4LS2A

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with dh03a313
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
364
structure length
364
Chain Sequence
b'GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with DH03A313
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 141
structure length 364
sequence length 364
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2013-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ls2A00
3MHGA 1Q6LA 4ADTA 1D9EA 5LNVA 3IGUA 1JQXA 2HS6A 3NL6A 1P1XA 3BPWA 1YPIA 3SSJA 4MYXA 3B03A 3IEBA 4NXKA 3UXDA 1A5SA 2CZ5A 2RKXA 1YTEA 1QOQA 3O15A 1YTDA 5KINA 3M5ZA 1TTJA 3HGJA 3QYQA 1FCBA 1I45A 4UTIA 4RKAA 5TIMA 2YSWA 4KFPA 4S2BA 1VZWA 3HG3A 3E0IA 3W2MA 4ZZ9A 3EX2A 3CPRA 3IV3A 1JRCA 2PC4A 3M43A 4HSOA 3NPVA 4N2YA 4YLWA 1S3HA 4GUGA 4DF0A 1QPQA 3NQ6A 3MYOA 3BW4A 3G1SA 3LHZA 3S6DA 1Q6QA 4FX7A 4AXKA 1G4EA 3LERA 4QNWA 1TJPA 1SZFA 4UTHA 5FESA 3LHYA 1L2UA 3BG5A 3G0XA 3EX4A 4A3UA 2NX1A 1RQBA 3MWAA 4DO6A 5CKSA 3C2OA 3JS3A 3TW6A 2ZFAA 1EP3A 2YX0A 4K7VA 3W7CA 5GVJA 3HOJA 3DBPA 1C8VA 1IXNA 4OV9A 4WUIA 4Z1BA 4JTGA 3MP4A 3T78A 1KFKA 2ZA2A 4LVBA 3TXVA 3LHWA 1LOLA 1J4EA 1GOXA 1I2NA 4LU0A 5HUPA 3S1XA 4QISA 2OT0A 3MYPA 3DENA 2A4AA 2JKEA 2QJHA 4MYAA 3NZRA 3VKJA 2OT1A 4UFMA 3RNDA 3LM7A 3NPXA 4M19A 3A22A 4QIUA 3NA8A 1R47A 4UFLA 4QSHA 4MZ1A 3CQ0A 3MI3A 4GNJA 4JX4A 4LC8A 3G1YA 2Z6IA 1DOSA 1YDVA 3NVTA 1RPXA 4QJ1A 5AYXA 1DL3A 3N9RA 4AVFA 4AH7A 3O1NA 1LRQA 2ABAA 2B4GA 1MO0A 1OVDA 1RD5A 1MSSA 4S2CA 3P67A 3GKAA 1OK4A 2R91A 1L6SA 2ZCGA 2O7SA 2VEIA 3C2FA 3ABRA 4EVZA 1TB3A 2NUWA 5IM51 5A8GA 3E12A 4RZ6A 4CQ9A 3O6CA 1B9BA 1HO1A 3STEA 3UWUA 5ABTA 5G2IA 3TK7A 5U7SA 2CLKA 3MW7A 4CNNA 4RZ5A 4NZFA 1CI1A 3PSVA 5HR7A 2H8XA 3GYEA 4LRTA 4UCGA 2XFWA 3UWQA 1WOBA 3BVJA 4GE8A 1XFBA 3L68A 1J2WA 3MHFA 5CZ0A 3W07A 5D05A 5BRBA 2CW6A 2ZZ1A 3GDRA 3ZWTA 4G1KA 1TIMA 2YFOA 1LCOA 2E6YA 2BZNA 1EUNA 1TPFA 3W1NA 3BG9A 2GQ8A 2A6NA 3NNTA 4UTWC 3CIWA 3W1MA 4MFEA 2YFNA 3EWWA 2VOMA 1H1ZA 1VJIA 3MP3A 3KRUA 2ZTKA 3LBMA 1B4KA 2Y89A 2F84A 2VELA 3B0VC 2WPBA 3NQAA 3YPIA 3W83A 1G4SA 5I3IA 4NXSA 1UBSA 3O16A 3S1WA 2JBMA 1QCWA 4MFDA 3KAOA 3S0CA 1ZFJA 4NQ1A 1H60A 2DZPA 4OHQA 3W7LA 4RK8A 2YR1A 3GXTA 4KFNA 4JEQA 2KZHA 3S9YA 2YGYA 1NEYA 3HB9A 1SO5A 1MEWA 2FDSA 1KBIA 5DLCA 3NXFA 2FPTA 1TRIA 5AHIA 3HBLA 5CGQA 1SZNA 4N6FA 2NX9A 2Y7GA 1LM1A 3PWAA 5D30A 4BI7A 4WOZA 3EXTA 2H6RA 1ZHAA 1KV8A 3OBKA 3GKFA 4UC5A 3UY8A 2C3ZA 2GPTA 4K7YA 2GQAA 5H91A 1SSDA 4ICNA 2YYUA 3LHVA 3LRKA 2ALDA 4CQ8A 1S5VA 4MLJA 2CLIA 2ATMA 5CZJA 4WXZA 2PURA 1GWJA 5F1UA 4AHPA 1KM3A 1BWKA 3LDVA 5FF7A 3GXPA 2WNZA 3W7OA 3CC1A 5C5YA 4O4VA 3RK8A 1P4CA 3PSWA 2C13A 2AAMA 3MJYA 3THAA 4ORIA 2HSAA 4NVTA 1SO6A 2VEKA 3LXAA 4U28A 3B4UA 3CLMA 4DF2A 4HIBA 4Y9AA 2ZZ3A 3TMLA 4O12A 1JCYA 1LRTA 1SPQA 4YMZA 4Y8FA 5D02A 5I3KA 4LNYA 2DZXA 5J5RA 3S8HA 2ABBA 2R94A 4O4WA 3E96A 3BLEA 1EB3A 3TROA 2FTPA 1QO5A 2DP3A 3LV6A 5EA9A 2TPSA 4Z1CA 5C54A 2ZRZA 5DY3A 3GNDA 4E0CA 4S1FA 5LHFA 4IUOA 2Q8ZA 5FEXA 3SI9A 3NL2A 5C6MA 1D3HA 1TSIA 1TQJA 1NF0A 2I9EA 4XUGA 3NDOA 4PTNA 4UNLA 3R12A 2E6AA 3PB0A 3EWBX 3QPZA 1OX5A 2VEPA 3NQEA 1ME7A 1KM0A 1BEUA 5I3JA 2CLMA 3P8JA 4GXMA 2NUYA 3NQ8A 3TW7A 4UTTC 1Q6RA 1XI3A 2OJPA 4BI6A 1PVNA 4EWND 5LSMA 1CW2A 1XBVA 3M1ZA 5KITA 5D38A 1W8SA 4RJEA 3IIOA 1WOAA 4LT9A 2VXNA 1FXPA 4AWTA 5LNSA 3JR2A 2C14A 4K6AA 1LOQA 2HTMA 2FFCA 2Y70A 1YTKA 4IMFA 4UMAA 4MY8A 1PL9A 1K8YA 1GG1A 4JTHA 2NWRA 4NT0A 1GZGA 2C16A 4UFKA 3N2XA 1I4NA 2FB3A 1A53A 3G24A 4OGZA 1D3GA 3KHJA 3W2JA 2YW3A 1SSGA 1C9DA 4I7WA 4N9CA 3GDKA 4YWIA 5F2GA 4LVGA 3AO0A 2CLEA 3LBCA 3N14A 4X9SA 5FEZA 4IXHA 2WKJA 3GK0A 3DI1A 3GZ3A 3P8IA 4Y96A 4QNEA 3O63A 2VFFA 4A22A 4O11A 3KVMA 1EEPA 3GR7A 5LZLA 1TPB1 1H7WA 3TSBA 3W1AA 3C2EA 3L0KA 3TAKA 4PA8A 4LWWA 3FFSA 3TIMA 4XTIA 4LVDA 3UWYA 1DORA 1AG1O 3M9YA 3BG3A 4UFIA 2ZRXA 3DHDA 3N19B 4LS0A 3L9CA 3I65A 4K8HA 1H63A 4A2SA 1KFCA 1RQEA 3BV4A 1OF8A 2OZ0A 4KFOA 3W74A 1R2RA 4B5NA 1VH7A 3B0PA 4ORMA 3N9SA 3LLDA 3LHTA 2XN1A 4UTLA 4ALDA 4IWWA 3CEUA 2Y88A 3QQ1A 3TQKA 1ICSA 1YXCA 2WSRA 5BOOA 1W54A 1ICPA 2NX3A 3JRKA 3DZ1A 2Y7EA 1KTNA 2DORA 4FO4A 1A5CA 5FF4A 3QMTA 4FIQA 1C29A 5HWNA 1DQXA 1LRNA 2QCMA 2V2HA 3QH2A 3A9IA 5LKYA 5FEWA 2Z6JA 2C1HA 3W76A 5BNKA 4GUHA 1GVFA 1JUBA 1N8FA 3KX6A 3NL3A 3PBUA 1HG3A 3QJAA 1HL2A 3SR7A 4TIMA 5G1TA 1LBFA 2EF9A 2ZTJA 3C52A 3NM1A 1GEQA 4O17A 4JTJA 5D2VA 3CM4A 1W5OA 4PFMA 2DZTA 3M16A 4XWUA 4BR1A 1DHPA 1LBMA 5HMSA 2WSYA 4JTUA 5U4NA 1P5BA 1NVMA 3VFLA 1LTDA 4IPJA 1O4UA 3W1LA 1M7OA 1YPFA 2GUUA 3CTLA 2PRLA 4BWLC 1JRBA 3LX9A 4JR5A 3HGRA 3NOEA 3ANYA 1WXJA 3R2GA 2YCEA 5EL1A 4O0ZA 1TV7A 1XUZA 2VEMA 2QCCA 4EIVA 1SZEA 4IX2A 2W6RA 1B57A 2RDUA 3PS7A 2HS8A 1K03A 1GVSA 1SU5A 2CLOA 1WA3A 2FQIA 3B04A 3CT7A 2QUVA 4FNRA 1ZY9A 3NPUA 2X1UA 3EWUA 1KFJA 3ABQA 1EWDA 1ONRA 4O52A 2DU2A 4XKYB 4LRSA 1AL8A 1ZAJA 1KM1A 3HIJA 3W7DA 1ME8A 3QFEA 4JICA 4QAIA 2QKFA 3WJXA 3C61A 3L0NA 1KTBA 1GVOA 3R8RA 4FXRA 5FEPA 4FX6M 3SGZA 5DN1A 3L0GA 3W75A 3LCFA 5AFDA 4TMCA 2E09A 1EX5A 2YPIA 3G1DA 2Y62A 2QAFA 3HF3A 2NV1A 2AGKA 4JTIA 1YADA 5D2WA 3S5ZA 2PRMA 5HNRA 4Z1DA 1VYRA 3EB2A 3DFQA 3R89A 3A24A 1KV5A 2Z1BA 4JTFA 5AOUA 1OYCA 2BX7A 2WO5A 1Z44A 3PC0A 3HO8A 2VENA 4Y6GA 2A6LA 4K36A 4MVAA 3M41A 5LNRA 3KFTA 4MLRA 1ZAHA 1IIGA 5DCDA 3MUXA 2I14A 2X16A 3CWOX 3A5FA 5AYYA 1LROA 3STFA 3T40A 3TXZA 3GDMA 2CFFA 1LP6A 2J27A 2ZDRA 1OFOA 1WX0A 3C2RA 3P62A 3EX3A 1QPRA 1RZMA 3LOTA 4GRSA 5G1YA 1XBXA 1H7NA 4O0KA 4WZHA 1IF2A 5HULA 1JCMP 3RLVA 3G3DA 4WXYA 3UY7A 2G97A 1SO3A 3KOFA 2QUTA 3PM6A 3EXSA 4HNNA 4R33A 5K2ZA 1OFAA 2A7RA 3M6YA 4FXSA 4JD4A 3W1XA 4HNTA 3VE9A 4NJJA 3C8FA 1IIHA 3T44A 3UPWA 2G95A 5D2TA 3WJSA 4DF1A 5LGZA 3TJXA 1QMLA 1R2TA 5C2XA 2ZRYA 4P2VA 2E6DA 1H62A 4W9TA 2WOQA 3WJWA 4XQ6A 3SIZA 2PRHA 1OJXA 5AHMA 2W79A 2WNQA 2VC6A 1XC4A 1X1ZA 4AB4A 1OX4B 1TPWA 3OHIA 3OG3A 3TNOA 1M5WA 1OYBA 1FY6A 3FJ6A 3L65A 3WK1A 3HGOA 4M6QA 2BSLA 4O14A 5CG7A 4I7UA 4X22A 5HWMA 3TFCA 1KFLA 2OX1A 2JKPA 3N73A 1BTMA 4MKNA 4R53A 4GC4A 5D2YA 2J9YA 1SO4A 2J88A 3DGRA 5DELA 1TJRA 3TE9A 1OX6A 3CEPA 2ZBTA 4NX0A 1EP1A 3E9AA 3BLFA 5CPOA 2OCZA 3LTPA 5CSSA 4DPQA 1P0KA 5CPMA 1VLIA 5AN7A 3PAJA 4XTDA 5EPDA 3WK2A 3HMJG 1QDSA 5AC7A 3G0SA 1Y0EA 1G67A 3W7PA 2FPYA 5F1VA 4O57A 5DBTA 1U83A 4JTSA 3W84A 4GFSA 2QCNA 5D03A 3TDFA 1L6WA 1UASA 3NQFA 4FNQA 4IGHA 3SGUA 3AJXA 3CHVA 4AHOA 4YCOA 2X30A 2P10A 2Q8LA 1W3TA 1XCFA 3PG8A 4IQLA 1X7FA 4FNUA 1KLZA 4BF9A 3F4WA 2QJIA 1EIXA 1KFBA 3UWWA 3HJZA 1QFEA 3O05A 2VFDA 4C1LA 1QR7A 3NQCA 5FF2A 4OT7A 3HPZA 2B7QA 3GDLA 3VCRA 3UQNA 2V81A 1JCNA 2XN2A 1W5MA 4NUWA 3GX9A 2CLLA 1SW3A 5AHLA 1IXQA 1WYIA 3W23A 3W7HA 5C55A 3A21A 3LGEA 1XM3A 4JDYA 4RCXA 1FWNA 5KZDA 2QCDA 3LXBA 3LI0A 3W87A 2PE4A 1QWGA 1XUUA 4MIMA 5CZTA 2JGQA 4UMCA 4Q33A 5BMWA 1YDNA 5EY5A 4NX5A 3QM3A 4DO4A 3FKKA 1VRDA 1OK6A 2Y7FA 5K4XA 3QEZA 4DBDA 3RU6A 4R7JA 4LS2A 3PR2A 4NNCA 3F4NA 2C15A 1IGSA 5E0KA 3M5XA 5F2MA 3FJLA 4NZJA 1FX6A 3C56A 4UTWA 1W31A 1A5BA 3DH7A 2ZZ4A 4LV9A 2YXGA 2VFGA 3L2IA 2QJGA 2A7PA 4DPPA 3TAOA 4C1KA 2GJLA 2EAWA 3M47A 2ATSA 2B7PA 4JGDA 3TQVA 2GVJA 3IIZA 3H53A 3TFXA 3NYZA 1RR2A 1JR1A 5I3HA 3MI6A 3LI1A 4YXGA 2JK2A 3A23A 3EWXA 1JQVA 3G8EA 4WY0B 2DZVA 4CQAA 1YXYA 1HFBA 2FPVA 2H8ZA 3ABSA 5K9XA 1OFRA 2G96A 3BO9A 2NXHA 1SFLA 8TIMA 4MJMA 1ZCOA 1MEIA 1L9WA 2QCLA 4JTKA 3NZ1A 3QPYA 4K38A 1F5ZA 1I2RA 3QMSA 3F03K 4LTSA 4DO5A 4O10A 1UUOA 4KKXA 4E38A 1K8XA 4UTJA 1J5TA 3W1UA 4O1BA 1G6CA 2Y6ZA 4MJZA 1H50A 2C18A 1GVRA 2DZSA 4HKPA 2EPHA 1W1ZA 2NXIA 3D0CA 3GXNA 4LVAA 3S1UA 4ZMGA 4TMBA 4UTUA 3W2NA 2RFGA 1KM5A 3DXIA 4QITA 1JCLA 5H2ZA 3GAKA 3KVKA 4HPXA 1K7EA 1XXXA 1XDMA 3GLCA 3HG5A 4AF0B 1O5XA 3W6YA 3B05A 3I68A 3W7JA 4IPIA 3HGSA 3W88A 3W2KA 1NSJA 2J9ZA 3BW2A 3M5VA 4P61A 1F6PA 3BLIA 1FWSA 1VCFA 4OWGA 2A5HA 4M6PA 3C0JA 1SZGA 4HN4A 2TSYA 4M6VA 1VCGA 2V5LA 3UPBA 5G2WA 4CNOA 4I9AA 5J5DA 2DZUA 3EWYA 1XL9A 3NM3A 4PC8A 1VPXA 3DU0A 1FCQA 2VFIA 5K9DA 3W86A 1TRDA 3UD6A 2QF7A 1VHNA 2TMDA 3P7YA 5K4ZA 3C2VA 1FWWA 4MZ8A 1VQTA 3MHUA 3U2OA 5AHNA 1ME9A 5IBXC 3UZJA 3DAQA 2ISSA 1RVGA 1ZJIA 3UXAA 1LDCA 3GNNA 2RHGA 4GUFA 3SZ8A 4TX9A 3MP5A 3INPA 5LNWA 1W56A 4KWVA 2H3DA 1TTQA 4K37A 5EYWA 1PS9A 3PUDA 4Z1AA 1FDJA 1K02A 4RX0A 5KZEA 3QRHA 4IMGA 3IVUA 2VFHA 1TCDA 4HHPA 4LW7A 1FWRA 3CB8A 1G7VA 4H4IA 4AMAA 2CLHA 2B0MA 3C4UA 4ZL1A 2CLFA 2G5WA 4LUJA 1LORA 3NQDA 2BWGA 4JY9A 4UTTA 3THQA 1AW1A 4Q32A 4FB7A 1L6YA 1TPVA 1HO4A 3HG2A 3GIYA 4Z0JA 1EA0A 4XKYA 1Z48A 5IBXA 2QCEA 3QW3A 1TPDA 1Q6OA 4M5PA 2ZZ6A 5MHBA 4IX0A 4NNBA 2F7FA 3O6DA 3PBVA 3O8AA 1DVJA 3EXRA 1OF6A 3HPSA 1M6JA 1BWLA 1EUAA 1WAUA 3NQMA 1VLWA 5AC6A 3LRMA 4JDBA 1LBLA 1KA9F 4CCEA 1TMHA 3TCEA 4HSNA 1R30A 1LZOA 2R8WA 4LV4A 3G1VA 1MXSA 1V5XA 5D32A 4RLIA 1AMKA 1AK5A 2H90A 3LTSA 1VR6A 3QMRA 1GYLA 1VC4A 3MO7A 3LCXA 3W7EA 2FLIA 4O8RA 1ICQA 1DQWA 3F1QA 3PBYA 2CWNA 1N7KA 3T7VA 5L9FA 2Y61A 4NJKA 5DBUA 2JGYA 1MEHA 4JNMA 4O13A 2DJXA 2Q3OA 4LS1A 5F2IA 5G2HA 3S5NA 4N4QA 3S5OA 4WOQA 1W0MA 1KLYA 4IMDA 2X2GA 4NJIA 3W22A 4HPJA 2PCQA 1WBJA 4ZQCA 2NXGA 4KWWA 4MY9A 1F6KA 4LY8A 1KM4A 2GOUA 1T96A 5CPLA 3LLFA 3IIVA 1JUEA 1Z42A 4Q4KA 4K39A 3NO5A 1SR9A 3HPXA 4UFHA 3QQ0A 1T0OA 3S42A 4WY0F 1O60A 4RR4A 3L66A 3O07A 3PG9A 3ABOA 3IIPA 4UTKA 3WJZA 3BGGA 5DY2A 3W7NA 2C0AA 2YYTA 3DFPA 3TC6A 4E2BA 4N9DA 3DFTA 2TYSA 3L5MA 1DV7A 3I7RA 1G7UA 3DKJA 3OVPA 2RH9A 3P5ZA 3STGA 4LVFA 4BI5A 4FX8A 5A5WA 4JYDA 4BWLA 4Z08A 4MPQA 5F4XA 3P60A 2YDAA 3P5YA 2GVLA 3W1QA 2CU0A 4IJBA 2E5DA 4O53A 3TMQA 1ZNNA 1SW0A 4AAJA 3H54A 3ZWSA 2Y63A 3M7WA 3SW6A 3MBDA 3I7QA 3VI2A 5HQEA 3TSDA 2ZRVA 1G69A 3WK0A 3FYOA 4ADSA 4ZQRA 2OMAA 2X1RA 3OIXA 1WDWA 1N55A 3P61A 1VYSX 1OFDA 1TPC1 2DZWA 1XKYA 3IGSA 3UNDA 1YDOA 3CIXA 4NU7A 1H7PA 4RZ4A 3IIXA 5F4WA 4JYFA 4CCDA 5KTLA 5SWUA 4CNPA 4L4LA 4PODA 5I3FA 3G8RA 1H7XA 1GPWA 4JN6A 5LGXA 2GJNA 4UR7A 1I2OA 1A50A 4EF9A 4UR8A 1TPUA 1Q45A 4RXGA 3W3OA 4OV4A 1SW7A 3K30A 4WX2A 1F73A 4MUZA 1FDZA 1SFJA 2ZQ0A 1QAPA 5HJLA 1XDLA 3NQ7A 1F74A 2XN0A 3IGXA 1GTHA 5D37A 3GAYA 1W5NA 3LXCA 3W1PA 5EMUA 2DJLA 2B7NA 1PCWA 2A0NA 4IMCA 4NNAA 3W85A 1RQHA 4H3DA 3OEXA 1GVQA 4HT3A 3NQ2A 2LLEA 1FCVA 1JVNA 3BARA 4ZQPA 4IOTA 3LB0A 3L67A 3PY2A 5EBUA 1KBJA 2A21A 1G4PA 3FA5A 1SQ7A 1OYAA 1F05A 5KZMA 3Q94A 5DCEA 4A29A 1B3OA 2ZYFA 3O6YX 2V0TA 3MMTA 3G22A 1FXQA 2TRSA 1GYNA 3BK0A 3FEMA 3EX6A 5D33A 1TQXA 2FIQA 3PUOA 1WBHA 3W71A 1W3IA 3WJYA 3UWZA 1M7PA 1W3NA 3H55A 3TX9A 3W7KA 3BGJA 4JYEA 1VHCA 3W1TA 3W9ZA 1LYXA 3I6RA 4UIOA 4TO8A 2QAPA 2VFEA 3LV5A 3NGJA 1R46A 2ZZ2A 4WY0A 1FQ0A 3OVRA 1HTIA 1T99A 2R14A 3E02A 1NFBA 2NWSA 1TV8A 1UB3A 1TREA 3E49A 1FDYA 3B8DA 4JS3A 5D09A 1QOPA 1YXDA 1GT8A 4X3ZA 3TU9A 2NUXA 5G5IA 4RXFA 1JUKA 1JULA 3G1FA 3GB6A 1TTPA 3KXQA 4XBKA 3Q58A 3N3MA 4GJ1A 1FWTA 2P0OA 4JTEA 3NEVA 2WSQA 1TPH1 4JIQA 2I1OA 1T8XA 2Z0IA 1PE1A 2ISVA 2BXVA 2FJKA 1Q3NA 4PL1A 3MBFA 5HWJA 3ZS4A 3C3NA 3V75A 3FOKA 3QZEA 3LCIA 3R13A 4POCA 5BW6A 3N2MA 4AF0A 4FF7A 2QDHA 4AWUA 1OABA 4FNTA 1OHLA 5BMXA 1O95A 5HUOA 1FCUA 1MZHA 4ONVA 1WQ5A 1YLVA 4DEFA 4UMBA 5T26A 4MOZA 3TJLA 1GG0A 3IVTA 1ZENA 1XBYA 2UV8G 4IXXA 2ZRUA 6ALDA 2BTMA 3NQGA 4GUJA 1TV5A 2NV2A 2P1FA 2ISWA 4JX5A 2Y7DA 3LCWA 2D73A 3Q2DA 3VE7A 2WV8A 5K9CA 4O1AA 4OU1A 3PF3A 3SFKA 3EEGA 4DBEA 3M5YA 3GR8A 1ADOA 1XBZA 1FBAA 4DELA 3MI2A 4TU1A 2EKCA 4O19A 4O54A 4AWSA 1AL7A 1KW1A 3ELFA 1U5JA 5K7JA 3PBWA 3TKFA 3U6WA 4O1DA 1A5AA 3HG4A 2V9DA 2GVGA 5E93A 4CCCA 4U4MA 1H61A 2GQ9A 3BW3A 4X2RA 2QR6A 1QO2A 1VYPX 4OE7A 4MY1A 2C6QA 3W72A 1LLWA 2WQPA 1RV8A 2QCFA 2E5CA 3KVLA 1VS1A 3I7SA 2RDWA 5AC8A 1JJKA 1G4TA 3G0UA 1DKWA 4N6EA 1OFEA 4PCFA 2J6XA 5AYZA 3G1XA 5F2LA 1K7FA 1W5QA 1OG0A 3SJ3A 3LCLA 2X1SA 4N4PA 2NLIA 3QC3A 1UUMA 3G18A 4PH6A 3PULA 5G4EA 3N34A 1OFBA 2BLEA 1VCVA 2QCHA 4O1CA 1YYAA 3FIGA 3W7MA 5I3GA 2B7OA 1V7YA 2EHHA 1TPEA 4JXCA 3Q37A 4UUIA 2V2DA 4CLMA 3P81A 3NAVA 1VGAA 4PL2A 3W7GA 2X1TA 1F7BA 3FS2A 1W5PA 4LUIA 3RMJA 2W0UA 2WJZA 5AHFA 1EWEA 2QEZA 3EWZA 4LC6A 4O28A 1O5KA 2E68A 5F4SA 1E51A 5AHEA 3B0UX 4QM1A 1I8JA 5AB3A 4N9BA 3M0ZA 1ZAIA 1I2QA 4I7VA 4JTLA 1BKSA 4WD0A 3P84A 5FI8A 3TC7A 3WFAA 1X8FA 2CZDA 3DFSA 1P0NA 3S1VA 4UTMA 3LCHA 4A2RA 3TR2A 1GJPA 4DXVA 1QPNA 3G1AA 2QCDB 5CZSA 3LTYA 5KMYA 2AQWA 1X6UA 1H7RA 2HMCA 3NL5A 3ATZA 3R5EA 3GDTA 4JTTA 3VNDA 3U8GA 4ML9A 1IXPA 4YL2A 3TV8A 5K3VA 3W7QA 4GBUA 3W1RA 4JY8A 1GTEA 3W7IA 3KRSA 5TBOA 3QW4B 3UWVA 4ZQMA 4XBSA 3G1HA 4NJHA 1R2SA 1ML1A 3QSTA 2RDTA 1H51A 4Y90A 1UCWA 5E1QA 5L6UA 3USBA 4MZYA 3EKLA 2QCGA 1PV8A 3DHFA 3KRZA 2H3BA 1B4EA 2Q3RA 4YCPA 4XZ9A 1FUYA 3OA3A 4DQWA 1Z41A 1THFD 3TQ0A 3QF0A 3L5AA 1QNVA 1PHWA 3OVQA 4QQ3A 4A21A 4D2JA 1JCXA 2JKAA 2QDGA 5EKYA 3A5VA 4FIRA 3W73A 3FKRA 1W37A 1DBTA 3W7RA 4TR9A 4FEZA 1EPXA 4R34A 2E6FA 4WJEA 1DJQA 3CWNA 1F2JA 3M44A 5LHEA 4H6KA 4HNUA 2V2CA 3IVSA 4FNSA 3NPWA 3UYCA 4BK9A 2A7NA 4ADUA 1PHQA 4O16A 1OFQA 4M7SA 1OFPA 2E77A 3G3MA 2CZFA 5DXYA 3FYPA 4J9JA 4N9EA 1WV2A 4K8EA 4IMEA 3HQ1A 4OBTA 1CX9A 4NJGA 1DJNA 3DFOA 2WNNA 1UJPA 2ZA3A 4O50A 3IRDA 3P82A 3ZR4A 3TUUA 3T55A 1I2PA 3W70A 2YW4A 3SY5A 4UNKA 5TQLA 3WK3A 3O06A 3RFAA 5KSWA 4EOUA 4Z0SA 3B06A 3TA6A 1S5WA 2V8ZA 4O15A 6TIMA 1TTIA 3TSMA 1JCJA 1O94A 3TH6A 4RV8A 3V1PA 1AW5A 2Z2UA 1K8ZA 3L21A 2ZRWA 3RF9A 2O7QA 1NF7A 3NG3A 2ZZ7A 3L5LA 5D2XA 1KTCA 4JX6A 5G4WA 4ZQOA 3DKLA 4BFAA 3S5YA 1SUXA 1ZALA 1LOSA 3T4CA 3DFNA 3LCGA 1H5YA 3PB2A 1GQNA 2A85A 2EGZA 4N02A 3KVJA 2CZEA 4E2DA 4JIPA 5D04C 1LLZA 3W2LA 5HINA 3P80A 2VKZG 7TIMA 1KM2A 3P74A 2E5BA 3LHUA 3W2UA 2V5BA 5DCBA 1PIIA 1IXOA 1PCKA 2IQTA 5DXXA 3C6CA 3GVGA 1K7XA 4UXDA 4ZVJA 5FF0A 4GWEA 1KM6A 3NQVA 3RLUA 2V82A 3UZ5A 2A1YA 2NZLA 1X1OA 2YZRA 4WQ6A 1TO3A 3NR0A 1EP2A 5LNUA 2C19A 2J24A 4M7TA 1K3UA 4EF8A 1KFEA 5FF3A 1H1YA 2Y85A 1NAL1 1AW2A 2QUUA 2ZA1A 2FB2A 3EKZA 4ZQNA 2J9XA 3EX1A 4PEKA 4O18A 4LOCA 1H7OA 4GUIA 1ALDA 1HUVA 4L4MA 3DI0A 5CPNA 2A2IA 3PVFA 3PUEA 1QPOA 3CU2A 3ZFHA 4AHQA 4FHAA 3LRLA 1OX4A 4UFJA 3ATYA 4FNPA 3STCA 2E1DA 2ZZ5A 2V30A 1F76A 1TYGA 5CSRA 1S5TA 3QSRA 5HR6A 3SECA 4AEOA 4OQVA 3FLUA 4HNVA
chains in the Genus database with same CATH superfamily
4DUXA 1XPGA 3IGUA 4F48A 3IRSA 5CG0A 1UA7A 4Z1YA 1R6WA 3GDBA 1P1XA 3BPWA 4MYXA 4JFSA 1YTEA 4JHOA 2V63A 3VTRA 2CITA 3O15A 2XJ7A 5KINA 2O4MA 5BRQA 1TTJA 3QYQA 2R1PA 3I3EA 1I45A 4RKAA 4HA4A 5TIMA 2PBGA 2YSWA 4S2BA 1IZJA 3HG3A 3VOFA 3E0IA 4R5EA 1ZB5A 2PC4A 3M43A 4GC3A 1FOBA 4HSOA 6REQB 4JPGA 1NP0A 1ZJBA 3A12A 1QPQA 1XFCA 3LHZA 3S6DA 3G1SA 4I6KA 4FX7A 3AXKA 4QNWA 2DT3A 3EAUA 3TQPA 2DIEA 4UTHA 5FESA 3LHYA 3G6MA 3RM4A 3C86A 1H3GA 1UWIA 1RQBA 1XIDA 5A2CA 2PA6A 3TW6A 1TJ0A 2ZFAA 1TMLA 4W84A 4JCLA 2VUYA 1MQRA 3HOJA 3DBPA 2EJ1A 3OW1A 1K9EA 3QLDA 3CQHA 1ODZA 1LQAA 5BRPA 3T6CA 3CH0A 4K1GA 2ZA2A 4PR4A 3NCOA 4GZJA 1UIPA 1EYWA 3U2EA 5HUPA 3DECA 2R82A 3VX0A 1HJXA 1SM9A 2QJHA 1OZQA 1IQ8A 2PB1A 2F38A 5T91A 3NA8A 1R47A 1PB0A 1E4MM 4QSHA 3V0SA 3WD2A 4GNJA 1S1RA 4JX4A 4LC8A 5JVLA 3G1YA 1DOSA 1RPXA 4QJ1A 3SCPA 4AVFA 3AU2A 3O1NA 2ABAA 5T9BG 3KHDA 3SFWA 1MSSA 2AMXA 4S2CA 1SMDA 2Z1WA 2PTZA 3C2FA 4GINA 1A0EA 5IM51 2O56A 1FH8A 1UOZA 2BG5A 2QLYA 1TX0A 3ANVA 5ABTA 4J5NA 3LSBA 3EOEA 4CVWA 3PSVA 3GYEA 4UCGA 2XFWA 4R88A 4QCFA 4YHEA 3BVJA 3S5SA 2GUYA 3BE7A 4GJJA 3L68A 3TWAA 2F6KA 2W61A 4F79A 5CZ0A 3GO2A 1E3XA 4G1KA 3MMUA 1TIMA 2XIMA 1LCOA 3A4WA 2BZNA 1EUNA 3KM8A 3MT1A 2GQ8A 1T41A 1A80A 2P0IA 3K13A 1V51A 3W1MA 2YFNA 4H01A 3VM5A 1YMYA 3MP3A 3TYCA 5FSDC 3KRUA 4IGMA 2J77A 1B4KA 5TD4A 4F3HA 4AX7A 1JD9A 1PKMA 2KX9A 5I7GA 3VXGA 1MXDA 1YNYA 5AC4A 3TYEA 1B3YA 5I3IA 4NXSA 1QCWA 3ZT6A 3E6EA 4H7ZA 4MFDA 3EMZA 3BAWA 5AY7A 4NQ1A 2OWWA 1G9HA 4FF5A 3H2FA 4KFNA 3BMXA 2Q71A 3H2CA 2KZHA 2YGYA 1NEYA 5DANA 1J6PA 1MEWA 3FY1A 5I06A 1B31A 4PCSA 2OOFA 2J7BA 3SN0A 2FPTA 3GBEA 3ZZ1A 1YQ2A 2BS9A 3RUBL 2FHFA 1NDVA 3CZEA 1U22A 3LN3A 5AKQA 3ICJA 4HSHA 1TJ2A 4YTSA 3GKFA 1V3HA 3UY8A 1SSDA 3WMCA 3KRBA 2ALDA 3VD5A 1S5VA 1XRVA 3T05A 3VOCA 2ATMA 4WXZA 3ITLA 3H7UA 1GWJA 3V36A 1BWKA 1E1EA 5FF7A 2QW5A 1FHVA 3GXPA 2B81A 4KW2A 1TFVA 1QI5A 4DZAA 1J0IA 2C13A 4DWSA 3RCMA 4F0MA 2AAMA 1QOXA 3E2QA 5M03A 1VEMA 3THAA 3N4AA 3PP7A 3VKAA 3G1RA 4J28A 4NVTA 3ANUA 3V5OA 3LXAA 3GRIA 4BQ5A 4KGLA 4O12A 4AZ7A 1NWRA 1JCYA 3ITCA 3W01A 4IJCA 3FA4A 7ODCA 4Y8FA 5J5RA 3VNLA 1A47A 1HL8A 1YNPA 4ZO6A 1V0NA 3CIVA 4Z1CA 3UZZA 3ITXA 3OZMA 3GNDA 1VFSA 4PRWA 3TA9A 3SI9A 1WUFA 3NL2A 4GFIA 3M46A 1D3HA 2RGLA 5C6MA 1TSIA 2E7FA 1NF0A 2I9EA 3QPZA 3EPOA 4EPDC 3NQEA 1OG6A 4S3FA 4B5TA 4GX9A 2G0WA 2ZX5A 3NQ8A 1H5VA 4UTTC 1Q6RA 3M0IA 3KP0A 3PWGA 2OO6A 4UQBA 1XBVA 1XLGA 3KL3A 3IIOA 4LT9A 3AOFA 1FXPA 1W1VA 4L7ZA 1FKWA 3JR2A 1F3TA 1LOQA 2GYIA 3B8WA 4BY3A 2BMBA 1PL9A 1K8YA 1EJRC 2NWRA 3NO1A 2C16A 4UFKA 1I4NA 4KERA 1E72M 1XYAA 2P53A 1WDQA 2HE5A 1C9DA 2WSKA 3VCCA 1WZKA 3GDKA 4YWIA 5BXRA 5LA0A 3AO0A 4DZIA 3BAYA 3N14A 2BOEX 3OP2A 5FEZA 3GZ3A 3TTEA 4MADA 1CB7B 4CKQA 1E71M 3KVMA 1CT5A 3GR7A 4TV6A 5EMJA 5LZLA 1JF5A 1TPB1 3PTQA 3TSBA 4XBJA 3C2EA 3TAKA 2VR2A 4LWWA 3ZVHA 3UWYA 3M9YA 1IWBA 3SIMA 2VX5A 2XWDA 3S2NA 4N7QA 3QYSA 1FWAC 4KFOA 1QJWA 1EDGA 4PTXA 3MS8A 4YNGA 1VH7A 3B0PA 4A4AA 2J7CA 3LLDA 1IEWA 1FWFC 2XN1A 3ZT5A 2ICSA 5CBJA 4AFYA 4MG4A 1F07A 3FN9A 3QQ1A 1UR9A 2WSRA 1W54A 1ICPA 3JRKA 4Q22A 4JTQA 4V1YA 1X96A 3CJPA 4AEEA 4DJEA 1QK0A 3CLWA 4QS5A 3WBAA 4HVXA 1F3EA 4DN1A 2V2HA 3BDKA 2RJHA 2Z6JA 2IQ0A 1O12A 3KX6A 5EBAA 3SUUA 2WM0A 2J7GA 1HL2A 1LBFA 5IFTA 2ZTJA 1OCBA 2ZUMA 1GORA 1LL6A 1V3IA 3TONA 4O17A 2V3DA 4O0QA 3EA2A 3T07A 2GDQA 1ISYA 5HNTA 3MTWA 4OVXA 4AYSA 4RDVA 5AYIA 4IPLA 5TNVA 3CGTA 4Y2WA 4PMUA 1E1CB 3NOEA 1XLFA 4QEEA 2OEJA 3KBSA 3UF9A 1XUZA 4ZODA 4YPJA 3SN4A 2UY4A 1SZEA 2QPUA 2W6RA 1PZ0A 3QZ6A 4FI4A 5HJXA 1NJJA 2VD8A 3SCQA 3WEMA 2XPKA 3RPMA 4CEXC 1XIMA 2FQIA 4DZ5A 2VCCA 3EA1A 4K8GA 3VOIA 1EWDA 1DP0A 1RA5A 2DU2A 1AL8A 4GY0A 4BCEA 4HBKA 3TYAA 4JICA 4MHBA 4QAIA 2QKFA 5HPOA 2AOSA 3NZQA 5CAKA 1GVOA 3ZSSA 3W75A 1TV2A 4TMCA 1YNQA 2YPIA 1EX5A 4HPHA 3K4DA 1EQPA 1DPMA 1EJUC 1EJVC 2AGKA 2UY5A 3OZOA 1YIXA 3S5ZA 5HNRA 3GXMA 3CS2A 1G1YA 3WQWA 4JTFA 5AOUA 4ZXLA 2QPSA 3WNMA 4MB4A 3ARTA 3PC0A 4QDWA 1Q7MA 1ZAHA 1EJTC 4PMQA 5H8PA 3STFA 1X97A 4W7VA 2I17A 4A8RA 3KDNA 1I75A 4XISA 3GDMA 2PWEA 2O55A 3P62A 3CTTA 1TELA 1C91A 5G1YA 3LOTA 3PJWA 3LPOA 4WZHA 5HULA 4K2SA 1JCMP 2XZ7A 4WXYA 1V3KA 4OBRA 3SCRA 4UNIA 2QUTA 2ZADA 3A4JA 4HNNA 3WLRA 2GL5A 3WNPA 2A7RA 3M6YA 4FXSA 4RE4A 1B90A 3BZJA 3UPWA 3LMZA 4O1FA 1C3FA 4DF1A 4TV5A 3VD7A 3TJXA 2E6DA 2W4XA 1POJA 1R9XA 3K8KA 6ENLA 2PRHA 2A3CA 4GLEA 4JNYA 2WNQA 2QPXA 1JYVA 4EAYA 4AB4A 5HNNA 1LT8A 1TPWA 3OHIA 3C0SA 2CIPA 2CBIA 1N2VA 5A69A 3FJ6A 3L65A 3HGOA 4M6QA 2ZUNA 4I7UA 3N73A 2OX1A 2JKPA 1BTMA 4XO7A 4ZCWA 4P8VA 4MKNA 1SO4A 3WBYA 3THUA 3UW6A 3VPLA 2PTXA 2HVMA 3NYDA 1EP1A 3E9AA 3OYZA 3WF2A 4EXAA 4US5A 5H8UA 3D6NA 1MW3A 4Z17A 4XTDA 5EPDA 3G0SA 1XRSA 4PTDA 2PFHA 3H4XA 5DBTA 1IT8A 3F4DA 1EDQA 5D8WA 3TDFA 3NQFA 4HN8A 3AJXA 2X30A 4EPBC 3HMCA 2Q8LA 1TVNA 1U1UA 1W3TA 3H2NA 3ZO9A 1DJXA 1XCFA 4FNUA 2BY3A 4AD5A 1EZWA 2QJIA 3MUIA 1XISA 4J7RA 4B3ZA 4MAZA 4X0NA 1EX1A 1UH4A 3HPZA 4C6KA 2MANA 2XN2A 2CLLA 4FSAA 1JXKA 2IXVA 4W5ZA 4XZWA 5AHLA 3M0VA 1IGWA 3W23A 1T40A 2WZHA 3W7HA 4E3TA 2ZWYA 1V3LA 2EBNA 3T42A 3T09A 4M1BA 1O5QA 1FWNA 2X40A 2DH2A 1GQKA 3POHA 3CHEA 4S3EA 4WSHA 4NF7A 1XUUA 3E5BA 4UMCA 4Q33A 5CJMA 5BMWA 3TZNA 3VDAA 1O1ZA 5C8BB 1GOQA 4DO4A 3CQJA 3F2BA 2Y7FA 3LMYA 3U3HA 2WWCA 4DBDA 3RCYA 3PR2A 1IGSA 4NRRA 3FJLA 1FX6A 4F4RA 1CYGA 5C9ZA 2OWCA 2GJLA 3A47A 2B7PA 4JGDA 3C0LA 3TFXA 2HVOA 3NYZA 4S39A 3MZNA 5FJOA 5I3HA 3EA3A 3MANA 4KBXA 1UWAA 3EWXA 4RPQA 3G8EA 1DE5A 1J0HA 3T2OA 2FPVA 4J2MA 2WC3A 4ECLA 3S3GA 3WH9A 4JHZA 1QHOA 2VR4A 2QCLA 3WYZA 3ZSTA 2HV5A 2WZEA 4V15A 2PF8A 2AQVA 1UUOA 2PGRA 1K8XA 3ZQ9A 5REQB 2OSYA 3SRHA 1GVRA 3L4ZA 2YOCA 3OGRA 2EPHA 3D0CA 1RUSA 3WLKX 1W1PA 1CLKA 3IJ8A 1V6UA 4KGJA 3GAKA 3KVKA 4HPXA 1CECA 1XDMA 2YCKX 4CN6A 5I77A 4AF0B 1O5XA 3LK6A 1Z7AA 3W7JA 1B54A 4IG2A 4NG3A 1PX3A 3HGSA 3COTA 3VIPA 3DN5A 3CAWA 3W2KA 5FJRA 3ZR6A 3PHAA 2A5HA 4GCXA 1CGXA 1JI1A 2TSYA 4HU3A 4MKSA 2V5LA 3AXXA 4PB3A 4CNOA 3CO4A 4PMJA 2D2GA 5J5DA 2PDMA 4H9TA 3SUWA 5GNYA 1VPXA 4KRZA 2DW6A 4MB5A 3WQOA 4AD1A 3PZGA 4G2DA 2JFEX 2XM1A 4U10A 4J3ZA 4MUPA 3ARSA 1UKPA 3R6IA 3EYPA 5JQ9A 2XFYA 1LDCA 4TX9A 3MP5A 2P76A 2YZ5A 4KWVA 1TTQA 4K37A 1XH2A 3S1GA 3TR9A 3PUDA 1OZMA 1W1A1 5IHSA 1F4HA 4IFKA 1UD4A 4IMGA 1PKLA 1RP9A 3ARRA 1TCDA 3WF4A 4LW7A 1ECQA 4H4IA 2D0GA 3ZOAA 2CLHA 4ZL1A 2CLFA 4LUJA 1OD8A 2BWGA 4JY9A 4B4FA 3VC6A 2O9RA 1B30A 1QI3A 3THQA 5D9MA 4G5DA 4RUBA 1R3SA 5CC7A 1YKWA 3HG2A 3HU7A 1ONEA 5IBXA 3KBJA 3UCCA 1DQUA 4M5PA 2PGEA 3O6DA 3KOZA 3L4TA 4EP8C 3DDMA 1M6JA 2DQXA 1VLWA 1XF0A 3LRMA 2YL5A 3EKGA 1L8PA 3BSGA 4H6EA 3ZJ8A 2PBOA 1R30A 2OTDA 6REQA 4BQ3A 2QVNA 3WLPA 4JFWA 2Q02A 1ISZA 1PAMA 4NYUA 2WQDA 2WZMA 1EJWC 1CXLA 1VC4A 3MO7A 1US0A 4Z2KA 2FLIA 3ME3A 1E9LA 3PBYA 4RDZA 1E5JA 1RP8A 3A6OA 3TN6A 4WDXA 3T7VA 2Y61A 4NJKA 3R0KA 2EG7A 1MEHA 5F2IA 1DXEA 2Q3OA 4LS1A 5G2HA 2ZVRA 4B5VA 3S5OA 2E28A 4WOQA 3WFZA 1UKSA 2VWSA 4DNMA 2Q6ZA 3GR4A 3OGSA 2PWGA 2VRJA 4HPJA 4LAOA 5A3HA 3VD4A 3AMDA 2VDIA 1P1MA 4MB3A 4MY9A 2BXYA 2GOUA 4GQRA 3T0CA 2BGQA 4Z2LA 1W3KA 4CU8A 3CT2A 8A3HA 4K39A 3NO5A 3OTRA 3QOKA 1SR9A 1YBQA 4UFHA 3QQ0A 4L1XA 2I16A 4GIAA 1XX1A 3ABOA 5DMNA 3WJZA 4U5IA 4PB4A 2FH8A 3KTXA 2PDBA 1OCNA 3BJFA 5GNXA 3HV9A 3SEPA 3SRDA 2RH9A 1XCWA 3P5ZA 4F0KA 3LGDA 1O66A 4JYDA 4DJDA 3ARQA 1EOMA 5F4XA 3P60A 2YDAA 3P5YA 1KRMA 3L2MA 3LD5A 3GHSA 4AAJA 2DT1A 4ERIA 3H54A 3ZWSA 3M0YA 1VRXA 2FHCA 3VI2A 4A3RA 3OA5A 4HZ8A 3VD3A 4OKDA 6CGTA 2P88A 4ADSA 2OXNA 1N55A 1BF2A 3IS4A 4PUWA 4IMAA 2DZWA 5LA2A 1GKPA 2EKGA 3IGSA 1E73M 3MUY1 3UNDA 1DIKA 1H7PA 1EJXC 1PYFA 5F4WA 4L4LA 2YA0A 1Y7VA 1FKXA 2VR5A 4JN6A 2ZXDA 1I2OA 1EL3A 1A50A 4A3HA 1C93A 1J9YA 4H1ZA 1Q45A 5E6YA 4OV4A 2ZX6A 3H7VA 3K30A 1F73A 1FDZA 5EMKA 4IHCA 2QV4A 2X8RA 3NQ7A 3GC2A 1TA3A 5I23A 1F74A 1PXGA 1OIFA 1W5NA 2B7NA 4NNAA 4JQ3A 4AZHA 1RQHA 4E8DA 4H3DA 5AVHA 3OEXA 3D5HA 2LLEA 3CMJA 3BARA 3WNKA 2INZA 5A1AA 4C6NA 4WKHA 1KBJA 1J10A 1UD8A 1F05A 5KZMA 3QHMA 4K1WA 5DCEA 1JNDA 3NXLA 2YA2A 5HBFA 1FXQA 4TXEA 2QJNA 1GQIA 2TRSA 3M0MA 1QT1A 2EXOA 5D33A 2CBUA 4W4QA 1DWHM 3PUOA 3KDOA 2PTYA 3ZXWA 3W71A 2PODA 4Z2HA 2XGIA 4UR9A 3E2SA 1BSIA 4C6DA 5EMYA 3BAJA 3NO3A 1KGXA 3MV01 3V0TA 2DUXA 4TO8A 2VFEA 3WUBA 4FXJA 1R46A 1TV3A 5J04A 3BTNA 4EACA 4WY0A 4D1IA 1HTIA 1KBBA 1BD0A 1T99A 4AYGA 1QXLA 4QJ5B 4ERAA 1UZ4A 3GNOA 1UB3A 4PMOA 3E49A 1CZ1A 1FDYA 4JS3A 4C6PA 5D09A 2WWDA 1GT8A 3CYVA 4XZIA 3TU9A 2WHKA 2NUXA 4DWSD 4RXFA 4JOMA 4LCRA 4XBKA 5LA1A 4GJ1A 3B8UA 2Z1XA 3SADA 3ZYZA 1FWTA 2PLCA 3AXHA 4JIQA 3MSDA 3CB3A 2Z0IA 1PE1A 2NQJA 2P3ZA 2FJKA 2DSKA 3MBFA 4LEFA 2Q09A 3QZEA 2REQA 3N2MA 1W91A 4HNOA 1OABA 1UR3M 4WDUA 1D7FA 3WF0A 5FACA 2QUMA 4DEFA 3XINA 1EXBA 1BHGA 1GG0A 1MQPA 3DESA 2UV8G 4F0SA 3C5QA 3VMOA 2BTMA 4IP5A 3T08A 4GUJA 4XZNX 2NV2A 3FDGA 3BMWA 3GVWA 3LU2A 4HB7A 4XD6A 3LCWA 3Q2DA 2D73A 4EK7A 4BEQA 5K9CA 3WDPP 3GUWA 4XB3A 2ZUWA 3TZFA 3GR8A 5D9NA 2BXZA 1FBAA 1E6PA 4DELA 4DUOA 3V0UA 1KW1A 3G6LA 5XIMA 1HL9A 3ELFA 4MNMA 1XYLA 3BICA 3TKFA 4O1DA 2X2YA 1A5AA 1DWGM 2PF0A 2V9DA 1B1YA 3K4WA 1V6YA 4ZSTA 4DI8A 1H61A 2PGFA 3S83A 5C2CA 4GKLA 1QO2A 1VYPX 2AKZA 4OFCA 4KWSA 2VVNA 2WQPA 1RV8A 4JQ1A 2QCFA 1AODA 3I7SA 2RDWA 5MF5A 2RGMA 1DKWA 2OVLA 4PCFA 5F2LA 1GVEA 3G18A 5G4EA 4HK6A 2W91A 3N34A 2KAUC 2QCHA 1YYAA 3UR7A 8CGTA 1PX4A 1ITUA 1EGZA 3BJSA 2VGGA 2PWVA 2V2DA 5AYBA 3W7GA 3UG8A 1F7BA 2XVNA 1XWYA 1U5HA 3EWZA 4LC6A 2E68A 1G01A 1E51A 5AHEA 3UG3A 3F4CA 1I8JA 4W8BA 4N9BA 4PMNA 3EOUA 5HQLA 2GJXB 3W4RA 4E4UA 1BKSA 4GHRA 3P84A 5FI8A 1B2YA 3UBPC 3WFAA 1X8FA 2CZDA 4P7RA 3S1VA 3N2TA 4JN7A 4A2RA 1JYXA 4B90A 4Q8TA 1L2QA 2XIJA 5CZSA 3GNRA 5KMYA 3RPTA 2AQWA 1X6UA 4DJED 1QBAA 3ZJ7A 2HMCA 3R5EA 3GDTA 2J79A 4LYKA 2NVCA 3VIJA 3TV8A 4HP5A 5K3VA 4GBUA 3W1RA 4JY8A 3RX4A 3GC5A 4ZQMA 4XBSA 4NJHA 4QE4A 2EEXA 1ML1A 1H51A 1UCWA 5L6UA 5FJPA 3DHFA 1ZS2A 2DPEA 1RK5A 2Q3RA 4YCPA 2E67A 1F8IA 3OA3A 4XZ9A 5JH1A 1A5MC 3L5AA 3HZ3A 3OVQA 1E1CA 4LYQA 4A05A 4DY1A 3W73A 2D3LA 4FIRA 1W37A 1DBTA 4TR9A 4FEZA 3QY6A 1EHNA 3CWNA 1BF6A 4H6KA 4HNUA 1CIUA 3VDGA 5CC5A 4FXFA 3UYCA 5ABEA 3PWIA 4BK9A 2Z00A 1RCOB 4BEUA 1EF3A 2CZFA 2OQYA 2X0SA 1WV2A 3HQ1A 1PBGA 4B2DD 5LXXA 4NJGA 1DJNA 2HXUA 1UJPA 4O50A 4PBEA 1JPIA 3AHTA 1I2PA 4PUJA 1EBHA 5LIXX 4J3WA 3B06A 3TA6A 1UR4A 1VEOA 2VC7A 6TIMA 1JZ7A 1JDFA 4HHHA 1QHZA 3L21A 4J4KA 2PDIA 5A94A 3E38A 1ONXA 4ZQOA 1JZ3A 1SJDA 3BQ5A 3SUVA 3IAPA 3S2CA 3DERA 3DFNA 1H5YA 1XKJA 3PB2A 1GQNA 3KVJA 3QOMA 3QC0A 3R8HA 4GPNA 1BG9A 5D04C 4REQB 5FA5A 3IAQA 2BODX 1E56A 2E5BA 3LHUA 4PMRA 3W2UA 5DCBA 1LUCB 2XINA 4R7OA 1EO7A 5BOFA 3UJEA 2IQTA 3C6CA 3VUPA 3GVGA 1K7XA 1GUVA 2OKTA 5AZ0A 4P8UA 2WMIA 2C71A 1X1OA 2UBPC 1R3YA 5XINA 2C19A 4RL3A 4M7TA 4LUTB 1H1YA 2FB2A 4ZQNA 1SFTA 3HTWA 3M6DA 1WDSA 2DFAA 4CUCA 4D6IA 4IIBA 3VIMA 5CPNA 3PUEA 3ZFHA 2O9OA 4AHQA 3FGCB 2IPGA 2V69A 4UFJA 3VUSA 3KCJA 1Q6GA 2E1DA 2QIWA 2V30A 4PCTA 1DWAM 4GO9A 3WD0A 5HR6A 3BANA 4AEOA 1WKDA 2YIHA 1Q6LA 4ICCX 4ADTA 1RH9A 2HZGA 1UYQA 2HS6A 3NL6A 1ZJHA 3ARPA 3SQLA 3B03A 3UXDA 1A5SA 3K46A 1QOQA 4KWOA 4PFHA 3KOWA 4FOJA 2CXGA 1UOKA 5LIUX 4US5D 2PPGA 3W2MA 3DG3A 3XIMA 1JRCA 3L4YA 1O68A 3EPMA 3PBGA 2CKRA 4N2YA 2H9AB 4GVFA 1S3HA 3IUDA 3QPEA 4DUWA 1BKHA 3BSMA 1PIFA 1G4EA 1XICA 4HA3A 1TJPA 3CV1A 1IHIA 4GY1A 3PJTA 1A3XA 3CZ8A 2NX1A 2HDJA 2VCAA 3B9DA 3MWAA 1X38A 3CL8A 3QLLA 1GZ1A 5CKSA 3C2OA 3J7HA 2D24A 1EP3A 3WQ5A 1C8VA 4OV9A 1SZRA 4HK7A 4Z1BA 4JFVA 1REQB 3MP4A 4LF1A 4LVBA 4AC7C 1E4LA 5B7YA 3JW7A 2VWTA 1LOLA 3PFRA 4GIYA 4M24A 4AY1A 4Q8VA 4ES4A 4LU0A 1IR2A 3DFHA 4QISA 3Q4DA 4TVUA 4NYYA 2JKEA 3KS5A 4MYAA 3VKJA 2OT1A 4UFMA 3RNDA 2Z1KA 3QZAA 5FIPA 1UKTA 3A22A 1E6QM 4HCLA 4C1NB 4MZ1A 3CQ0A 3MI3A 4H9ZA 2PWUA 1W32A 1YDVA 2FMNA 1AFSA 5AYXA 3GIQA 4XKMA 4DZHA 4WKFA 1XG4A 2VEGA 2VGFA 4AH7A 3KLLA 3WQPA 1V0LA 1MO0A 1OVDA 1UZHA 3O9NA 1EC7A 3GXIA 2R91A 1L6SA 4RDWA 2VEIA 3ABRA 3R94A 5A8GA 2CHNA 4RZ6A 4C6QA 2BDQA 4CQ9A 3EOOA 3APGA 3PZ9A 5G2IA 4PTVA 3MW7A 4RZ5A 1CI1A 3TEVA 3SRFA 4LRTA 4LF2A 2Y0FA 4JKLA 3P93A 1T8QA 4XZBA 4GE8A 3U4FA 2A3HA 1J2WA 1XLCA 5HQMA 4D8LA 4MGGA 4S3CA 2CW6A 1SJAA 1J0YA 3H70A 3AS1A 2E6YA 3W1NA 3ID7A 5KEZA 3CIWA 4CNTA 4MWAA 4W8LA 1DWJM 2ZTKA 1XINA 1R7OA 3TC3A 5EMLA 5CC6A 3B0VC 4LSBA 4LX4A 4WKAA 2WPBA 3NQAA 3BGAA 4JTAA 1G4SA 3W83A 3EDDA 1UBSA 3RRXA 2D2HA 4CD4A 1H60A 4OHQA 3W7LA 3A13A 1QNOA 1VP5A 4A8LA 4JEQA 4HU8A 3WDQA 1KQZA 4IISA 5DT5A 2DZBA 1BSLA 2FDSA 5C70A 1JAKA 2VX4A 4G7EA 2PP1A 4H7CA 5AHIA 4N6FA 1PPIA 2MUCA 4NI3A 2Y7GA 1TE1A 3U2ZA 4BI7A 3B8VA 2H6RA 2IPFA 3OBKA 3V1HA 2FFIA 3LHVA 3LRKA 3WQEA 2CLIA 3GTFA 2E25A 4HPGA 2PURA 2DV0A 2FTYA 5F1UA 3SQMA 1QW8A 3T0DA 2Z2BA 2WNZA 3CC1A 1KR1A 4O4VA 4CU6A 1ZRQA 3GTNA 5CAHA 1PZ1A 3UT0A 3ZJKA 1SO6A 4U28A 1SMAA 4HIBA 4UTFA 5CGTA 3MSRA 2OZ3A 3UJSA 3RO6A 3N04A 5D02A 5I3KA 2HE8A 1Q8JA 4RPPA 3UGVA 4PRRA 2DZXA 3S47A 2Y4SA 5JBFA 2FTPA 2TPSA 1M7XA 4S1FA 3FDKA 5LHFA 2Q8ZA 3BWWA 3VC5A 3HPAA 3WQCA 2J4GA 4OOZA 2FGBA 3R12A 4LXFA 1K77A 3GYCA 3PB0A 4MJ4A 1ME7A 4JFTA 1KM0A 1BEUA 1XP3A 4EWJA 1J6OA 3EOSA 2NUYA 3BV7A 1HKKA 2VQTA 3GM8A 4WLCA 5CLTA 1XI3A 5LSMA 1CW2A 1O5RA 3RJYA 1W8SA 3VX1A 5DMMA 1WOAA 2VXNA 3E1F1 4HD5A 3RPDA 3JZEA 1C8XA 5FKYA 5LNSA 4FLOA 4C7GA 2VZOA 3S6TA 1QU4A 2HTMA 1JEZA 2Y70A 1YTKA 4IMFA 4UMAA 1GG1A 3IJ6A 4Q8NA 1GZGA 2FB3A 3G24A 4OGZA 4E2VA 3KHJA 3A3XA 3RN6A 2YW3A 3VGDA 1UP3A 3QBUA 3PZOA 1SSGA 2OSWA 2JQXA 1ZGDA 1U1JA 1XRTA 5F2GA 2HQAA 4LVGA 2R1LA 2QGHA 1VFTA 1UH3A 3LBCA 3O6AA 3CO8A 3P8IA 3O63A 4A22A 4ZB0A 1HGYA 1XYMA 4BF5A 1K6AA 4P5UA 3TIMA 4D72A 1P7TA 4HMDA 4LVDA 4BF7A 4UQCA 1DORA 3OO2A 1AG1O 1XGDA 3K8MA 3ARVA 2BHYA 3OIHA 1YE4A 1QNSA 3N19B 4JNZA 4K8HA 4PUNA 1H63A 1AH4A 1NELA 1WO2A 4A2SA 3CQKA 4DJFD 1E0UA 3VNYA 1M3UA 2OZ0A 4LH8A 4WRHA 4C5YA 4DJDD 4ORMA 1A5LC 1TWSA 2QVHA 3GG8A 4UTLA 1YPXA 2Y88A 3OVGA 3N6JA 2NX3A 3NSMA 2XGBA 3FV9A 2Y7EA 1UC4A 1ESWA 1A5CA 3RLGA 4JIIX 3ARWA 2P50A 5BWFA 4ATDA 4FIQA 2OGYA 2QV5A 4AISA 3QH2A 3A9IA 1S2UA 1RLCL 5DFAA 4IH3A 5FEWA 5BNKA 4GUHA 1N8FA 3PBUA 3QJAA 4TIMA 3NM1A 1J18A 3P2VA 1TWIA 4JTJA 3CM4A 5D2VA 2CBVA 1FWJC 4FA3A 4D6CA 4XWUA 2Y2WA 4U31A 1DHPA 1LBMA 4RE3A 2WSYA 4JTUA 1X6NA 4PN2A 2EPKX 1JG9A 4IPJA 1QTWA 4HYWA 1YPFA 1JDEA 4L1GA 1OGBA 3SDOA 2PDNA 3SRKA 1JRBA 3HGRA 4M29A 3ANYA 3EB3A 4E8GA 3SCVA 3FHQA 4JZ5A 1E9YB 1EGMA 4H9MA 4O0ZA 1TV7A 4EIVA 3CQIA 4OIFA 6A3HA 2RDUA 4Q7NA 4KEUA 2HS8A 3B04A 3CT7A 4DB7A 2WCAA 4JL2A 9CGTA 3VILA 3EWUA 3ABQA 4O52A 1ONRA 3LUTA 2VURA 4XKYB 4LRSA 1ZAJA 4FMVA 3U57A 1M9HA 3PNUA 3HIJA 3W7DA 4I6VA 3L0NA 4AIOA 4M8UA 4LB3A 4Y9PA 1W1IE 3O2LA 2D20A 4FX6M 3SGZA 1LG1A 3AAMA 3L0GA 4CQBA 1MI3A 1QI4A 1FHLA 1UQYA 2NV1A 4L1WA 1YADA 2PRMA 4IJRA 4Z1DA 5A6KA 1VYRA 4INFA 1S2VA 4LPCA 5JIPA 2Z1BA 4IM4A 3VGHA 1OYCA 2A6LA 3OB8A 4K36A 4MVAA 3M41A 2PLJA 2FZ8A 1IIGA 4Y9NA 2X16A 3CWOX 4G1NA 3WMBA 4HOWA 5AYYA 2JIEA 1LROA 2QMJA 3VD9A 1YEYA 1LP6A 1UD3A 2J27A 2ZDRA 4I5RA 3C2RA 4NHVA 5JIWA 2FH6A 1QPRA 1XBXA 3WLSA 1AQ0A 2V5DA 1XD0A 4RNHA 1DIOA 3GVQA 4C6JA 4F66A 4GX8A 4D6GA 3HV8A 3UY7A 2G97A 1SO3A 3KOFA 1L0PA 3EXSA 3JU2A 1OFAA 4F0RA 4WVXA 4JD4A 4XD3A 3QR3A 4NJJA 3T44A 1M41A 5D2TA 3WJSA 3R43A 1QMLA 4WCJA 4MM1A 1FH7A 3H2MA 2PDGA 2G4FA 2O92A 4CD5A 4KMQA 3WJWA 1HXJA 4M3PA 4I9TA 4QRNA 4XQ6A 4IQEA 5AHMA 1KGUA 3W29A 1ZTVA 2Z1SA 4J3SA 5I02A 3TTOA 1FFQA 2IMRA 1OX4B 1GOMA 2WMHA 3RHGA 3OG3A 5D9OA 3THDA 5H6HA 3UVIA 5M5DA 3WK1A 2BSLA 4O14A 2TAAA 4FOUA 4X22A 3VNZA 3TFCA 1KFLA 2VJXA 1WZMA 3BH4A 4R53A 4WJ8A 5D2YA 1C7TA 2J9YA 2J88A 5DELA 1TX2A 3CEPA 4NX0A 2J6VA 3BLFA 4S23A 4DIAA 3MQTA 1GQLA 3LTPA 3F7JA 3MVIA 5CPMA 1VLIA 3RYSA 4ZB5A 3P6LA 3PAJA 3HMJG 1QDSA 1JGIA 4W7UA 5AC7A 2XHYA 3CNYA 4DWDA 1G67A 4HHLA 3W7PA 4DYEA 4GI4A 1U83A 2WXDM 4W88A 3W84A 4R85A 3AS3A 1L6WA 2E0PA 3CMFA 5DEZA 4FNQA 3H2OA 1OC7A 4AUBA 3PG8A 4IQLA 1X7FA 1KLZA 2DEPA 5EFFA 4A35A 3HJZA 3L2LA 2VFDA 4C1LA 1QR7A 3AYSA 5FF2A 3ZLGA 3MZ2A 3GDLA 2GJXA 1VBHA 1SJCA 4NUWA 3EBVA 4ZOAA 1Q6DA 4JHMA 1QATA 3R79A 5C55A 3C8NA 4ZB2A 2XUCA 1XM3A 4JDYA 4RE0A 4U2ZA 4EKJA 3MUZ1 3MY9A 3LXBA 3LI0A 3W87A 2PE4A 5CBBA 2JGQA 2GGIA 1UUQA 1ZLPA 2Q8XA 4I9JA 5EY5A 4NX5A 5FL0A 3WH6A 2YL6A 3WBWA 3CV7A 1D8CA 3OJGA 1R3VA 5EGRA 1PDYA 4IGNA 3RU6A 4LS2A 4NNCA 1UWTA 2AAAA 3F4NA 2C15A 5E0KA 4Q3MA 3CUXA 3M5XA 2F8QA 2QJJA 1W31A 1A5BA 3PFMA 5A6AA 3V35A 2GK1B 4C1KA 3ZM8A 2HCVA 1D8WA 2Z24A 2R1KA 2VRQA 3KWSA 1WDPA 3MI6A 3LI1A 1TWWA 2JK2A 4QROA 2J47A 1JQVA 2JEPA 5I5RA 1YXYA 1HFBA 2H8ZA 4GVGA 5EMMA 2WZTA 3ABSA 4EX4A 4IPNB 1OFRA 3GFXA 8TIMA 4MJMA 1B3VA 4C7DA 1L9WA 4C6FA 1CWYA 1VF8A 4JTKA 3NZ1A 3QPYA 4K38A 1EC9A 1I2RA 4XD4A 3QMSA 3T2QA 1LWIA 4KKXA 4S3AA 3UR5A 3BOLA 3IJ7A 1J5TA 4ZOEA 2Y6ZA 4MJZA 4AD2A 4ZTXA 1EXPA 2C18A 2DZSA 2PDLA 4W7WA 3S1UA 3GXNA 4DM2A 5FL1A 4U3AA 5C2GA 3MC5A 4QITA 2CHOA 3UJ2A 3A9BA 4PSPA 5H2ZA 1CEOA 3CZKA 1K7EA 3UA3A 1XXXA 4YTUA 4IPIA 3AALA 1OGSA 1SGJA 3ZT7A 3W88A 3CZJA 2YCIX 4EXBA 3M5VA 1UWQA 4P61A 1F6PA 3VA8A 1VCFA 4OWGA 1JCTA 1K9FA 3R0DA 4PMYA 4R7WA 2WJEA 2I57A 3N2BA 1A5KC 2CKSA 4LUSA 4REQA 1S5NA 4I9AA 2DZUA 4W5UA 4CD8A 2E3ZA 1H11A 3AZRA 3O7UA 3W86A 1LUCA 1VHNA 3H4WA 3P7YA 3AZTA 3WELA 2XIQA 4MZ8A 4CQCA 5IBXC 1XGEA 2G41A 4KCWA 4V28A 2D2JA 3AUOA 2RHGA 1EBGA 3SZ8A 1AZ1A 5LNWA 2IPWA 1XYFA 4HYVA 1K02A 4RX0A 5KZEA 3IVUA 2VFHA 3WZ0E 3MCNA 1SVDA 4HQVA 4LNCA 4RNIA 3LS9A 3U48A 4OECA 1FWRA 2PZ0A 2EG6A 2B0MA 3H8AA 1NU5A 2J8TA 2G5WA 3FGCA 2FGZA 4OOUA 3NQDA 1DXFA 4ATLA 2NVAA 4UTTA 4EAMA 2G3MA 4Q32A 4FB7A 1TPVA 4ACZA 3W0KA 1I1WA 1EA0A 1R9ZA 1S2WA 4U2YA 5E0CA 2QCEA 5HANA 3QW3A 1TPDA 3A4AA 1I6NA 4CU7A 5MHBA 4J40A 1EGVA 4GYPC 1KBKA 1LF1A 2PDQA 3NURA 4DBUA 1V4YA 3PBVA 3O8AA 3PZTA 3EXRA 1OF6A 3VO0A 3VKDA 3M0XA 1BWLA 3NQMA 4HZ6A 1ISWA 1E0XA 3I4KA 1KA9F 1KXVA 2Z25A 1OY0A 3TCEA 1Q7ZA 4HSNA 4HMNA 1DTNA 3G1VA 4RLIA 3K4AA 1XH1A 5CZKA 2XSBA 4GI8A 3LTSA 3S2JA 4QE5A 4GY7A 4HZMA 2ZKMX 1GYLA 3W00A 1DQWA 1A3HA 3F1QA 2EPMX 5LIWX 3HFYA 1UPMB 3VKBA 1N7KA 1U1HA 4JBRA 3GVRA 5L9FA 5DBUA 5G1MA 3N4FA 4JNMA 2OPJA 3CZGA 4QDMA 3S5NA 1DE6A 3UR2A 2GGGA 1UR0A 2QQ6A 4NZ4A 4DJFC 3NVDA 4IMDA 2X2GA 4CVUA 1WBJA 1AH3A 3BAKA 4IQDA 3GZAA 1JPKA 3MVTA 1Q66A 4NIRA 4KWWA 1WKFA 3GSMA 1AJ0A 1KM4A 1T96A 1V7AA 3B8IA 4R9OA 1Z42A 4Q4KA 4V2XA 3E2VA 1WDDA 2J13A 2ZX8A 1JFHA 4UOZA 1B3WA 3GW3A 4WY0F 4RR4A 4LAZA 3PG9A 5DMYA 3SB0A 1KXHA 3WEZA 3BGGA 3W7NA 2YYTA 2V68A 4C1NA 2NVDA 3SSZA 2OLSA 3NOYA 4OJYA 5CXPA 3DFTA 2TYSA 4I9MA 1DV7A 3LNPA 3DIPA 1FWEC 4IP4A 1XLLA 4JCMA 4LVFA 1B3ZA 3DGBA 2AKMA 5ABFB 3GH5A 4MPQA 3R10A 2ZX9A 2GVLA 1VIZA 3GUGA 4C65A 3UXLA 4O53A 1ZNNA 3ALFA 3QFWA 2ISFA 2Y63A 3MBDA 3I7QA 2YXOA 1KFWA 3WK0A 4ZQRA 4XAZA 5A2BA 1WDWA 4B5SA 3W37A 2NQ9A 1C90A 1XKYA 2R6OA 4CNSA 1YDOA 4RZ4A 2D3NA 3ES7A 5KTLA 4CCDA 1Q6FA 1BQGA 4C5ZA 5I3FA 1H7XA 1LQ0A 3ZLHA 3KW3A 2BHZA 4UR7A 4ZBCA 2OLHA 3BJTA 5A95A 1JZ5A 2CLPA 3ARXA 4Q4MA 2PTWA 4RXGA 3W3OA 3L4WA 2OYMA 3N1AA 1QAPA 1EZ2A 3OOQA 3LBOA 2XN0A 3IGXA 1F6YA 3LEPA 3OYXA 1NTHA 1PWLA 3GAYA 1KWGA 3GTIA 4F2BA 2A0NA 3ONCA 4MWAD 3AIQA 2OFJA 1RJRA 1U33A 3NQ2A 4HK5A 4LFYA 4IOTA 5E9AA 3L67A 4U33A 2G8ZA 3LYEA 3PY2A 2A21A 3SM0A 3WQ4A 4W87A 1OYAA 1ZZMA 4CEUC 1IYXA 3Q94A 2PGWA 3R25A 4A29A 3SCTA 2ZYFA 3MMTA 3G22A 1XYBA 4J3VA 1W9BM 3BK0A 1W9UA 3EX6A 2FIQA 1WBHA 2DSZA 5BYWA 1W17A 3UWZA 1MNZA 1W3NA 5IOBA 3R7MA 3H55A 3TX9A 3SJNA 3B3DA 3W9ZA 4J27A 3I6RA 3VZXA 1S38A 4KS0A 3TYBA 2XYLA 3DC8A 2QAPA 1WZAA 4P7LA 2ZZ2A 3OVRA 2HWGA 3WLMA 1S2TA 2Y24A 4NASA 2FZDA 5CLWA 4XAFA 2Y8VA 4I5UA 4MTVA 3B8DA 1ISVA 1KXTA 2P8BA 1YXDA 2E40A 4X3ZA 1BTCA 3O3RA 3TTYA 3G1FA 3SAZA 3KXQA 2X1IA 4YTTA 3GFZA 4JTEA 2I1OA 1Q13A 1UD6A 3DEQA 1Q3NA 5HPCA 2GVEA 4ACYA 4UOQA 3V75A 3FOKA 2XU2A 4POCA 1EEXA 2HPMA 4FF7A 4FNTA 1MZHA 4V27A 3PBMA 5A8MA 2PDJA 1VD6A 4GMEA 2X0HA 1E70M 3IUHA 3TJLA 1Q2RA 3S2MA 1R3QA 1XBYA 1V6VA 3TN4A 2ZRUA 4Q8WA 1AQHA 1Z89A 3KCLA 2BP1A 3S4TA 4TX8A 1RLDA 1RALA 2ISWA 1J0ZA 3DHPA 2WV8A 1YHTA 4OU1A 1EA9C 3GE7A 3M5YA 3PTMA 1ADOA 1XBZA 3W27A 4B3KA 1RD6A 1DEDA 1QNRA 2VC9A 2L5HA 5D4YA 4TU1A 4O19A 1X98A 3RDKA 1B9ZA 3TTSA 1U5JA 1PSCA 3W28A 3U6WA 3BOXA 3A4XA 4CCCA 2GQ9A 1G94A 4OE7A 2DUZA 4MY1A 2C6QA 4L9ZA 4DLMA 2E5CA 1EFZA 1VS1A 1CGUA 3GTHA 1OFEA 2J6XA 3STPA 1W5QA 1OG0A 3IPWA 5H8MA 5E0FA 1UUMA 4U3CA 1NQ6A 3FJ4A 4AY8A 4CQDA 2OB3A 2P3EA 3EGJA 1VCVA 5JH2A 2DY3A 3W7MA 2ACUA 3SQSA 1EJ7L 2EHHA 4PEEA 3DYPA 4CLMA 2HBXA 3NAVA 2PMQA 4PL2A 1VFOA 2X1TA 3OZYA 1W5PA 4GI6A 3WQGA 2WJZA 5AHFA 2O9PA 1P0BA 4MAVA 3L4XA 4O28A 2J62A 4JIHA 5F4SA 2X7VA 1KCZA 4QM1A 1Q8AA 1A5UA 5DRCA 2IQDA 3MO4A 2NW0A 1KKRA 2PEVA 1ZAIA 2OYLA 3CZLA 3H4GA 5C9XA 1QHPA 4WD0A 3TJIA 4C6MA 1QPKA 4MJ2A 3TC7A 4UTMA 1E43A 4H00A 4GO8A 1CENA 1UMYA 3TR2A 1Z9AA 4YVPA 4PUKA 3VU2A 2QCDB 1VFLA 2X41A 3NL5A 2UY2A 4NZ5A 3U8GA 4ML9A 4YL2A 1JPDX 3AIWA 5TBOA 3QW4B 3UWVA 5HJYA 1XSKA 1R2SA 3TN3A 2VM8A 5E1QA 4MZYA 2QCGA 1PV8A 1JPHA 2ESCA 2H3BA 3LY0A 1X8CA 4GQQA 3BOFA 4DQWA 1Z41A 3VGGA 3EZ4A 3EOLA 4QQUA 1QNVA 1UA3A 2FDMA 1PHWA 4QQ3A 5CJ5A 3AXMA 3N17A 4D2JA 3GU9A 4GQGA 4PCPA 2QULA 1OB0A 3A5VA 3B8SA 1ZU8A 2X05A 5ABGA 4R34A 4WJEA 1TWZA 2POTA 1G5AA 5LHEA 1YE6A 3T0AA 5HMFA 2V2CA 1XIIA 2JIWA 4DWSB 1IEXA 3IVSA 3D46A 2WVSA 2A7NA 2VCBA 4AEFA 2C1IA 4M7SA 1OFPA 3G3MA 5DXYA 3FAXA 3FYPA 3ORWA 4N9EA 4IMEA 2OWXA 4DAIA 3CV2A 3TUUA 3SY5A 2PWHA 4UNKA 1OC6A 5TQLA 3WK3A 1A5NC 3APTA 2GJRA 3NFUA 2V8ZA 1OINA 1J93A 1JCJA 1GYMA 2C79A 1O94A 1BVNP 1K8ZA 3I6TA 2ZZ7A 5D2XA 2Z7GA 4JX6A 5G4WA 1OWQA 4MWAE 3DKLA 5I3DA 4BFAA 1EDTA 1LOSA 3WH5A 2VYOA 5AECA 3S9ZA 1HNYA 2XVKA 3IGHX 2CZEA 4E2DA 3K2GA 2D23A 1LLZA 5HINA 3P80A 2VKZG 1AUSL 4QJ3B 3T81A 3N2OA 1ZBKA 2V5BA 1I1XA 4FOKA 4HGXA 3AI0A 3CXOA 4GD0A 1TUFA 1WXZA 5DXXA 4ZA0A 1HVQA 2UY3A 4GWEA 1XIJA 4ICMA 4LBSA 2OKOA 3NQVA 4WR3A 3RLUA 2GWNA 3WNOA 1DJYA 3AWOA 2HROA 4WQ6A 3NR0A 4Q8MA 1CGVA 4AZIA 1EOKA 5D9PA 4DYJA 2Y85A 2QMKA 3Q67A 3EKZA 1E0WA 5HOSA 5CJNA 3UPMA 4PUMA 2FKPA 1H7OA 1ALDA 1HUVA 1GJUA 5I0DA 1CXFA 2ZIDA 3DI0A 2A2IA 4H8NA 3VIGA 3N13A 3SY1A 4ROPA 1OX4A 3ATYA 2PSNA 1V02A 4FNPA 3V5FA 3STCA 2ZZ5A 1F76A 1TYGA 1WPCA 5A8NA 3SECA 1Y5XA 1H49A 2VDGA 1CBGA 2ZWZA 6XIMA 1D9EA 4XAYA 3BLOA 3IACA 3RJXA 1JFXA 3IEBA 4NXKA 3VOHA 5A6SA 2CZ5A 2RKXA 3H2AA 3DFYA 2XVGA 1QRQA 1TE6A 1YTDA 3QGAC 4IL2A 3M5ZA 3RMEA 3HGJA 1FCBA 4UTIA 2HK0A 5C7VA 1QW9A 1VZWA 5CBIA 5GQBA 1C8QA 3CPRA 3IV3A 1XIBA 1AJ2A 3R8GA 4BJHA 1NARA 3CH9A 4YLWA 4GUGA 1OBAA 4DF0A 2PDUA 1Q6QA 7TAAA 1HP5A 3V16A 2Q01A 2YDSA 1HJQA 2YCJA 4RV3A 3VDBA 5AZ1A 3G0XA 2OG9A 4A3UA 1GGOA 1W1B1 1W3JA 4DXKA 4EANA 3I3DA 1UD2A 3GXDA 4DO6A 4QHRA 3CHDA 3JS3A 3W7CA 4DO7A 1ADSA 3C2YA 1UR1A 4FLSA 4WUIA 4JTGA 5A2AA 4DBWA 3T78A 3FX4A 3ZVIA 4XVEA 5HAOA 3LHWA 4QTGA 3VZZA 4C7FA 3EWDA 3RX2A 3S1XA 3H2EA 5AVNA 1UR8A 5I78A 4XZHA 2OT0A 1RA0A 3PZMA 4I3GA 3E0WA 3NZRA 3THCA 3LM7A 1M65A 3VCNA 3RU8X 3VKCA 1GOKA 4QIUA 3W53A 3SBFA 4KCVA 1P0DA 2VZTA 1VJZA 4QXIA 1NFPA 2GK1A 2Z6IA 5I24A 3N9RA 5IFPA 1HJUA 5FCZA 1HT6A 3LLXA 1RD5A 3CK5A 4XO6A 4GH1A 1JZ4A 3R11A 3UR8A 2ZCGA 2W66A 3L4UA 4GZ7A 4EVZA 4IIEA 3TYUA 3MKKA 3O6CA 3ITGA 3STEA 5U7SA 2CLKA 5FJJA 1GW9A 1IWAA 4NZFA 2G3FA 4ROQA 1BFNA 2H8XA 2E1WA 2O4QA 1BXNA 3S2LA 1QASA 3BMVA 3DHUA 3UZXA 4GJIA 7ENLA 2YKKA 3MHFA 1GOOA 2F2KA 5BRBA 1KKOA 3GDRA 4DNHA 2OQLA 2YL9A 1DXIA 2XSXA 4NZCA 1OCJA 1MUMA 2A6NA 3NNTA 2EPOA 4UTWC 1Q6EA 4MFEA 3TN5A 1H1ZA 5BWAA 1IR1A 1ITCA 2Y89A 2F84A 3TCSA 1JYNA 3YPIA 2GOKA 4NY2A 1F8MA 1AMYA 2JBMA 4QG9A 2GFTA 4TQTA 3KAOA 3S0CA 3TLLA 1WUEA 1ZFJA 1F4AA 3UZYA 4RK8A 2YR1A 3GXTA 3CL6A 2V38A 3BC9A 3S9YA 1CCWB 1LLOA 1R3WA 1GW1A 4L9YA 2DVUA 3NXFA 1MFUA 1TRIA 4FLRA 3HBLA 1TWDA 3W81A 3WL1A 3PWAA 5D30A 1CXHA 3CAKA 4HMEA 4IT1A 4WIWA 3VIHA 3U7BA 3CV6A 2BBFA 2FTWA 1ZHAA 2QJMA 1KV8A 2DIJA 1JYWA 4W8AA 3WLJA 5FJTA 4UC5A 1ZPTA 2GPTA 4K7YA 3WLIA 1XLEA 4ICNA 2YYUA 5CPQA 3KBNA 4MLJA 4HMCA 1K8CA 1J8VA 1J79A 1TIWA 4AHPA 3B9EA 3KCOA 4MSSA 5E70A 3HM7A 1B3XA 3W7OA 1AVAA 3RK8A 3PSWA 3BAXA 2Z4GA 3MJYA 4ORIA 4ASTA 2PZNA 5ECVA 3CLMA 4DF2A 1R38A 3GWQA 4NAFB 2ZZ3A 1Q63A 2FJUB 4QFUA 5FAJA 3TMLA 3CAVA 4YMZA 1XPYA 4LNYA 3AIUA 1XQKA 2XWEA 3S8HA 2ABBA 3E96A 3VIOA 3GC4A 2OGJA 4DUVA 1QO5A 3A64A 2DP3A 2A3LA 3KUMA 1Y65A 3LV6A 4Q8PA 5EA9A 5C54A 5DY3A 2ZC8A 2NQHA 1J11A 4IUOA 5FEXA 4U5KA 3GD6A 1TQJA 3NDOA 4PTNA 4UNLA 1OGGA 4Q7BA 1OX5A 2HBVA 1U5VA 2VEPA 1ODUA 3LENA 4AMCA 2W67A 2QHAA 3KL5A 2QXWA 3P8JA 2BV9A 3CHCA 3V3WA 3T0TA 3TW7A 5GJPA 3M1ZA 5D38A 1UHVA 4RJEA 4CN1A 2PDCA 3PJUA 3AIBA 4BZYA 3MCOA 5FOOA 4TTGA 4AZ5A 4GZIA 1S2AA 1US2A 4QG8A 5BXPA 4JTHA 4E3VA 4NT0A 1Z8AA 1XSIA 1ECEA 3W2JA 2J8FA 3NWRA 2PC8A 1K70A 2O9TA 4GZEA 4RE2A 2XSAA 2AL1A 4N9CA 1KC7A 1HKWA 1OD0A 1VB9A 2CLEA 1BYAA 4X9SA 3VIKA 4IXHA 4RZBA 1EF2A 4OUEA 3DI1A 2VFFA 1EEPA 3SN1A 5DO8A 3OU8A 2D0HA 4F9JA 1R9YA 5HA7A 2IUZA 3FFSA 4XTIA 1WKYA 1H4PA 2FGLA 3BG3A 4AZGA 1I0DA 4UFIA 5ABFA 2UZ9A 2C7FA 2ZRXA 3DHDA 3N25A 4H7VA 3L9CA 3I65A 1XLMA 1A5OC 1HW6A 2C1GA 1R2RA 1RJQA 4B5NA 3N9SA 2JE8A 3HQNA 4IWWA 1LWHA 1FFRA 3CEUA 3TQKA 4DX3A 1ICSA 2PWFA 4QS6A 1UC5A 3I6EA 3U5YA 3B9NA 3OZPA 1KTNA 3EDEA 4WEVX 3RAOA 2DORA 4FO4A 4IP7A 4AD3A 3F2DA 2VO5A 2YB1A 1VFHA 1RVKA 3QMTA 1PEZA 1NY1A 5HWNA 1DQXA 1LRNA 3N3TA 3K1GA 1EC8A 1E1FA 5I03A 1GVFA 3N6HA 1DJGA 2C91A 3WD4A 4CNUA 3SR7A 4ZSUA 3TP4A 4UZSA 1Q2SA 3OBAA 1QUMA 2WMKA 4PFMA 1Z6KA 4BR1A 5HMSA 6TAAA 5U4NA 1P5BA 4Q4PA 1ENUA 3UG5A 1V8EA 1KRAC 1NVMA 4N42A 1LTDA 1V3MA 3W1LA 1M7OA 2GUUA 2PRLA 4PMZA 4BWLC 3LX9A 2V5JA 1WXJA 3R2GA 4IFKB 4H9YA 2WKGA 1J12A 5EL1A 1KQYA 2QCCA 3NUKA 1TUXA 3DCPA 4IX2A 3M0HA 2JF7A 2A3EA 4DVOA 3PS7A 1K03A 9XIMA 1SU5A 1WA3A 4S38A 2QUVA 4FNRA 3NPUA 1KFJA 3D47A 5IXEA 1ME8A 5CCZA 1R87A 2V6AA 1BRLB 3WJXA 4PTWA 1KTBA 3R8RA 4M80A 4FXRA 5DN1A 3ARZA 3KBMA 1UW9A 2BGSA 2Y62A 4L6OA 2PWDA 2QNEA 3WLHA 1PYMA 2WVUA 4JTIA 3QKZA 1HZYA 1RJPA 1DHKA 4YTRA 4QE1A 3EB2A 3DFQA 3UXIA 1VBUA 3A24A 4FPSA 3VDHA 3PN8A 5C0QA 3PPCA 1HJWA 3GH4A 2WO5A 3GIPA 1TZ9A 2VENA 3BLDA 2WK2A 4WGXA 3HPFA 2QS8A 4ATWA 5LNRA 3KFTA 3L4VA 4UBPC 5BXTA 2OSXA 1W2PA 2I14A 1FTXA 3UJFA 2FZNA 2GSEA 5MKGB 2GDVA 3TXZA 2E9MA 3IK4A 3LGGA 3WH7A 1ADDA 4KIRA 1OFOA 1WX0A 3WLQA 3GNXA 4YHGA 5HNUA 2E8ZA 1P6WA 4GRSA 1RZMA 3ENLA 1H7NA 4TVDA 3CPGA 4AY7A 4Q6JA 1JDAA 3CAQA 3W1XA 1GEHA 3BSHA 4HNTA 3C8FA 4HYRA 3PNZA 1FP8A 4JIEA 5LGZA 1R2TA 4LALA 5C2XA 1MUWA 1XRFA 2WOQA 3D3FA 2XIBA 2IS7A 1YBQB 4ML4A 3ECQA 1RY8A 3SIZA 1OJXA 1YRRA 4GNKB 4JEJA 4C60A 2W79A 1DIDA 4HJFA 1BVWA 1XC4A 1X1ZA 4TUFA 3N4EA 2QGYA 1GONA 3OQEA 4D8ZA 2J7DA 2J7HA 1QNPA 1FY6A 1OQFA 3VM7A 3CL7A 5HWMA 2Z28A 1TVPA 3EDKA 1EHAA 1BG4A 3M7SA 3CASA 4WDTA 3UNTA 3DGRA 2NQLA 1TJRA 1OX6A 1XYZA 2ZBTA 4P8WA 4FR6A 4D6JA 5CPOA 3UP8A 1OEPA 1PZ2A 5CSSA 4DPQA 1Q85A 1P0KA 4Y9MA 4QJ4B 3ABZA 5AN7A 2HJPA 3TLQA 2XDFA 3VOJA 1LG2A 7A3HA 1DJWA 4X9YA 4CCZA 1WXYA 2ALRA 2FPYA 5F1VA 4O57A 2YDQA 2QCNA 3N12A 5D03A 1XHGA 2XZ9A 4H8HA 1E6XM 4IGHA 1W2VA 3NEHA 3CPUA 5ENLA 3UYIA 1NDZA 3F4WA 1ZBCA 2RAGA 1TA3B 1QFEA 1RK6A 1S46A 1MQQA 3NQCA 2XH7A 4OT7A 3WQFA 3RLHA 1E9ZB 3LM3A 4GXPA 3VCRA 3UQNA 2V81A 3AWNA 3SO7A 3LQGA 5XIAA 1W5MA 1O1HA 3GX9A