3AKDA 2G0TA 4MRVA 4ZCIA 5LDDC 4V0ME 2GDJA 3QPVA 3EZ2A 3IPXA 5SZKB 2OBLA 3LBHA 3UG7A 4I1SA 3C8UA 4C7OA 2P67A 5FBWB 1QHHA 3T1TA 3NDPA 1G8GA 4PAOA 5HCIA 2NPIA 2IS1A 3PUZA 5GVRA 2QGNA 2YWEA 5EZ6B 1G3QA 5KO2A 1ZU5A 3CX6A 2DB3A 2YVUA 5FL7D 1E79A 4B3CA 4BPBA 1P61B 3W6PA 4KXFB 1WP9A 4A4DA 1W36C 4CEHA 1HT2E 2ORIA 4JBWA 2QAGB 3EWAA 4E07A 3K70C 2RGAA 3PXGA 3K0SA 3SBEA 3PUYA 3OF5A 1U8AA 4G01B 1QVRA 2ZRNA 3NBYC 4NYJQ 1E2MA 1XD9A 1SVKA 1XTKA 2HLDD 2JLSA 4RZ2A 1XPOA 1ZUIA 2QE7A 4BLQA 4Q1FA 4QGGA 1CP2A 2MSEB 1W4CA 3HU3A 3Q8XB 4M1OA 3K8YA 1ZIPA 2ORWA 1AS0A 2VYFA 3BD9A 1VG1A 3DHWC 3GLHB 4KBFA 2GK6A 3PFIA 4DB4A 3VQTA 4DBLC 3QPUA 1CXZA 4Q9IA 4EJSB 3KB1A 3TW8B 4BLRA 4LJ7A 3L8ZA 2IX3A 1U0LA 1WMSA 5TXGA 4HAUA 4B35A 3CZPA 4TSFD 3CPEA 2ONJA 1KNXA 2CE2X 3DMNA 3QXHA 4K46A 5AUOB 4LOAA 2GXQA 1N25A 2ZRCA 1Z6TA 4WW0A 1XF9A 3AVYA 1DTSA 2ZETA 3B2EA 2B92A 1E1RD 3S1AB 3GLIB 1JAHA 1Z47A 1Y3AA 2BKUA 2GTPA 1MR3F 2ZJ2A 3U3JA 5DNYB 3EARA 4OJKA 4U7DA 5G40A 1OV4A 1R8QA 1ZUHA 4JIMA 1PLKA 2QENA 1DPFA 1T91A 2PJZA 3RRMA 2O8BA 1DVRA 1A2BA 3LVQE 2IWHA 5JCPA 2W2TA 5KDLA 2Q9BA 4TL8A 1MO5A 3VNVA 2Q9AA 1E2LA 3ADKA 2ZJOA 4LHVA 1XPUA 1R10A 4D2IA 4I4LA 2FEMA 3KB2A 1T5IA 5TB5A 1NL3A 3AP2A 1XTSA 3KQNA 1S96A 3SHFA 5BQ5A 2BKEA 1D2NA 4P32A 1E94E 3VR1A 1K6MA 2J9RA 4F92B 2QTVB 1NVVR 2IYZA 5FOWA 2A9KA 1E9FA 3AF3A 2AK2A 3U3MA 1IN8A 2ZYVX 3H0KA 3OIWA 3GEIA 3PUXA 1EFHA 5DYGA 3B1XA 3D6TB 1N6HA 4WOPA 4NP6A 2BBOA 3IEVA 1RRCA 3QSYA 1JI0A 1VYUA 1U8YA 4LHYA 1XEXB 2W6ID 2AKYA 3I8SA 4AI6A 1F2UA 1XXHA 1HUQA 1L4UA 1NBMD 5A0FA 2QT1A 4WXPA 3BFVA 3Q7PA 3KKMA 2ZI4A 3QVVA 3SJZA 5L3QB 1MO3A 1S0UA 1FQKA 1E3MA 3I5YA 4AYXA 2JLZA 4BZXA 4LBVA 3QF4B 1UAAA 1IY2A 2CVHA 2Z4RA 4X8LA 4F4CA 2C8VA 3TGPA 4TWZA 4HDQB 2QP4A 4HB0A 5CDFA 4ZI3A 2FX3A 4KBGA 3TR5A 1YZUA 1U0JA 2O8EA 2NZ8A 3EW9A 1CU1A 1KI6B 1OXUA 2W0SA 2QAGA 4V0OA 4V0KA 2WJVA 3VNUA 3A1TA 4YMUA 5J4YA 4QJ4A 1IM2A 121PA 3LAWA 2WOJA 1XEWX 3N5CA 4NH0A 3KJIA 4Q19A 4EQ6B 4HI0E 4B33A 4B48A 1W1WA 4TQ9A 2XITA 3X1WA 2R8RA 3GEHA 1S3GA 4JSYA 4DCNA 3PEWA 2JLXA 3GLHA 3T5GA 1P72A 2HDNB 1UBGA 4QNMA 1EWQA 4D80A 2WSSA 5HZHA 3NIBA 4HB3A 4JL8A 1ETUA 4DUGA 4URXR 2H92A 5EXXA 4DLSA 3P32A 1R0YA 3UMFA 2Q3HA 1QG4A 4JKIA 4EJSA 3EZ6A 2KE5A 2OEPA 2QNRA 3Q85A 4GDFA 2PJRA 2H8KA 1KKLA 2J1LA 2J7PD 1DO2A 1BOFA 2QM7A 3AKEA 5TVKA 3WY9A 1OJLA 4G5GA 3GLGE 3LQQA 4DLVA 2C04A 2EVWX 2RGCA 5TARA 4V03A 1NLZA 1TU3A 2YNMA 3ICEA 1OB2A 3UKDA 4OHXA 4EPWA 2NGRA 3C14C 4HLUC 4DSOA 4OI0A 4NZYA 1ZM4A 4UNQA 1YRBA 2IHBA 3SS8A 3S1AA 3GLIA 3O47A 1I2DA 1KI1A 1Z8FA 5KSOA 4JVMA 1E2PA 3VHLB 5F9FA 2PZGA 4FMCB 1OIWA 1OKKD 2Q3MA 4IDOA 2A5DA 3IIMA 4QGHA 3MD0A 1SHZA 1RE0A 4IHQA 2JA1A 1IQPA 3MLEA 4D4MA 4HLUA 2VP2A 4DIDA 2CBZA 4ACAA 2G77B 2C9YA 3CX8A 1FTSA 4IOJA 3ZVNA 3RC3A 1GRQA 3ZZUA 2XTZA 5HTKA 1KK0A 5FR1A 1AA9A 3CUEF 2ZI6A 1HE1C 2VBCA 2CL7X 3U4QB 4MDEA 2PEZA 2AWOA 4M8NE 2NOAA 2V9PA 1TMKA 3EWSA 1FUKA 1VG0B 3CW2A 4H1UA 4NYJR 2WPDD 2QAJA 2W2XA 2CE7A 4Q7JB 1TU4A 5E7JA 1IN6A 1E9CA 3CLVA 2QTHA 4FW9A 3PEVA 2BVNA 1M7BA 1P7CA 1US8B 2NO1A 3EC1A 5J4LA 3K53A 3OFND 1E9RA 1XEXA 3T1VA 5G3YA 4OI1A 2ZXUA 1TQDA 4G5OA 1DAIA 4B32A 1FUUA 3NWJA 2P6NA 3DZ8A 1F48A 5DHFA 2BHRA 4HLDA 5F2EA 4Q01A 1F3OA 1E79D 4RJLA 1UKEA 2Z43A 2IUUA 3REFA 2QN6A 4BFSA 2ODEA 2WWWA 4QHYA 4IXMA 1KI4A 1PLJA 3TSWA 3K0CC 4LJYA 3O8BA 3WNDA 2XNSA 1DEKA 3ZD6A 1W4BA 2J0UB 4BZQA 3QF4A 3AQ4A 2NPFA 2DFTA 3CRRA 5CJPA 2FSGA 1E0AA 3FGNA 3RSLA 2GZAA 2CJWB 3AUYA 4A0FA 3NC0C 1E4YA 4QNRA 4LCBA 1PZNA 2AWNA 3OHMA 5BN4A 3GJ7A 2GBLC 3ZGXA 1ONBA 1P62B 1TF2A 5D3MA 1KI3A 2H18A 4BECA 3K1JA 3OAAD 3E5HA 3EX7C 3VTKA 3VR3A 4UNRA 5CYOA 5FL7A 4LYAA 1Q3HA 5CB6A 1EFUA 2C9CA 2OFXA 4V0MA 5FPTA 2A78A 1T3HA 3EASA 1XTQA 3U3KA 1FMJA 1OYYA 2R6AA 5FOTA 4HEJA 4EQ6A 3KXLA 5FPSA 4ZIRB 3WNCA 1OXXK 3KUDA 2V55B 3DKVA 1TQ6A 1KMHB 2Z6VA 2A2ZA 4JZKA 4QJ3A 5CM8B 4E22A 3TSOA 4L15A 1OYWA 4DSTA 4QBHA 3SNHA 5L3RA 2ZQ5A 3KQKA 3B13B 5EE5B 4B3BA 4OQLA 2PMDA 5A5GA 1CIPA 4PC1A 1NKSA 2ZRHA 3I72A 1II8B 3CNNA 1KNQA 2OLKA 4QKQA 2GKSA 3CWQA 2JJ1D 3LFUA 1H8ED 1ZD1A 3RRNA 2A5YB 4V0LA 4ILEA 2HT1A 2Z83A 3CWZA 3RS7A 4LPSA 4MYTA 5KYKA 2ZI3A 2DFKB 2OBMA 2K5UA 4OKSA 3DVLA 4KO8A 2H7VA 4G5QA 4Q18A 1EK0A 1NN1A 2MSDB 1RW4A 2G83A 2W6JA 3I8XA 5LB2A 1NIJA 5KPJA 1E4VA 1L4YA 1UBEA 1IXRC 4LJAA 4WVFA 3RLFA 3W90A 3MWKA 2B7CA 1Z0FA 2GAOA 1D6JA 1WXQA 4I99A 3KFXA 4LK2A 3EXAA 2HT6A 4EPYA 1NI3A 1CJKC 1G20E 3WBJA 5AJWA 3GLGB 5B57C 2EYQA 3BIFA 1VCIA 1Q1EA 1XNJA 4BLTA 3GJ5A 4DHEA 3DOEA 3WP1B 3A1WA 2VO1A 2FF7A 2P3SA 4M0LA 1OXSC 2J59A 4B3GA 1CJUC 1IN7A 3KKOA 1U8ZA 4AWXA 3BGWA 4QRHA 4GPTA 1GNRA 4ZCLA 1W49A 1NVXQ 4IOLA 2WSMA 1E2JA 3VX3A 3KQUA 4ON9A 2W2VA 2CK3A 2LWIA 4K8OA 4RD4A 1TTTA 2NZJA 1US8A 2Q3FA 1K8RA 1R0ZA 1U2RA 2V7QD 4LC1A 1A5TA 3QF7A 5EE0A 5LB4A 4U02A 1QBKC 1E98A 1Z5ZA 4P4UA 3UG6A 2KJQA 4KYIB 1OT3A 1NMXA 2GF0A 4A82A 5AWFC 3OEED 3DM5A 4Q9HA 4ZDKA 4KSBA 4CEJB 4POAA 2FV8A 1XD2B 4WAUA 4ZO4A 2J0UA 2RHMA 2NO6A 2FE4A 1QDEA 2W83A 521PA 1VMAA 3W6OA 2CJWA 1E1QA 1HH4A 1YR8A 1J2JA 3SZRA 1EFRA 1G7RA 1TADA 1W7AA 1P2UA 1KY3A 1SKQA 5FOVA 4AKIA 2ZRJA 3BORA 4JVSB 1G291 5HPYB 3BAFA 1SKYE 1OFUX 3AVXA 2WSSD 1CLUA 3DDCA 3GJXC 1P9RA 1QRAA 2CEAA 2C99A 4DUGD 4G5SA 1DO0A 2E87A 3FMOB 2WWHA 3IBGA 4ZIRA 1XMJA 2CXXA 3RS5A 3SE0A 2QL6A 2IYUA 1UBCA 5J47A 1GRRA 4TYQA 3LVRE 3AM1A 5CK4A 3LXXA 2WIBA 3ZS9A 1MRNA 4KI0A 621PA 2A5GA 2EFDB 2C96A 4C0SA 2QORA 2ZRLA 1AK2A 5EXSA 4URUR 1C1YA 5CDFE 2VP5A 1VCOA 1TUEA 1EFTA 1ZUNB 4A15A 1JR3D 3LDAA 4XD7A 4D82A 1HA3A 3IKJA 2LKCA 4YXWA 1E2NA 3QKTA 3ZQJA 2FSHA 3LY5A 2ZAMA 3FE2A 1Q22A 2RH5A 2XSZD 1FOEB 5SZIA 1H8HA 1R4AA 3GJ3A 4EPXA 2W00A 3X1YA 2YOGA 2QPOA 3WYGA 1KK3A 4B76A 4Q7MB 4WZ6A 1TNDA 3FHOA 4KODA 3D7MA 5DI9A 4C7OB 2DPXA 5FTLA 2YV5A 4DJTA 1ZNZA 2O8DB 2FPLA 2Q6TA 3AVVA 1KMQA 4F4JA 3GLHE 2BV3A 4MYUA 2C03A 3QXXA 2F3TA 2HCBA 1JR6A 5FI0B 2ANBA 4RD3A 1G7CA 1TAGA 2ZE6A 4B47A 4CEHB 3NC1C 4Q21A 3DKPA 3DO6A 3ICQB 2VP6A 2JEOA 3A4NA 5CLQA 5K8TA 1NVVQ 1Z0AA 3GLGA 3AP3A 5JI3E 3TVDA 2OXRA 2XZOA 4XWAA 3L0OA 4B6EA 5KSPA 1UF9A 4GP6A 3AP1A 3U7EB 4DLUA 4W7SA 1WRBA 5CB8A 1FNNA 1O3YA 4IW3B 1KIMA 4EAQA 2D06A 1W36B 3T35A 2NQ2C 3P27A 1DAHA 2FWRA 3K70B 1UKZA 1SGWA 4A2WA 3A6PC 4JLPA 3NXSA 3OEHA 4HDCA 5E3HA 3VR6A 2WM9B 4IVRA 3QKRB 1FTNA 4TT3D 2JJ2D 1LVGA 2VP0A 2J46A 3N2EA 4NONA 4YMVA 1DAFA 2GRJA 1U90A 5FTJA 3B60A 4BRWA 4IOMA 3TR0A 5P21A 4D4KA 1W4RA 1IOZA 2F55A 2VHQA 3ZVMA 1QHGA 2ZYWX 2F1HA 2WHXA 1HY3A 3LV8A 5IHPA 2JASA 3DEFA 4NCNA 3W3ZB 4CEJA 2QI9C 2JLRA 4E03A 4M1TA 2DWPA 3TH5A 3RS4A 3GJ6A 1XTJA 2VTKA 1A2KC 3G82C 3PENA 1RC8A 1UADA 2KWIA 4LJ5A 4PHGA 1X8LA 2DCUA 4H9GA 3BERA 4LGMA 4IVQA 4LV8B 3EPLA 2Q0HA 3ND9A 3REGA 1WCV1 2ZJ5A 2JIZA 1KK1A 3B5JA 1LF0A 1CJMA 2VQSA 1AGPA 2V1XA 3P26A 3RABA 5KUTA 4O0MA 2KBFA 1ZM3A 4L16A 4LJ4A 2WJYA 2YYZA 2R44A 1ANKA 2R9VA 2AD1A 2QM8A 2X2EA 3THWB 1E0SA 3HP1A 3MUFA 5HKKD 2A3RA 1XCPA 4DCUA 3K0AB 5C4MA 2BIFA 2D2EA 3NTUA 1G8PA 6Q21A 1P5ZB 3SJAA 1RYHA 4JL6A 4P4TA 2ORVA 1EX6A 2AL7A 1FNMA 1KO1A 1XD8A 5AK0A 1Q20A 1HYQA 3L2OB 3FPAA 3PV0A 5TV2A 1W0KA 1S9DA 2D74A 5FBQB 4US2R 2ZUBA 3RRZA 1AKYA 1SKYB 4CEIA 1CR1A 4LHZA 2V3CC 4MGKR 2CCKA 4M1WA 3I62A 2ZR7A 4BEBA 2ZYTX 4V02A 3H86A 1GRNA 3D31A 4PPGA 3LW7A 3RWOA 1LB1B 2GJKA 3WHLA 4TTPA 3WNBA 1JQJC 2FEOA 3CRMA 4GI7A 1IAQA 2CNWD 3DPUA 1P6XA 4HLCA 1YZGA 2R6DA 4LC0A 1YKSA 4LY6A 3KJGA 2IEZA 4JLKA 4DDWA 2EU8A 2QY9A 2ZU6A 1YRAA 4C30A 2OXCA 3RAPR 1IN5A 4PO8A 4LDJA 4X8OA 3TQFA 3D8BA 5JJIA 2O8DA 2WMOB 1NLFA 4M1YA 3L0PA 4A2PA 1KZGB 1SXJD 5GADl 3ZLJA 4LV6A 3AF0A 3B8HA 1GP2A 3VR5A 3LXRA 1WDTA 2O8EB 4XWOA 1DAMA 1LS1A 5KDDA 2UVQA 3VAAA 1GFIA 2Z0MA 4Q03A 1XJQA 3UIEA 4UQOA 2IEYA 3FB4A 3CZQA 5AUNB 4A92A 3A1VA 4PZZA 3U7FB 3UMRA 1M7HA 2G88A 3SI7A 2AK3A 1QHSA 4GMDA 2VSOA 2EWVA 4Z1MA 1JEEA 2REXB 4BGDA 1TQ4A 3BH6A 2DFLA 2VP4A 4XIGS 4FN5A 4XVRA 2Z5FA 3QKRA 4JLBA 1GG2A 3ADDA 3TKLA 3THOA 1J70A 2FH5B 2ZAOA 3NEJA 1P2VA 1KOFA 4AC9A 4FCWA 4OQXA 4PSVA 4PR0A 4A1FA 1L2TA 4B44A 1W48A 1BH2A 2QMOA 3OIYA 4LZZA 4N0DA 5FPKA 4MGIR 3W9YA 3SQWA 3KQHA 3NH9A 1Z6GA 1E1QD 4RCZA 2HJGA 3ECCA 4G5RA 4DVGA 1KSHA 3QBVA 4URZR 2XOKA 3HPRA 4R9UC 3IIKA 4DSUA 2B21A 4QOSA 3Q9LA 2BC9A 1GDDA 1NVWQ 1H65A 2ZRMA 3CRVA 1CS4C 1N2CE 4Q4JB 5FTKA 3WMGA 1WBBA 2L0XA 3N2IA 721PA 2D4HA 4M4SA 2ZUDA 4JL5A 2H17A 2ZS9A 2QSZA 4Q1CA 1Q3TA 2GJ9A 4AKEA 1NN0A 2E9SA 4KVGA 5AJXA 1ZM9A 2ZE7A 3FHCB 3K9GA 4LJ6A 1FMLA 1AZSC 5DHAA 2XGJA 4PZLA 5B64A 4TLDA 4AY2A 3T1QA 4M1KA 3TUIC 2R62A 3THWA 1GNQA 1N6RA 4BFTA 1B23P 3O8RA 2YWGA 1GM5A 2WWFA 3K0AA 4A6XA 1RRGA 3LW8A 2ZTSA 2VHCA 2ZEJA 2JLVA 4CRWB 1X1SA 3CF0A 3IIJA 4JLNA 4JLVA 2G0NA 3A58B 4MQBA 4PC6A 5KSYA 1XCMA 3QIAA 4S35A 4XD7D 3VU9A 3IHLA 1W0JA 1GKYA 1XRJA 1KO8A 2I1QA 4P31A 1BMFA 5BXQC 1RZ3A 3VMFA 3BB4A 1XMIA 4DEYA 3A1UA 5J4HA 2HV8A 1G3UA 4D0NA 1IJFA 4X8MA 5EJEA 4LJ8A 3B82A 1V5WA 4G3XA 4I81A 4TL7A 3TAUA 4XVUA 1ZW6A 3UXMA 2FFQA 2PBRA 3QY0A 4HUQB 1YR7A 4I1OA 4EDHA 4HAZA 5FUYA 1PLLA 1X86B 2JAQA 1R5OA 3OE7A 1G7SA 3CH4B 2XX3A 4GP7A 4PSAA 2FU5C 3JVVA 3BB3A 3Q5EA 2OILA 3TAHA 2DY1A 4QG7A 2G1KA 2RCNA 3PR1A 2DBYA 1NKTA 5EE9A 4NU0A 2NO7A 3IO3A 3Q5DA 2JLWA 1RFLA 4KAXA 3W8NA 2C77A 3EAQA 4KFRA 3DZDA 3TRFA 2BOVA 5TY0A 1D2MA 3SU8A 4WIAA 1D9ZA 3BH7A 3A1SA 1MKYA 5D3MB 1RPZA 1GKIA 4DLYA 4Q9LA 2PZFA 3CIOA 2GXSA 1U81A 1X3SA 1ZM7A 3SJCA 1HT1E 1Z63A 2ZR0A 2ZI9A 3U5ZB 2C95A 4Q00A 4URWR 2ZVQX 4YLGA 5C1BA 4LPKA 4EFLA 2ZJYA 4NMMA 3Q72A 4C0BA 1AIPA 1Z6YA 2AFIE 2ZPTX 4R98A 5KHOC 2PLRA 4F7WA 4A6PA 4GZLA 2VPPA 4QHTA 3GPLA 3VKHA 4FCVA 3UPUA 2XZPA 3RC8A 4CYMA 1WA5A 2PX0A 4E5UA 4ZPXA 1EFCA 4YONB 3GJ0A 3MWJA 2QROA 3B9QA 3MWYW 1N5JA 3V9PA 4ZV4A 2JIZD 5D3QA 2BJWA 3SQXA 3L8YA 1DS6A 5FPYA 2IF0A 2RHDA 5JEDA 4HZUB 3CPHA 1FP7A 4V0NA 1KDTA 2J3EA 1PJRA 1E9DA 4Q4JA 3RNLA 4ESVA 2HXYA 3KX2A 2O5VA 5K8IA 3WYAA 1W2GA 4DLZA 5E95A 3R9WA 3FDIA 3X1ZA 2QPAA 2AD5A 4DSNA 2XNDA 1NBME 1OHHA 3U2QA 3VR2A 5FL3A 5JJKA 1QHNA 2QSYA 3TE6A 1SVSA 4NCKA 1JQLB 2IS2A 1NN3A 3RS0A 3MCAA 1EXMA 4GSYA 3WMFA 4OJQA 1BKDR 3SEAA 3ZS8A 2XB4A 3LLMA 5JFGA 1E2IA 1F60A 1X8JA 3QENA 4C0AC 2GILA 1EX7A 3SOPA 2RGNC 1XP8A 3GCGA 1JJ7A 1FQJA 4YDSA 4MUBA 5SZHB 2RB4A 4TN1A 2PCLA 2PCJA 4X8HA 1RJ9B 2GAAA 2GK7A 5KSZA 2Q21A 3U60B 1CEEA 4QBFA 3GFTA 4ASUA 2WJIA 4KFSA 4C0HA 2JGNA 1G3MA 2C9OA 1VHLA 2F43A 4O2RA 2BBWA 4HDOB 4OL0A 3T06B 2P6UA 4UKDA 4GOJA 2WJGA 2IS4A 2UKDA 1RVDA 2PEYA 4MRRA 5IK2A 4KJZA 4PQYA 4KFTA 4Q7LA 4TL6A 3QE0A 4JT4A 4PAMA 4QHSA 3R8FA 4Q4LA 1T5LA 2O0JA 5C4GB 1W2HA 1NN5A 4HUQA 1E32A 2O52A 1D2EA 3ZIAA 1P9NA 3GFPA 1SVIA 1XU4A 4B74A 4DDUA 1CULC 1P9WA 1XMVA 2QA5A 1UDWA 3LRPA 4L5BA 5EXPA 3P20A 2J87A 2DYKA 1MV5A 4Y0VA 2JLYA 2GZHA 3MWLA 2WWYA 4BFWA 3V4RA 2OAP1 3C7KA 2NMVA 4II7A 2YC2C 4BZPA 3WP0A 3H1TA 3CONA 1E0JA 4M22A 1NMYA 4RKFA 4ABYA 4HAYA 2WVJA 1UFQA 1KKMA 3K0EA 4C0KA 4TZ0A 1T9HA 3SHWA 1ZM2A 4MH0R 2QE7D 1JXOA 2ZRKA 4MYHA 2W58A 2R6CA 3K0CA 4HUTA 1GL6A 4C0LA 4MITA 3I61A 2WKRA 3QOFA 2PH1A 4P4SB 3M6AA 1OH8A 1MH1A 1NJGA 3CNOA 4DKXA 4E09A 1CRQA 2HF9A 2C2HA 2JJ8A 4N0EA 4TMKA 5JMTA 4PAQA 2GBLA 3LD9A 1G17A 3NBFA 3QXCA 3TVTA 3MMPA 2OT3B 4HB4A 1IBRA 4TLEA 2BMFA 1J8MF 2IA5A 1YJ5A 2ODBA 3TK1A 2A5JA 4TYWA 2JDIA 1FFHA 3QJYA 4RZ3A 3K09C 3B85A 4LX0A 5ANRB 3QKSB 3DMDA 4CGZA 1KDRA 5EP2A 1T3LA 2QRZA 2WIAA 5C2JB 1NMZA 4HZUA 2YOHA 2FA9A 1SQ5A 1ZJ6A 3KQLA 1HE8B 2QMEA 5DN6A 5EZ5A 3U61B 3K09A 3OZXA 3BOSA 1G21E 4OHWA 2G3YA 2GF9A 2R6FA 3X1XA 1E6CA 3ZZ0A 2E1RA 4TMVA 1P3JA 2ZU0C 1Z22A 1KI2A 1W46A 4Q1AA 2IC5A 4OHYA 4ZDWA 3TQCA 4A36A 2OZEA 3BE4A 1CR0A 1R2QA 1G5RA 1JPJA 3ASZA 3IILA 3LBIA 3R20A 5F9HA 5J40A 4M53A 1M8PA 2FSFA 2IYYA 4WZBE 4DDVA 3GFOA 1GVNB 3PCRB 5CJ2A 3ZD7A 3IHWA 4BFZA 4D4LA 4YC7A 3R8CA 2ANCA 1RJ9A 3FMFA 3PIRA 4D81A 1UM8A 2WICA 1GWNA 5L8VA 3R9IA 1MABA 4BEJA 3A4LA 3BH0A 1SXJC 2NTYC 2D62A 4Q66C 3RDPA 4C0QC 5F3WB 3AGQA 1ZNWA 2OG2A 2OE2A 5KPDA 3SN6A 3NVAA 3AVPA 5FR2A 2FFAA 4P33A 1S1CA 4US1R 1Q21A 1SVWA 2WBLC 1M34E 3K9NA 1WE2A 3W5JA 3KXIA 4M9XA 4URVR 3UK6A 3NG1A 4UNSA 4C3ZA 4B34A 1E2EA 1W5TA 5JS8A 1GZSA 3ZYCA 3U6BA 4AKGA 1COWA 2AN9A 2B6HA 1KGDA 4OHZA 4DCTA 1JB1A 1Q0UA 5H68A 5CK5A 1N6NA 1R6BX 1U9IC 4TL9A 1QZXA 2IK8A 3L82B 3CRW1 1Y63A 1LNZA 2IYSA 5K8UA 5KTYA 1M1YE 3EIHA 1OH5A 3AKCA 3BC1A 4Q02A 1R7RA 2IYVA 1Q57A 3EG5A 1G18A 2ZSDA 1EG7A 5H1YA 1P2SA 1Z2AA 2XJ4A 1LS6A 2GVZC 4LJ9A 5AUPB 1KO4A 4GOXA 2VSXA 4M1SA 4NCIA 1MRSA 1I4LD 2IYTA 5DIFA 2B8TA 4RD0A 2ZROA 3BXZA 5JHGB 1OLOA 4P4SA 2TMKA 4OI2A 4C4PA 1N0VC 1N3BA 3NDBB 1OE0A 1XZPA 1UKYA 1VCMA 4G1UC 5JRJA 1TQ2A 3AVOA 4HSEA 1YR6A 3B1WA 2ATVA 5AJYA 5FTNA 3R7WB 2CMKA 4FD2A 2O8CB 5FI1B 3VR4A 1YR9A 4TSFA 1YZTA 1P60A 2MSCB 2I4IA 4JVNA 4CIDA 2UZ3A 1W4AA 4YDHB 2NIPA 3RANA 3X2SA 5LD2C 2BDTA 3L43A 2OLJA 1JXMA 3AB3A 3BFXA 5B58C 1EWRA 2VL7A 1IY1A 1FPMA 2RGEA 1AS3A 3F5FA 5HZKA 2ZS8A 4FXPA 1F6BA 4CEIB 4MKFA 4G0NA 5JJLA 2CLSA 1SVLA 2VF7A 3AF4A 3QKSA 5DLQC 1GL7A 2FSIA 1CJVC 4QBGB 4RVCA 1TUIA 4C2UA 5M04A 5CIQA 3EIEA 1P4SA 4NL4H 5H70A 3RVBA 3TSZA 3W34A 1NSFA 2BJVA 3QKUA 4TZ6A 3O8DA 2GNOA 3PQCA 3EA5A 4LYHA 4GRAA 3IUYA 4CZ2A 1UBFA 3HYTA 1QG2A 3NHBA 5SZJA 1KI9A 1G6OA 4Q1DA 1NG1A 1NSTA 1ZRHA 1Z6AA 2QQ0A 3FWYA 5EP1A 3X1DA 3P4YA 3QI2A 1FW6A 1YVDA 1YE8A 1D5CA 1G8FA 5FOSA 2WAYA 5GJVC 3I3SR 5EXTA 1UPTA 4BFXA 2AXPA 1DAGA 3IQXA 4ASUD 4Q4AB 4BRUA 2FMXA 1PUJA 3NEYA 4MRNA 4A8JC 1LF5A 2H57A 2QP9X 3BWDD 4CF7A 1XB2A 1DG1G 2BWJA 3F0TA 1Q1QA 1JALA 4MKGA 4Q7KA 1I4TD 2FZLA 3BBPA 3CX7A 1S9HA 4QBIA 3O8CA 4JBYA 4NPHA 2RGGA 4QGAA 1KDOA 2W6IA 1N5IA 1DAKA 2NO0A 2X1VA 1E2KA 4B75A 4LBYA 4W9MC 4JYBA 1XZQA 4GNKA 1NBMA 2XZLA 1DADA 2FPKA 3CH5A 2ZI5A 4Q1BA 1KJYA 4IEEA 3LBNA 3HDTA 1VKJA 3RS2A 4IDHA 3QVUA 1IHUA 4YMSA 1CF4A 1BS1A 3W3AA 3QEJA 1UJ2A 2VEDA 3BFKA 2AFHE
chains in the Genus database with same CATH superfamily
3GD7A 2IUFA 2AEFA 1Y8QA 1ZNXA 1LX7A 1IUKA 3UJ3X 1EVZA 2P6OA 4FTWA 3VR5H 1N6OA 4Q93A 3I2YX 4P8RA 2DJIA 3CUYA 4IDEA 1YJBA 4NYMR 1Y9EA 2F1JA 3QX8A 3C5WP 1YU6A 3SIWA 3SLKA 4TPKA 5LQMA 3I2KA 1GGEA 4ME6A 1VLQA 3PNQA 4M89A 3G3EA 4QC2A 4QO7A 3DEYX 1VIAA 1H94A 1TZCA 5B1DA 1TVEA 4HDKA 2YCBA 4JYCA 5BWMA 2AZDA 1HDXA 4EK9A 2IY9A 1VE6A 5AI0A 3VU3A 3P0HA 2AXNA 4ZCSA 1ZVKA 2QF7A 1VI6A 3U4GA 3Q12A 1WTCA 3P9ZA 4RMGA 5C1PA 1L8XA 3GLFB 4KPUB 1M34B 2ZUCA 1MU0A 1XZGA 4I1IA 3M2TA 1TU0A 2NU9B 1JZSA 4EY7A 3QMPA 5ELMA 1FSGA 4WBNF 5I7OA 2A1UA 4XM0A 4R01A 5BSRA 3FJOA 3GQVA 4QUGA 3JR7A 4E5PA 3AV0B 4J3JA 4YP9A 4NAUA 3ZCSA 1NRJB 3DTVA 1UAYA 3RADC 3BJMA 3C43A 5B1IA 2O1WA 3BTSA 1N0HA 4OP3A 3REQA 1CHNA 1SJ9A 2G9RA 2ZBVA 4FYIA 2CMDA 2GCNA 3RWMB 3VH3A 5JBNA 1SPBS 1WSAA 2HI0A 4BO6A 4HZIA 3OZVA 3R6GA 4WINA 2ZUVA 1B74A 2O8CA 2B78A 3FBTA 3AEZA 4UNIA 4HDRB 3C3EA 4TVSA 3W2GA 1E99A 6ADHA 4G4SO 2IZ0A 5EIFA 4Z8XA 2QW0X 3HBFA 2R8YA 4L9RA 3EFBA 4IS3A 1ZIOA 5BN5A 4B71A 2CN1A 3NC4A 1G66A 2OZLA 1MCZA 3KR0A 3QNUA 1Z0DA 4RSGA 4BP3A 5KJCA 1PEDA 2X13A 3QHAA 5LYYA 2YHAA 1VA5A 5ESDA 1TL7C 2BEWB 1Y5IA 3WLLA 3U62A 1E2FA 1FC0A 1T15A 1O54A 2GD2A 2A0KA 2QTTA 4I50B 4WKNA 1WQ3A 3RFCA 3UWKA 1BRTA 3W5HA 2BZ1A 3TRHA 2DHRA 1RHQA 4LMPA 1EKXA 1T4CB 3B1YA 4GEKA 3NORA 4G0YA 4F9FA 1LVUA 2FZ4A 5DMXA 1QYVA 2ID7A 2IU4A 3OU7A 4RE6A 4K6CA 3FGOA 4Q3AA 4OKIA 4MW9A 5LQUA 1Z06A 3OLVA 3W4JA 1IVYA 1SELA 3W05A 2EHDA 1OX4B 3RK0A 3ZHBA 1BFDA 3JD2A 1G3RA 5BQFA 1ADJA 5MF6A 1H4TA 4QUEA 5KNBH 1PJQA 1Z56C 2BFCA 4M21A 3WYFA 3HMKA 2SNIE 3JASB 4QL3A 2NVUB 1RRPA 5A6VA 2CCJA 4N6OA 2C58A 2V1UA 2EGUA 4W8HA 1GGKA 2N46A 2V7WA 2GHTA 1NC1A 3UYLA 3SICE 3A6FA 4J0IA 3CJTA 1B73A 4JB0A 2FN3A 4Z4GA 5E4FA 4CLRA 2H29A 3HR7A 2PD6A 1KZ7B 2J3HA 3HKDA 4N54A 3SYRA 1B1CA 2PZMA 4PFQA 3SEFA 1E20A 4MCHA 3WGMA 1U2QA 4PHHA 4XEUA 1DT3A 1P44A 2O48X 3H5WA 4MHTA 2VF5X 1OTYA 3TZ6A 1XZ8A 3OQNA 4X61A 3HYRA 3IEMA 2HNAA 3VHXB 4BFUA 4EZEA 4CMJA 4PR3A 1G0NA 4P7BA 1M75A 2VQ3A 4BFVA 3GVCA 4I9GA 4D0RA 4QDXA 1QE3A 4ZXFA 2R751 5EJ6A 2J0SA 1TT5B 3CLUD 1NJ6A 3HJFA 2C2ZA 3DL4A 3CVUA 2A0XA 2QT0A 2NPOA 3DXFA 3GGJA 4GX2A 3KOWA 4ZYXA 2CXHA 2UAGA 2X9NA 4O4HB 5DFAA 4EG7A 3HWSA 4ZYUA 3E2IA 4KQIA 3ADCA 1SHJA 4RKYA 3TINA 1OZ0A 4MO2A 4ZK2A 5A0TA 4IIJF 3SR4A 1BE8A 3GUCA 5CVVA 4NBSA 5JCZA 1C9JA 4BCDA 1EK2A 1RQGA 4QDUA 4DNQA 3L6UA 4NOMA 3ZVLA 1MO6A 2C3MA 2FJPA 1CC1S 3P2MA 4YGXB 3ABQB 2H1VA 1RHJA 3FFTA 1XOIA 2UXDB 2IS6A 5EKTA 3RU9A 1B0PA 1W44A 2F1RA 3UA3A 1L7VC 2IIPA 4BP8A 4KUGA 4FFRA 2XUKA 5CITA 1MDBA 1T4MA 2PS9A 3Q3HA 1SURA 5ESRA 4YRAA 4JNKA 1B2LA 3GCZA 3BHJA 3TPCA 1BGXT 4OXIA 2X3FA 1YCFA 4JKYA 1NSYA 4F60A 1ZNQO 3PX3A 1T43A 5JZSA 4WESA 3LBYA 4D25A 1JJVA 4AO7A 4C4YA 1FX0A 3KEMA 3GDFA 2A9RA 5K3AA 4BLUA 2YZ2A 4NZOA 4AZSA 5BUQA 5A04A 3G2JA 2BONA 3JYPA 4L27A 4AKSA 3GYBA 1X80A 4GX0A 2OCLA 1E1YA 1CR2A 1NDQA 2EWMA 5IAGA 3RFFA 2PZ8A 3G2NA 3E3MA 5TX7A 3VKWA 1WF6A 4CCYB 3O9VA 5EQDA 4HMPA 1UDCA 4EB6B 5GIPE 3SZLA 2PGJA 4BDTA 1PVVA 2OB1A 3ROMA 3MXOA 1PX0A 4HGRA 4N65A 3UQYS 4ENTA 2PL1A 5L4NA 1PT7A 3PPIA 3QVOA 2BHTA 4EF6A 2XKJE 3B1ZA 2TMDA 2KB0A 2QTFA 3HKBA 3BMOA 4KR0A 2Y1WA 1JQ3A 2B9VA 2PVSA 3A4IA 5B2ZA 3D43A 4YXWD 3ILVA 1N6PA 4OF4A 4OBBA 1WCYA 5CXQA 5J2UA 1V9SA 1H8HD 1SCUB 2BEUB 4PZYA 3VR0A 2XRYA 5CYGA 1AMNA 2ZDQA 1UXJA 1Z38A 4N5IX 4B87A 2IUSA 2Y8EA 2OBYA 1MAUA 3U7GA 2VSFA 3QFRA 3T9FA 3KQPA 4MVJF 2DQZA 4A27A 2AUNA 2QHXA 1GKLA 3L3BA 1WB9A 2CXPA 2RMKA 1J99A 1IDN1 2VAPA 4ERXA 1MZVA 3UK2A 1DIOB 4C1BA 2J3KA 1HZZA 3BK7A 1RZVA 2GYVA 3IOYA 3MPUA 2ENUA 4M8LA 4N76A 2AI2A 1DIRA 2G40A 3QW2A 3WVNA 4CW7A 5DNCA 5EE1A 4C04A 4ZI2A 4FGLA 4HGZA 4WKGA 1F1BA 4R0NA 3MGKA 4IQ8A 3ZWQA 1M6NA 1XJCA 2ECKA 3AKYA 3IAM6 4LYFA 3QFTA 4UBKA 5AKIA 1HNZB 4AQDA 2JBHA 1V0JA 5DK6A 5AVWA 4B2PA 1L7PA 5L3SA 1LY1A 1ESCA 1EP2B 3CRQA 1DLJA 3PQFA 3VSEA 1EP1B 4FYVA 5KMGA 4G1BA 4DB2A 4NZZA 5CFZA 3BE6A 3NKFA 1UPXA 2Z09A 3C5CA 2BH9A 4NQRA 4BLOA 5DI3B 5IKXA 3LTNC 3H5AA 3CS3A 3UANA 5FRDA 3ZE9A 2DCMA 3C74A 3FNEA 2VPXA 2Z57A 3KJEA 4YRFA 3S70A 4ICIA 3OUUA 3GAMA 3L05A 5GGXA 4TTIA 5LLSA 3WQHA 1PFGA 1IVSA 2V5UA 3V1UA 3L93A 2Q5FA 2CLCX 1QV7A 1JTEA 2JZNA 3PEEA 2PPVA 2W8BB 4PY2A 1QO0D 2RI6A 3BGDA 2QPTA 4YJGA 3FTEA 4EFDA 2QWXA 2WSLA 1XVVA 3MRSA 3THXA 3R41A 2G7ZA 3KYDA 4I7EA 4IV5A 2IV2X 5EP3A 3RVRA 5G41A 3MTEA 5M2QA 4GU5A 2JA2A 2WD8A 3HR4A 3K6RA 4GQBA 1HYHA 4UXIA 5DYIA 3NHWA 4MS1A 2ET6A 3DZFA 4JT8A 2OZKA 2ZSKA 2ZRAA 4YAIA 4B6PA 5FJJA 4K81B 3LCVB 1YK1A 2JCSA 4BRZA 1AGNA 1BYUA 3CF4A 2HUPA 4RJ2A 2YWFA 4GBJA 1UZAA 4UC0A 3NM4A 4Y2QA 2Q7DA 4JWTA 4UEWA 5FBLB 2BTQA 1KDPA 3EAFA 3G17A 3DNPA 5JRZA 1IEXA 4I4NA 1DL5A 4RELA 3KPVA 4KNWA 1XDDA 1T5DX 2DWQA 3SZGA 1XA0A 5K3FA 5EUBA 2ZUUA 4QARA 4DABA 3H6HA 3T3HA 5KKNB 3ED5A 2O19A 3THYB 4YJ3F 4RFSB 1E77A 1LPNA 4HWKA 4CQMA 3H5NA 1XU9A 2BKVA 5CW2A 4DRZA 3MBOA 4UXJA 1FTGA 1JJIA 2UU9B 2Y1GA 3PPYA 4Q82A 5DRYA 2VBFA 1P45A 3I4FA 4XDYA 3AERB 3PITA 4KFUA 1WKVA 4L9SA 1GA1A 5TPZA 5JATA 3A1EA 3AC0A 1FFXB 2PYDA 4BASA 2W0MA 3OH8A 1GPJA 3EGXA 5FFMA 3L7AA 2F4NA 2QQGA 2GWHA 5BW6B 5LJIA 4YHBA 3U9TA 3CZCA 1KZ1A 5FUWA 5KOYA 4RTJA 3ECSA 3BCSA 1QC5B 1UBUS 2Q5QA 3CNLA 4L3WA 5A62A 5L9AA 2DZDA 4KUHA 3WLJA 1QTNA 4NJMB 1N5DA 5K8JB 3WLAA 1DBSA 1RYYA 3DBLB 5G0VA 2JFZA 3U1TA 2J3QA 1KI7A 3U37A 4QFDA 5EKSA 3ISVA 2OD7A 3VNSA 1SUDA 3TB6A 3H9CA 4O2LA 1O9GA 1TW3A 2EG5A 1ECFA 1U11A 3V00A 1ZJ5A 3EOBI 1Q0ZA 2ZSAA 4H59A 3B52X 2NT4A 1QK3A 4MJ7A 5SICE 2OFFA 4UMFA 1B3BA 2XSZA 4IDDA 2LCFA 1KHHA 2H7CA 2X2FA 2O7VA 1KJZA 1T9ZA 2PRYA 2QVGA 1BCRB 4NBWA 2RGNA 4U7WA 5CP8A 3ZY6A 5BW5A 5BV7A 2O7RA 3BD7A 1DFIA 3IDOA 3V4FA 3KKPA 5DSXA 3QG5A 5B1SA 3TI7A 4B45A 2QD2A 2EW1A 3KTAB 4I36A 1UPCA 1CDDA 1A88A 3SYLA 1CTQA 5B3JC 2X0IA 4ZAGA 3PVZA 3W6NA 3PXDA 2FHSA 2JIMA 2QZZA 1U2GC 1LBHA 1MAVA 1SXJB 2J41A 2V4ZA 5JMPA 4DV3B 3ZCXA 4IJMA 1UWVA 5FP0A 1UPFA 3ANNA 3DBVO 4OL9A 1FRZA 4YPVA 5KYYA 5I4CA 3BA1A 2VT7A 3F5MA 3ZCRA 2Q8PA 1D0VA 2XYPA 3H84A 5I9SA 1F06A 4XFKA 1QYIA 2IYRA 1LRKA 4INZA 2EZ9A 2DSTA 4PSKA 4YTEA 3BRSA 1NW6A 2VXBA 4CKBA 1VLHA 3K0FA 3ILHA 3L02A 1SIWA 2B4RO 3JZAA 5K09A 2OWDA 1ZJJA 1HNWB 1GGMA 1LQTA 2ZAGA 4HDSA 4UUNA 5CX1B 5MN5A 2HPHA 2Y1CA 3P0FA 3WBFA 4MLPA 1EJ6A 3T34A 3R5JA 5AH0A 3KKEA 4BJ3A 4DY6A 1JYEA 1J2UA 4JHLA 1VXOA 2EDCA 4RXUA 3RW9A 1Z2CA 3K70D 1HSOA 1MO4A 3R3UA 3RUDA 3RBZA 3NTOA 4TT3A 1BS9A 3LPCA 3VRHA 3EYWA 3OETA 1KU0A 1RAIA 3QX9A 2DT5A 3LLUA 1XYVA 3E7WA 2RBGA 3OT5A 3RO7A 1NMQA 2Q0SA 3IDQA 1SC1A 3BUSA 3LUKA 4NBLA 4KSYA 1IONA 1EGAA 2J33A 4ZOCA 3HFSA 4E7PA 5A1JA 1DX6A 1OIXA 5JPIA 3AU8A 3DE4X 4JUAA 2GM5A 4FDVA 4MRSA 4M2LA 2HKIA 4X84A 1NW9B 1TB4A 3QWBA 1Q95A 5IDVA 1O87A 5C80A 2YV1A 2YBEA 3FYUB 1KH1A 3D8SA 3OOJA 3M4NA 4ID3A 4QO8A 3SIXA 5IAOA 1E5LA 3TGLA 1KO7A 4I2VA 3B2QA 4WZAE 1DV1A 5KJEA 4EJ2A 1ZJ4A 3UCXA 3OMXA 4A8TA 1Q1ZA 1BW9B 3IKVA 4HT3B 1QS0B 2W2KA 2V8OA 3NUZA 3LQ1A 1KYYA 2KI5A 1D09A 4BMVA 2ADMA 1DOAA 1EDBA 1P0IA 2G82A 4UEQA 2VYVD 3BVPA 5F1PA 4EL0A 4EFMA 2K87A 3I6MA 2H16A 2IBTA 4C2TA 3NJ8A 3BTUA 1L1EA 1J7JA 1HV8A 5DO9A 2CNDA 2HDOA 2IY8A 5JFTA 4KHZA 1M0SA 1J2YA 1E8DA 1NP6A 4GQIA 5HQJA 2NO5A 1XDSA 2OM2A 2YH2A 2EKQA 3UC5A 4RTQA 2JIQA 1M66A 3PEUA 3IQZA 4HNHA 4NYIR 5GP1A 3DA8A 2VTEA 4U9HS 2PMWB 2G6TA 4KE9A 1YB5A 3LPLA 2F7SA 1VL8A 4K86A 3E9NA 1DHTA 4N5DA 3WRXC 1NT2A 5K3CA 4CL0A 4TSKA 3STHA 2SKDA 1R0SA 1U2ZA 1NU6A 4UVDA 1Z82A 4DCVA 2VIIA 3P0JA 4RQAA 5HMLA 1UBOS 3RD5A 4ZU1X 1TCAA 3HYCA 3AONB 4PYJA 3GZNA 2MYPA 1UOEA 1W0JD 2ZIAA 3QEOA 1G7TA 4TKUA 4R0MA 1IBMB 5LDHA 1Z25A 1BQ3A 3MN1A 3PHJA 4OHVA 1YA6A 4RXMA 1KSJA 4LWZA 2QLBA 2CV1A 3CO5A 5ERGB 2DULA 3O4VA 2ZWMA 2GCPA 4R2WA 1WVMA 1ZMOA 1G9SA 4NTZA 4FHGA 1UZLA 2ZANA 4L0CA 1AT1A 1AB5A 4L9WA 2XQVA 1T3SA 3D7LA 1OMOA 4BU1A 4L5YA 2PVCA 3UCEA 2B30A 5A02A 3CVWA 2ZRFA 1WM1A 3WWEA 5LU9A 2F9MA 3CMCO 4PLGA 4A8JB 1YULA 3IQFA 4GIBA 2HL6A 1N5KA 2OC4A 1N6LA 2XMPA 2AE2A 3C3XA 3R09A 1RLJA 3PT5A 1IXSB 2WLSA 1D03A 3P94A 4MWDA 4TKVB 3UJ6A 4B46A 5J4VA 1JG6A 3EVGA 1N32B 1YZYA 4G5XA 3T1NA 4NBNA 4PU0A 1I3CA 3O1LA 5DHQA 4BO8A 5CDUA 5JWRA 1S8AA 2ZBRA 2AW5A 2H2FA 2Q9UA 4R1PA 5A5DA 3QE9Y 1VHTA 2EQAA 3KJNA 2AW3A 3WLRA 4Z7NB 5FL7A 2YASA 1GILA 1YE5A 3K9HA 3LG2A 1LV7A 1R8SA 2VJBA 2Z2XA 4HYQA 4CDGA 2QGFA 4DCOA 1EIZA 3SXUA 2CNNA 1T3TA 4TXHA 2YYYA 3IVCA 2HQBA 2W4QA 3G0GA 2PX3A 4LWOA 4C22A 5JDIC 4OIFA 3G1TA 1W25A 4JS0A 3MG9A 4TXNA 4WK4B 3WGZA 3UJNA 3SOZA 3TSYA 2C4VA 2HLDA 2WF8A 4UU1A 3KEQA 2HXSA 5KTNA 3JTEA 1IN1A 1YFKA 4OJMX 1M7GA 2I54A 1F2TA 2H1RA 4BNFA 1MXHA 5KYTA 1I36A 4IGFA 4PC2A 5EJ9A 3QVTA 1GUAA 1QZZA 1MX5A 3U13A 1N9KA 2W70A 1U7WA 1X8KA 2C2XA 3OJWA 3VDQA 5K0FA 1ELOA 3ZQ6A 1BJTA 2R11A 1PF7E 6LDHA 3G0HA 1XEWY 3G5MA 2YVLA 1I2MA 3A4MA 3LUFA 4KK4A 4LZAA 3NIDB 3NHJA 5EZYA 1UUFA 3ZE0B 3JARA 1EVIA 3H0CA 3MSXA 5GJBA 3TEJA 3HKCB 2AKAB 2Q45A 2VLIA 3HRHA 4BNHA 1DZ3A 2E89A 2IIVA 2R5NA 3AH8A 3WAGA 4G4GA 2G9NA 4DXHA 1KEPA 1GRCA 2FKNA 2R1ZA 1NPYA 3B7GA 3GQBB 3ICOA 5IBQA 3VU8A 2OCAA 2VDUE 1B0AA 2QTLA 4FDMA 1KO5A 2QTGA 3PC6A 2FG5A 3CLHA 5ALGA 4RMNA 4Z0NA 4B9AA 4W5HA 4D4IA 2VFAA 3KSZO 4XGRA 2GAJA 3RHZA 1A4XA 4Q9DA 1EGVB 2C0QA 2P8JA 3O1IC 1VJ1A 1OIVA 2HEIA 4RD2A 4JOQA 1P74A 1QIFA 4PWZA 3SC4A 4F3TA 3L46A 3C5HA 3IBSA 4O4JF 1KXJA 5CVEA 5FH9A 4KE7A 3TMYA 1L7DA 2REBA 4NE2A 2AR0A 1JHYA 3E9EA 5BSFA 3Q8WA 3AEYA 4JB8A 3K1YA 1Z3IX 2A7QA 2ZB7A 5CTAA 4ZODA 5L3VA 5LR6A 1A27A 2EFCB 8OHMA 1E8MA 4HH0A 5IXJA 4HD8A 4P3OA 1ENPA 3HK2A 2XUGA 2G1JA 1JBQA 1T1GA 1X94A 2XQIA 4J03A 1KE2A 2C2YA 2R4TA 2VPQA 3BIOA 3RHFA 4R7ZA 1T5OA 2R47A 1SOUA 3GO4A 4CVNA 2BGGA 3FHTA 2PU7A 2PT5A 1ZK4A 2YWJA 3AUJB 1GR1A 2YXBA 4L6IA 2OTCA 1UFVA 1TPZA 1WABA 2QLFA 3DAHA 4J43A 4OQDA 5ALWA 3RAGA 2FPUA 3U4AA 8ABPA 1H0RA 1RSZA 1X3LA 1M5RA 3HM2A 3HI6A 3F6CA 4YRPA 1Y1KE 1U6IA 3FRIA 2NUTB 1CEYA 4KQGA 2XAUA 2VCYA 3QOWA 4F9TA 3HKDB 4JROA 4PHTA 1E0KA 1LQ2A 3RCBA 5HQTA 1NG9A 2NTEA 1E3TA 2Q7XA 2R6GA 4UJ3A 4BQOA 3R3JA 4ZMSA 1ICEA 3L7CA 2G9ZA 2V96A 5EUMA 3PFCA 3EVBA 2Q41A 1BOOA 4Y1FA 4N7MA 5JSZA 4NVRA 1E9EA 4ZJPA 3I5XA 1ADBA 2HJVA 4GSLA 3BHMA 4JVLA 4NCJA 1B6RA 4RSHA 1G5QA 3S44A 1SVMA 5FNVF 2QR3A 2CHVA 4NATA 1ZU4A 4GFDA 5IK2D 4YRGA 1C2TA 2WQZA 1U7OA 3CH7A 3LRTA 1Y6RA 2X8BA 5JI2E 4W4TA 4FFOA 3D59A 3BGVA 5JY1A 1QOPB 1OFTA 2FSUA 2ZTVA 3DL7A 2X1HA 3QBTA 4XB2A 3VZBA 1OVMA 1SCJA 4PQEA 5JS7A 4DIUA 4YHHB 5PNTA 1AKTA 4HJXA 1CUSA 3TNLA 1MLDA 4B73A 4CTNA 4UBJA 3D3WA 3ZZMA 3IE1A 1P7ZA 3KU1A 1MENA 4L75A 2WJJA 3I6YA 3IUSA 4W5JA 3USES 4B43A 1EESA 2PO5A 4MVJP 1FZQA 3ET5A 2J08A 4BAUA 1QR2A 1DINA 4B31A 3LQRA 3FOCA 1HYEA 3SBXA 4EKDA 3SR0A 3OJCA 2A84A 2JIPA 4UZEA 1EBBA 2HSEA 3DPSA 3FCCA 3R3ZA 2IL1A 2XTMA 3FNHA 1LRJA 2WU3A 3E1SA 4G86A 4EMBA 2XGMA 3BF8A 3SSMA 3D2CA 1LLCA 4H4DA 4HG2A 2IKSA 1IXKA 1XE3A 5IHXA 5KYXB 1BMDA 1O89A 4LYEA 3LT1A 2C2KA 3MWFA 1WQ1R 3H5TA 3T1OA 2RGRA 3ABOB 1Z0JA 4UMDA 4PG7A 4IIUA 1GPDG 2V6JA 4ECAA 1II9A 3TW6A 3LE8A 4NFSA 1KFKB 2OESA 3WRWA 4DXAA 4NWIA 4V3CA 1C30A 3BMCA 1Q12A 4Q47A 5CA1B 3IEXA 1ODCA 4JJ8A 1E61A 2G1AA 3DTTA 3HJNA 5HXAA 5ALDA 3MT0A 1TIBA 5I47A 3HBLA 3JYLA 4WESB 4DSAA 1YNSA 1MAHA 1TVKB 3EH1A 2AQKA 5BN3B 2NZWA 3K7EA 4KGVA 1BHQ1 2L2QA 3WJ1A 1E3EA 2RKOA 1BXRB 3QBJA 4NULA 4TLAA 1XD2A 4PC3A 4D8VA 1X80B 5ITWA 1XZBA 3M4YA 4HMOA 4V2UA 4IZIA 4A0QA 3W04A 5KYUB 1K5DA 3H8VA 3N86A 5TLSA 4BCBA 4Z6KA 2I3BA 3PD7A 4H1TA 3AHGA 3FOAA 3IPLA 1H0SA 4E1AA 1N2SA 5FUMA 3W5CA 3GNQA 5HS4A 3DE7X 3W5DA 4YJHA 4OHMA 4LSWA 3IULA 4Y1RA 5CX4A 3ABSB 5DBIA 3BMOB 1P4JA 4QXQA 2UUAB 5L4SA 4DUYB 1Z4PX 2SHKA 2Y9MB 5GOTA 4BXOB 2XDWA 1C3OB 3B38A 5GONF 4MW4A 5J2UB 1JDBC 1P0FA 5A6SB 5TRTA 3OZ7A 4P3XA 4HV4A 3G2HA 4UHCA 3WADA 1CYEA 2WG1A 1QRUA 1PL6A 1TJ5A 2AMFA 2H00A 2M1XA 2R8XA 3CNBA 5B1HA 4XWKA 1GTSA 4KRFA 4DARA 2ODQA 4LDNA 3T54A 2EJTA 1Q44A 2AJCA 3KFVA 1AKNA 3QYJA 4P3YA 4WN3A 5C46F 1GU0A 2HBQA 3DNMA 1OT5A 3N0RA 1WDKA 4WH0A 1DE0A 2PQ0A 5E4JA 1Y6ZA 2ODNA 2Q8NA 4XJVA 4IJKA 5J4KA 3Q87B 2O8VA 4HAVA 3R7DA 1VMKA 3I34X 3R5SA 5G3ZA 4FE7A 2OGZA 1PDOA 1DC7A 3ZJ5A 3FPHA 2L18A 3GJYA 3UA4A 4EG3A 1RWQA 3AFMA 1Y6GA 1MTZA 1ZP6A 2QL7A 5AI6A 4PLPA 3ZWPA 3AR8A 1P1FA 3V46A 4C4AA 2CV0A 2CHGA 2ECPA 1A96A 1TMOA 2MU1A 3AU9A 3F7MA 3FSEA 1XLUA 4KAAA 5I51A 3VH1A 2BR3A 1CPYA 5IJ0B 2OQIA 4WA7A 3GNLA 3N28A 4F56A 1OZFA 1GAQA 2CSUA 3HXTA 4FCTA 2VJQA 4FUTA 4JH0A 4ZCMA 5H02A 1Y1LA 4C03A 4QPCA 4MRVA 4ZCIA 1WHTA 3O8QA 1J5XA 4G37A 4IQGA 3GUUA 3H4TA 3IPXA 4TVOA 3LBHA 4C7JA 2JLXA 3C8UA 4U6NA 4C7OA 4W5OA 5LQCA 4D57A 5U1PA 4ZJUA 2DH5A 1SXGA 5GVRA 3FTFA 5IYZF 2QGNA 2I3ZA 1C3VA 3AFHA 2QN2A 1A98A 1ZU5A 3A0RB 2XMSA 2EIXA 3AZOA 4HC4A 4BPBA 2PWBA 1P61B 5I9NA 3SF8B 1MD9A 4B3SB 1W36C 3HLYA 5KQGA 4YRIA 1HT2E 1R4ZA 3GV0A 2QAGB 4E07A 3HHPA 2VZ8A 4QUAA 3QWAA 3H1GA 1XV5A 3SBEA 2EKBA 2WJ4A 3PUYA 1EK5A 1PDWA 1U8AA 2JVIA 1R18A 2COKA 4IHKA 3RVJA 1OI2A 1XTKA 2OBBA 3PXEA 1G38A 4K28A 2MYTA 1U6KA 1HFWA 3NBMA 4L02A 4IDCA 5FWYB 5AM0A 5J59A 2PSHA 3UFXB 3A9TA 2BTQB 4YPFA 1MMFB 3ANLA 4ZYZA 4QYWA 2GN8A 2OHJA 3CW8X 5CNJA 2IPMA 5A9TA 1AS0A 1C9YA 2A5LA 1VG1A 4KBFA 4PSCA 5K3FB 1NUTA 4D02A 4CQMB 3FR8A 3ESYA 4AZTA 4DB4A 1L4HA 2HO4A 2B5OA 4KYVA 4B4OA 2J5RA 3PTAA 1P7VA 4FBMA 4RVOA 5HFNA 4JUIA 4UW9A 2JEZA 5I4KA 2FMIA 3TW8B 1EVEA 4BLRA 3V1LA 3L8ZA 2IX3A 5C8YA 1FSSA 1AO0A 3QYPA 4ETIA 5HOEA 5F76A 2Z9DA 4H0CA 3T95A 1MVLA 2ZAIA 3CZPA 3DE1X 5I9IA 3IPAA 5I7VA 3K5IA 1KNXA 2CE2X 2RK4A 2GYWA 2QX6A 3R23A 4CODB 3QXHA 1EM6A 4ZQGA 4EYOA 5CPFA 2GVNA 1OI3A 2E49A 1Z6TA 1PEAA 4GPIB 3D7RA 3MQFA 5YASA 1XF9A 4E5MA 2JVKA 2ZETA 2W6MA 3B2EA 2FPSA 4ZAVA 1E1CA 1NUPA 2GZRA 1JAHA 3F74A 3AV3A 3AHDA 4G5YA 2DWCA 4JP3A 3S1AB 4CIXA 4JI0B 5DNYB 2REQB 4OJKA 4YAWA 4ML3A 3CH6A 5F4ZA 3HUTA 1RQ7A 3DAYA 2Z6UA 1BEZA 3IESA 3PBKA 3VPCA 1DPFA 3RRMA 1CJCA 1DVRA 1A2BA 4GEGA 2BR5A 3C4VA 1TYDE 1KJ9A 4L95C 2W2TA 2XUOA 3KRTA 4W82A 5KDLA 4UPDA 2Q9BA 3L6OO 2FEWB 5BVHA 4CLOB 3ADKA 1KY4A 2ZJOA 4RV4A 1R10A 3X1JA 4BNKA 3J7TA 3C45A 1XPUA 1SCBA 4EEZA 4X85A 4RMHA 1NL3A 3PR2B 5K0ZA 1J97A 5LM3A 1CZNA 1E0DA 2P62A 4E7OA 1XCOA 3TLGA 1K6MA 2B9EA 2J9RA 3FIJA 3NBKA 3AHFA 4F92B 3DULA 1T1JA 2VRCA 2V7GA 2DTDA 3NAQA 3DFZA 5KYYB 3C1TA 4UOQA 3EXEA 1F7VA 3OTQA 2VJLA 3NW9A 1P9OA 3U3MA 2PH5A 2ZYVX 3HG7A 5ICMA 1EFHA 4GXRA 3B1XA 3D6TB 2DFVA 4TVBA 5L45A 2BFOA 4WOPA 3L1HA 1NNSA 4F8YA 1VHJA 5ALEA 3QSYA 1JI0A 1B0ZA 1VYUA 3PD0A 4LHYA 2H1SA 2JAUA 4TXLA 2ZXEA 2QB5A 3N2ZB 4XUCA 1A0OA 2EX4A 1OLXA 3KC2A 4X6LA 4OTZA 3I8SA 4P35A 1F2UA 2SCUA 4KIJA 1XXHA 5KNCH 3I9KA 1WY5A 5A0FA 2IYAA 2FDXA 3UEOA 4WXPA 4LX8A 4BB5A 1MJGA 3Q7PA 4F2DA 3ZI4A 3B5IA 1NHGA 4KO1S 5LNK6 3O4JA 2ZB2A 1RABA 3MCUA 1E3MA 1H2XA 3C6ZA 3I5YA 2JLZA 3K35A 1R3DA 3P2JA 3QF4B 1IY2A 1DXQA 2CVHA 2Z4RA 1KZHA 3FI0A 4INAA 3VDXA 3WLQA 4EKYA 3TQIA 3TGPA 4TWZA 5CDFA 1AMOA 2GCIA 3TR5A 8GPBA 4YV1A 1YE3A 5CG1A 5JR3A 2QVZX 2VPYA 4F3RA 5IYZB 5AVVA 1G42A 2B98A 4L6AA 2RD2A 2OFPA 3EG9A 3A9RA 2WJVA 5K4AA 4OD0A 1EFKA 2PUVA 3BM5A 1NXOA 3FZNA 2AEMA 5EERA 1FUIA 3KOOA 3C6MA 5H80A 2I87A 3RYCA 5EZSA 3EWNA 4DDMA 1IM2A 4JLWA 3JAMA 121PA 1O95C 3DB2A 4DYVA 4MAMA 1XEWX 2FZVA 1E3DA 4RGQA 4RVUA 1RXEA 4KLRA 4XI9A 2OHGA 2WKSA 3F96A 4D5EA 2EJCA 2R7MA 3FM9A 1NT4A 4DMGA 1XVUA 1K6JA 1H0HA 1S3GA 1XZLA 3HUUA 5BO5A 4MUNA 1P72A 1Z35A 2HDNB 3A26A 3I9V1 5F4BA 2WSSA 3WGHA 1Y9JA 2YRWA 4HB3A 3Q40A 5BSUA 4JL8A 1HOTA 1EVYA 3WIDA 4URXR 1JEJA 2OXFA 4ZQHA 4HWPA 4N8SA 3A6GA 1JMKC 3ZWMA 3IIIA 4UUQA 3EZ6A 4D79A 2PJRA 2H8KA 1V4VA 2H2DA 4NNOA 5DGCA 4DG8A 1DO2A 3EVCA 2GBFA 3WKDA 5IM4A 2PE5A 3GMSA 3TGWA 2YV2A 3GPDG 3SEQA 1CUZA 3WGYA 4A1OA 4BNLA 3GLGE 2IS1A 2BDUA 1QTRA 1Q0SA 4RHUA 2UUPA 3SK0A 5HCUA 3EZLA 1NLZA 4WI1A 2GZMA 4WBNA 5A9RA 4Z4QA 3UMGA 1FYVA 3T3OA 4UEJA 3T5TA 2NGRA 3C14C 4KR9A 3ZXYA 2A3NA 1U63A 3ZDCA 4LOLA 1YRBA 3R8XA 4X6XA 3SS8A 4YXFA 3GLIA 3O47A 1I2DA 4TXMA 1ORRA 2K6GA 1E2PA 3KAPA 4JI5B 1KEEA 1M6EX 4IFTA 1OIWA 3HA2A 5F9FA 2BGNA 2A5DA 1PVDA 4BFLA 4DRYA 3MD0A 3Q4GA 4GKVA 4P3PA 1SHZA 1RE0A 4ZU6X 3LF2A 4UE3S 3FPLA 4KN5A 4IHQA 3VVLA 4HLUA 2F3QA 2VP2A 1KRXA 3EA4A 3G5AA 3CZAA 2CBZA 5AVKA 2Q7OE 3RG2A 3CX8A 3MJEA 2RAVA 3ZZUA 3PSAA 2VHZA 1L6IA 4TYMA 4YJDA 3ZIDA 2IXDA 4I6JA 1KPGA 2OXIA 3BMQB 4Y6PA 1AA9A 5TE9A 1ZD2P 2HFKA 1GZHB 4M8NE 2OMEA 1A3CA 1TMKA 1MEEA 3WB0A 1JJFA 4R54A 4QQRA 5JG7A 1FUKA 2ZCJA 1AURA 4OLBA 4NYJR 1JA1A 1Q1GA 2YL2A 2PMBA 1CCWA 1TU4A 1TDJA 3O6VA 5B3JA 1QF6A 3CLVA 1P1KA 2QTHA 4FW9A 3LFHA 5FEUA 1U2GA 2XE6A 2NO1A 1US8B 3JQ9C 4X7BA 5EWMA 3W79A 1EP3B 4EBFA 4D45A 5LZ8A 3T1VA 1HOXA 4ZGGA 2ZXUA 4C07A 3U0VA 1DAIA 4B32A 3EMVA 3NWJA 1JG3A 2P6NA 2NXWA 1MDFA 5JNSA 1F48A 1OFVA 2ODPA 4G67A 4EG4A 3DV0A 4HLDA 4IICA 2IUUA 4RJLA 4BFSA 2ZVJA 1WETA 4UFPA 2ODEA 4BGUA 3NMUF 3CURA 5CA0B 1GCIA 3OD1A 5FWDA 5GTDA 3K0CC 1DEKA 3LSTA 4ER3A 2J0UB 4BZQA 3ZD6A 4GVXA 2DFTA 4RSRA 3DXZA 4Q37A 1E0AA 1D04A 4RH1A 4QLAA 4A0FA 1EGHA 3GA5A 3OHMA 3HZZA 3NHMA 3GJ7A 2ON6A 5ELLA 4U8GA 3U9LA 2P9HA 5BPHA 3S68A 4BECA 2DR2A 3VGJA 1NE2A 3K1JA 4GYWA 3R3XA 1QQ5A 4KQMA 2YJ6A 2ZWOA 3MS4A 2GPNA 2QN1A 5JAQA 4UNRA 1BDHA 2EBHX 3O92A 4E4RA 1Q3HA 2VKTA 1EFUA 3TCKA 5BURA 5ES4B 3H8SA 5GZ1A 2E7ZA 1XTQA 5AI5A 3TX6A 3U3KA 4MSUA 2R6AA 2RKWA 4U7FA 4X1YB 5BV8A 3Q10A 1XHFA 5FPSA 4ZIRB 2ZUTA 4WY2A 5LYJF 1E4EA 4IUCS 1YVUA 4FVTA 3KSRA 4IIJA 2QN3A 3IJ5A 3QLTA 3DKVA 4YJ2F 3O95A 1BXZA 1KEKA 3N2YA 4DAEA 1F51E 1ECBA 1Z4KA 2AXEA 3ZE2B 3LDUA 4JZKA 4P6VF 4E22A 5BWNA 1RWXA 3S4YA 3WG9A 3TSOA 1OYWA 5ICCA 4HNTA 3E61A 5ADVA 5K45A 2X22A 1P7PA 4AUMA 1UMBA 2ZIVB 2NQ8A 3AEUA 4B3BA 3HKEA 1CIPA 5L7TA 3BWXA 1QHFA 4XCVA 1MNQA 5JAZA 3ESAA 1PR2A 1TZMA 1DU4A 1A7AA 1U4NA 1YNOA 3CNHA 3I72A 3IAAA 4R9NA 4RE5A 5C3MA 2XAAA 3KG2A 5FFNA 2OLKA 4B09A 2ZZMA 2VT2A 1NDUA 3CWQA 2XYGA 3LYUA 1JKIA 4V0LA 4ILEA 3RTCA 2IPXA 1Y6JA 3ZKWB 5KQLA 3KUUA 1Q2XA 3E4DA 3WLKX 3WRXA 1YDMA 2HZBA 2JGDA 2YMQA 2P9GA 2Q4OA 4BBJA 2PX5A 4NE7A 1NN1A 2QSUA 4LA4A 1EDEA 2WU4A 1RW4A 2G83A 2W6JA 3C0KA 4QPJC 2IEDA 3VNBA 5F9MA 2JHGA 3H8WA 3RR2A 3KOMA 3S7TA 1L4YA 1UBEA 2F9FA 4P7JA 1Z4QA 4WVFA 2B7CA 4MQEB 1IHPA 1Z0FA 2GN6A 2XUIA 3AETB 3OBIA 4XIJA 5HBRA 4DVJA 5GM1A