4LRWA

Crystal structure of k-ras g12c (cysteine-light), gdp-bound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
155
Chain Sequence
TEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase KRas
total genus 54
structure length 155
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lrwA00
3B85A 2XEXA 5TXGA 1TNDA 1S96A 1E9SA 4IVQA 1NN1A 2ZVQX 5BYKA 4LI0A 4LBVA 1DAEA 5JECA 3CZPA 3RS0A 5KO2A 2P2LA 2GK6A 1WQ1R 4MRNA 1XU4A 1FUKA 3PVSA 4B3BA 1SXJD 4NYJR 5FPHA 1KY3A 5FUYA 1ONBA 2DY1A 1KO8A 3RNLA 4E5UA 1E2HA 1X1SA 1W4CA 3QPWA 2FGKA 2R6GA 3VHXA 2QAJA 4BFUA 4BLTA 3ZVMA 2IYXA 5A0FA 4NU0A 2JJ2D 2PZEA 4HLCA 3P20A 5HCNA 1HY3A 3IILA 1BYUA 1W48A 2VRWA 5LPNA 4HUQB 1Y63A 1CF4A 3SJZA 3TGPA 2FG5A 2QA5A 4Q03A 2RGBA 2ZSDA 3OZXA 1CJVC 4DDVA 1IOZA 1U99A 4RCZA 4B75A 4Q4LA 5KTYA 4PSKA 1IXRC 1UFQA 2CDNA 4TYNA 5H68A 4NL4H 3TVDA 2J0UB 1CR4A 5J47A 1Z0KA 2D2FA 2QPOA 1SKQA 1ZBDA 3DDCA 3UK6A 2PT5A 3QIAA 1II8A 4KITB 2OSBA 5JCZA 3Q5DA 4JBXA 1OFHA 5L3QB 4I1UA 1NVVQ 1FFHA 3ETLA 2J0QA 2AXNA 2W58A 2WWFA 3FYHA 4LBWA 1SKYB 1E32A 1C4OA 1EFRD 2XNDA 3QXSA 4LYJA 4R9UC 5C18A 1VG0B 1Z2AA 2ZUCA 4OI0A 4ASUA 1XZQA 3WHLA 4LJ7A 3E70C 4GNKA 2ZJ8A 1S3GA 1G8HA 3U3KA 4P4UA 4E09A 1VMAA 3QKUA 1BOFA 1YKSA 1S9DA 4FCVA 4QOSA 2OFOA 2FE4A 1QBKC 1KMHA 1G6HA 4B44A 3QKTA 1DG3A 1LVGA 2A30A 2RMKA 4CT4B 5FOVA 2GZDA 5BXQC 621PA 4FCTA 3TUZC 4YMTA 4PHHA 3GJXC 1FNNA 3OEED 5L3SB 2O8DA 4II7A 4DT1A 3GFTA 4JBYA 4IVPA 2QENA 3NBFA 3GPLA 3Q5EA 2OLKA 1I2MA 3K0FB 4ASUD 1U8ZA 4XTRA 4Q9IA 4XSHA 2CLDX 1XPRA 1ZJ6A 4ON9A 1XCPA 1G3MA 2BHRA 1NN3A 3CONA 1M8PA 3N5CA 4Z54A 3K0CC 3AKDA 3LLUA 2GHIA 2F6RA 2XXAB 3QVUA 1E2QA 3ZGXA 5JSZA 1LW7A 1GSIA 1QRAA 5BWMA 4CEIA 1YRAA 3A37A 4Q01A 1MO4A 1NN5A 3J81k 1XD2B 2D74A 3CR8A 3KQNA 3NH9A 4Q4AB 2V9PA 2ZR9A 1IXZA 2ODEA 2G3YA 3DMDA 1TMKA 2QEQA 3I8SA 4JLJA 3KJHA 1S1CA 4QGGA 1Q0UA 4GBMA 3QY0A 4X8MA 4CDGA 1NLFA 4NCIA 4B3XA 2GF0A 1G3UA 1W0JD 1YE8A 4KJZA 4Q9KA 1F2TB 4M53A 2OHFA 1KIMA 5JI3E 3QG5A 4XWKA 1KI4A 1KKMA 1NY6A 4NHOA 3VHLB 2CNWD 4MKIA 4PQFA 3VR3A 4F7WA 2AD5A 2GKSA 3QF4B 1IAQA 4MA4A 5CK5A 3VKHA 3GCGA 1KZGB 1N6NA 4JLAA 3WMGA 1U2RA 2NPFA 1N6RA 5BW8A 4TL8A 3T34A 3W8RA 3O8DA 5HZHA 2WJGA 1UBGA 5DIFA 4PPGA 3PENA 3DKVA 2X77A 4QGHA 2BJWA 1WCV1 1KI8A 3K9HA 1E4VA 4Q19A 4G3XA 1EX6A 3VKWA 1R10A 3U60B 3NH6A 3ZVLA 3HPQA 3SR0A 4HZUB 2BIFA 1T5IA 1ZM7A 3ONWA 3I72A 4KFUA 4TMZA 4JT2A 4YMSA 5EXSA 4OQMA 1CKEA 4RVCA 3VTKA 3O8BA 4S2EA 1E2JA 4IEEA 3JVUA 5A4JA 1S0UA 4TYYA 3THXB 1WA5A 2IK8A 1F6BA 3AB3A 3CRQA 5KPJA 4HDQB 1W0JA 4Q1CA 3EPKA 1G8YA 1CTQA 2BKUA 4TQAA 4HLUA 4PQYA 5DHAA 2JLUA 3R9XA 1KHTA 3CM0A 3OFND 3W90A 4IXMA 3ZIAA 3KX2A 3AVYA 3IQXA 1HV8A 4C0HA 3LD9A 4CEJB 1E2EA 1I4TD 4DRZA 3H2YA 2YOFA 4XVRA 1Z2CA 3SJAA 1MOZA 2QL6A 4US2R 2QRZA 4ABYA 2IF0A 5CB6A 1OE0A 2G1JA 2GBLA 5F2EA 1IHUA 4Q4HA 4WZ6A 3GLHE 1HUQA 2ZUBA 2H57A 1KI9A 3IUYA 3DL0A 5EE9A 3FMFA 3C7KA 3EC1A 3NBYC 3TBKA 1IONA 4O2LA 1YZQA 5CJPA 4YQFA 5C4MA 2J87A 1RC8A 2O8FA 5CYPA 2Q3FA 3LX5A 5DH9A 3ZJYA 4KO8A 4PX9A 4YXWA 1XTSA 2OILA 4I4LA 3AP1A 1XTRA 4B43A 1QHNA 1AKEA 4P0TA 5D3MA 1VCOA 4V0KA 2F1RA 3AF3A 3ZVRA 3CO5A 4O3MA 2RGEA 2VP9A 2RHMA 3AQ4A 4BFWA 1JNYA 1TQ2A 2HT6A 5DYGA 3Q3JB 3Q8XB 1YZKA 4TQUS 2A7QA 4TSFD 1Z6XA 4Z1MA 1XTQA 5JRZA 5TB5A 3SBEA 1RPZA 3ZZTA 2O0KA 5JJKA 4V0OA 1G7SA 2OFXA 3C8UA 3EWAA 2UVQA 2CJWB 1OYYA 3A58B 2FH5B 4WA7A 4XWOA 2G83A 3K70B 1L4YA 2XOKA 5HE9A 4HAUA 1GZSA 1SVWA 3W6NA 3TNFA 2VHUA 3N2EA 3W8NA 4PHTA 1GM5A 4CYMA 3L0OA 5P21A 2DPXA 4LJ6A 4QBGB 1QHYA 2JCSA 2O52A 3QE0A 1N6KA 4KYIB 2KI5A 3IGFA 4I81A 4UNNA 4V03A 3LBNA 2H5EA 5ELXA 4PAQA 3BB1A 1T8TA 3B9PA 1RE0A 2ZIAA 4Q7KA 5C46F 4Q4HB 2DBYA 1UEIA 3U2QA 5L3RA 4LGMA 4NCHA 1GNQA 4CGZA 4PC2A 1G6OA 1U8AA 3TSOA 1OFUX 2IYSA 4HUQA 1XJ0A 5FOUA 1W0KD 2XTMA 2A5JA 4DWJA 1Z6YA 2HCJB 3M1IA 4OQXA 1EXMA 1R2QA 1BH2A 4JT4A 3GJ4A 1RW4A 4FMDF 5G3YA 3QXCA 1NI3A 4M1TA 5J4KA 4BLQA 1P61B 2XZOA 1XMVA 1KSFX 4OHXA 1SVLA 2AL7A 3CLVA 1XMJA 1ZYUA 4W5HA 2FFBA 3K8YA 4FIDA 2HYIC 4M8NE 4M1WA 1Q3HA 2FF7A 4N0DA 2I1QA 2CHGA 3FMOB 2V7QD 4RZXA 2ZITA 1QHHA 2VYFA 2P6RA 3CUEF 3MFYA 3KQHA 5KNDA 1UEJA 3KXKA 3EA5A 3VR4A 2H7VA 4B35A 4AYWA 3UATA 1LNZA 2J7PD 2ATXA 3OEHD 2QBYB 1MKYA 4ZV4A 3QVVA 4XD7D 4W5JA 2IWRA 1ZC3A 1EX7A 2IA5A 2P3SA 1GL9B 3NWJA 1CJTC 4IVRA 5LB4A 4MDEA 3DEFA 3F5FA 1E0KA 2QE7A 4BFZA 4QJ3A 1NSTA 3B9QA 4GI7A 4GPTA 2G0NA 3NHBA 4CEIB 1GVNB 4HB3A 3X1ZA 1DE0A 2GVZC 2ORVA 2GAAA 2RGNA 2D2EA 2QGNA 5JZVA 2WTUA 1W7AA 3GLIE 1OYWA 1QHIA 3FFAA 3CZQA 5L3SA 3AM1A 3BB3A 3SHFA 4YMVA 4KBFA 5CDFE 5B64A 1OH6A 3BB4A 3RWOA 4DLXA 1X3SA 3Q7QA 2O8EB 1E3MA 1S8FA 4AURA 5EQTA 2C03A 4BLOA 1GKYA 3RDPA 4TYQA 1JPNA 1YR7A 4EPXA 5JRJA 2PJZA 3U3JA 2B8TA 5KNCA 2BCJQ 3WMEA 2R2AA 4MUBA 1M1YE 1NIJA 4A0GA 1E9FA 1XP8A 4JKIA 2ZTSA 2A5GA 2W00A 4KSBA 4RFSA 4AG6A 3ZD7A 3SJBA 1M74A 5TVKA 3WNDA 2FEMA 4N3NA 2FX3A 3B78A 1JEEA 2WSSA 4H1UA 2V55B 1HH4A 4BEJA 4LOAA 2W6JA 1DPFA 2WV9A 1MR3F 1TF5A 3W3ZB 1G18A 2QGZA 1T3HA 3ZLJA 2IX3A 4LJ9A 3K09A 1R5NA 1Z0FA 4F4CA 5AJZA 2IYLD 5LB2A 1D2EA 3T15A 4MKFA 3SYLA 1WF3A 4MGYR 1AJEA 1DAGA 1WBBA 3I92A 3QF7A 4MYUA 3TAHA 4TZ0A 5SZJA 2GF9A 4BASA 2O0JA 2O0HA 3T35A 1SKYE 3LY5A 1OW3B 2EFEB 2HLDA 3A1SA 1EGAA 2MMGA 1TX4B 3KQLA 3KKOA 5GVSA 3X2SA 3E2IA 2C95A 1G64A 5KPDA 2R9VA 2ZJ5A 4PFSA 3HWSA 4TYPA 2ZSAA 4OI4A 4IOLA 1CBUA 1NVVR 3EIQA 4R7ZA 1KO1A 2FSHA 3OIWA 4L16A 1E0JA 1NLYA 3GJ5A 3OE7D 3M6AA 3MRSA 4Q1DA 3CF6R 5E95A 1EWQA 1OSNA 1E1RA 3IHLA 3VMFA 5K8LA 1ZD1A 1AS0A 2NPIA 1OFIA 3QNUA 1IY2A 1P2UA 2RH5A 1RZ3A 5KUTA 4PQRA 5LBIA 3KQUA 2QAGA 1TQDA 2ZI4A 1TUEA 2R6FA 2RGCA 4Q66C 4TWZA 1B23P 3GLIA 3LNCA 1PLJA 1CR1A 2HJGA 5FOSA 3S1AA 5LD2B 4JYBA 4G5QA 2CHVA 2DYKA 1CXZA 1JB1A 4JLVA 1JAHA 1ZVQA 5DO9A 2G1KA 2NG1A 4DSOA 5JWRA 3C15C 2WBLC 4TLDA 5GJWC 4NPHA 3DKPA 3UXMA 3W5IA 2IYQA 4TSFA 5EZ5A 2XX3A 1EFHA 2QU8A 4Q5IA 5SZKB 1C1YA 3FFBA 4P31A 2O8CA 3E5HA 1XJCA 3ADDA 4PZLA 2BMEA 1HA3A 2PMKA 4D0GA 4EIWA 1P9RA 4DUGA 5DISB 4ARZA 1WP9A 4KV9A 4OBEA 5JJLA 2QORA 2XTNA 1X1RA 4NZYA 4OQFA 4V02A 5CITA 1JECA 4QC2A 1XXHB 2C99A 3PIRA 2DWPA 4IFEA 3RC3A 3ZQ6A 5JLJA 4LHXA 2VL7A 3TW8B 2ZI3A 2FPKA 4PZZA 3S1AB 4CT5A 4JSYA 1SVKA 1KAOA 2QTHA 3W34A 1CP2A 4C7OB 1R0WA 4M0LA 5FR2A 1GRNA 1IN7A 2GWHA 2CL0X 1G3IA 5B57C 1ZCBA 2OAP1 3JVVA 3EC2A 3FGNA 4OQLA 3EPHA 3PG5A 4KBGA 1J90A 2REXB 4W7SA 5FTMA 1MT0A 4Q00A 2GXAA 1TPZA 3WNBA 1FMLA 2BKEA 3SE0A 1VG8A 5JBQA 1UDXA 3AKYA 3SS8A 3PQCA 3BH7A 2CVHA 4C3ZA 2IYRA 3MJRA 4JJKA 1RFLA 3CX6A 2IHYA 4JJZA 2FDCA 4OJKA 3QBVA 1NY5A 4D26A 1G20E 4M9QA 4BZPA 5IK2A 5FUXA 3IO5A 2CMKA 4TL9A 4URUR 4B76A 2BWJA 4DLTA 4NCKA 4OHZA 1XD2A 4Z1MD 3BIFA 4DJTA 3LV8A 3QUSA 4V0LA 3RS3A 3FHOA 1Z5ZA 2Q21A 2R6AA 3RRNA 1ESNA 1XEXB 2ZYVX 2F55A 4B3GA 1U9IA 2IHBA 2OCBA 1T3LA 1OF1A 4A8JC 1ELOA 3K0FA 2J9RA 2WAYA 4HZIA 3EIEA 3VNUA 2MSCB 2DFKB 1W49A 5G53C 1NMYA 2H1LA 3HR8A 2Z0MA 4ZCIA 4RD0A 5HCIA 2CE2X 4EJSA 1JAIA 2ZYUX 4HZUA 2JLSA 1TUIA 3FWYA 1NMZA 3B2EA 2VHTA 5AK0A 4TT3D 3CWQA 1UADA 4JYCA 1NJGA 4HB4A 3O8RA 1XDBA 1XPOA 4ZDWA 4AK9A 4IHQA 2PLFA 2ZI7A 1Q12A 3VR6A 2ODBA 1ZW6A 2N42A 4TT3A 4B73A 4QG7A 4EAQA 2XB2A 521PA 3AUXA 2E87A 1Z8FA 3TW4A 1DTSA 4FMBB 1E99A 4KI0A 4IXNA 2OBMA 1R8SA 4LUCA 4D81A 1G8GA 3U61B 1VYVA 4HYYA 2G9NA 3C4JA 3THXA 2BBWA 4PXAA 2ZJAA 4G01B 2PBRA 4BLPA 2V1UA 3L2OB 1B0UA 1Z63A 5FUVA 3OHMA 1RYHA 3ASYA 4NYIQ 4A0FA 4B74A 4BFTA 2PJRA 4QJ5A 4O25A 5KDOA 2QP9X 3FVQA 1VIAA 4UNSA 2E9SA 1ZIPA 1N6IA 3H84A 4U00A 1NSFA 3K0CA 1E79D 4OI1A 4DLYA 2PT7A 3L82B 2ZRFA 4HDCA 4TMWA 4M1SA 3THOA 4Q7JB 1PUIA 3NC0C 2P5TB 4M1YA 4A0RA 4G5SA 3T06B 2X1VA 1IBRA 2EFHB 2F1IA 4PO1A 5F3WB 3GP8A 1F5NA 1E9EA 1Z6TA 4KFSA 1TQ4A 4UNRA 2VH5R 3VKGA 1GKUB 1Z6AA 2RCNA 1G7TA 4KYUA 1IXSB 1OH5A 2FGJA 1OIXA 2HDNB 2XNDD 1ZM9A 1XF9A 4ESHA 3RYTC 2FSFA 1NBMA 1YZLA 4BGDA 3DVLA 3DOEA 1P3JA 2UZIR 2ZROA 1I4LD 1YR9A 5CYOA 5EE1A 1QG4A 2OCAA 1Z08A 2QMEA 3CRW1 3F0TA 3C14C 1Q22A 1T6NA 3DO6A 2REOA 4S35A 5GADl 3I5YA 4MDFA 3PV0A 1KI3A 2JLVA 3A36A 1FP6A 4K46A 1RRCA 3UG6A 1MRNA 5A5GA 1KJWA 2OM2A 4TZ6A 1H65A 2BMJA 3LFUA 3VX3A 2EW1A 4O2RA 3JZMA 1HURA 3R20A 4X8HA 3HYRA 1G21E 3TRFA 3GLFA 5F9FA 1GITA 1NBMD 1X8JA 3UMSA 4FD2A 2R6CA 4KVAA 2RB4A 2A5DA 3QKSA 5TY0A 5KYKA 5BQ5A 2OAQ1 2FOLA 4EPVA 3MMPA 4N0EA 4TN1A 1K6MA 4KCGA 3VFDA 4BPBA 1G17A 2RAPA 4AYXA 3E1SA 3X1DA 3ZVNA 4HSEA 1I2DA 3MWKA 2GEVA 3GQBA 4A0HA 2ZRCA 3AVOA 2C2HA 5JSZB 2EYQA 2CBZA 2YWHA 1U98A 1YJ5A 1UAAA 2DR3A 2EQBA 4NP6A 4DT1B 2O8DB 2XJ9A 1Q44A 4B6EA 1VKJA 5F98A 3BH0A 4F4JA 3AKEA 4TTQA 5C4GB 3EX7C 2ZR0A 2GBLC 1P7CA 2CK3A 1P5ZB 1UDWA 2IS4A 1WMSA 2WKRA 1TTTA 1IN8A 1SULA 2ZSBA 4MRSA 4XOIA 2XXAA 5DGXA 3MJHA 2IWHA 3K53A 3R7WA 3BOSA 5CB8A 2E1RA 5J40A 2QTFA 1G8FA 5IHPA 4GDFA 3QKSB 1TU3A 3GFOA 5AJVB 3NDBB 1ZP6A 2Q3HA 2ODNA 5FBRB 2BMFA 1SVIA 2WICA 1KI7A 2WKPA 5CDFA 2QQ0A 3LXRA 1QHXA 1S4QA 3PUXA 4P4TA 1ETUA 2WKQA 2EFGA 2C9OA 4YMWA 4CZ2A 4DXAA 1KK3A 2B21A 3AP3A 3LQRA 4P3YA 1QZXA 4DSUA 5BN5A 2QI9C 4C7OA 4D4LA 2D62A 1P9NA 3NXSA 1NKTA 3GEIA 3BC1A 2NZJA 3NEJA 1XB2A 3CBQA 1FOEB 4OJQA 2F7SA 2W6ID 4LJ4A 2ZJOA 4PC6A 4DIEA 4Y0VA 4URVR 1CLUA 3R9WA 4ACAA 3GJ6A 4YC7A 2J3EA 4RZ2A 4NMMA 1SVMA 2BC9A 2RGNC 3A1UA 1AA9A 2YC4C 2ZRNA 4OK3A 4WVFA 2GCPA 2PL3A 3I73A 3EARA 2GCOA 3PFIA 2QP3A 5EE3A 3T61A 5F9HA 4LYHA 2AWNA 2AN9A 1E2NA 4CEHA 1FNMA 2OT3B 3M4YA 1JBKA 1TADA 2C5LA 2W6JD 5DLQC 1G7RA 3GLHB 5E7IA 3QKRA 3GEHA 1G7CA 1XFAA 1OLOA 5AUQA 4NKRA 1FUUA 4Q18A 1JPJA 4CW7A 4GRAA 3BWDD 2EFCB 3K0AB 4C0AC 4QFMA 1G16A 3CIOA 4NBSA 1W4AA 2QG6A 3IHWA 1P73A 4UJ5A 1MV5A 1Q20A 4RCYA 2HT1A 2B8WA 2ZRMA 2VEDA 4GZMA 1OH7A 1N5KA 1AQYA 2QSZA 1KDTA 1Z3IX 2AHOA 4NE2A 2IUUA 1KO5A 3N2IA 1QG2A 2OCPA 5JI2E 4HB2A 1ZD9A 1IJEA 2AD1A 4LC0A 2GZAA 5AJYA 5DYIA 1OXSC 1UPTA 1E98A 1LF5A 4WZBE 5JFGA 4A6XA 2WAXA 2ZI9A 1M34E 4L9WA 3V4FA 4ZCMA 4PC1A 2C8VA 4TTPA 3QEOA 4QNRA 2WM9B 2ZE6A 1QF9A 5HR5A 5AJWA 2Z4SA 4YMUA 4Q1EA 1ZIOA 3KFXA 3CPJB 2DB3A 2I1VB 4JVMA 1JEDA 2ZR7A 5AUOB 2ZM5A 1E2MA 2TMKA 4EPYA 3RLFA 3VU9A 2XITA 3L0IB 4U7DA 2OUKA 4PO8A 1X86B 2YWEA 4JLPA 1ZUIA 1NG1A 2VHQA 3WRYC 4D0LB 1FZQA 4HLQB 2ZU6A 4M4SA 4RD6A 3SFZA 1W46A 4DCUA 3DM5A 4C2TA 2J5XA 5L8VA 2KSQA 4DB2A 1DAKA 2PCLA 5H70A 2R62A 1XTIA 4L9SA 3Q85A 4XWAA 2A5YB 4AG5A 4GMXA 4BRWA 2VPPA 1HE8B 1GTVA 2X2EA 2BEJA 2GETA 2WIBA 4WOPA 1WDTA 3CRMA 3L8YA 3NDPA 2J0SA 2EVWX 3KKPA 3I3SR 2ZI6A 4GMDA 3TE6A 5FR1A 4DCNA 1OV4A 2KJQA 2ZE5A 2AX4A 2BM1A 4EDHA 3Q7PA 5SZIA 4E07A 2BMDA 1J7KA 1JI0A 1QVRA 2J45A 1R5OA 3Q9LA 2VP0A 4X8OA 4EPWA 1ZCAA 2NO9A 3TUIC 2VF7A 1UJ2A 1GL6A 4A2QA 3MD0A 3A6PC 2JA1A 5FPSA 2JLZA 1LY1A 3X1XA 3TVTA 4QBHA 1OIWA 4JL8A 4EFLA 5GVRA 3GLFE 3WP0A 1D5CA 5KDDA 3U7EB 3AF0A 2PX3A 1N3BA 3K0AA 1A4RA 1VIYA 3NC1C 2QP4A 2GJ8A 3SC3A 2QM8A 4PPFA 4FMCB 3PUYA 4XVQA 1J2JA 3W3AA 3W6PA 3RHFA 1GILA 2IUSA 3LWNA 4PR0A 1QHHB 5FOTA 3BE4A 3D8BA 2QNRA 3GJ7A 3KL4A 4IDHA 4C2UA 3I5XA 1CJUC 2PLRA 5DI9A 1LF0A 2NO6A 2CHQA 3C5CA 5TDHA 2EWWA 1CEEA 4YLGA 1G5RA 1N5JA 1KO4A 2AFIE 1L7VC 4C0QC 1N6OA 3RSLA 2BBOA 3CH4B 2X2FA 4D4JA 2WJYA 1NRJB 3ICEA 1P6XA 3K9NA 1VTKA 2WIAA 1OJLA 4QJ4A 1CULC 4G5RA 3IIKA 1KGDA 4MYCA 4R98A 3SOPA 4DSTA 2IF2A 2J46A 1F60A 2BM0A 2WWIA 4PHGA 1COWD 3WYFA 1IJFA 3UWOA 2JJ1D 3EPLA 1GRQA 5BYJA 3R9IA 4ARZB 1BIFA 2FWRA 4QNMA 2FFAA 3TQFA 1WXQA 4BFXA 4D82A 1E6CA 4LHWA 2FPMA 4FI3C 3SYNA 3ND9A 5CK4A 2ZEJA 1O3YA 1G41A 1OXTA 1N2CE 4JVNA 1OIVA 2QZ4A 3R7WB 4R71A 4DSNA 2FJUA 2ZS9A 5DHFA 3HR7A 3KXIA 2ZRLA 3GLGA 2FFHA 4GOKA 2A2ZA 2OESA 3CX8A 3FB4A 1AGRA 4DDTA 4DDUA 3SNHA 2AFHE 2OXRA 1XCMA 4LZZA 4DZZA 5FL7D 2W6IA 1BS1A 2WOOA 4DEYA 3HJNA 1NN0A 4Q1AA 2JIZA 4B32A 4BFSA 1H8HD 2GXSA 4BFYA 3OFNA 1L2TA 2ZPTX 2Q3MA 5BN4A 1IN6A 4A2PA 3RAPR 2R8RA 3SZRA 4Q9LA 3U7HB 3QEJA 1ZNWA 4U5XA 3RVBA 2ZRDA 1G5TA 2P65A 1YZNA 3KTAB 4NYMR 2FU5C 2AR7A 5DN6D 1T9HA 2P6UA 3D31A 3T12A 4G0NA 1W36D 1NF3A 1P4SA 4CIDA 4BECA 3PEVA 4POAA 1OHHD 4V0MA 2V7QA 4WXRA 4QL3A 1M6NA 1YQTA 3V00A 1BMFA 2O5VA 3NVAA 2GXQA 4IRUB 3G82C 1II8B 2FSGA 4MITA 1ZNXA 2L0XA 1UKZA 1JALA 3ASZA 3QSYA 3EW9A 5DI3A 1G3QA 2BBTA 3GJ3A 4J0QA 3ADCA 2QTVB 3D6TB 1CU1A 3BFKA 4HAXA 4TMKA 721PA 3OESA 3L0SA 3RS2A 2J7KA 1U94A 1GFIA 1SVOA 1RRFA 3RRYA 1U8YA 2ERYA 3U4QB 5E4FA 5FBQB 5FOXA 2ZAOA 4Q21A 4TL7A 4URWR 1ZD8A 1GL7A 2ZRBA 3WP1B 1EWRA 1DAIA 4TLAA 2IUTA 1UKYA 2QUZA 4JIMA 3THYA 2F43B 1KK0A 1E1RD 4RKEA 3WXMA 1CR0A 1PUJA 1R7RA 3RS7A 4KXFB 3KZ1E 5IRCD 2QMUA 3NBZC 1RIFA 1VYTA 4PAMA 3ZS9A 3VX4A 3GJ0A 1TAGA 3O8CA 3AVTA 4RZ3A 1W5SA 3IO3A 4L8GA 3RSOA 4EPTA 2ASEA 4XTCS 4US1R 2GTPA 4DCTA 5IF9A 5EE0A 5JWHA 5J4YA 4KHZA 4Q9HA 3KFVA 2CCJA 1CRPA 2R44A 2BBSA 3FDIA 5TV2A 1YZGA 3KUDA 4M1MA 3SQWA 1NP6A 3EASA 2DWOA 4PC3A 4I1VA 4UXIA 2NMVA 1F48A 4XJXA 3OAAA 5HE8A 3IIJA 2V3CC 1N5IA 2NO1A 1T0HB 4F93B 2G6BA 3MWLA 1L8QA 1T91A 4EQ6B 3IIMA 4P33A 3SFVA 1E9BA 1GRRA 4Y0AA 3OAAD 5EZ6B 5L3VA 2G77B 1JQJC 1T5LA 5KSOA 1UKVY 3BORA 1XWIA 2RGDA 4B3FX 4KODA 2Q6TA 2PZGA 4YXWD 2FN4A 4C0JA 5ANRB 3JZAA 1EFRA 1TL7C 2YZ2A 3VNVA 1F3OA 3DHWC 3IEVA 1VG9B 4K8OA 2I4IA 1DG1G 2N1BA 4DDWA 2EWVA 3QJYA 4GSYA 4LHZA 2P0EA 2QM7A 4FWTA 3A8TA 3LX8A 4ZDJA 3NHAA 3ZQJA 4A9AA 4TL6A 2WMNB 3RC8A 4ZDIA 1GDDA 4B33A 1CR2A 2ZJ2A 1MO5A 2AKYA 2HV8A 3R8CA 4ERNA 3BXZA 1P9WA 1Y3AA 3P32A 5H1YA 5FBWB 1MO3A 2H16A 3BJIC 5M04A 3FHTA 1R4AA 4UQOA 3QPVA 5E3HA 1AKYA 1T8UA 3I8XA 4KFTA 1LB1B 4JS0A 2HUPA 2ZSFA 3UIEA 1P2TA 3GLGE 5D3QA 1R0YA 1GOTA 4KLZA 1BO6A 1H8EA 4KAXA 2VP2A 3MG9A 5TMPA 2LKCA 1E2IA 3LAWA 4LX0A 3THYB 2YC2C 1DOAA 5FH9A 1JR3E 2NQ2C 4W5WA 4RD1A 1XEWX 1HEIA 1NL3A 1J8YF 2QPAA 5KNBA 2EU8A 2VSXA 3N70A 5JWOA 3AF2A 1DS6A 2X19A 4I1SA 3ZD6A 1GNRA 4MQBA 5HPYB 3ECCA 3ADKA 4BQSA 5KSPA 2GEDA 1D2NA 4Z51A 2QN6A 5G41A 4LBYA 6Q21A 3F3YA 3X1WA 3WBJA 2GNOA 3H0KA 1Q1QA 4EKDA 1YZUA 5EUMA 2HF9A 5LDDC 3LVQE 2XB4A 2QT0A 3H4MA 1KI6B 4DLVA 4QKQA 2IBMA 5DN6A 4IOKA 2ZQ5A 1WBDA 1JXMA 4AYTA 1F2UB 2O8BB 1W0KA 1L4UA 1E69A 4LPSA 2ZETA 1U9IC 3B8HA 1YVDA 1R6BX 1GUAA 2SHKA 1AN0A 1KMHB 4FXPA 3PEWA 3LVRE 1Z6GA 3DPUA 3GLGB 2XAUA 1KYIA 4NONA 1W36C 2B7CA 1QDEA 4URYR 2J59A 5JEEA 4AKEA 2J0VA 1CJKC 1PJRA 3BGWA 3GMTA 1EFUA 1VHLA 2BVNA 3T1OA 2OCYC 2JLQA 3A1WA 4NDZA 3WRXC 2JASA 3EG5A 3DMNA 3K09C 4P32A 1G3RA 2QMOA 4LHYA 3B1WA 5FFMA 2YWFA 3KKQA 1W2GA 3PUWA 3MSXA 4PHFA 4QXAA 1FW6A 4IEIA 3K0EA 4HLDA 3W6OA 4CVNA 1IN4A 3RS4A 3FKQA 2Q0HA 4M2LA 4LDJA 2W0SA 1JQLB 3NG1A 4A36A 1TEVA 2AXPA 3K1JA 2QMHA 4LV5B 3QOFA 4ZCLA 2W0MA 4MRRA 5LD2C 3RABA 1PLLA 4B2LA 3X1YA 3A1TA 2J1LA 1XTJA 4B6FA 3AVVA 3DZ8A 4ZIRB 3KQKA 1ZU4A 5JJIA 3B82A 1OKKA 2IYVA 2YVUA 3MAAC 3THWB 1RRGA 2LCFA 5C2JB 2HEIA 2REBA 1HQCA 4GZLA 4LJAA 4RD3A 3K70C 5H8WA 1HE1C 4BZQA 2YOHA 5CIWA 4Q4JA 2NOAA 1N0VC 4AI6A 2YOGA 3B1YA 5AJXA 421PA 5B2ZA 2YINC 1T0JB 3UWKA 2KWIA 1HTWA 2GVDC 4G1UC 4A8JB 3MUFA 3KJIA 1VDZA 2YNMA 1JJ7A 3EZ6A 4BZXA 3I61A 5FTNA 2WMOB 1Z0IA 4YDSA 4DLUA 4DCSA 1Z28A 4FN5A 2GAOA 4GP7A 3M0EA 4LYFA 1II0A 2F3RA 2ANBA 3QXJA 1ZM3A 2C98A 3IEUA 1UBFA 2XGJA 2R6DA 4B34A 1KZ7B 1Q1ZA 2ZRAA 4ACBA 1CIPA 3NIBA 2VBCA 1KI1A 4BRUA 2W2XA 2QSYA 4DKXA 1E9RA 2WHXA 4FCWA 1P60A 2XZPA 3ND8A 3V9PA 2QAGC 2ZRJA 1D9ZA 1Z0AA 1ZUNB 1XPUA 3ZIAD 1S1MA 2PCJA 3PEYA 5UKDA 1F2UA 1C9KA 2G88A 2K5UA 3AKCA 3EXAA 3P4YA 1JXOA 4MGZR 4DIDA 4DB4A 3AVQA 5EJEA 2HLDD 4FMCF 4NCJA 3BFXA 4DLWA 3EWSA 2N46A 2RKOA 2CJWA 1P2SA 4TQ9A 5J5CA 1ZNYA 2FSIA 2Q9AA 1E2DA 1KSHA 1M7HA 2JJ2A 3OIUA 4WIAA 5CM9C 2ZXUA 1FQJA 2Y8EA 1OB2A 2C04A 2ZS8A 4JLBA 1E9CA 2YV5A 2OLJA 3BS4A 4K81B 4RZUA 1E2KA 1TF7A 1JR3A 2CCKA 5EE5B 2F1JA 1N0UA 1Z47A 4IDQA 2O8EA 3AEZA 4IJMA 4DLSA 2JDIA 3TQCA 1IY0A 1AIPA 1US8B 3CX7A 1KTVA 4QBIA 2VP6A 1ESMA 3FMPB 1E9DA 1IQPA 4U02A 2ZI5A 3K70D 2XTZA 1HQYE 1KKLA 2PH1A 2ZRHA 2WJVA 3AUYA 4LK2A 1V5WA 5B30A 4FINA 4A15A 5HKKA 4BWYA 4L5BA 1G8PA 1G291 1OT3A 3KB2A 4B48A 4IW3B 1ZUHA 2RGXA 2IW3A 1NJFA 1TU4A 3EA0A 3BAFA 3F8TA 3ZS8A 3V4RA 1UF9A 1MABA 2A5FA 2C77A 4D25A 2A9KA 2BCGY 3QPUA 1JJVA 4E22A 4Q4JB 2ZYWX 3L0PA 1AS3A 2NIPA 5HTKA 5C1BA 3HU3A 2DFTA 4DVGA 3IDQA 5E7MA 3U3MA 4ESVA 4PSVA 4DHEA 3U6BA 1VCMA 4OHYA 2KBEA 3U6KA 3WBKA 3QENA 1P75A 4UNQA 3I4LA 2ZU0C 5KSZA 5J4VA 3TK1A 1GAJA 1KMQA 1EFCA 1A2KC 1XD9A 2XJ4A 3A4NA 3RANA 4F4IA 3AV0B 4MRVA 5KDLA 3C16C 4AY2A 3SU8A 1SHZA 2ATVA 2FMXA 1KJZA 2WSSD 4GFDA 4LPKA 2IL1A 3I1FA 2MMCA 3LBIA 4JVLA 4LSGA 1XMIA 1NVXQ 4HDOB 3LA6A 1PVOA 1YRBA 2GXUA 1FMJA 1N0WA 4IOJA 2JLXA 3QQ5A 2DFLA 2VSFA 3LW7A 4CRWB 4AKGA 1MABB 1E1QA 1WE2A 2QT1A 2ZREA 4OHWA 3WNCA 4Q48A 1FP7A 1SXJE 3A1VA 3WYGA 4V0NA 3RRZA 1AS2A 2ZJZA 1XXHA 1J99A 5FBLB 4ZI3A 4HLUC 5E7JA 3OF5A 2HYDA 4KLNA 4MUAA 1ZC4A 1QHGA 2BOVA 2RGAA 1R5BA 4UXJA 4F91B 3BRWD 1E94E 4C0KA 1VPLA 3EAQA 2JJ8A 1RKBA 1E4YA 1MRSA 2CLCX 2R65A 1DADA 5J4LA 1NKSA 4GP6A 2ORIA 5G40A 4JLMA 2ZJYA 2BEKA 5J4HA 4IDNA 1JR6A 1NBME 2WSMA 3U7GA 3VR2A 1G5PA 1FX0A 4QGFA 1MH1A 1SGWA 1AZTA 3T5GA 2JLYA 1LTQA 3D3QA 5FTKA 4M9SA 3LLMA 1Z0DA 1XBTA 3OEHA 1KDPA 1NVUQ 4BE7B 3REGA 1KO7A 1N6PA 4C0SA 4W9MC 1YR8A 2O8BA 3BERA 2WPDD 2WVJA 4MH0R 1M2OB 4KSCA 1EK0A 2V1XA 3L8ZA 1X8KA 4KFRA 2F43A 3SN6A 1KDRA 3T5DA 1XNJA 4RFVA 4B47A 4UKDA 4QHSA 5JEDA 3I62A 1BYIA 3PEUA 2JLWA 2UZ3A 2JAQA 3K0SA 1ZU5A 3D7MA 1KAGA 1OXUA 2IS6A 2J0UA 2ZRKA 1RYFA 1X6VA 3CKLA 4OQNA 2CE7A 2I3BA 1Z07A 1D9XA 3IKJA 1VECA 3G5UA 4HB0A 4HI0E 4C0BA 2V6IA 1OKKD 5KHOC 1E0AA 4RD4A 3FTQA 4M1KA 3U4QA 4HAZA 5K8UA 1XCGB 3PR1A 4JL5A 1ZM4A 4AIIA 4GOJA 3U7FB 4I99A 3DZDA 3DOFA 1DELA 2WPDA 3TR5A 4WW0A 2KBFA 3T1TA 2OE2A 3LRPA 1SHKA 3VR5A 1VYUA 3EZ2A 1V43A 1VCIA 1RVDA 1KK2A 4I1OA 1ANKA 3H86A 1Z22A 4RFSB 5FTLA 3LW8A 4QHTA 1G4AE 1UBCA 4ZKEA 2VHJA 1OXXK 1A2BA 5EP4A 3W9YA 1SXJB 5IT5A 4M1OA 3B60A 5FPTA 1DAMA 1OB5A 2JIZD 4MYTA 4URZR 5EP1A 2HF8A 2P6NA 4OK5A 3KUCA 3P27A 5FL7A 2ONKA 2ZSEA 3BFVA 8OHMA 3W5JA 2GJAA 3Q72A 3ICQB 1P72A 2GRJA 2ORWA 1LS1A 1FX0B 3SYKA 1Z0JA 2CEAA 3FE2A 4XSGA 2GJKA 2XNSA 1GIAA 1KSGA 4F92B 5EUQB 3CNOA 2ERXA 2IC5A 3FPAA 3UMFA 1E1QD 4CEHB 3P4XA 5JCPA 2ZRPA 4OKSA 5CIQA 1DAFA 3G0HA 2MSDB 2H92A 2VSOA 3LXXA 1A5TA 1E2GA 1XTKA 4C9BA 1E79A 1PLKA 4EJSC 2GESA 1Q57A 2AWOA 2ECKA 2F9LA 1A82A 2YWGA 5GJCA 2PMDA 2D7DA 3AF4A 1J8MF 2IEZA 1W44A 1DO0A 3UMRA 4URXR 1E2FA 4NYIR 1LFDB 4UJ3A 3OIYA 2Z5FA 4CF7A 5FPKA 2VP5A 2QAGB 4A82A 1DARA 1QHSA 3ZH9B 5KOYA 1XD8A 2GDJA 4LJYA 2HCBA 1R0ZA 3CWZA 3I32A 4V0ME 4AC9A 4M9ZA 1VG1A 1GKIA 5FTJA 4PC7A 2BV3A 3HPRA 1AZSC 2C9CA 1P2VA 3CRVA 2OBLA 3VR1A 4EUNA 3PJRA 3FKSA 4H9GA 1ZAKA 4JBWA 3NTUA 1T4GA 2IT1A 1SVSA 3QXXA 4JKYA 2VHCA 5CLLA 4DC9A 2D06A 4N1AA 5AWFC 4PAOA 4TMVA 2NZ8A 2PX0A 3PUZA 2A3RA 2FNAA 3U3RA 3MCAA 1KI2A 4LJ5A 1YZTA 2GCNA 5G3ZA 1RRPA 3FKSD 2KE5A 3CR7A 1SZPA 3ZYCA 2W2VA 3CNLA 2X8AA 4OI2A 2WJIA 3P1JA 2C78A 3VU9B 1NG9A 4YDHB 2XZLA 4IFBA 1WB9A 4ZPXA 4TLCA 1I4DD 1Z06A 3EZ9A 2GK7A 4EFMA 1IM2A 2O8FB 1AGPA 1W4BA 4LY6A 2CK3D 1GWNA 5EP3A 2CL7X 5DI3B 1N6HA 1W47A 3IPYA 4MYHA 4D4KA 3CRRA 4A2WA 3RS5A 3GLFB 4MRPA 1HT1E 1YR6A 2MSEB 1TF2A 3GD7A 3KKMA 4EFNA 4Z8YA 2GJ9A 2IYWA 4LHVA 3B1XA 4Q7MB 3CPEA 3TH5A 2WWYA 1KDOA 5BN3A 4FW9A 4LYAA 1DAHA 2OBNA 2WJHA 2CNWA 3QG1A 1SXJC 1TEXA 3IBYA 1S9HA 1XZPA 3MGCA 1R8QA 3TAUA 1XRJA 4LV8B 4P4SA 5SZHB 1DBSA 4YONB 2H17A 3AP2A 3ADBA 3GFPA 4D0NA 1NIPA 2F1HA 2ZRGA 1K5DA 2WZQA 3WHKA 4HUTA 3TUJC 4B3CA 4ILEA 3B1ZA 1KK1A 1AM4D 1VCNA 3A4LA 4Q7LA 2QROA 3WY9A 2OG2A 1OXVA 2Q9BA 4L15A 1J70A 2JEOA 4JL6A 1K8RA 3B7GA 2FEOA 1W4RA 5AUPB 3QBTA 1PV4A 3TIFA 4NYMQ 2AKAB 2D4HA 2EYUA 3KB1A 1ZMXA 4DUGD 2Z43A 4LC1A 2QQEA 4IDPA 3BD9A 1KOFA 2VTKA 4HATA 5JHHB 3U44A 3AVPA 3ZZUA 1EESA 2B7BA 1EFTA 2IYYA 2ZUDA 2IYZA 2HJVA 1D6JA 4LBZA 4F38A 4BLRA 1PZNA 3TJZA 2A78A 3OIVA 2CCGA 2DHRA 1G9XA 2VIIA 3THWA 1TQ6A 2DFNA 2BJVA 4FMDB 3RWMB 4QBFA 4Q4AA 2ANCA 4A6PA 2W83A 1HYQA 3B6EA 3C41J 4RSGA 2UKDA 3P26A 1KNQA 4OK6A 5FI0B 4NYJQ 1DO2A 2C9YA 4X8LA 1T3SA 2IYTA 5GJVC 1IY1A 1G4UR 3PXGA 4DBLC 4PZYA 2ZE7A 4TTRA 221PA 1S2MA 1F2TA 3O47A 2J41A 1U0HC 1FQKA 1U0JA 3UPUA 2QPTA 2V4ZA 1ZNZA 4H1VA 3EZFA 2ZRIA 2YHSA 4RD2A 4JMPA 1YHNA 1W2HA 4B3DA 5AR1A 1M7GA 4Q1FA 1H8ED 3QKRB 4A92A 1E2LA 3HU2A 4XIGS 1N25A 3B1VA 3TLXA 4TYWA 1LS6A 3B13B 3SBDA 2YJTD 1KJYA 2C96A 1P62B 4NCNA 3KKNA 4BFVA 5IDVA 4DCVA 2JATA 3PITA 1KY2A 2CXXA 5FI1B 4QM7A 2WWHA 2WWXA 2OEPA 2ZAMA 3KTAA 4HAVA 2VO1A 4JZKA 3VAAA 4RY2A 1CJMA 4HAYA 4P4SB 3QI2A 5CJ2A 1G19A 1YU9A 1U0LA 1OFTA 1RJ9B 2IYUA 1Q1EA 3SDZA 1KSJA 4NH0A 3UG7A 4JLOA 4IOMA 3CH5A 4BUJA 4QGAA 3R8FA 3NBXX 1XXHE 2WWGA 4OYHA 3U44B 2DCUA 5FPYA 821PA 3L43A 1U90A 1ODFA 2Q9CA 3TSWA 1SXJA 4D4MA 5KSYA 4JLKA 4AD8A 2JJ1A 3CW2A 3WYAA 1BMFD 3OEEA 1OPXA 4MGKR 3AVUA 1US8A 5CM8B 5EXPA 4ZO4A 2CL6X 3BH6A 5JS8A 3TMKA 5TARA 1OHHA 2VA8A 2AK2A 1E9AA 3HU1A 3T1QA 2ODWA 2FPLA 5L3QA 1GG2A 2OV2A 2B92A 4TLEA 1AQUA 3UANA 5IK2D 4PO9A 3LH5A 2ZYTX 2FFQA 3VQTA 1G1MA 4QM6A 1GP2A 5EP2A 2IXFA 3NEYA 2RGGA 1E0SA 4WZAE 4AKHA 1RJ9A 2Z6VA 1NVWQ 4Z8XA 3GJ8A 2ZE8A 4QRHA 1H8HA 2GZHA 4L4UA 1XMSA 3LBHA 2NTYC 4D80A 2NO7A 2HXYA 3CF0A 1XEXA 1KNXA 3AH8A 3ZZ0A 1XX6A 2KB0A 3CNNA 2IS2A 2V6JA 3SHWA 4EPRA 1N6LA 4IKEA 4WXPA 1S3SA 1FPMA 4MKHA 4Q47A 5HKKD 4JLNA 4C0LA 4O0MA 4QHYA 1OH8A 4XD7A 2B6HA 4LWZA 4BLSA 2JLRA 5JHGB 4R2HA 2P5SA 2J7PA 4C4PA 2WWWA 2DWQA 2ZS7A 3CPHA 2PZFA 1CS4C 1K5GA 1W1WA 4BEBA 2P67A 4JLDA 3RRMA 4D6PA 1QVAA 2JDID 1COWA 2LWIA 4A1FA 2PEYA 121PA 2OO7A 4ZIRA 2VP4A 3IBGA 3K9GA 4A4DA 2XSZA 3H1TA 4HAWA 2BDTA 1JR3D 4LCBA 3QXHA 3ZDQA 2RHDA 3IPXA 1CRQA 3C5HA 2CLSA 3KJGA 1EG7A 2WJJA 3UKDA 2VQSA 4ITRC 1W5TA 3AF1A 3KDSE 5EXTA 2ONJA 4GT1A 4B2IA 4B71A 5HZKA 3BK7A 3TR0A 3FOZA 2IXGA 1HT2E 2XSZD 1NNEA 4PTLA 2GCOB 2O8CB 2F3TA 4KU4A 4R2IA 5EXXA 4AKIA 3EPJA 1Q21A 4TLBA 3QF4A 5B58C 2AK3A 3SJCA 4GOXA 2YKGA 2QRNA 1ZM2A 2QBYA 3LDAA 3GLHA 1A7JA 2V8OA 4LJ8A 3CF2A 4KVGA 2OZEA 3HP1A 4OL0A 2ZANA 2GA8A 5FBVB 5GJBA 1U81A 5K8IA 2G0TA 3TSZA 3OE7A 1UKEA 3KXLA 3LO5A 4E03A 4XVUA 2QY9A 4AWXA 3REFA 3SQXA 2VF8A 1DEKA 2F9MA 1FTNA 2OFWA 1D8TA 1BKDR 4US0R 4PPQA 4MKGA 5JS7A 5FUWA 3LQQA 5JMTA 1XEWY 3EZ7A 4ZDKA 5CLQA 1MO6A 2D3WA 3GLIB 1KI6A 2Z4RA 2D7CA 4FWIB 4B2PA 4WBSA 1X8LA 3K9LA 2XOKD 1Z83A 2FV8A 3WMFA 1UM8A 1FL9A 3PCRB 5K8TA 1ZINA 3MLEA 1FTSA 4TMTA 2IEYA 1E96A 2H18A 3SI7A 3FMIA 1VHTA 4NTZA 1WRBA 2GEUA 2ZJBA 3IQWA 2IS1A 2CVFA 4M9XA 4LV6A 3HYTA 4PANA 4CEJA 3FHCB 4DLRA 3B5JA 4PSAA 4DEXA 1D2MA 4Q9JA 2V54A 3BBPA 2LKDA 3TKLA 4JSTA 5DSZA 2FZLA 1Q3TA 2PEZA 1II9A 2IXEA 4HEJA 4JVSB 4Q1BA 1M7BA 2H8KA 4DLZA 4RJLA 3A4MA 3HDTA 3NKVA 4GL2A 3AGPA 4G5GA 2ZVPX 3CB4A 4IDOA 1W36B 5KU1A 3AVXA 4G5OA 4EJSB 2NO0A 2FZ4A 1XEFA 3PUVA 3AVWA 1LV7A 5D3MB 3U3OA 1UBEA 3T1VA 2EFDB 5FOWA 4XH9B 2HXSA 1GNPA 1Q1BA 3MWJA 2GJSA 4UNPA 3AGQA 2OXCA 3DM9B 5DNYB 1NMXA 3MWYW 5AUNB 3SEAA 3KJEA 1E2PA 1XJQA 4LRWA 4UXHA 4TMXA 4EQ6A 1R0XA 2QE7D 3GEEA 1IN5A 2VLIA 3U5ZB 1SQ5A 4PPNA 1DVRA 4ZKDA 1NLZA 2W2TA 3EIHA 1N5LA 1AK2A 2WOJA 2GILA 1ZRHA 2JGNA 4Q02A 4OHVA 5DE3A 1Z29A 2Z83A 1A1VA 2FA9A 2NGRA 2YYZA 4M21A 4WAUA 4C30A 4MGIR 4A8JA 4RKFA 4M22A 4ZI2A 5FL3A 1O87A 4D2IA
chains in the Genus database with same CATH superfamily
1ZH6A 1BVUA 2XEXA 2YQ5A 1WS6A 1UIRA 1U3TA 2XDQB 1TNDA 4ZOLA 5TXGA 2E6UX 2AEJA 2QRLA 5JAOA 1D4OA 3EGDB 4LI0A 2EV9A 2EL9A 2PPLA 4F2WA 5KO2A 1WXIA 1TYZA 2P2LA 5F51A 4KXUA 1DJLA 2ECFA 2YBEA 3I9JA 3J7TA 2W70A 4EB6A 4PNZA 4F5YA 4B3BA 1SXJD 3C6BA 3MB5A 5IFKA 5FPHA 3UXYA 5TPZA 4GI2A 3MTEA 3GRPA 3UV7A 1JEAA 2B94A 3OLWA 1X1SA 4DL9A 4QXMA 2V5VA 4LXYA 4YREA 2R6GA 4P2BA 3U62A 3VHXA 4PQGA 2QAJA 2XWBF 5JXWA 2IYXA 2A9RA 3EY4A 3B1KA 4B0PA 3W2IA 3ICPA 1U2DC 2X4IA 1E20A 4RLQA 3TQOA 1BYUA 4TTSA 4I8DA 1KQOA 4HUQB 4PBRA 2O50A 2QX4A 5K1ZA 4YJGA 3SZGA 4MYRA 4YQYA 4EB0A 4FNGA 5IC6A 2QA5A 4DPKA 3GUCA 1YMVA 5JADA 4Y3UA 3L6CA 3E5RA 4HJRA 5CFNA 4ZGBA 3F97A 4B4OA 1LDGA 1TM1E 1GU0A 2R00A 2C8JA 1FJGB 2V0GA 4YN3A 4K86A 1YB1A 4J2OA 1YV9A 4BE4A 3TVDA 3EG9A 2J0UB 3NLLA 5G0UA 2JIMA 1Z0KA 1KE1A 5J47A 2R5NA 5FO0A 3G85A 1GTG1 1SKQA 4ZODA 3OQIB 3PSHA 1IOLA 4XI9A 1UZMA 4OAOA 2HAEA 4ZCSA 5M7EA 3ROZA 4AU1A 3D3KA 3SR4A 5C8ZA 5JCZA 1IQ0A 4JBXA 4KDRA 5CVUA 4KIJA 3SIWA 4Y2JA 1HNWB 2PIDA 2BMWA 4YALA 1D0IA 1JEJA 2VDVE 4LBWA 3FYHA 2NUAB 3ULKA 1QBGA 1C4OA 1EXNA 1ZG3A 1FUYB 1VG0B 2JJMA 1Z2AA 3NJ4A 3D4LA 3PRHA 1SBQA 2NUPA 3BQNB 1I7NA 4E3WA 3ZD8A 4CIWA 1LWOA 1CNMA 3AJEA 1UAYA 2ZJ8A 3NHKA 3O90A 1G8HA 3G1WA 4WFQA 3PC2A 2ZWPA 3OQNA 1VMAA 3ZCQA 3QKUA 1HI9A 3FNBA 4G2TA 1Y8RA 4MQEB 1V8DA 2FE4A 3SC2B 1F7VA 3HB0A 2A88A 3IT2A 3TL3A 2GKOA 3CW8X 1LVGA 2A30A 5E4JA 1NYLA 4UTVA 4NE7A 1T34A 2JFHA 1IEQA 4FCTA 3WL3A 2CSUA 3GJXC 4BBPA 3DAGA 1KARA 3DWIA 4QUJA 4II7A 2C0QA 2FN8A 1RP1A 2YV3A 4FI3F 4J75A 4WKNA 3IDFA 4JBYA 2UYQA 4PINA 5A7GA 3IKLA 1P7WA 3GPLA 5BSUA 1I2MA 2BGTA 2B5VA 3K0FB 4OHFA 1U8ZA 4IQ8A 5JMOA 3FYUC 4Q9IA 2WI8A 4WBNA 1D4AA 4Q6WA 3BEDA 4WGGA 1CY0A 3GT0A 1G3MA 2IPOA 1Z26A 4YRLA 3TOXA 1C1DA 1BNCA 4JJIA 5ALGA 3DTYA 4H7HA 1H69A 3LLUA 5JSHA 3QVUA 1CLEA 1E2QA 1RAEA 4IGKA 1LW7A 2A0YA 1MW9X 5BWMA 4BX9A 1V45E 2DPHA 2FVYA 4D98A 1G1AA 1V37A 1WDKA 4CMEA 4RY8A 4EG5A 3PUHA 3N2KA 5C8YA 3KQNA 2IDMA 4Q4AB 4PG4A 4YPFA 2LUOA 1NWHA 2GEJA 2FZEA 3V8QA 5K3SA 1T3GA 3G6KA 1C7RA 3I8SA 1QPZA 1UANA 1UT6A 1S1CA 1J49A 3K0HA 3MPOA 4IIJF 4JLJA 2OQIA 3QY0A 4DR2B 1FTWA 4YJ2A 2YS6A 2G4VA 1EFDN 3EXHB 3KJXA 1QGUB 1W8DA 1HE3A 2ZJ1A 4FGSA 2CFOA 1LBHA 2GF0A 4NNOA 1G3UA 4KJZA 2Q5CA 2NYAA 1K6EA 1W4ZA 2HWUA 4M46A 5LP6F 1SOUA 3C39A 2VAMA 1FDUA 1KKMA 2F59A 2QZSA 2G0AA 3ETGA 2CNWD 3V6MA 5HZGA 3VR3A 2XHEA 2GKSA 1TAQA 3HVJA 1NATA 3QF4B 3F2VA 5EZYB 5M3BA 4A1OA 1O5OA 1AQNA 1OLSB 1QAMA 4I46A 3JXEA 1WMBA 4N9QA 4DR4B 1KF0A 1V1RA 1F6DA 3C3AA 3WHPA 3FGOA 3ND7A 3WMGA 2IGBA 4UBJA 1Z7WA 1N6RA 5BW8A 3T34A 2YCLA 1J06A 4L7QA 1NHWA 2VOJA 2RGYA 1P18A 1Z4OA 4PCAA 3PFNA 4H7DA 2G5GX 4I3GA 1O03A 4MWTA 3IUPA 5B3AA 1WCV1 2G76A 4YPOA 3DGEC 3K9HA 4IZ6A 4JU9A 1E4VA 4HH0A 3V2IA 4HRAA 1ZHOA 3PGLA 3R3ZA 3TL6A 3HPQA 1C1HA 1T0PA 4UQPA 5SYNA 3RAFC 3QHQA 1NW4A 2C3MA 1L3IA 2HADA 3O1LA 3A25A 1CKEA 3PWTA 2O7RA 2Z08A 2Y0BA 2AKEA 4PSDA 3MHPA 1H0KA 3JVUA 3VH1A 1V8PA 3I30X 1HTTA 2Q4TA 2W6ZA 4YCSA 4M0MA 1S0UA 1XZEA 3T5BA 3WZLA 3UAOA 5KPJA 1F6BA 3CRQA 4H08A 4HDQB 1W0JA 1KRXA 3EPKA 1CTQA 1K5PA 3E23A 1VKHA 2FXVA 1RWQA 3OFND 3AVYA 5C31A 1MA3A 1FDVA 1HV8A 1UKAA 4C0HA 1HGXA 1PR0A 2GCEA 4CEJB 1K3FA 2CVPA 1L9KA 5AXBA 4DRZA 2YS7A 2OGZA 1HLPA 4XVRA 2JEZA 1Z2CA 4K26A 3SJAA 3WL7A 3WRYA 3ZDRA 4D9HA 2QRZA 5A5VA 5CB6A 4X91A 5HFAA 1GDHA 4DEVA 1OE0A 3W04A 5IABA 2BONA 5KOHB 3LFTA 2IH5A 1R18A 2MINA 3GLHE 1Z4JA 1QANA 3DMRA 5TLSA 2RIRA 2CLKB 4UC0A 2XLBA 1YMUA 2BFEB 3DL0A 3DDSA 5JVDA 3D1VA 3HCFA 1T8RA 3NBYC 3TBKA 5C4MA 1EDEA 1QCCA 3PHHA 5IJAA 4NESA 3SHTA 2C3UA 5DH9A 3V4OA 3PQ4A 4PX9A 2FRDC 3CEMA 5CDHA 1AKEA 4P0TA 2XE8A 1VCOA 1W0CA 4OIMA 4GUAA 2P3QA 4V0KA 4WLOA 5KI6A 3ZVRA 1NMSA 4M88A 1TM2A 2NT4A 2WJPA 2RHMA 3KSMA 1JNYA 3U09A 1TZ2A 3Q3JB 4QLBA 2DLCX 4UBLA 2XRYA 4DZTA 1L5HA 1EZ1A 4NX2A 2FCAA 4ALJA 1Y6FA 2CXUA 5CA0B 5TB5A 1TGYA 1FXSA 2VDPB 2YASA 1RPZA 4KNYA 4MYSA 3ZZTA 4JXXA 2BGGA 4MB6A 4V0OA 4EYGA 2OFXA 3ZTYA 1MGOA 3VO2A 2YUTA 4C6SA 3F3KA 3WAGA 1S8NA 2UVQA 3EWAA 5T6BA 2PRSA 3VBCA 2CJWB 3ICOA 4RXTA 3S2FA 4BCCA 1MEJA 3L02A 4ISBA 3DL2A 4KLRA 4PVDA 4WA7A 5BXYA 3KYIB 1A9TA 4UATA 4FHZA 4ZVQA 4B3IA 1OQAA 2P6OA 1HF3A 4D9CA 5I4IA 4I3FA 4C6RA 5C7IO 4X93A 3T3MB 3W6NA 3DMTA 3W8NA 2VHUA 2K87A 1GM5A 1O8CA 4YAGA 3PPXA 4CYMA 5P21A 1UC4B 2B78A 2IXTA 4LJ6A 2J5QA 4ZQFA 2HA7A 3VXKA 5C53B 2CB0A 2KI5A 3IGFA 2VSNA 2YWDA 4UNNA 3B7WA 3EXIA 4PIMA 4WCFB 4YS6A 3BREA 4B46A 4CR8A 5KJFA 1ML3A 2RC6A 3LBNA 2H5EA 1LRKA 5F7JA 4PBSA 1T8TA 2RH9B 2PSHA 1RE0A 2D5IA 3B9PA 4H1TA 1SQ6A 1P74A 4IJQA 5C46F 4GPIB 3CMCO 3GG2A 4GD3Q 4R1LA 2Z56A 3WMXA 3HP4A 1BU5A 1XO1A 3A3PA 5L3RA 1GNQA 3R0JA 1U28C 2NZVG 5CVJA 4YJ3B 4XR9A 2Y66A 3Q88A 3QMVA 1G6OA 2ZYSA 3TSOA 5JQGB 2X1LA 3D4IA 4NBKA 1TCVA 2C5GA 3KO8A 4CV0A 2XBUA 2EBWA 5EHNA 1QH0A 3A3YA 3M1IA 1IL0A 1EXMA 1EWYA 1NXTA 2Q2VA 1I10A 3EWNA 4JEMA 4LOKA 1WY7A 2O7QA 3GJ4A 1ZX1A 3FPSA 1RW4A 2TMGA 4FMDF 4XIYA 5DCYA 4BLQA 2XZOA 1B26A 1G6Q1 2DQZA 2R8OA 4OHXA 4OPMA 1YDMA 2O48X 1BCRB 1NUHA 1ZYUA 2HNAA 3N2LA 1N5RA 3FVWA 2OHXA 3K8YA 4WT7A 5BSTA 4X9XA 2HA3A 5GQSA 4DAOA 4MMZB 2V7TA 4M1WA 3WJ2A 3A9WA 1CZNA 1T9DA 5LQSA 5K9ZA 3HGTA 2CHGA 3AETA 3FMOB 3ESQA 3LQYA 3QJ5A 1PV2A 4KPEC 1SUEA 4KPGA 1QHHA 4GQBA 2P6RA 3V55A 3CUEF 2BH9A 4JUAA 2JGDB 3LCRA 5KNDA 2PX2A 3UHPA 2JCYA 1QGYA 4AYWA 3TX6A 1RXYA 2CD7A 2QRVB 3G2OA 2QX7A 1A98A 1PSWA 1A5BB 2GEFA 2Q99A 3OEHD 4IQGA 1MKYA 1Z4PX 3GPCA 3TZBA 3W5HA 4ZV4A 2P11A 2FX2A 1ZC3A 1EX7A 4O4HF 1C1DB 4B6JA 1CJTC 1EUCB 4ARVA 4FFMA 3F5FA 1GZ5A 4QJ3A 1AO3A 3C1OA 3KYCB 3OBIA 2G0NA 3NHBA 5HF5A 4CEIB 4Z6KA 1QH8A 3V9AA 1OAAA 1UWCA 4HB3A 4U6QA 2OO5C 3EK2A 3WLKX 1E1CA 2ORVA 2QGNA 4ZXFA 1YONA 4B3HA 3E3MA 1QHIA 3K32A 3CZQA 2D2VA 2H7XA 2V59A 3DCNA 3IODA 3MNFA 3R3WA 1GPWB 1O95C 1TU0A 3RAEC 3BB4A 2AF4C 4GXNA 1NXXA 2P9GA 4EELA 1OH6A 1QGUA 1TZKA 3D2CA 4LRXA 1NT2A 4EHKA 3F4BA 4AURA 4UUPA 5EQTA 2C03A 3G9ZA 1JBQA 4BLOA 5HDBB 1OX6A 3RDPA 1RQRA 4GC9A 4MVJA 4FYPA 4TYQA 1YR7A 4EB8A 3SJUA 1IPFA 1D0VA 1RQPA 4OXKA 2J6HA 3QFTA 2HTFA 2RBGA 4BWGA 4DNPA 2VFAA 4KK3A 2BCJQ 1EFAA 3KBOA 2Q3DA 3LT1A 3T4EA 3NHRA 3AEKB 1NIJA 2FEKA 3P9NA 2ZYIA 1XP8A 4A0GA 1FIUA 4ZK2A 3A1NA 1R0CA 4B3RB 1P0FA 4AG6A 4UQLA 2FEMA 3VPFA 5AKXA 2PS1A 3KEQA 3U7QB 3M7IA 4NBWA 4M8IA 3WLAA 2PJUA 2V55B 3RKUA 4ZHQF 1LPPA 3K1AB 1RQXA 1SXGA 1MR3F 1MA0A 1TF5A 2GLTA 3DKRA 2XWPA 3M3PA 3NGLA 3PB3A 4ZQCB 4BMVA 2IX3A 3FOCA 5CNJA 2P9ZA 5AJZA 3WRXA 1Q0HA 5A03A 1JUDA 1TJNA 4G0OA 1NJ2A 1Z39A 4OA5A 2TYSB 1I9CA 4BO1A 1L8XA 3CVXA 1MX3A 2V65A 3JQAD 1Y98A 3O0TA 4JI1B 1AJEA 4C03A 1VGQA 4MYUA 5GY7A 3FWNA 5AW4A 1PX2A 2ACWA 3TAHA 4RTSA 2GF9A 3OZVA 3TQIA 2HR1A 3T35A 1SKYE 4AG3A 1OW3B 2ONCA 2Q8PA 2WE8A 5BV1A 2NP6A 3CR3C 1QCZA 3WAJA 3Q0TA 4A0SA 3DHNA 3E2IA 1QFJA 1VIDA 2EC5A 4PGAA 5BQPA 4G41A 5K3AA 1N36B 3LT2A 2D7JA 1QTNA 1NVVR 4R9SA 1PR6A 2JD0A 5DXFA 3VUEA 1KORA 1NLYA 1XAIA 2A3NA 3D3WA 5K3DA 3GJ5A 1A77A 3OE7D 5EEGA 2HMYB 3V7UA 2GN2A 3C6QA 3S3TA 1E1RA 3VMFA 1YRLA 5DGTA 5DTIA 5L4SA 1XZCA 3QNUA 1IY2A 1P2UA 1W9HA 5EMLA 5T4HA 3UK1A 5KUTA 5CH3A 3EF0A 2BFEA 1UOEA 1D07A 1AX9A 2ZUFA 2QUJA 2DHDA 4IQFA 2TSYB 4K1XA 1IWOA 2UVPA 1TUEA 1UCFA 2RGCA 3BWMA 1LDYA 1JEOA 1ADJA 1RD4A 4OGFA 4MSUA 3RJMA 1A3CA 5LLDA 1BAPA 4GPD1 4BVLA 1IBLB 1T6ZA 3PXAA 5JD4A 1LX7A 4MR8B 3DZIA 2MJLA 2RGRA 5TJHA 4C01A 4V0RA 5B4VA 5CBPB 5ALQA 5FLXA 3KYDA 4NXNB 2DU8A 4Y6GB 4LQDA 4B4WA 1W581 2HBRA 4MLPA 2RHRA 3GR6A 4TRJA 3VDXA 3RKSA 3L4BA 1A8PA 4TLDA 3PJGA 4R1PA 3R8XA 4BLUA 4WRRA 2FWBA 1N9GB 5F5NA 2Z5GA 4AO6A 2CUTA 2IYQA 3MFQA 2XX3A 3ODPA 4C0XA 1RLIA 2WV7A 3AWIA 2ZZMA 4Q5IA 1C1YA 4P31A 2K7FA 5E1BA 3FCOA 1KRHA 1L5RA 1LEHA 2B6NA 5JRDS 4CKCA 4TX1A 4WN3A 1LUAA 4M7WA 3HKCA 2BMEA 5DNVA 5G0TA 6PFKA 4Q0MA 1ZIDA 1U1DA 4DUGA 1VDMA 1RAGA 1CW2B 2BFCB 4OQYA 2J09A 1UPCA 3MC1A 4FLEA 4OBEA 2XTNA 2Y4NA 3KZCA 4O4IA 5CITA 1MB3A 1JECA 2JIPA 1IB0A 1OX4A 2H9AA 3L6DA 2FUCA 3DZBA 2B4TO 3RC3A 5ILOA 4LHXA 2VL7A 3PWSA 1Z18A 2BGNA 4LDPA 2WWRA 1UJ4A 5HK9A 3DWFA 4GWGA 3S1AB 4CNBA 3JYLA 4CT5A 3LYUA 2QTHA 3W34A 1V41E 2R3SA 1VXRA 1POWA 5JXGA 4BC0A 7AT1A 3C3YA 5EVJA 3X0DA 2GWHA 3WYNA 4TN5A 4LGCA 3E7PA 3HB7A 3PYLA 3EPHA 3FGNA 1ZQ9A 1FFBA 5DM70 3KL2A 1GAEO 1MBZA 2ZTHA 4BKUA 4C3OB 1CVLA 2JHAA 4JEUA 2BF7A 1CQWA 3HN6A 3UB2A 3SQMA 1FSPA 1AHNA 4CNQA 3B1JA 3BH7A 2F62A 3MELA 1ZJJA 1JN0A 3NNDA 3MJRA 4C3ZA 1GYQA 4JJKA 4NBUA 3UUGA 3W3AH 2DUJA 4FYIA 3RTGA 4L5YA 1SCUB 1SZJG 1JAXA 3QBVA 4PCVA 3MS2A 3COZA 4GYYA 4HNVA 1P1HA 5KYXA 1QVWA 1LSUA 3LA8A 4B76A 2DUMA 4LJRA 2HV9A 4Y0NA 4NCKA 2M2IA 4OHZA 1XD2A 4KXWA 2HCTA 1MQ9A 1UFOA 5I5EA 1J8FA 3QUSA 3RS3A 4Z9YA 3A4VA 4XIFA 2BMVA 1EHCA 1QQBA 2GBCA 1XEXB 2XYGA 2ZYVX 4Q3EA 5AKYA 4DQXA 1U9IA 1FFWA 4P36A 2O2YA 2LNDA 3GRCA 3R24A 4KQKA 2EIHA 2FMHA 4A8JC 3TG8A 4KQIA 2XVYA 1Z2OX 3ZE7A 3K0FA 5B7GA 4H1WA 4B6OA 3T0IA 2I33A 3W5VA 4WBNB 1UZAA 2KHZA 4HWRA 2OR3A 1Y5RA 3QZUA 1CIVA 3EFOA 5G53C 1KP3A 3HR8A 2FPPA 4M8SA 5F9MA 1JVBA 1XDGA 1ZN2A 4FGJA 4TV8A 4GYWA 4MP6A 2ID7A 3CISA 2PAFA 1DC5A 1NDHA 2J8ZA 1NMZA 3LCMA 2ST1A 3IIEA 4FNMA 5AK0A 2H5IA 2Q1SA 3E8XA 4DG5A 3CWQA 4HTFB 4LIPD 3DLHA 4KZKA 2XCIA 4DXHA 1N1EA 1PJTA 2IHTA 1NTOA 1YDWA 2NYVA 1XDBA 3B3JA 3GEDA 3QXGA 1DUIA 5CRIA 4BUZA 1XPOA 1U2DA 1KEVA 3RR2A 3HJAA 2ZI7A 3HKBA 1DIGA 4ZQBA 3ANSA 1ZW6A 1QIFA 2GN8A 3GHHA 2PSJA 4TROA 4CMKA 1XQ6A 3FPGA 3LMKA 2NSDA 5HBGA 2XB2A 3GGCA 2PRIA 4AZ3B 1YC5A 1X80B 4QTZA 2E87A 3IQFA 4FZ5A 5EERA 1QIEA 1DTSA 1WEKA 4HG2A 2P91A 4B7ZA 5BN5B 4CU2A 3OFKA 4IXNA 3RK1A 2R8ZA 3ZDFA 1VFNA 1QH1A 2G9NA 3C4JA 3R40A 3UPDA 3KZOA 4DR1B 3EGDA 4PXAA 4BLPA 4JIGA 5KWEA 5EIHA 2CVZA 3L2OB 4MI3A 3TRKA 1THGA 4NYIQ 4B74A 2OQ2A 4O25A 1T26A 1LLDA 2PWBA 1TW2A 2FETA 2EG5A 3USZA 2ZBEA 4LK3A 3SLRA 3K0CA 4ALIA 3IESA 1P4HA 4HFJA 3ZGLA 4F85A 7REQB 4QPCA 4RKRA 3D7SA 4RVDA 3THOA 5TSDA 1W30A 1RLOA 1AK9A 1V71A 3E9YA 2VN8A 4GWLA 1TVEA 4UTRA 1FFDA 2X1VA 1IBRA 1Y7IA 2F1IA 3GFVA 5F3WB 5AO9A 4I8IA 3DAPA 5D1HA 4DIMA 4CXMA 1E9EA 1A88A 4G65A 5D87A 2GTHA 1WUTA 2GK3A 2WNSA 3U4GA 3HBJA 3NAQA 3AT1A 3M5CA 4UU0A 3BL6A 1V16B 2XNDD 3VUFA 4TSKA 4BGDA 2NU9A 5AVKA 2FSFA 3DMTC 1HT3A 1K68A 3DVLA 4BHTA 2QTAA 1URPA 3KR2A 3P71T 3MTQA 3CRW1 4WUTA 1Z08A 1BE8A 2P2SA 4IAOA 2CT8A 1Q22A 4R05A 5BNWA 1HQKA 1IHXA 4IS2A 1KI3A 4GZ6A 2JLVA 4K46A 4LA4A 3EDOA 5CG1A 1RRCA 2Q3BA 1MRNA 1G63A 3D0QA 3LSTA 3VOAA 2OM2A 4DWVA 3ZLTA 5EHXA 4TZ6A 1ZSNA 3WL5A 4BJ5A 3VX3A 1Q17A 2QTTA 3JZMA 2VJMA 3HYRA 1YNSA 4H4DA 5F9FA 1SR8A 2O0MA 3EXHA 3DMGA 4OLBA 2R6CA 4KVAA 5KYKA 1W76A 4F9GA 3BXPA 1UT8A 1NUAA 2AQ8A 4N0EA 1EVIA 4S24A 2VUUA 1QAOA 2FWAA 4J0KA 4BPBA 3AXTA 5KNBH 3GI1A 2RAPA 3L8HA 2C4TA 3E1SA 4JUFA 4RA9B 4HSEA 1A4XA 4BMCA 3MWKA 4CT0A 4A0HA 5T7BA 5AICA 1U1IA 2ZRCA 1P3DA 3AVOA 3DDZX 4ZO8A 4DTIA 4JI6B 5IYZA 2WYHA 3P0HA 2E5LB 1WMEA 4I55A 1IEXA 4D9KA 1JVNA 4IJ6A 2FSVA 1YJ5A 4Y6OA 1ADYA 2EQBA 1ZEJA 2FEWB 2QRHA 4NP6A 1UAAA 1KFCB 4B09A 2BTQB 2JIOA 4FT4A 4RIGA 1GLVA 5IN4A 1U65A 4MIKA 2DWCA 3RHSA 1JEYB 3BZUA 1JFFA 1ISSA 2HQ1A 1QVZA 2UUOA 2GBLC 5DK6A 5FWAA 4MLZA 1T4BA 3ZLUA 1GFSA 3TF5A 1WMSA 3UWMA 1H9BA 2X8WA 1C3OB 5CX1A 1FCJA 1N9ZA 3ILYA 5FB3A 1EP1B 2XXAA 1JSLA 1RLTA 1X9GA 2IWHA 2YRFA 3WLIA 1DINA 1P4JA 2ROQA 3FGZA 5H3CA 3ZGOA 2VHEA 4E5DA 3QKSB 4GPEA 2G63A 2H5JA 2YJ6A 2WICA 4QUIA 5CDFA 4FIZA 3U4AA 2QQ0A 3BBLA 2NXWA 4MJ3A 4CLRA 1BQEA 1QHXA 1JHOA 5EQDA 4DXAA 1ETUA 4G67A 2EFGA 4GMGA 1XAJA 2R4TA 4R1NA 1J5XA 3AP3A 3DBRA 4TMYA 3HXOA 1GAWA 1L8AA 2IV7A 1UDAA 5ALMA 2CHUA 3IMKA 3EEOA 3UJCA 2D62A 1T1IA 4C7OA 5IDYA 3KD2A 3O7WA 3GVCA 1T3ZA 3NEJA 3ROKA 3LXMA 4MI9A 1YK0A 3GFFA 3NHJA 1Z0SA 5F21A 2F3PA 2CNDA 2W6ID 2R8XA 2JCXA 1CLUA 1U4NA 1XLWA 4ACAA 3R9WA 3WWZA 2E4ZA 4V24A 5LOVA 1Q14A 1SVMA 1AA9A 1AKVA 3JAKB 2ZRNA 4UHJA 3GXBA 4WVFA 4AJ1A 1IHDA 2QF7A 2GCPA 2PL3A 3QW2A 3I73A 4GYJA 3BFJA 3EARA 3KJQA 3AF6A 2QP3A 1N5MA 1UJ6A 1DIAA 1SQGA 1WKCA 1FTGA 1SM4A 2Q4DA 3DFZA 4I55F 3G1TA 4LYHA 4MVWA 4QUAA 5T57A 5BSGA 5JR3A 4CEHA 4C2AA 4GR4A 2GQ0A 1XKXA 2JIQA 3KZKA 1QRRA 5T8KA 5TPZD 1F06A 5ADHA 1UC9A 4F6RA 1LQ2A 1NVMB 4DGSA 1EUZA 3H8SA 3QKRA 3EIXA 3OP4A 4GMFA 2ID8A 2X13A 5FXMA 4ZYWA 4KXNA 1WMFA 5AUQA 1FUUA 5ICGA 1H22A 2NYRA 4R7GA 2C2WA 3M1LA 2O3UA 4MI1A 2VHZA 4IO1A 5E8RA 5EHQA 4X62B 3FD8A 4CM5A 2CUZA 4KJXA 1AKMA 3DC2A 2IQ5A 4JC4A 4LWPA 3D3JA 4OJNA 4ZRDA 4KXVA 1SUWA 5SY9A 2VEDA 3MVEA 4UMEA 3A6HA 2V96A 3IAEA 2VYNA 4PIVA 1SNYA 1UAGA 3AEUA 3E81A 3IRUA 1KO5A 4FILA 4AJ2A 3QVSA 5JI2E 1ZD9A 1ZW1A 4S2UA 4ATNA 1SUPA 2HHCA 2F1OA 5LWQA 4UEWA 3DZCA 2O7SA 1IM5A 2BEVA 1NJSA 1JHXA 4LC0A 5IHXA 1M2EA 2GPYA 5K03A 5CHYA 2WAXA 2JAOA 4C4XA 3AEYA 4L9WA 5H3HA 1CEXA 3FMVA 3DBRB 4PC1A 4EKEA 2QRMA 2KM1A 3E6AA 4JT9A 4A8TA 4J94A 5ITZA 4B3MB 4IIXA 3D7RA 2XBLA 3VC3A 4D8XA 1BFDA 1SUFA 5K2OA 3MJVA 1K98A 3TPCA 5AJWA 5BNIA 4YMUA 1MIOB 2PQ6A 4UHEA 3KFXA 4WZBB 5IC5A 3CPJB 2HFKA 4RENA 1QV9A 2I1VB 3KB6A 1JEDA 1H23A 2ZR7A 3AUUA 1W88B 3FLMA 4RK6A 3NDJA 4F5ZA 4JI8B 3RLFA 2CLIB 1PGJA 2BFDA 4PO8A 3PNVA 2YWEA 3JALA 2RAFA 5JG7A 4DVJA 4LF6B 3C74A 4JBIA 1YA8A 3OPVA 2QUBA 2ZU6A 3L1VA 1W46A 3M5WA 4ZQIA 1H1LB 4ML3A 4OBXA 5A71A 2KSQA 4F6LA 1QYXA 5L8VA 4DB2A 1ZEMA 2VF5X 1XTIA 1L5HB 2A5YB 3EOZA 1WZ2A 4HX5A 1P31A 1HE8B 3BMNB 3VZDA 5DBIA 2WIBA 3CO0S 4WOPA 4TV9F 1SU4A 4BQFA 1UMCB 2B37A 3AEQA 1M8JA 1UMDA 2ZI6A 1GZDA 4LF4B 4UULA 3TE6A 1ZIXA 2P62A 1OV4A 1B2LA 2KJQA 1L5FA 3P2OA 3INYA 4YT8A 1PS8A 1PHPA 1B1CA 4EMBA 1I1NA 5CFPA 2CNBA 4DLAA 3L7AA 4YP6A 1QVRA 2J45A 3FCEA 4FM9A 3GEPA 1ZGBA 3EVGA 3LK7A 4UTOA 2CHFA 2HJWA 3Q9LA 1NZFA 1WSBA 4LRQA 1GKKA 2OV1A 4RKWA 2AFHA 2DPGA 3T9CA 3AEUB 3H1EA 1Z8HA 2R68A 3L93A 1UJ2A 1GL6A 2ABWA 3GFQA 3MD0A 2CV0A 1N3IA 1LY1A 4R0VA 2XAAA 4KV7A 5EVCA 3ZU3A 3GLFE 4JL8A 1JE1A 3WP0A 2CUNA 1D5CA 3GGSA 3NWBA 4PBTA 3DBIA 3AF0A 3K0AA 1GSOA 1N3BA 5DEOA 4B8YA 3FZYA 2OWDA 3W8FA 2C84A 2GJ8A 3VGPA 4TUYA 1OBVA 4OGLA 5I7VA 1TD1A 3FUXA 1M34A 4Q3LA 3RASA 2ZSKA 3DZJA 4W63A 3LWNA 5LP6C 1QHHB 4IWNA 1S2GA 3ELWA 3D8BA 2WIGA 1WD7A 3GJ7A 5DRYA 3SNKA 3AKZA 4QU0A 4K9QA 1GUZA 3I5XA 3ZHQA 4S1NA 1LF0A 1RACA 2WF5A 1V95A 2XTAA 4EI8A 3BWVA 2WZBA 1G5RA 4YLGA 2CD9A 1L5GB 1KO4A 3UC9A 4C0QC 1XAHA 4RYDA 1KMMA 4AJ9A 1RI5A 13PKA 2WJYA 3NANA 4CMJA 4D4JA 1U7TA 2ORYA 3O9ZA 1OJLA 4A7PA 3BWYA 4GOND 4QJ4A 2IPNA 3OURA 4NS4A 4QICA 1L7BA 4AX8A 3ZDDA 1FYWA 2PSSA 3IIKA 4MYCA 3AOGA 1XVAA 3TAXA 3H7IA 4CIBA 2J46A 3PKJA 3M4XA 2RAVA 1C2YA 1YZVA 4FC6A 1VFPA 1ZJYA 3IDAA 3BKWA 3GRVA 4RZSA 1IJFA 4FEGA 3FYUA 3EH1A 1QRSA 3BEOA 3A9UA 5G4KA 5C52B 3VI4B 5A6VA 2YW9A 3JYOA 5EI5A 2FWRA 4QDJA 2FFAA 4X6YA 1WXQA 3TQFA 4D82A 4P1ZA 3FZGA 5IH7A 5JH7A 4DIKA 1GAQA 3K5HA 5BV7A 1E1YA 1DMRA 1OX4B 3IP8A 3ND9A 2ZEJA 3AHHA 5BWNA 5AHWA 2I7VA 3I04A 4WGFA 3TLEA 4JVNA 3KQLA 1OIVA 1HOTA 2YW2A 3HR7A 1MRZA 5K0ZA 2ZRLA 3SAJA 1V7PC 1NYTA 1JNXX 3H5LA 2VWHA 4AN0A 5HUHA 1WULS 3CX8A 2VZEA 3M5PA 5ADWA 1AGRA 4DDUA 3KSZO 3R7BA 4JXJA 1A69A 4LZZA 2F67A 5DDIP 4W8GA 1LJ8A 2FSSA 3JSXA 1SPBS 3TN7A 3PGJA 5BY2A 3GJSA 2WOOA 2M6SA 2N9UA 4Q1AA 5LLTA 4X71A 4YCAA 2IUEA 1EP9A 3VPSA 3ZNPA 3OFNA 5BSVA 4Y2QA 5BN4A 2O7VA 1DV1A 1CB7A 3BSFA 4A2PA 2OBFA 3KUXA 2I66A 4PAWA 2R8RA 2EF0A 2MSKA 2IYOA 3LBAA 4CQNA 4Q9LA 3K1YA 3QEJA 3CLSC 3KWJA 3L1IA 4U5XA 5H80A 4E1BA 7MDHA 1WB4A 1EM8B 1H2RS 3KTAB 5IUNC 3FI0A 4R31A 2AR7A 3DUFB 2P6UA 4UAVA 3NZEA 2JI9A 4JLUA 1NF3A 3CX4A 3NB0A 3OWOA 3DMFA 1MJ5A 4P5PA 4EO7A 5K3FB 1F8FA 1BXKA 2NLOA 2R1TA 2YZMA 4IZOA 5E6SA 3V00A 4ND8B 2GM3A 3ZKWB 2R00C 1E5VA 3QU9A 4WZAA 1UKCA 1WAMA 2GXQA 2GZ2A 3HUEA 4GOMD 2L0XA 1I2CA 4NDNE 4FDMA 1LRLA 2L18A 3GJ3A 3TRJA 4TMKA 4CLXA 1CU1A 4HAXA 2C2BA 5CD1A 2FN3A 2IW1A 3L0SA 3RS2A 1VGRA 1GFIA 1U9YA 2D1RA 2IYNA 2FR8C 2Q2QA 3SY8A 3G17A 3GT7A 1U8YA 4MS4B 4TTVA 1O97D 1RPNA 4BO2A 3IP5A 1RJEA 2FLWA 2R85A 2ZAOA 3OJCA 4V38A 5FOXA 4DADA 4F2GA 3LKZA 1E60A 1XWFA 1A9YA 3L7KA 4FQ7A 3HNPA 2GM9A 1YRHA 1OA0A 4UASA 2ZUEA 5BQXA 4IYRA 2J5KA 2WD7B 2PUGA 3WTCA 1V6AA 2F43B 1IXYA 2W93A 3HCWA 3PFFA 3ZJVA 2QDXA 1Y5MA 3AJAA 3ELUA 1E1RD 3E3LA 3OF3A 4RKEA 1LC3A 5IT9A 1GCUA 4YJHB 1N8TA 4FUTA 3ESRA 4LY9A 1JR4A 3SDBA 3VKVA 1UWVA 5BWCA 1RCFA 1YTUA 4UVGA 1IWBB 1GGEA 2BP7A 2CLMB 4MUFA 5JZSA 3NBZC 5IRCD 1VYTA 2HK8A 3I4CA 3GJ0A 1HYEA 2F9FA 4RZ3A 4BVJA 2OBYA 2DT5A 2JJQA 2WTNA 3IAUA 5DX1A 3IUSA 3PI7A 4XTCS 3O2JA 4E2ZA 3FCSB 1QS0B 4ROSA 5D5PA 2R8BA 4JC0A 1HR0B 3PTAA 4Q3KA 3RUHA 2D0DA 1Y3HA 3HJBA 4L0QA 4PLZA 4KHZA 4RIHA 2OKCA 3AQIA 1Q0ZA 4JB8A 4CFZA 1QZTA 4Q9NA 2HUNA 4LXIA 1RM0A 1Y1TA 3N86A 5TV2A 4RK1A 3U4CA 4GR5A 5DYYA 1RYYA 4BO8A 1UL1X 2RI6A 2V6MA 2X7HA 3SQWA 3FWZA 2GD0A 3DYIA 4I1VA 4UBKA 1F48A 3ABQB 4XJXA 4C05A 3IIJA 1GA4A 2PY6A 1E6KA 3EQZA 2NO1A 3GGDA 1TT5B 4LRUA 4ZQEA 1I30A 3MPUA 4X3OA 4YV1A 2V7XA 3SFVA 4Y0AA 2JD1A 4N4AA 4BWFB 3QTTA 1JQJC 3H2ZA 4R2JA 3ZWDA 1A9RA 4QYTA 3DO8A 4KQJA 5AVVA 3PLRA 2NN3C 3HA7A 1TJ5A 1LZLA 5CLJA 3I01A 4KYVA 3A7DA 2FPOA 2P2NA 4YXWD 5MFZA 2IPXA 4I5EA 2R87A 5ANRB 5B1SA 4RM3A 4K9NA 1FYDA 2WQZA 2O2JA 1Q7TA 4QQFA 1H3NA 3VNVA 3C97A 5DCWA 1XCJA 1DG1G 1YFKA 4Q3BA 1PL8A 5I4BA 2QM7A 3ZLVA 2HIGA 4FWTA 1KP9A 3ETJA 4CODB 3DFFA 3LP5A 1AXRA 3IXQA 4MO2A 2WD7A 3NHUA 1IWPB 3QTBA 4TL6A 5A4KA 3ZGZA 3O84A 4ZDIA 1EP2B 1TA9A 2AKYA 4ERNA 4O2AF 1E6WA 2VK2A 1JDJA 4OKIA 4YJHA 2QUKA 3P32A 2WUGA 5EWMB 4UBMA 3NT4A 4OGGA 1PR3A 3FHTA 3VR6D 7ADHA 1AKYA 1LI7A 5LQCA 1LB1B 2HUPA 2NTVA 2WYUA 1PT5A 1U7WA 3GROA 3H5VA 1IG0A 3UIEA 4OYLA 1GGHA 3E5MA 5A2GA 4RGVA 4HQ0A 1DBWA 5FWXA 4LCEA 4KLZA 1JHQA 3JQ8A 5CA0A 3PQ8A 4LGYA 4RZHA 1H8EA 4O4JF 1A8QA 4MUGA 2CKDA 2HBYA 3QBEA 2EJVA 1RKUA 5KYXB 4OY3A 4IIJB 5SV2A 1DAPA 4RVGA 3ERCA 1DOAA 4O2AA 5BWLA 5FH9A 2XNCA 4DW8A 1JR3E 1PW7A 1JA1A 2ZIFA 4YRPA 4RD1A 1J8YF 2PU5A 1HETA 2IU4A 1P0QA 4MR7B 2VSXA 3N70A 3AF2A 4Y6LA 4I1SA 3ZD6A 1ZKDA 4MQBA 4BEVA 4EEKA 4BQSA 1DTWB 5HPYB 1UZLA 3TX2A 1D2NA 3UW1A 3RAJA 3ZBTA 1NYQA 1J9GA 3CVUA 4Z51A 4QPJC 2LXNA 3KZVA 2QN6A 5LYYA 5G41A 4LBYA 3EVCA 3V4SA 3WBJA 2GM4A 3H0KA 3HZZA 3MGGA 3FNQA 4F97A 3PWKA 2J85A 4BQIA 1G2QA 1B8PA 1H94A 4Y9RA 5BRAA 3BWEA 3LUDA 4ZEMA 5KTOA 4WNYA 3L7CA 3VNSA 1POXA 3PK0A 2OECA 3GH1A