4LS2A

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with dh03a313
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
364
structure length
364
Chain Sequence
GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with DH03A313
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 141
structure length 364
sequence length 364
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2013-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ls2A00
4O1DA 2ZZ1A 4O17A 5KMYA 1OK4A 3A22A 3TROA 1VH7A 3B0PA 2R8WA 4NX5A 4NVTA 1XFBA 2PC4A 2TPSA 4YMZA 1F05A 1N8FA 3NL3A 1PHQA 2ZQ0A 2CWNA 3BG5A 3G0UA 1JCJA 1I8JA 3B4UA 5LNRA 5J5DA 4BWLC 4M19A 3LERA 3TSMA 1JQXA 1D3HA 3MP3A 3EXTA 1H7OA 2ABAA 5D30A 2H6RA 4D2JA 1X1OA 4NQ1A 2Y85A 4WY0B 4MZ8A 3TJXA 3W1QA 1JJKA 3EKZA 3LI0A 1TPB1 1RPXA 5BMWA 5BNKA 2ZA1A 3N14A 5BW6A 3IV3A 2V2CA 4WY0F 4LNYA 3DHDA 3C2VA 3W1TA 1R2TA 4UCGA 5C5YA 1DJNA 1FCVA 2Y61A 3TW6A 4JTUA 1LRQA 2ZRVA 4MFDA 3W1XA 1OF6A 4JYDA 1QR7A 4UMBA 1F5ZA 3FIGA 1OVDA 5BOOA 1OF8A 1KV5A 3EWWA 4IXHA 3P82A 4A3UA 4RX0A 3WJZA 5I3FA 2ZA3A 4QQ3A 2QCEA 3GKAA 3HG4A 4PL1A 3L2IA 3VCRA 3QQ1A 1OG0A 3R8RA 3VI2A 4EVZA 3W7GA 5HUOA 1DOSA 4MY8A 3BG9A 2E6FA 1DV7A 1YYAA 3H54A 4EF9A 4MZ1A 3EKLA 4O10A 1TRDA 3HOJA 3HGRA 3HPZA 3KFTA 3A5VA 4ZQOA 2QUTA 4ML9A 2BLEA 1YADA 4RXGA 4OGZA 2CLLA 4GNJA 4ZZ9A 2EF9A 4WX2A 3NQ8A 2HS6A 2CFFA 3QPYA 4JDYA 3UXAA 1T96A 2O7QA 4ORMA 1M7PA 2CZFA 5LKYA 3QYQA 1A5BA 3JR2A 3SSJA 2A7RA 1QOQA 1U83A 5FF4A 3TMLA 1G69A 3W86A 3IRDA 3WFAA 3M5VA 3W7NA 3ABRA 5AN7A 5EYWA 4GXMA 3HBLA 2ZRZA 1BWKA 1B4EA 2J6XA 5KZDA 3L0NA 1IXPA 3F4WA 3UNDA 1GPWA 2CLIA 2J9ZA 1GWJA 2FLIA 5T26A 2A7PA 3MBDA 1SO4A 3DU0A 4BR1A 3QPZA 2QDGA 4M7SA 2E6AA 1CI1A 3UY8A 3JRKA 3CT7A 3LTPA 3TQKA 3EWZA 5FEZA 1W3NA 3HB9A 4FX6M 4A21A 3CLMA 3HJZA 3FKKA 2FPYA 3S5NA 3W7LA 4UFHA 3G1SA 4JXCA 1F7BA 2C19A 1PS9A 2FDSA 5F2LA 2WPBA 5D05A 2A1YA 3IIXA 1KM6A 2QDHA 4GUGA 1VPXA 1G7VA 2JK2A 4FIQA 2ZFAA 3TH6A 2FJKA 4NXSA 2I14A 2ISWA 5FF3A 2DZUA 3OIXA 1K8ZA 4JTFA 1HFBA 1GJPA 4UTKA 2CLEA 1EP2A 4I7VA 2DZTA 4LT9A 3FJLA 3GR7A 1C8VA 3GNDA 1I2QA 2B7OA 1W5QA 1AL7A 5FEXA 5D09A 5MHBA 1S5VA 1VCVA 1Z48A 2A4AA 3W1RA 1YTDA 4GUHA 4TX9A 1EX5A 3ZR4A 2YYTA 1EIXA 1O5XA 3M9YA 4MJZA 4Z1BA 3I6RA 1FDYA 1LOSA 4Q4KA 1K3UA 1TJPA 2EPHA 5LNUA 3SJ3A 2ZZ3A 4JDBA 2V9DA 2DZPA 3P5YA 1X1ZA 5AC7A 4LU0A 1DQWA 4X2RA 5K9DA 1G4PA 2R94A 1ZNNA 3W88A 3L0GA 4IJBA 1HUVA 3P5ZA 4IOTA 1KTCA 4OQVA 2OT1A 3ZWSA 2J24A 1M7OA 1AW2A 1LP6A 4N4PA 1MEWA 4RCXA 3NOEA 4O4VA 3L0KA 4K38A 3IIOA 1HL2A 1THFD 3KVMA 3LBMA 3DGRA 2R91A 3W7QA 1LYXA 3HF3A 4JN6A 3W23A 1XL9A 1AMKA 4DXVA 1VYSX 2D73A 1OX4B 3KAOA 1DBTA 1GVOA 2Y70A 4ADTA 3MMTA 2H8ZA 2JGYA 1SSGA 4FXSA 3M43A 4FNPA 4LV9A 4QSHA 3A9IA 4PA8A 5CPLA 1KM1A 3M6YA 3R12A 1W56A 1K7EA 4GWEA 5I3HA 2XN2A 2ZZ4A 2YFOA 4TMCA 3P80A 4IMEA 4FXRA 5HINA 3P8IA 1LCOA 3O6DA 4FIRA 2JKAA 4R33A 2V30A 3W7KA 1TPC1 3ABQA 2E68A 2H3BA 2C18A 5F2MA 4RLIA 4NNCA 1FWSA 1G4TA 5DN1A 3S1UA 3LCXA 5D2TA 2I1OA 3PY2A 1TREA 3HGSA 3GR8A 5I3IA 1EB3A 5KZMA 1I45A 1KM2A 3B06A 1Q6LA 1H5YA 2OX1A 5KINA 4PODA 3PG9A 2O7SA 5LGXA 1AL8A 1P1XA 3T4CA 1EWDA 4UTTA 2HSAA 3C4UA 1QCWA 1W37A 3UY7A 3KOFA 4HNTA 3LHVA 1H7PA 3G18A 1WV2A 5DCDA 4O11A 1VC4A 4O28A 4ZQRA 5LHFA 4JTHA 4LS1A 2DZWA 3DBPA 3THQA 3LXCA 3RLUA 5SWUA 3GXPA 3BG3A 3NPWA 5KTLA 3W9ZA 3VNDA 4FX8A 3UQNA 4O19A 4WOZA 2YR1A 3P60A 4MYXA 4UFKA 2ZRUA 3O16A 3O1NA 4HKPA 1TTJA 3CWNA 2PE4A 1WOAA 1S5TA 1VZWA 3EX1A 3Q58A 3UWWA 5HJLA 3NL6A 3QEZA 3QSTA 1FWTA 3ATZA 5E93A 4UTIA 3TCEA 3W70A 3C56A 2P1FA 1ZCOA 2JBMA 1L2UA 4R34A 3HGJA 3MW7A 4QJ1A 3MP5A 4K7VA 1PE1A 1OFRA 4E0CA 3FOKA 1TPUA 2B7PA 3IVTA 3PSVA 1WYIA 3O6CA 8TIMA 3WJXA 4RKAA 1JCYA 3RU6A 4ICNA 1QDSA 4R7JA 1I4NA 1LDCA 4O15A 3AJXA 3QRHA 4UMAA 3NPVA 3B04A 3KRUA 3SZ8A 4HT3A 3DFSA 4IMGA 4YLWA 3DAQA 4HN4A 2NLIA 4FEZA 2FQIA 1OFQA 4ZVJA 5DXYA 5DLCA 4TMBA 4IXXA 5LNVA 2QKFA 5EA9A 4UTTC 1X6UA 5FF2A 3W7OA 1JUBA 3NM1A 1HTIA 3W72A 1JUKA 3LXBA 2R14A 3BO9A 4LOCA 1R2SA 1NF7A 1L6YA 3CC1A 3LI1A 5A8GA 1TO3A 1PV8A 2QUVA 4CNPA 4AVFA 1DVJA 1TV8A 4UC5A 2C15A 4ADUA 1KFJA 1FUYA 2CLMA 3NAVA 1Z44A 3C2EA 3GXTA 2ATMA 3L5AA 4DPPA 1UASA 2ISSA 4JTIA 4K7YA 1FDZA 1FDJA 1ADOA 4UFLA 3G1DA 1RQBA 2NUXA 4QNWA 3L67A 3W2JA 2WJZA 2YW3A 3CIXA 3MI2A 3QQ0A 4N9DA 1OK6A 3OVQA 2QCDB 5HWMA 3N9RA 1YXCA 4OE7A 4X9SA 1IIHA 3PUEA 2VELA 4RV8A 3ZFHA 5C55A 5LSMA 4KWWA 1I2NA 2H90A 3ANYA 2TSYA 4FX7A 4MLRA 1LTDA 3ATYA 2A6LA 1LZOA 5HMSA 3W2UA 4HNVA 5AYYA 3CTLA 2QR6A 1NFBA 3S5OA 3OHIA 3MUXA 3IIVA 2GVJA 4C1LA 3BW4A 1K02A 3PUDA 2HTMA 4UTLA 2V8ZA 5F1UA 3IGXA 4QISA 2QF7A 4KFPA 2Y89A 4EIVA 2FB2A 1DORA 1P5BA 3LLFA 3P8JA 3TDFA 1XBZA 3W76A 1KBIA 3NPUA 4UFJA 2NV1A 3W7JA 4TR9A 5F4XA 1ALDA 1GTEA 3G8EA 3MO7A 2E5BA 1RV8A 4GUIA 4JX4A 3DKJA 5D03A 2CZEA 3KX6A 1GTHA 2Z6IA 1XC4A 2X1SA 4GJ1A 3RLVA 2J27A 3LHTA 4FNUA 4BI6A 3KRZA 4EF8A 1TPDA 1OYBA 3EWYA 4OU1A 3TC7A 3UPWA 3BLIA 2X2GA 1QO5A 3EEGA 1WAUA 2HS8A 2ZRYA 4UTHA 4LVDA 1ZAIA 3NQFA 2TMDA 3LCFA 1D9EA 1O60A 5KSWA 1JVNA 2V5BA 1TTPA 1GG1A 4ZMGA 2QCGA 4Z0SA 4Q32A 1DL3A 1EA0A 3NO5A 1SZEA 4QNEA 2NUWA 4IWWA 1OX5A 3DFQA 2CZDA 1KM3A 2OJPA 5HULA 1OFEA 3O6YX 1W3TA 4HNUA 3N2MA 2YXGA 4KWVA 3H55A 5HWJA 4JYFA 3L66A 3RK8A 1ZAHA 3SGUA 1TJRA 6ALDA 4NUWA 4I7WA 1F6KA 4CQ9A 1TQXA 3LOTA 3OEXA 2V2DA 4PL2A 5C6MA 2TRSA 5A5WA 1F73A 4OT7A 4JTLA 4NXKA 2BSLA 3A21A 5BRBA 3UZJA 3GDLA 4RZ4A 4X22A 4NJIA 3QC3A 5I3GA 3HGOA 3T44A 1A5CA 3W85A 4PEKA 4Y90A 2QCCA 4QM1A 3LRMA 5AHNA 1OFAA 3BW2A 4LVBA 1LLZA 5F1VA 3PULA 1RR2A 3GKFA 3GAKA 1KFEA 2Z1BA 1H63A 4CLMA 3HQ1A 1L6WA 3QZEA 1RZMA 4ZQCA 5L6UA 3SY5A 1XI3A 1LBFA 4ONVA 1V7YA 4KKXA 2VEPA 4DO5A 1JCLA 1B57A 1BTMA 4I9AA 3KHJA 2FB3A 5AHLA 5I3KA 2Q3OA 4MY1A 2ZZ7A 4JIPA 1KM4A 5AHFA 3RF9A 3HPXA 1OX4A 4H6KA 1GEQA 1SO5A 3MI3A 2GPTA 3W87A 1TYGA 3CEPA 3W7PA 4WUIA 1PVNA 5CKSA 5K3VA 3HPSA 1H7XA 2E6DA 4NJHA 5EBUA 1H1YA 5H91A 3S5ZA 1NSJA 3N73A 4XTDA 4DF0A 1KLZA 1VQTA 3UD6A 2WQPA 3LGEA 1MO0A 2G97A 4NNAA 4JTGA 3GZ3A 2FPTA 3C0JA 4N9CA 1YXYA 1LROA 5G4EA 1JRCA 5K7JA 4FHAA 4RZ6A 3FYPA 1FCQA 3P7YA 4WQ6A 4NX0A 1XBXA 2YDAA 2BWGA 3EXRA 3PUOA 4FB7A 1ME8A 1O4UA 4IX2A 1K03A 4MIMA 3TR2A 1QWGA 4YWIA 3N9SA 3G1XA 3G8RA 4JTEA 4CCCA 3LTSA 4CQ8A 3TNOA 3CWOX 3NXFA 1JQVA 3WK0A 1IXQA 4MY9A 3OG3A 2E1DA 2OZ0A 3OBKA 4L4LA 1QPQA 3B03A 1OYCA 1BKSA 4TU1A 5AHEA 1KFCA 1F76A 2A7NA 2CU0A 3EX6A 4HPXA 4DF1A 1KTNA 2X1UA 3PF3A 5K9XA 3PSWA 2YX0A 4OV4A 4LS2A 1OX6A 3F03K 4DELA 5F2GA 1Z42A 3F4NA 1SW0A 5DCEA 1I2OA 1IXNA 3WK1A 4UTUA 2WO5A 4Y9AA 1U5JA 3VE7A 4N4QA 1SUXA 1VJIA 3K30A 2G96A 3I68A 1LOQA 1O5KA 3BVJA 2YGYA 3MI6A 4P2VA 4BF9A 1W1ZA 1LM1A 3LX9A 4WXZA 1J5TA 4M6PA 5G2IA 3S5YA 1BWLA 4IMCA 3W7MA 2YZRA 4S1FA 1OHLA 1W8SA 4LS0A 4Z1CA 2V0TA 2W6RA 4JX5A 4LVAA 2QEZA 1ZENA 1A50A 1ICQA 3T40A 5HR6A 4GC4A 4UIOA 1FCUA 3EX2A 5DBTA 1TTIA 3T55A 1RVGA 1DKWA 3HO8A 1G6CA 4O50A 3NPXA 3IIPA 5AOUA 1EP3A 1OYAA 2WSYA 3ZS4A 3WJYA 3TX9A 1WX0A 3IGUA 3MP4A 3W7EA 2J9YA 2NZLA 2RHGA 1TPH1 3B8DA 4FNTA 3S1VA 3W83A 1B9BA 2YSWA 1SW7A 5D32A 4Z0JA 4CNOA 3O05A 3DKLA 4JNMA 1QPNA 1WQ5A 1X8FA 2WSRA 4NJKA 3P62A 3YPIA 4A22A 3MJYA 4M6QA 3TXZA 4A2RA 3GB6A 5DBUA 3W1UA 1VLIA 5G1YA 4JTTA 1M5WA 4CCEA 3D0CA 3HMJG 3STEA 4AB4A 5H2ZA 3E9AA 3TAKA 3MBFA 3RFAA 1DJQA 5F2IA 5L9FA 4GE8A 4N6FA 4O53A 3DXIA 5CSRA 4MKNA 5F4WA 3U2OA 2Y62A 1JULA 3L65A 1TPFA 4RXFA 2NXHA 3GDRA 2VFHA 2W0UA 3GNNA 5IM51 1H61A 4NZJA 3A5FA 5G5IA 1IGSA 4RZ5A 4U4MA 1UJPA 3LRLA 4M5PA 3G1HA 4FNQA 2DZSA 4WOQA 4AH7A 1ZAJA 4L4MA 4XBKA 3KVLA 4FF7A 5EKYA 1K8XA 5D37A 3OVPA 2QCDA 3LDVA 2QCFA 5AB3A 1JRBA 3NNTA 3G3DA 3P84A 4AWSA 2OMAA 2DU2A 1QPOA 2EAWA 2NWRA 2ZYFA 3GDKA 3E0IA 1ICSA 1DHPA 3GK0A 5DCBA 3TA6A 1FXPA 3C3NA 4W9TA 1EUAA 3SFKA 1GVFA 3F1QA 1TPEA 3TUUA 3TE9A 3H53A 3W7DA 4O16A 2VEKA 3V75A 5DELA 5HUPA 2JKPA 3TV8A 3KVJA 4O8RA 1W0MA 3HG3A 2P10A 1JR1A 3B0VC 1SW3A 1TSIA 4TIMA 5D04C 2ZZ2A 3PWAA 2RDTA 3GDTA 3TXVA 4IPIA 3SECA 2E5CA 1QFEA 1G4EA 3C2OA 3STCA 3EWBX 1VYPX 4AMAA 4YCPA 1H7NA 2EGZA 4MVAA 3QF0A 1L9WA 1ONRA 1PCWA 1GQNA 3BPWA 5HWNA 1W5PA 3PBVA 1GYLA 3N3MA 2QCHA 3NA8A 3NGJA 5DY3A 3TSBA 1XM3A 1YDOA 3NR0A 5HQEA 3LTYA 2VFIA 3W75A 4LC8A 5EL1A 2VOMA 3MHUA 1TCDA 3W74A 3NEVA 2GQAA 1W5OA 4WXYA 4B5NA 3O63A 1NF0A 1SU5A 1Q45A 5LHEA 2QCLA 3G3MA 3C2RA 3NQCA 4UTWA 3UWVA 4O0ZA 2V82A 1ZALA 3IVUA 1FWRA 3E96A 3UWYA 1SFJA 1GYNA 2JGQA 1RQHA 1XUUA 2BTMA 4QIUA 1KA9F 1EP1A 4N2YA 5TQLA 2XN1A 1KBJA 2CW6A 3S8HA 1PIIA 4GUFA 3NL5A 1LLWA 2PRLA 1YPFA 3BLEA 5BMXA 1W5NA 2C6QA 3SIZA 4Z1DA 3RMJA 1K8YA 2CLFA 1F6PA 2CLOA 1QO2A 4YL2A 3U6WA 5AHMA 3N34A 1SSDA 4HIBA 2ATSA 2KZHA 3BV4A 1H7RA 2RDWA 4HHPA 1K7FA 3DFOA 3TMQA 5FF0A 3W7CA 5DXXA 5TBOA 1PCKA 3QW3A 4H4IA 4UNLA 3EXSA 4HSOA 3FJ6A 4K37A 4OV9A 2DZVA 2WKJA 1SZFA 3W1NA 4JGDA 4GRSA 2C0AA 3B0UX 1TV5A 1EEPA 4Z08A 5EMUA 1W5MA 3PBWA 3CIWA 4PTNA 4S2CA 2X1TA 5AYZA 1VGAA 1HG3A 5EPDA 4IMDA 5K2ZA 1GG0A 4FNRA 3QMTA 4O0KA 5D2XA 3ELFA 1ZY9A 3NQMA 1FWWA 3DFNA 2C3ZA 1KTBA 5D2YA 4O52A 4XQ6A 5I3JA 2X16A 1JCMP 4CNNA 2TYSA 1RD5A 4M7TA 4UUIA 5CSSA 3S9YA 2NX1A 1I2PA 3VFLA 2YPIA 3DFTA 2Z2UA 4LVGA 1TQJA 1FQ0A 1YTEA 3DI0A 3A24A 4UTWC 1IXOA 1Q6RA 5AYXA 5U4NA 3THAA 3NQGA 1OFOA 1ZJIA 2QCMA 4JYEA 3BW3A 3LRKA 1XCFA 3PG8A 4JY8A 1LRNA 4JX6A 3S42A 3TFXA 1AG1O 2NX3A 3G0SA 1MSSA 2NXIA 1WXJA 4LRSA 5G1TA 4ZQMA 1S5WA 3MHGA 1N7KA 3QSRA 3BGGA 4O54A 4U28A 3G1AA 3UYCA 1VLWA 5HR7A 4MUZA 3M7WA 2Q8LA 4O1AA 1CX9A 2YYUA 1YXDA 1VCGA 3W07A 2QUUA 3TSDA 3LM7A 1NVMA 4K39A 3CEUA 2G95A 2GVLA 1GT8A 6TIMA 3WK3A 2VEIA 3G1YA 3NL2A 4CQAA 3GLCA 1H50A 2CLKA 1QMLA 2C16A 1W54A 4A2SA 3RNDA 3IIZA 3SR7A 1WA3A 3EWXA 2F7FA 3PVFA 2Z6JA 2XFWA 3E49A 3LCIA 4JS3A 1LOLA 4PH6A 1H60A 5E0KA 3UZ5A 4HPJA 1T99A 3P61A 2LLEA 1R30A 4OBTA 3N19B 2E6YA 4UXDA 3M16A 2OT0A 4AEOA 2H3DA 4DF2A 1QPRA 2ALDA 2VENA 2WV8A 1UB3A 3Q37A 4QAIA 2QJHA 5KITA 5LNSA 3S1WA 2YFNA 2PURA 3W1AA 5G2HA 3O8AA 3QW4B 5CZTA 3LHWA 3FLUA 1IF2A 2VFFA 1TMHA 1TIMA 2GJLA 2VEMA 1BEUA 3NG3A 4UTJA 2ZCGA 3QM3A 4EWND 3C2FA 2CLHA 1T0OA 2ZDRA 4NT0A 3W1PA 2JKEA 1NAL1 2GQ9A 3ZWTA 3IVSA 4AHOA 4FO4A 4IQLA 2C1HA 3JS3A 3HG2A 3LCWA 1EWEA 1XDLA 3W1LA 3DH7A 1SR9A 3VE9A 4DQWA 3W2LA 1ICPA 3TKFA 3P74A 4K36A 1VS1A 4NU7A 1WOBA 1Q3NA 3LB0A 4NZFA 3TC6A 1H7WA 3LXAA 4WD0A 3BK0A 2FFCA 4OWGA 4LV4A 2FIQA 1F74A 4CCDA 3A23A 4DO6A 3EX4A 2QAFA 3IEBA 2Y7GA 1SZGA 4K6AA 2QCNA 3E02A 3NQ7A 3PC0A 3TQ0A 3STGA 1MXSA 5U7SA 2V2HA 2PCQA 1B4KA 7TIMA 4N6EA 5DY2A 4LW7A 1HO4A 2VFGA 1OFBA 4JIQA 4R53A 4O57A 4AWTA 3SGZA 3DI1A 3LCGA 3PAJA 3DHFA 3NQ2A 5C2XA 1XUZA 4DO4A 3C8FA 5G2WA 1GVRA 2Z0IA 2J88A 2G5WA 1SZNA 2WOQA 2E09A 1YTKA 4ZQNA 1AW5A 4WJEA 3OA3A 1GOXA 3HG5A 3C6CA 3VKJA 4BFAA 2ZZ6A 4XKYB 3LCLA 2AAMA 4UTMA 4S2BA 2W79A 2NX9A 3PBYA 3G1FA 4YCOA 5LGZA 2NV2A 5D02A 1VHNA 4RK8A 3FEMA 3EX3A 1EPXA 3PB0A 3R2GA 5KZEA 3NQAA 3PS7A 5LZLA 4LY8A 1WDWA 1ZHAA 3Q94A 3ABSA 1R2RA 4M6VA 4AAJA 3LHZA 1KFBA 3S6DA 4JR5A 4KFOA 3UPBA 1WBHA 4FNSA 5G4WA 3U8GA 3LV5A 4Y8FA 5CG7A 1GVQA 3W1MA 1Z41A 4GBUA 1LBLA 3E12A 3M41A 2QJGA 4O13A 4XTIA 3IGSA 2V81A 4MZYA 3GXNA 1OFPA 1XKYA 3W2NA 5K4ZA 2E5DA 1FCBA 4XWUA 4UR7A 4O4WA 3BLFA 2ISVA 4PCFA 1OFDA 2Y7EA 4Y6GA 4LWWA 1L6SA 3KVKA 1R47A 3N2XA 1ML1A 1O94A 1OJXA 3GX9A 1ME9A 4LUJA 4MJMA 1XXXA 1SQ7A 3V1PA 2HMCA 3TW7A 4UFMA 3W73A 4BI7A 5CGQA 5CPMA 1KFLA 4N9BA 4X3ZA 3LBCA 3KXQA 3T7VA 1IIGA 1UBSA 2B0MA 3NQVA 3W7RA 1Q6OA 3TK7A 5K9CA 2WNNA 4C1KA 3GIYA 4JTJA 1WBJA 3MYPA 2QAPA 1MEHA 2PRMA 4MYAA 1JCXA 3CB8A 4DBEA 3INPA 3EB2A 1GVSA 2ABBA 2EHHA 3P81A 4UR8A 1TRIA 4JICA 2I9EA 2OCZA 1QAPA 2VFEA 2A5HA 2Y63A 5FESA 3GAYA 3W7HA 3M5ZA 2VC6A 1LORA 4E38A 2VFDA 1YLVA 3QFEA 5F4SA 3LCHA 1EUNA 2BXVA 2Y7FA 3W6YA 4UFIA 5D2WA 2GQ8A 2A0NA 4IGHA 1VYRA 1FX6A 1QOPA 4O1CA 4A29A 3W2KA 5AC8A 2WNZA 4O1BA 5CZSA 3S1XA 4AF0A 3L5LA 1A5AA 1P0NA 3M5XA 4XUGA 5EY5A 2ZTKA 1W31A 1Y0EA 1G4SA 2X30A 3B05A 1UCWA 1XBVA 2A21A 1TPVA 4NNBA 4Q33A 3O07A 3LHYA 4LUIA 1ME7A 3W7IA 5IBXA 1J2WA 3WJSA 4I7UA 1AK5A 5D2VA 3W84A 2RH9A 1H51A 3L5MA 2YCEA 1PL9A 2BZNA 3C61A 4RJEA 3TU9A 3USBA 5FF7A 3M5YA 2C14A 4ZQPA 2P0OA 1FXQA 1K7XA 3I7SA 3LV6A 5J5RA 3S0CA 4IUOA 4K8EA 1UUMA 4EOUA 1YPIA 3GVGA 2NUYA 3NQEA 4JTKA 2V5LA 2F84A 4BI5A 4DBDA 4E2DA 5FEWA 3CU2A 3W3OA 3FYOA 4RR4A 1R46A 2VKZG 1KW1A 3BGJA 3UWZA 3CM4A 3R89A 5D38A 5AC6A 2C13A 3TJLA 2VXNA 3MHFA 2DJXA 3MYOA 3C52A 1B3OA 1S3HA 1TPWA 4MOZA 3TQVA 3W2MA 4DPQA 3DZ1A 1LRTA 4ZL1A 4XBSA 2A2IA 1H1ZA 2GUUA 3CHVA 3PBUA 5E1QA 3NQDA 4DEFA 3M47A 1N55A 4AWUA 2X1RA 3CPRA 5LNWA 2GVGA 4POCA 3FS2A 4UNKA 5CZ0A 3G1VA 4JTSA 1PHWA 3L9CA 1V5XA 2Y7DA 3LHUA 2UV8G 3NZRA 4P61A 3M1ZA 3O15A 3GDMA 5AHIA 2B7NA 1NEYA 5TIMA 4LVFA 2FTPA 4JY9A 5CPOA 1CW2A 5FI8A 3UXDA 4AHPA 1FY6A 3SW6A 4ADSA 3NZ1A 3NDOA 3FKRA 2ZZ5A 4O18A 3L68A 2Q3RA 3QMSA 1FWNA 2RDUA 4G1KA 1M6JA 3I7QA 2RKXA 3PM6A 2GOUA 5GVJA 3TFCA 2AGKA 4O12A 2PRHA 3CQ0A 3FA5A 4AXKA 3UWUA 5AFDA 4K8HA 2DJLA 3QH2A 5IBXC 4JD4A 1KLYA 4LTSA 2DZXA 3WK2A 1D3GA 3UWQA 4BK9A 1P4CA 4GFSA 1SO6A 1SPQA 1J4EA 4ALDA 1RQEA 1C9DA 4MPQA 1OABA 1P0KA 3M44A 2J9XA 3W22A 2DP3A 2BX7A 2Y88A 4N9EA 2B4GA 1TTQA 2YW4A 4ORIA 1TV7A 4WY0A 2ZRXA 4AF0B 4N02A 2RFGA 4QITA 1VHCA 1AW1A 3PR2A 1F2JA 3G0XA 2A6NA 3AO0A 2EKCA 2ZRWA 1TB3A 1VRDA 4E2BA 2AQWA 4YXGA 1H62A 1ZFJA 1SO3A 1YDVA 2IQTA 1MZHA 1A53A 3TAOA 1VCFA 4O14A 2DORA 3GYEA 5CZJA 3DFPA 2Y6ZA 2Q8ZA 1HO1A 1G7UA 4BWLA 1YDNA 3LLDA 3G22A 4PFMA 1G67A 4HNNA 4J9JA 2WSQA 2ZTJA 5ABTA 3P67A 4LRTA 3I7RA 3NVTA 4LC6A 4XZ9A 4HSNA 1KFKA 3QMRA 2B7QA 4MLJA 2CZ5A 3QJAA 1KM5A 3SI9A 3NM3A 1O95A 5D33A 1SFLA 4UMCA 5FEPA 3FFSA 1JUEA 3L21A 2H8XA 3MWAA 1GZGA 2WNQA 4IX0A 1X7FA 1T8XA 1Q6QA 1XBYA 4H3DA 3TIMA 1VR6A 3KRSA 3T78A 4IMFA 5HNRA 4WZHA 3O06A 3OVRA 5CPNA 5C54A 1QNVA 1DQXA 1W3IA 3R5EA 1KM0A 3STFA 4AHQA 2NXGA 2NWSA 2E77A 3I65A 1JCNA 2A85A 2ZA2A 4JEQA 1UUOA 3EWUA 3R13A 4IPJA 1C29A 1FBAA 4XKYA 4Y96A 1MEIA 4MFEA 1XDMA 1I2RA 3ABOA 4PC8A 4KFNA 3BARA 1A5SA 2GJNA 3G24A 2QJIA 3HIJA 4TO8A 4NJGA 3PB2A 2FPVA 3DENA 3W71A 4NJJA 3NQ6A 4Z1AA 4GUJA 3Q2DA 2ZBTA 2XN0A 4OHQA 1E51A 3WJWA 5K4XA 1KV8A 1LBMA 3NYZA 3M0ZA
chains in the Genus database with same CATH superfamily
1H41A 4O17A 4BJHA 5FJJA 4L1WA 4YMZA 1OGGA 4JCLA 2NW0A 1VFFA 1PHQA 2ZQ0A 3BG5A 2VX4A 1JCJA 3B4UA 5LNRA 4D72A 1XIBA 4BWLC 1CB2A 1JZ3A 1D3HA 3MSGA 4GVGA 4ERAA 2WHMA 2IUZA 4HJWA 4NQ1A 4WY0B 3BLOA 3W1QA 1LUCB 3EKZA 3LI0A 1TPB1 4ZGYA 1RPXA 3QR3A 5BNKA 3BJFA 5BW6A 4CD6A 1KCKA 3C2VA 4W89A 5H6HA 3W1TA 4QDPA 4UCGA 2FTYA 1FCVA 4MFDA 3W1XA 1F4HA 1OF6A 3VNKA 3RHGA 3EA2A 4WR3A 4UMBA 3MC5A 1GOIA 5BOOA 3GU9A 3EWWA 4IXHA 4RX0A 1X6NA 2FYMA 2PTDA 4PL1A 1JFHA 1SJCA 1TR9A 4MB1A 3R8RA 1BQGA 5HNUA 3WLJA 4M56A 3W7GA 1DOSA 4MY8A 1NP2A 1EQPA 3WLHA 4ZQOA 1W3HA 1YADA 4H19A 4J35A 4ZZ9A 4CD4A 2ZWYA 1HL8A 3GXMA 1O12A 2VEGA 3QPYA 1L8PA 3UFYA 3UXAA 2O7QA 1NOUA 1XDJA 3SSJA 1QOQA 3M7SA 1G69A 1SJAA 2EEXA 3N13A 1W2PA 2DUAA 5HDRA 4GXMA 3HBLA 2QJMA 1JAKA 3TP4A 4KRZA 1CXKA 1JAEA 1B4EA 2J6XA 3QPEA 3EPMA 3UNDA 4ZENA 1LQAA 1WO2A 2W66A 3A3HA 4BR1A 4F79A 4GMEA 4QDMA 4L4OA 3AICA 3IV8A 1MW0A 3CT7A 3LTPA 3IAPA 1XQKA 4V28A 5LA0A 4GY7A 2E40A 1E1EA 4G8TA 1W3NA 3OO2A 1TVPA 3CLMA 4Y9OA 3UPMA 3W7LA 4NZ1A 5JXQA 4ASTA 5D05A 3VYLA 4MKSA 5I06A 3IIXA 4AXNA 4EXQA 1G7VA 2JK2A 1JXKA 1BYAA 2FJKA 1EQCA 4NXSA 1TZ7A 3PZUA 2PLJA 1V6VA 5AYIA 2E7FA 1I1XA 1HFBA 2CLEA 4I7VA 4LT9A 4UQAA 4AYGA 1C8VA 3TN6A 1XH1A 1XJBA 1Q2SA 3GNDA 3IARA 1AL7A 5D09A 1AQFA 4CVUA 1OB0A 1M7XA 1W1IE 4EK7A 2YCLA 3M9YA 1XICA 4Z1BA 4PUNA 4C5ZA 5E9XA 1QW7A 1RD6A 1K3UA 1EL3A 1UWAA 1RCXB 2ZZ3A 1B30A 2V9DA 3GNRA 2QT3A 4HMDA 3WL1A 4ATDA 2EPKX 4HU0A 3QV6A 1DQWA 2D24A 4R88A 4LSBA 4PUWA 2R94A 1BG4A 3W88A 3G5EA 4S3FA 3L0GA 1E4MM 3ITCA 3W00A 1GK8A 1WDQA 3KWXA 1OCQA 2IQDA 4Q6XA 2J24A 3TYEA 3E2RA 3ARQA 3ALFA 1R9ZA 4N4PA 3NOEA 1F61A 4O4VA 4DJFD 2W27A 3WH9A 4P7OA 4K38A 1THFD 3DGRA 2R91A 1QU4A 3OPSA 3ARUA 3AU2A 1LYXA 4JN7A 1XL9A 1E6NA 1HKVA 2D73A 2Y70A 4ADTA 2JGYA 4UOJA 4LV9A 3TLLA 3F5KA 2AMGA 2J7BA 1QBAA 1TV4A 1P6BA 1KM1A 3M6YA 4IIGA 3R12A 4GA8A 3CUJA 1RPKA 3WBAA 2YFOA 1MRQA 3CUFA 4FXRA 5HINA 4Y9MA 4FIRA 4R33A 3MDWA 1RBOB 4Q4SA 1FWFC 4L1XA 3KBJA 3SRFA 3WDHA 2VOTA 1EHAA 2C18A 4NNCA 4C7DA 3BAJA 2PWEA 3FSTA 2CBIA 3IJLA 3LCXA 3PY2A 5B7ZA 4NASA 4DY1A 1A5OC 2YA1A 1KM2A 5KINA 3PG9A 1PKNA 1AL8A 1P1XA 2HSAA 4GBDA 1FWAC 1VAHA 1A3WA 1ONWA 4L4PA 1YNYA 3UY7A 1EYWA 2ACQA 4GVIA 5J8LA 1JDEA 3ITLA 1WV2A 4LB4A 1TIWA 4XVDA 4E4FA 1GORA 2DZWA 3M6DA 3DBPA 3BCDA 4JTQA 4HA3A 5KTLA 1FA2A 1UOKA 4MYXA 3O16A 3VK5A 4MF4A 1K4GA 1TTJA 2PE4A 4WKHA 4GQGA 4Q7BA 2HVNA 3VMNA 4L7ZA 1S5TA 3Q58A 4H9VA 2UBPC 3BWWA 5HJLA 2Z2AA 1KFWA 4HGXA 1K6AA 4W87A 2QUNA 3TCEA 1I0DA 2VRKA 4QJ1A 1TVLA 4WSHA 3DYPA 3IVTA 3PSVA 1NJJA 1WYIA 3GG0A 3WJXA 4HYWA 4RKAA 1QDSA 1L8NA 3KBMA 1I4NA 3AOFA 1LDCA 2OEMA 2KX9A 4O15A 1LT8A 1KXVA 3H4XA 3B04A 1GPFA 3L4TA 2WC7A 4FSAA 3WNKA 5A2CA 1KC7A 4HT3A 4S3CA 3DFSA 3GW3A 1H0IA 3BICA 4ZCWA 2NLIA 1OFQA 1J01A 2PD5A 5DXYA 4CN1A 5HPCA 1J0JA 2QKFA 4UTTC 3GNPA 2Z4GA 1HTIA 1RJQA 3W72A 1DWHM 2J74A 1Q8AA 1CTNA 4GISA 4MMWA 1DHKA 2HV5A 3LI1A 3RU8X 3JU2A 2J78A 1DVJA 3W37A 4GY0A 1TV8A 1B2YA 4IF2A 3I4KA 1U1UA 2EPOA 3R79A 1KFJA 2CLMA 4XZWA 3L5AA 2ISSA 3CGTA 4U5KA 4LUTA 1J6PA 2QGYA 3ICJA 1FDJA 1QWKA 4IIHA 1RQBA 3L67A 3QGAC 4HA1A 3E5PA 4WF7A 2VWTA 4U5IA 1OK6A 3WNMA 2D0FA 5D8ZA 3NGFA 4KWWA 3VDAA 3VOCA 2YJQA 1EJSC 1Z32X 3ATYA 1LZOA 1FH8A 3I3DA 5AYYA 4J1OA 3ITYA 2QR6A 3UBPC 1NFBA 3V3WA 4Y7EA 1UKTA 4WDUA 1RLDA 4JNYA 3GE7A 4C6PA 1A0EA 2EPMX 4KFPA 3MPGA 2Y89A 1HGYA 4EIVA 1DORA 3QLDA 3LLFA 2G8ZA 1EO7A 1KBIA 3GIQA 3UW6A 4RE2A 3LY0A 1TVNA 3GH4A 4A8LA 4Q6JA 3ZOAA 5HATA 4GOAA 4TR9A 3G8EA 1NIUA 4IZGA 5M3WA 1XC4A 2X1SA 3EWDA 1MUMA 4QGCA 1SJDA 4UOZA 4F9JA 2QYGA 4EF8A 3F5LA 1OYBA 3OZMA 4AFYA 1GZ1A 4XZHA 2R1KA 2ZX9A 6TAAA 3OGRA 3BC9A 4LYQA 4WIWA 4UR9A 2YL6A 2QXWA 2FZ8A 4ZMGA 2QCGA 2XHYA 3WLPA 1DL3A 1SZEA 4B92A 3ARSA 3UZZA 4IJCA 1OX5A 3EDEA 4MAVA 1KKOA 1JL8A 1O1HA 2CZDA 3DFQA 2Y8UA 4UNIA 4HNUA 2VGGA 4Q8OA 1JD9A 3THUA 1VJZA 5MF5A 4MNLA 2Y8KA 4KWVA 4D6IA 2ISDA 4ZTYA 4JYFA 3DG6A 1ZAHA 4R7WA 2H9AA 3SGUA 6ALDA 4HTYA 4ML4A 5A5WA 1F73A 4OT7A 4ZE4A 4AVOA 4YNGA 5BRBA 3BAWA 2YDRA 4RZ4A 4Q22A 1EKOA 3B8IA 3KCLA 4REQB 5HQLA 4BS0A 4PMNA 4J2PA 4QM1A 3QYSA 1YE6A 2BXYA 1J6OA 2VRQA 1TV3A 4A3QA 3EMQA 4GNVA 3HQ1A 3LD5A 1RK5A 1IZCA 3N29A 1FRBA 1W9XA 2YB1A 3GC5A 3SY5A 1XI3A 4ONVA 1V7YA 4GPNA 2CBVA 1UZ4A 4B90A 2WHLA 3O0FA 2FB3A 4I8DA 2XH4A 4HJFA 5I3KA 1E0XA 2ZZ7A 3QVQA 2VQUA 2GFTA 4H6KA 1SO5A 4RV3A 1I60A 3CEPA 5CKSA 5EBUA 1H1YA 1PZ0A 1XYBA 5A1AA 3KWSA 1QHZA 2V3FA 4G9PA 3LGEA 1R7OA 2G97A 1PB0A 4KW2A 4NNAA 1IYXA 4W88A 3WLIA 4MWAE 3GZ3A 2FPTA 2P8BA 3PPCA 3VDGA 3P7YA 4WQ6A 5ENLA 1DJIA 1GEHA 1E5NA 2YDAA 5D9PA 7A3HA 2IPGA 4H00A 4C5YA 3UF9A 3PUOA 4FB7A 1O4UA 2O9TA 4NZ4A 3FGCA 4PUUA 1K9FA 2D2HA 5I02A 3G1XA 2X7WA 3G8RA 4NAFB 3I10A 3WUEA 1FWDC 3CWOX 3NXFA 2ZX8A 4HOXA 1BGAA 4KWSA 4MJ4A 4W5ZA 4XZLX 5MKGB 1IXQA 2UWFA 2WZHA 1E15A 2NSXA 3GU1A 1TWIA 2V3DA 4TU1A 2CERA 5AHEA 2E3ZA 1KTNA 1PXGA 4QS6A 4YVXA 1GOKA 2GGJA 3R8GA 4QE1A 2B31A 3MZ2A 3F4NA 4GH1A 3S47A 3KL0A 5DCEA 2VX6A 2WO5A 1BXNA 1QW8A 4PUMA 4OECA 1LOQA 3WH7A 1YKWA 2QF8A 1V0MA 4JQAA 2ZDSA 1LM1A 4ZBCA 4M6PA 1XYZA 1UWQA 2KAUC 2FH8A 1R3TA 5LXEA 1W8SA 5IFTA 4DAIA 4JX5A 2V3GA 3SY1A 2OWWA 1ICQA 3T40A 3N6QA 1YX1A 1ISYA 1TWSA 3EX2A 2QULA 3K4DA 3T55A 3THCA 3AROA 5FJUA 1G6CA 2VVNA 3VNMA 5AOUA 3SGGA 3TOPA 3WJYA 2FVKA 4JQ2A 4Q4PA 4AUBA 5ABHA 3IGUA 1XKJA 2VI0A 3B8DA 4RPPA 2INFA 4EAYA 1OG6A 3S1VA 8A3HA 4CGTA 4PUDA 4Z0JA 3XIMA 3WUGA 4IISA 4CNSA 1X8FA 1XIIA 2C1GA 4DRSA 4F0LA 4J3WA 2GUBA 4R9XA 2P88A 1P7TB 4M6QA 3TXZA 3B9NA 3L12A 4LCSA 3RAOA 1E9ZB 4MHBA 5G1YA 1EJVC 4JTTA 4CCEA 3D0CA 3HMJG 1CIUA 3STEA 3NYDA 3E9AA 2XH0A 3WQCA 3MUAA 1DJQA 4N6FA 4FLSA 4O53A 4X0VA 2I57A 4EPEC 1E6RA 2J62A 2UY3A 1EGVA 2NXHA 3GDRA 4JTAA 4CQBA 3T2OA 1QI4A 3FGCB 1Z69A 3COTA 2X2YA 4FNQA 4XG1A 1BF6A 4M1BA 1E70M 3QV9A 5EKYA 3O0KA 2QVHA 1VBGA 2VP8A 1DE5A 5CBJA 2F2HA 4IIFA 1R3WA 2NQZA 2HK0A 1GW9A 3P84A 2DU2A 2EAWA 2ZYFA 3A3WA 2HPMA 3GDKA 1YBQB 4B3ZA 5A6LA 4S3KA 4CN6A 1ISZA 1HKJA 1EUAA 1A5UA 3FAWA 5I77A 1RA5A 1TPEA 3OTRA 3TE9A 4B16A 4N42A 4B9YA 4AVNA 2VEKA 2O9OA 4RL3A 1Z3NA 4O8RA 1W0MA 5C2GA 3B0VC 4DZ5A 1O7AA 4M0XA 3GDTA 3TXVA 4GNKB 4H2CA 2FJUB 5CC6A 3SECA 4C6OA 4DVOA 1G4EA 3EWBX 1LT7A 3H12A 3B8SA 3AI0A 3IAQA 4G6CA 5A6KA 2OGJA 1Q6GA 2EGZA 3QF0A 1ONRA 3BAKA 5C0QA 1M01A 3N3MA 1BWVA 5A6MA 1YDOA 1BSLA 3LTYA 2MNRA 2VFIA 4F2TA 4PUKA 1EO5A 3MHUA 1TCDA 1XR2A 3JZUA 3N11A 2GQAA 4WXYA 1Q45A 5LHEA 3H4WA 3G3MA 3NQCA 1EJWC 4UTWA 5AC4A 3QHNA 2V82A 5BU9A 4RE0A 2W61A 2WZIA 3E96A 3TA9A 1SFJA 2JGQA 1RQHA 1XUUA 2BTMA 1EP1A 3W6MA 5TQLA 1ITQA 4MM1A 4TVCA 4JFWA 2QV5A 3KL5A 2XVGA 1K9EA 4JEJA 1UP2A 2GYIA 3HFYA 2CLOA 3VIPA 4C6QA 4H2HA 2VR4A 2PDIA 1ZB5A 3LQGA 2KZHA 1H7RA 3DFOA 2GVYA 1QTWA 3PJWA 3UGVA 3QW3A 4H4IA 4UNLA 1AD4A 3FJ6A 4LYKA 4K37A 2WCSA 2WKJA 2XVKA 2XPKA 3KUMA 3B0UX 4UQDA 5CJNA 5EMUA 3PBWA 4PRWA 4PTNA 1NQ6A 4M6UA 5JBDA 5AYZA 1VGAA 1HG3A 2VC5A 7REQA 6ENLA 2D2OA 5D2XA 1JPDX 3DFNA 1SGJA 2XFFA 4ZXLA 2C3ZA 5I3JA 2OODA 2X16A 2TYSA 5CEWA 3K4AA 2QZRA 1MXGA 3GS6A 3H2NA 2V5KA 3LSCA 4LANA 1E6PA 2YPIA 1ZS2A 2J7CA 4Y9NA 1YTEA 1CLVA 3A4AA 3DI0A 4AZCA 1GOQA 1IXOA 1H5VA 3THAA 3O2LA 3AQUA 3H2EA 2EBNA 1Q6EA 3UU0A 1XCFA 4JY8A 4D9PA 4JNZA 4Q8QA 3URBA 1T6MA 2HNHA 2NXIA 4LF1A 4U3CA 1C8QA 3BGGA 3HV9A 3M7WA 3W27A 1GW1A 2PODA 3BMVA 4S3DA 1FVPA 4IMAA 3CAVA 3RJXA 3BLLA 4O1EA 2RDXA 3G1YA 1NWSA 4CQAA 3PZIA 2CLKA 3WQGA 1W54A 5ECVA 1ISWA 1JYXA 3PZ9A 3WQ4A 1XIGA 4RNIA 4IP5A 4GQRA 3EWXA 2F7FA 3PVFA 4QG9A 1LOLA 4PH6A 5CSUA 2FZBA 4GLEA 1T99A 1IEWA 3CUZA 4TXEA 3WQEA 4MWAD 2E6YA 4UXDA 1J5SA 1V79A 2H3DA 2O9PA 1XFCA 1IEVA 3Q37A 4FXJA 5KITA 3S1WA 3PFMA 3VKAA 3W1AA 5G2HA 3T09A 4B91A 1X6LA 3FLUA 1XLEA 2GJLA 1BEUA 2BVTA 3NG3A 3QN3A 4UTJA 4DWSD 3EOOA 1I6NA 3NXLA 3QM3A 2EG6A 3ONBA 4W7WA 2WBGA 2ZDRA 2VUNA 4NT0A 1AZ2A 3IVSA 2XJ7A 4IQLA 3SRKA 5HJYA 3PZNA 4AZHA 3HG2A 4GI9A 3W1LA 1SR9A 1SZRA 1A3HA 3W2LA 1KGXA 3P74A 1Z89A 3TTSA 1WOBA 1Q3NA 3VCNA 2QQ6A 3OYZA 3RM8A 3VD9A 1FWGC 4GACA 2I16A 2OG9A 5AVHA 2PTWA 2J75A 3EX4A 1QOXA 3IEBA 2A3AA 3K46A 1DJZA 4CU8A 3M0YA 4K6AA 2QCNA 3RPDA 2WMFA 4C6IA 1MXSA 2PCQA 4F0MA 4N6EA 4AZCB 1YMYA 3R10A 4PYSA 4BQ4A 3AHYA 4YTUA 4R53A 3SGZA 4ZFMA 1M53A 2EKGA 3DHFA 3VGEA 3NQ2A 1XUZA 1UD2A 5CZKA 2PDHA 2WVVB 4DO4A 4MKVA 1RY0A 3BAYA 1SZNA 2GOKA 5DQPA 3VNIA 4ZQNA 1GQJA 5FD0A 2BHZA 3OA3A 1WZAA 3VKJA 2BG5A 1TE1A 5FA5A 4M51A 2AAMA 2W79A 5DX7A 2NX9A 3VIMA 1UWUA 1GNXA 4AQLA 4F2BA 4YTSA 2VMFA 1EPXA 3PB0A 4GIAA 4KH2A 3NQAA 1NWRA 3PS7A 5LIKX 5LZLA 2JEPA 2ZICA 1WDWA 4LY8A 3VGFA 1R2RA 1VFHA 4AAJA 3ZMRA 4PTDA 4AX6A 2AKZA 3PNZA 2VZTA 2ZC8A 3JVAA 3U8GA 3VDCA 2WAGA 4AZ6A 4P8UA 3VDBA 1GVQA 3W1MA 3WYZA 3L4XA 4XAFA 3CQKA 4O13A 4ZSTA 2O55A 1OFPA 5I03A 3VAVA 4BY3A 5K4ZA 1JZ8A 1FCBA 4DO7A 1MNSA 3BLFA 2ISVA 4Y6GA 2Y7EA 4H9ZA 1L6SA 2Z27A 3KVKA 3GX9A 3WSUA 3KM8A 1Y8BA 4QAWA 1XXXA 2CKRA 1ADSA 2PDMA 3TW7A 5I0DA 4CCZA 3N25A 5CPMA 4HPNA 1XG3A 4N9BA 3PWGA 1UBSA 3BUVA 3URAA 2BVDA 5K9CA 2IPFA 5CC5A 2GDQA 4JTJA 5LYRA 5HNTA 2G41A 4MYAA 3OODA 1JCXA 2BGNE 4DBEA 3INPA 5C8BB 5A8MA 1G94A 4EX4A 2EHHA 3AHVA 3ZM8A 3UR5A 2OSXA 3IK4A 2I5IA 1SVDA 4DJEA 2OCZA 2A5HA 5FESA 2GSJA 2WBKA 4GIEA 1EBHA 1LORA 1DXIA 1UD4A 3LGDA 3K13A 3QFEA 5F4SA 1KBKA 3L23A 2BXVA 3MVIA 3W6YA 1D8CA 2WB5A 3T8QA 4UZUA 5CSYA 4PMUA 2CXGA 4A29A 3L5LA 1PX4A 1P0NA 3CL7A 5EY5A 1E55A 4FK9A 2PGWA 3B05A 3WH8A 4Q33A 3O07A 3BCJA 3HFTA 3MUZ1 4XD3A 5IHRA 1L6GA 3K8KA 3E0FA 3REQA 4DUWA 2WMIB 1J10A 3NSXA 2DIEA 5I2UA 2WVUA 2YCEA 2BZNA 2F8QA 3TU9A 3USBA 1UZDA 2PDKA 4ZQPA 2P3ZA 2P0OA 1K7XA 1OBAA 4XZBA 3S0CA 2JFEX 1XLKA 3ZVHB 4JTKA 4AEFA 1R5YA 3WD1A 1TJ2A 4DBDA 4E2DA 5HPOA 3FYOA 4B5VA 1EJUC 1U2YA 3UWZA 5HMDA 2VXNA 3MHFA 1ODZA 2PDBA 1EF2A 1N8IA 2Y2WA 3KW3A 1S3HA 3TQVA 1FWEC 1R3RA 1UWSA 1AVAA 3N2CA 1J93A 4DEFA 3V0UA 4DI8A 3CPRA 3SUVA 4AY1A 2ZXQA 2XDFA 3NSNA 1AQHA 1QHPA 4JTSA 4GQQA 3M1ZA 4UOQA 1CXHA 3SB0A 2X8RA 1UHVA 3O15A 3G6MA 1DP0A 3B9DA 5BROA 3GDMA 1REQA 3CHCA 5CPOA 4NYUA 3T8LA 5FI8A 4AHPA 1FY6A 3HU7A 3NDOA 3L68A 3OG2A 3QMSA 3CPUA 1ZRQA 4G1KA 1NWUA 3R6IA 4JFTA 1XISA 3TFCA 2AGKA 3S4TA 4WGXA 3SUSA 3OJGA 1KLYA 2OVLA 3RX4A 3WK2A 1DTNA 3CH0A 2DW7A 2NVDA 4BK9A 1P4CA 4GFSA 1SO6A 1RQEA 3M4HA 3CV6A 4XVEA 2G3NA 2B4GA 1SFTA 2X1IA 4AD1A 1AW1A 2O56A 1F2JA 3PR2A 5H8MA 3E1F1 2WPGA 2ZRWA 1TB3A 2VC7A 4PBGA 2AQWA 4YXGA 5AKQA 3P2VA 4KGJA 2PWFA 1YDVA 1DYSA 1MZHA 1A53A 4ZFCA 1VCFA 1Y5WA 2QIIA 3OBAA 2HDJA 4LAOA 4F8XA 2Q8ZA 1CPUA 3SSZA 4W8AA 1GHSA 4PFMA 3OLGA 5GNXA 4EPDC 3TYZA 4RE4A 1J0YA 3BSGA 1A5MC 2AL2B 4LRTA 3NVTA 4LC6A 2VL4A 3HPAA 2B7QA 3LQLA 4MLJA 3QJAA 2F6UA 1O95A 4TTUA 2POTA 3L2MA 1SFLA 2CYGA 1E71M 4UMCA 5FEPA 2OWXA 3GZAA 2VGIA 3KOZA 1EZ2A 3IUHA 1GZGA 2WMHA 2ZXDA 1X7FA 2AL1A 1Q6QA 4H3DA 3WQWA 3KRSA 3WMCA 2DZBA 3O06A 3TONA 3RIKA 5C54A 3PNUA 1CXEA 3DOPA 3KZSA 1W3IA 3GM8A 3WEMA 2XSAA 2NVAA 4A8NA 1UR8A 3VGBA 2D0GA 2A85A 2ZA2A 2I17A 4G7FA 4IPJA 5I07A 1FBAA 4XKYA 4MFEA 1I2RA 4KFNA 4FOJA 3TYAA 2GJNA 4TO8A 4ICMA 1X39A 3PB2A 4GYPC 2VURA 3W71A 1Q8JA 3CZKA 3M0ZA 4HD5A 4YU1A 2A3BA 4DM1A 4B5UA 3H2AA 1PYFA 3VO0A 2XYLA 1FKWA 3M64A 5TF0A 1F05A 2O4QA 3Q65A 4LUSA 4EAMA 1QBBA 5AZ0A 3DBNA 1XG4A 4UQ9A 4MB3A 5J5DA 1Q7ZA 5IXEA 5IRPA 5HA7A 3QTPA 4M19A 3LERA 1HJWA 3TZFA 3TSMA 1JQXA 3IGHX 5I78A 5EMMA 5T91A 5IOBA 1H7OA 3PZOA 1FHVA 1XS2A 4C65A 1X1OA 2Y85A 3TJXA 5CQ1A 3GR4A 4NHVA 1AQ0A 3WNLA 2V2CA 4WY0F 3W26A 4LNYA 4EACA 3ITXA 1JD7A 5G4HC 3APYA 4QCEA 2J8GA 1BTCA 2ZRVA 4AIUA 1V93A 4JYDA 9XIMA 5HK4A 1OF8A 3P82A 4A3UA 3WJZA 1XLBA 2ZA3A 4XZNX 2QCEA 3GKAA 3HG4A 3KOXA 4XSMA 3UCQA 1BRLB 4L6DA 3QQ1A 1OG0A 4EVZA 4P8VA 3OA5A 3FEQA 5HUOA 1W9BM 2E6FA 1RH9A 1K8CA 4G56A 4D6FA 3HPZA 3HGRA 3A5VA 1NU5A 3KZPA 4RXGA 4DYKA 2XM1A 2PWHA 2HWGA 2C91A 3QGKC 3NQ8A 3GD6A 1N82A 3U2CA 2CFFA 1O68A 4JDYA 3WQOA 1MYRA 1T96A 1M7PA 2CZFA 2DT1A 3GG1A 2XVPA 4L9XA 1B3ZA 1HKKA 1V6YA 1U83A 2A7RA 5FF4A 2HPIA 1HJSA 3WFAA 3ABRA 4HK7A 4PRRA 1WE5A 3M0KA 4CQCA 1NFGA 3T81A 3L0NA 5ABFA 3KEHA 1GPWA 2CLIA 2IPJA 2PWVA 2A7PA 3DU0A 5B7YA 1ZUAX 1UD3A 3IK2A 3K8MA 1NDYA 1JI1A 1TZZA 2E6AA 3M46A 1CI1A 3UY8A 3JRKA 4Q4RA 1QATA 1XQLA 1ZU8A 5FEZA 1O1ZA 2PTYA 3OW1A 4CU6A 2WLYA 4M8UA 4LYPA 1LWJA 1UKSA 4UFHA 3G1SA 4CEUC 1F7BA 4K2SA 1YRRA 1WPCA 5F2LA 2A1YA 2HVOA 4GUGA 2HEJA 2PP0A 1QI5A 4KBXA 3W81A 5FCZA 3WLQA 1A5NC 1E56A 3OIXA 3ZLGA 3AWNA 3VNZA 3AMLA 2VGBA 3GR7A 4P7LA 4GXPA 4MTVA 2GJXB 1QI2A 1YDYA 3AXMA 4R9OA 1S5VA 1Z48A 3CUGA 4TX9A 1EX5A 4W86A 1EIXA 1O5XA 5E9AA 1ZGDA 4PCNA 1TJPA 4JDBA 2DZPA 2ZKMX 1X1ZA 4ZXOA 3AMKA 4LU0A 2OQLA 3AS0A 4X2RA 4XD6A 3SAZA 4XK2A 3WQDA 3DC0A 3CB3A 1MFVA 5T9BG 2DSUA 3ZWSA 1PAMA 1M7OA 3KRBA 2Q71A 1RP9A 1VFOA 4ATLA 4RCXA 1EYEA 2VR5A 1V3JA 3N4AA 1ZPTA 4GQ0A 3L0KA 4L6HA 4CNUA 2POZA 4FA3A 1W6TA 3W7QA 2DVTA 3WMBA 1EC7A 3W01A 3O9NA 1WB0A 1VYSX 2J66A 1OX4B 5LIUX 1WKFA 2H8ZA 1V0KA 1SSGA 7TAAA 3M43A 4FNPA 3SCRA 2GDVA 1Z7AA 4B15A 4GJIA 1TJ0A 4E4PA 2HBXA 1W56A 5HAOA 4WRHA 2ZZ4A 3MA8A 3P80A 4IMEA 1ECQA 1C7SA 3O6DA 1C92A 2BY2A 3OLDA 1TPC1 2VRJA 5CGTA 5F2MA 4RLIA 3RRAA 4IIDA 1DWIM 5DN1A 2A3EA 1TREA 3QFWA 1MFUA 3GR8A 3RN6A 4KRTA 4GD0A 3N04A 5KZMA 3JUGA 1GHRA 1H5YA 4PODA 1HW6A 4GINA 1EWDA 2DSKA 4RW5A 1GKRA 1QCWA 2VNCA 4HNTA 3LHVA 2JIEA 3G18A 4O11A 1UKPA 5EMJA 4O28A 4JIRA 4HCLA 4LS1A 4MDPA 4NAEA 4TVUA 3LXCA 4XUYA 2A3LA 1E43A 3MCNA 2Z1SA 4PN2A 3UR7A 5EU9A 1UROA 4FMVA 3NPWA 3W9ZA 3VNDA 4FX8A 1MW2A 5A69A 4WK9A 2ZRUA 2WMGA 1ZP4A 4HKPA 2OXNA 1XINA 4GI6A 4GYKA 2FHFA 3QR1A 1VFLA 1FWTA 3ATZA 1KWGA 5E93A 2XSXA 3UJEA 2P1FA 3PANA 4WSJA 3MP5A 4K7VA 3DHPA 2PD9A 1OFRA 4E0CA 4PGLA 1TPUA 2YBTA 5HQMA 3Q4DA 3O6CA 1GQLA 3BSHA 1JCYA 1R3QA 5A8OA 5FAJA 4XX6A 7ENLA 2PEVA 2ODOA 3CUHA 3QOKA 2OLSA 1XLLA 4ZE5A 1XH2A 4QROA 1MMFA 3DAQA 4HN4A 2PDUA 3F4DA 3ZLHA 4G7EB 5EA9A 3A4WA 1X6UA 5FF2A 1JUBA 3NM1A 4AZGA 2VM8A 3GBDA 2Z7GA 3M0VA 3T0DA 4P5UA 4EE9A 1KQYA 4JN8A 4QDWA 2QUVA 4GI8A 3N17A 4AZ5A 3IJDA 2C15A 3GWQA 1Z44A 3GXTA 1B9ZA 1BLIA 1Q6DA 2VHLA 4BF5A 4LXFA 4JTIA 4D6CA 3POHA 1WKEA 4UFLA 2OQHA 4QNWA 4MJ2A 2XIIA 4J5NA 3CIXA 2EXOA 3UZWA 3CS2A 4TX8A 2QCDB 5HWMA 3N9RA 4OE7A 1H2JA 1IIHA 3KTSA 5LSMA 2H90A 1A4MA 1OY0A 1NM9A 3W2UA 3FV9A 3UCCA 1XIFA 1AUSL 3HA1A 3CTLA 4IL2A 3VC5A 4NAEB 2C0HA 3SRDA 4GI4A 2PZNA 3PZMA 3IIVA 1UH2A 1B3YA 2GGIA 2YCKX 3PUDA 2REQA 3MVTA 1FWJC 3WLNA 1UZ1A 4QJ5B 4UTLA 5F1UA 4QISA 4E5TA 3QBUA 3CV1A 3WKZA 5XIMA 3LUTA 4AIBA 4DJFA 2ZVRA 1U30A 4E8GA 2NV1A 4YJ5A 2JE8A 3EOSA 5CLTA 1WXZA 3MO7A 4DB7A 2P5NA 4AW7A 4GUIA 4JX4A 3DKJA 2IXVA 1P6WA 2V67A 2VO5A 1GTHA 3KX6A 1E73M 2Z6IA 3RLVA 3VKCA 2X41A 4FNUA 4X2PA 4KPLA 4OU1A 3UPWA 3BLIA 1QO5A 2ZUSA 1WAUA 2HS8A 4HU3A 3DX5A 4LVDA 1ZAIA 5C7HA 3UJSA 1KR0A 3LCFA 5KSWA 3N6HA 2ZX5A 1QI0A 2D69A 3PPFA 1V3MA 2WZEA 3AJ7A 4QNEA 1E3ZA 3D3FA 1UPMB 2XUCA 4QCFA 5HULA 3SM0A 3C5QA 3D6NA 2OKOA 4D6DA 1TWZA 1A0CA 1E9IA 1UR1A 3EYPA 4RZBA 2ONEA 3H55A 1TZ9A 2VDGA 4QG8A 3SUTA 3WLKX 3L66A 3H7RA 3KOYA 1ODUA 1TWWA 2HK1A 4CQ9A 3SUWA 4J3VA 3OEXA 1DJGA 2TRSA 4H04A 4NXKA 3A21A 3T2PA 3TWAA 3UZJA 2OEJA 3GDLA 4X22A 4NJIA 4A3HA 1WZKA 5I3GA 3SUUA 5IHSA 3PWIA 4PEKA 2FGLA 3LRMA 3BW2A 4QX4A 5F1VA 3PULA 3KS6A 1KFEA 1HXJA 3MB9A 1H63A 1CEOA 2BBFA 4S3BA 5C9RA 2I9UA 4PTMA 3QZEA 1YIXA 5C9UA 4S3GA 1OGSA 2QMJA 4HOWA 3TLQA 3ZT5A 4B2DD 1QASA 4I9AA 2ZADA 3KHJA 4WSKA 5AHLA 4DBWA 1EJ7L 1KM4A 5AHFA 3DG3A 2WQDA 3RF9A 3A47A 3APGA 1KNWA 2XFRA 4R85A 2DH3A 3F7JA 1QI3A 3HPSA 2E6DA 3ISIX 4NJHA 3LGGA 3S5ZA 4CN4A 3QKZA 5TD4A 4XTDA 4DI9A 1VQTA 1CB7B 3PBGA 3UD6A 2WQPA 1AD1A 1MO0A 1MQQA 2V63A 1NP0A 1QNPA 1JEZA 1W3LA 3TCSA 1JYNA 2WM0A 4IPLA 4IUGA 1ZP3A 2F61A 1OSEA 4RZ6A 3FYPA 4W7UA 2PDNA 2WW5A 1IWBA 1XBXA 4DN1A 2PU0A 5CBIA 4IQEA 3TR2A 4MIMA 1XLAA 1NARA 1UOZA 3VKDA 2OZTA 4L56A 1LLOA 1ZZMA 3LA4A 4J40A 5BRQA 1ZBVA 4CCCA 3LTSA 4CQ8A 3TNOA 5GJPA 1S1PA 1JQVA 4KQNA 2B81A 4MY9A 2PDXA 4M80A 1E4LA 1PIGA 1ZL1A 4L4LA 1CECA 1W9VA 1KFCA 1F76A 2CU0A 3B4YA 4HPXA 4DF1A 4OV4A 2G0WA 4LS2A 3F03K 3CZ8A 4OBSA 5F2GA 3T1GA 1IXNA 1ZBWA 5BXTA 2DIJA 1UC4A 2QIWA 1QJWA 3VGHA 1VJIA 4W5UA 2ZX6A 3AS2A 3I68A 4K3ZA 3ES8A 1D8WA 2YGYA 5LXXA 1W1ZA 4DYJA 2DQXA 3RCNA 4WXZA 3U0HA 5G2IA 1JZ6A 3W7MA 1XLCA 4CD7A 1LG1A 3BH4A 1OHLA 2W6RA 4MB4A 3UNTA 3CWHA 1ZENA 1FWBC 4GC4A 4UIOA 1R3VA 1PEZA 3HN3A 4O50A 1SR0A 3WCZA 1XIMA 5A6AA 3IIPA 4XKMA 1OYAA 3ZS4A 1EEXA 2OTDA 1WX0A 4JIHA 3MP4A 2NT1A 3W7EA 2D23A 2PGFA 2NZLA 4FNTA 3ZYZA 5LIYX 5HXMA 5D32A 5DT5A 1UWRA 2HVMA 3IACA 1VF8A 3V18A 4JNMA 2OFJA 4B5XA 3ZZ1A 4NJKA 2R24A 4XSLA 3P62A 3AIBA 3YPIA 2GWNA 4J3TA 3A3XA 2WANA 2UY4A 3MJYA 1PZ3A 2GZXA 4A2RA 3GSMA 1VLIA 2PUZA 1M5WA 4YHEA 4AB4A 5I7GA 1KRAC 1ITUA 3RFAA 5F2IA 2BODX 3WELA 4FLOA 4JQ1A 5CSRA 3DXIA 5F4WA 4ES4A 3GFZA 4MPKA 3L65A 1TPFA 3DHUA 2BVYA 5EGRA 1OIMA 2R9RA 1WNOA 2FVLA 4NZ3A 4U4MA 1UJPA 3E2QA 3LRLA 3GFXA 3N15A 1YPXA 4WOQA 4AH7A 4CKQA 1B5TA 4FPSA 3VD7A 4XBKA 4FF7A 4G5DA 4AD4A 4Z2IA 1KGUA 3LBOA 5JQ9A 2EPLX 4GIRA 4Z42C 2QCFA 4RW3A 1JRBA 1E1CB 2OB3A 3G3DA 4AWSA 2PGRA 3DECA 4X60A 5DCBA 1XWYA 3SFKA 1GVFA 3H53A 3W7DA 4MG4A 1JYWA 3V75A 2W3ZA 3CL6A 3TV8A 3V36A 1TSIA 1V6TA 2PWDA 2ZZ2A 3PWAA 2RDTA 3O6AA 5A3HA 3CH9A 3LK6A 2QJNA 2NT0A 1W2VA 3KCOA 4Q7IA 4GFIA 1DWAM 4KEUA 1VYPX 3VGDA 3SDOA 3DDMA 1PCWA 1GQNA 1TMLA 4JHOA 4BA0A 1W5PA 3NA8A 1E0UA 3H7VA 3V35A 3GIPA 3RR1A 4A05A 3W75A 2FMOA 5EL1A 4QRNA 4Q3MA 4Y8EA 4B5NA 3QY6A 1F4AA 3O63A 3ZJ7A 2Y8VA 5A6BD 1HT6A 3GYCA 3VM7A 4I6VA 3ALGA 3WQPA 2PFHA 3F4CA 1CNVA 1YQ2A 2VC9A 3ZXWA 4CUCA 1UP0A 4E8DA 2XN1A 2ON3A 4GUFA 1WUFA 1BKHA 5DMLA 1Z9AA 3DN5A 3O3RA 4TV5A 2NQLA 4B5WA 3UR2A 3R94A 3UETA 3SIZA 2BDQA 1K8YA 1X97A 2CLFA 4YL2A 3U6WA 3MY9A 5EMYA 1SSDA 4HIBA 2ATSA 4HHPA 1K7FA 1Q7MA 3M0JA 2UY2A 3EXSA 3RG6A 1J8VA 1P43A 4H9TA 4Q8PA 1B3VA 2PDWA 2PLCA 4AZIA 1SM9A 1Q6CA 4LF2A 1H1NA 2PP1A 4E2VA 3LEPA 3QXBA 5EPDA 4IMDA 5JH1A 1GG0A 3WQ5A 3R4IA 3II1A 6XIAA 4AZBA 1AA1B 4QP0A 4W7VA 3ELFA 3N4FA 1RUSA 1LWIA 4Z2HA 2ZX7A 3LNMA 2VWSA 4B3KA 3DEQA 2PDLA 1KTBA 5D2YA 4HA0A 4O52A 4OZOA 4XQ6A 1S46A 1RD5A 3GNXA 2NX1A 1KRMA 1IEIA 3DFTA 3W38A 2Z2UA 1FQ0A 4P7NA 3EA3A 4O1FA 3V16A 1HX0A 2DSZA 3TTYA 1Q6RA 5U4NA 1KR1A 5DMNA 4JYEA 2QCMA 3LRKA 3OZOA 5E09A 1AG1O 2NX3A 3G0SA 2WSPA 1MSSA 3LU2A 1WXJA 4AC1X 1HP4A 3NOYA 3MCMA 2GJPA 3AC0A 1AH3A 4PTWA 3U4AA 2BB0A 5DO8A 3VFCA 4MUZA 3VKKA 3MO4A 3W07A 4HZ8A 1NVMA 3AMDA 4K39A 4A4AA 1GJWA 4X63A 4LAUA 6TIMA 1JZ2A 4M81A 1PJ9A 1H50A 2BOFX 1QMLA 1LL4A 3AIWA 1EIBA 3PTKA 1C90A 3WDIA 2Z2BA 1JDCA 3DCPA 3AXIA 2R1MA 1WA3A 4US6A 1SFSA 3E49A 3LCIA 1H60A 1XLHA 3P61A 4XD5A 2VD8A 4OBTA 3TNBA 3N19B 2GSEA 4YPJA 2OWCA 3K2GA 2VCBA 3M16A 2OT0A 1QPRA 2ALDA 2WV8A 1UB3A 1C8XA 3IJ9A 1OADA 4KWOA 2QJHA 5CCZA 2YFNA 4ZO7A 1TIMA 1HGWA 1E4NA 3CO8A 3C2FA 2TODA 3FK4A 1NAL1 4FO4A 3QOMA 2YDSA 4FR6A 4U31A 3GHSA 4D1IA 5GJMA 4K1GA 4K36A 3E38A 2CHRA 3QLLA 4DX3A 4W4QA 3LB0A 2E8ZA 4H9UA 3CMFA 3LXAA 3F5JA 1BF2A 5FL1A 1LJYA 2ZUUA 3DYMA 4XZIA 2FIQA 1TA3A 3A23A 4DJDC 3SEPA 1AMYA 2GSHA 4RDYA 3M0HA 4H41A 1S1RA 3PC0A 2Z26A 3STGA 5U7SA 4XIAA 2OELA 5D4YA 3VIHA 2VFGA 2FTWA 4LBSA 4GZIA 3DI1A 4TV6A 4AZ7A 1P0BA 3T9PA 4AYSA 2J8TA 1S2WA 3FY1A 3GO2A 2DEPA 3H2MA 3TEVA 1C8YA 4EPBC 3OVGA 2WNWA 1AW5A 1XV8A 2EJ1A 3ZO9A 3MSYA 3HG5A 3QC0A 5CAKA 1MZRA 3P93A 2ZZ6A 2ZOXA 1H3GA 1KWKA 1BYDA 4LBUA 1T7LA 3G1FA 5JVLA 5LGZA 3SN0A 1VHNA 2V3EA 3BLKA 4YWSA 3RLGA 5C9WA 2XIBA 1Q2RA 5KZEA 1UR9A 2YBUA 3Q94A 3TOYA 3GG7A 3LHZA 1HN1A 2WM1A 4QHRA 2VZUA 1QNSA 1B31A 2JQXA 2TAAA 3TJ4A 3LV5A 2DT2A 3MUY1 1F07A 2CBUA 3B8UA 1MW1A 3GH5A 3E12A 1UD6A 3MT1A 3R11A 4P7RA 3PP7A 5F7UA 5DRIA 3N6JA 4FXFA 4MZYA 3GXNA 3B97A 3PJXA 1AJ2A 1E4IA 4R3UA 2ISFA 1H09A 4GHRA 2PGEA 1EZWA 1XIEA 2DT0A 1XH0A 1VPQA 1ME9A 1NTHA 2WWCA 4MJMA 1HZYA 5BXRA 1NDZA 1FFQA 4UFMA 2GUYA 3W73A 2IKIA 4HQVA 4BI7A 3KL3A 3FHAA 1L0PA 2VD9A 5BWFA 4C1KA 1WCGA 4GZ7A 3MYPA 2QAPA 3EPOA 3W28A 3WEOA 4M24A 1GVSA 2ABBA 1Q65A 3P81A 1CGXA 1ZLPA 4UR8A 2VZOA 1ESWA 2I9EA 3WN6A 1F3TA 1QAPA 3THDA 2Y63A 3GAYA 3W7HA 2J6VA 3W4RA 4IP4A 2IQ0A 4E38A 4F48A 4PULA 3UA3A 4URIA 3WF2A 1R9YA 4UFIA 5D2WA 1XIHA 2FFIA 4IGHA 1VYRA 2QVNA 3CZLA 4O1CA 5ECUA 4O1BA 4Z2LA 3DFYA 4HB7A 1W31A 2PDCA 2VZSA 1Y0EA 4BHYA 1GOWA 1TPVA 1F3WA 1UMLA 4LUIA 1LF1A 3N2OA 3W7IA 5D2VA 3VGGA 2ZXAA 4MWAA 3UYIA 2RH9A 4HMEA 1H51A 3FX4A 3ITGA 3KTXA 1WDPA 3LNPA 4RJEA 5FF7A 3M5YA 4PBFA 4LJ3A 3S6OA 1FXQA 4ZEPA 2OQYA 3LV6A 1OQFA 2VJXA 1FWCC 2PA6A 3GQYA 1JFXA 2W67A 1EOMA 4DWSA 3KLKA 5RUBA 2F84A 2XM2A 3W3OA 2OYKA 3R89A 3K4WA 3MYOA 3C52A 3VOHA 1E5JA 3WH6A 4ZL1A 1QXLA 2GUUA 4WDXA 1M41A 3M47A 1N55A 4AWUA 5LNWA 4GGBA 2YCLB 2GVGA 1BPLB 3STPA 4EXAA 4Z17A 1GKPA 1PHWA 4PMJA 5JIPA 3MZNA 2G4JA 4GKLA 3TC3A 4P61A 4IL0A 1NDVA 3GY1A 3UWEA 4F0KA 3VIIA 5GNYA 5AHIA 5TIMA 2JEQA 2VGFA 5FSDC 2BY3A 1CW2A 3CHDA 3UXDA 1GVIA 2PB1A 3GU2A 1G9HA 3NZ1A 3NDYA 3S83A 2DY3A 3FKRA 1FWNA 1WDDA 2ZUVA 1B3XA 1VENA 2RKXA 3BQ6A 4P8XA 1TWDA 1B3WA 4YYCA 4O12A 4O0QA 3CL8A 4RNJA 3CQ0A 4D6GA 1BYCA 4ACZA 2PWGA 2FGBA 1EHNA 2DJLA 5IBXC 4JD4A 3T42A 1CENA 3B9OA 2OYLA 1D3GA 3ZJKA 3NEHA 1SPQA 1J4EA 5H1WA 4MPQA 4CNTA 1OABA 1UD8A 2J9XA 3S2MA 4W93A 1K1DA 2Y88A 1FHDA 2IXUA 4KS0A 4ORIA 4UBPC 3MMUA 1EJXC 4CVWA 4PB3A 3DIPA 3BLPX 4JFSA 5A8PA 2RFGA 3SQMA 4ILSA 1ZFJA 2WVSA 4GZEA 1SO3A 4H6QA 3KTCA 2ADAA 2CCRA 3RO6A 4J28A 5FJTA 3DFPA 2Y6ZA 4CU7A 4BQ2A 1G7UA 4PB5A 4BWLA 1MRAA 4Z1YA 3NQBA 2WXDM 4HNNA 3NO3A 1PDZA 3BL3A 3P67A 1RALA 1HF6A 1WZLA 3I7RA 3MSDA 5FSEC 4DWSB 3QMRA 1T41A 2QW5A 3WF4A 3APTA 3SI9A 3E6EA 3WL0A 2CLPA 3CQHA 4LCQA 1IT0A 2DT3A 3L21A 4IX0A 1XBYA 4C6NA 1VR6A 4KETA 4JAWA 3T78A 4IMFA 5FKYA 5HNRA 1POJA 4TUFA 4GGHA 5CPNA 2PS2A 5LA2A 2E77A 4C1NA 3I65A 1VEPA 1UZHA 2PDJA 3MSRA 1JCNA 5C2CA 3CZJA 3B9AA 3FA4A 3U2ZA 1UUOA 1FTXA 1C29A 1AFSA 4Y96A 1MEIA 3RJYA 2CEQA 5FACA 4L80A 1XDMA 3SJNA 3ORWA 3WLRA 3BARA 2HQAA 3HIJA 2QJIA 3VOJA 2QV4A 4HK6A 3BURA 3DENA 4NJJA 4QR6A 3ZJ6A 4GUJA 4Z1AA 2XN0A 1PTAA 1LBMA 3CO4A 4R27A 1WDRA 3BOLA 5KMYA 3AIVA 3TROA 1VH7A 3B0PA 2R8WA 4E6MA 2TPSA 4JFUA 3NL3A 4HK5A 4NZ5A 3CJPA 2CWNA 3G0UA 1Z6KA 1PTGA 4MADA 1GKQA 3MP3A 3T08A 3EXTA 2ABAA 3EEZA 2CESA 2XISA 3BQ5A 2XIJA 4KRUA 3TN3A 4MZ8A 5CJ5A 1JJKA 5BMWA 3MKKA 3N14A 3BV7A 1XYMA 4GK8A 1AQMA 2PTXA 1DIOA 5G1MA 3DHDA 1R2TA 5C5YA 4E3TA 1QR7A 3FIGA 4LUTB 1OVDA 4IGMA 2J79A 3GUGA 5I3FA 3H26A 3P0WA 1Y5XA 2CNCA 3VC6A 3L2IA 4Q8VA 1D7FA 3S1GA 1XRSA 2DV0A 4LFYA 4HCHA 1ZJHA 1DV7A 1E3XA 4EF9A 1JDFA 3KS5A 6XIMA 3HOJA 3S6TA 2QUTA 3ARRA 4ML9A 4OGZA 4GNJA 2EF9A 3EDFA 4XAZA 1J79A 2YCIX 2HS6A 3GUWA 4NSBA 2WKGA 1U22A 4ORMA 3C2YA 3CQJA 1W91A 3QYQA 1A5BA 3CAWA 3OZYA 3TMLA 1JF6A 4AU0A 3FW6A 3M5VA 2D2GA 1ONXA 5AN7A 5EYWA 1R3SA 7PTDA 3DFHA 1Q4NX 3EPNA 2ZRZA 1BWKA 5KZDA 3AFBA 4IJRA 5FL0A 1FWHC 3F4WA 2DGAA 1F8IA 3UZYA 1GWJA 7CGTA 1ZCCA 2D0HA 2EPNA 1P1MA 3U9IA 3H22A 2QDGA 4M7SA 4TX6A 1ZJAA 1JNDA 3EWZA 3RPMA 1OC7A 3DC8A 2MANA 1VBUA 3HJZA 3TW9A 2DZAA 4JXCA 2C19A 3ARYA 2W63A 4ZOAA 2W92A 2QDHA 1VPXA 1OIFA 1LG2A 4GCAA 4GY1A 4FLRA 3TH6A 2UZ9A 2ISWA 5FF3A 3V0SA 2BMBA 2FZMA 2ZIDA 2DZUA 1K8ZA 4JTFA 4UTKA 1GJPA 1ZJBA 4FI4A 4GYFA 3FJLA 5E70A 1CZ1A 2Y24A 3WLOA 2BOGX 1I2QA 1W5QA 1HVQA 2H9AB 1VCVA 2A4AA 1AODA 1W1PA 2OSWA 1F6YA 3GVVA 1YTDA 4GUHA 4ERGA 2YYTA 3WQ6A 1O5QA 1RSCA 1S2VA 2CIPA 1DEDA 3I6RA 4Q4KA 2QDEA 1JPIA 4FOUA 1NQKA 3PBMA 5HMEA 5LNUA 4C6CA 3ZVIA 3SJ3A 3R25A 3P5YA 1FP9A 2FDMA 5AC7A 2W9MA 3U7BA 3JW7A 1ZNNA 2FZDA 3ARWA 2CXEA 3PZGA 2Y4SA 1HUVA 3BTNA 4JTCA 4IOTA 1PX8A 3B3DA 3SQSA 1BD0A 2CZVA 2Z28A 1QK0A 2V68A 1AH4A 4J3ZA 3RITA 4H8VA 1MEWA 1WAWA 3KP0A 3ABZA 3H24A 2IKHA 2JIWA 3IIOA 3KVMA 2GWGA 3MUIA 2VX5A 2BHUA 3HF3A 4JN6A 3EMZA 1AMKA 4DXVA 3KAOA 1DBTA 3LMZA 1J9YA 3MMTA 4HNOA 3VKBA 4WJXA 1CWYA 1QVBA 4GWEA 5I3HA 5KETA 3RXZA 5A94A 1XW8A 4ECLA 3KBNA 1LCOA 2JKAA 1NWTA 1RBLA 2V30A 2E68A 2H3BA 1FWSA 3AISA 3S1UA 2VCAA 5D2TA 2I1OA 3EOUA 3HGSA 2DSVA 2Y5SA 4DM2A 5I3IA 1HVXA 1BVWA 1QW9A 4XO6A 2OX1A 3GC4A 3T2QA 5LGXA 3T4CA 4UTTA 1I1WA 2XTKA 3C4UA 3K1DA 1XP3A 3I4EA 3UEQA 3LPPA 2A79A 1H7PA 5FOOA 3AYSA 5DCDA 2CBJA 1VC4A 3W02A 4KCWA 3VUPA 5LHFA 3THQA 1DE6A 5GNZA 6REQA 2WJEA 5SWUA 1DIEA 2X0SA 3GXPA 3WBXA 3ITTA 3UQNA 4F40A 1UW9A 2YR1A 1UPPA 4UFKA 2ESCA 1R3YA 1EC9A 3CWNA 1WOAA 2D20A 3UJ2A 3EX1A 4AEEA 3UWWA 3NL6A 3QSTA 5FJPA 1V77A 4UTIA 3W70A 3C56A 3E0VA 3MUCA 1UMYA 2JBMA 1E9YB 3MW7A 4I6KA 4I5XA 2PDPA 1PE1A 4GABA 3GFYA 2E25A 2ZE0A 4RNHA 2Z29A 5CPTA 3PFRA 3RU6A 4DNMA 4R7JA 2P8CA 1PKYA 3AJXA 3GXFA 3QRHA 4E3VA 4UMAA 4MNJA 3NPVA 4S3EA 3SURA 3WBYA 5A6SA 1IQ8A 7XIMA 4EKJA 4YLWA 4FEZA 4ZVJA 3F2CA 3IJ6A 1XRVA 2OYMA 4L1GA 1GOOA 3FXGA 5LNVA 1JPHA 5AC5A 1VFMA 3DUGA 1EX1A 1JUKA 2IPWA 3VNLA 3BO9A 5A6JA 4LOCA 1M04A 4MGGA 1R2SA 4ZO8A 4UWMA 3VABA 4FLQA 3CC1A 3AYTA 5A8GA 3RM4A 1TO3A 1UWIA 4IPPA 1PV8A 4AVFA 1UR0A 1D7KA 4DIAA 4LAMA 3NAVA 3OQ8A 4LEQA 3C2EA 2ATMA 1Q4WA 3EDKA 5IDZA 4K7YA 3E0LA 1FDZA 3GTNA 5AY7A 1ADOA 1GCYA 3G1DA 2NUXA 3V5FA 3ENLA 1QT1A 4N7QA 3LMYA 3W2JA 4BKNA 3MI2A 3QQ0A 2AOSA 1S39A 3UVAA 5LIXX 3OVQA 4Q8UA 4X9SA 3PUEA 3ZFHA 2HE5A 3BMWA 1K4HA 1LTDA 4OFCA 2YL5A 5HMSA 1VJSA 4DBSA 4HNVA 3S5OA 3MUXA 1XD1A 4LNCA 3WD2A 4INFA 2GVJA 1Q13A 3BW4A 3MCOA 2WHJA 4L64A 4HVXA 2V8ZA 2BASA 1XCXA 2OGYA 2Y5JA 3IGXA 2FB2A 2E0PA 2HROA 3HZ3A 3P8JA 4D8LA 1XBZA 3W76A 1W3KA 4UFJA 4QQUA 5T8GA 3W7JA 5F4XA 3ZT7A 4DAFA 1ALDA 4H7CA 3SCVA 4UQBA 1DIKA 3PZQA 5D03A 3VVGA 2CZEA 2IKJA 3HQPA 4GJ1A 4PEEA 3EA1A 3LHTA 4BI6A 3KRZA 1TPDA 3EWYA 4D6EA 3TC7A 2X2GA 5D9NA 3EEGA 1HNYA 4UTHA 4NRSA 3MWCA 1R87A 1O60A 1V02E 2VT0A 3UG4A 2V5BA 1TTPA 1GG1A 2DW6A 4Z0SA 2YXOA 1EA0A 1XYLA 2NUWA 4IWWA 2OJPA 1UYQA 3WH5A 1QK2A 1TCMA 1OFEA 3O6YX 3S2NA 3N2MA 1OZQA 3NDZA 3BAXA 5HWJA 1YNPA 3RK8A 1TJRA 4NUWA 4LYRA 1IEQA 1F6KA 4I7WA 3VMPA 3TN5A 3LOTA 1JNEA 1P0EA 1C3FA 4PUEA 3HMCA 3V7PA 1OD0A 3QC3A 3T07A 3HGOA 1GUVA 4YYFA 1A5CA 3AIEA 4JPGA 5AHNA 1IT8A 1LLZA 3SIMA 3PPHA 1RR2A 3GKFA 3FVDA 5JH2A 2D2JA 4CLMA 3KLLA 1P48A 1Y5VA 1U33A 3VNYA 1PKMA 1U1HA 1L6WA 1RZMA 7REQB 2BV9A 5L6UA 4U3AA 1XX1A 1LBFA 4KKXA 2VEPA 1JCLA 1B57A 1BTMA 4XBJA 4IIBA 1J2BA 3PTDA 2ALRA 5CG0A 3CUIA 4ENLA 4D8ZA 2QUMA 3QTGA 1KRBC 2ZUWA 3T0TA 3WDPP 3HPXA 1XIJA 1GEQA 4Q4OA 3MI3A 3A9BA 2FH6A 3AXKA 1TYGA 1A47A 4LH8A 3W7PA 4F2UA 1PVNA 3RR4A 1S2CA 5K3VA 3SN4A 5H91A 3N73A 5I09A 1KLZA 3MANA 2PF0A 3IWPA 1TFVA 1H0GA 4JTGA 2Z25A 5DT7A 3EOLA 4JBRA 1RBAA 3BZJA 4B9ZA 5K7JA 1LROA 1QNOA 2WSKA 3AU6A 4X0NA 4DZAA 2BWGA 3EXRA 3SCWA 4DXXA 1QWGA 4YWIA 3N9SA 4PMQA 4JTEA 4JL1A 5T9CE 3RDKA 5I3DA 1F9CA 3ARVA 5CAHA 3OBKA 2A3HA 2WC4A 2X7VA 3B03A 1OYCA 1BAGA 2E9LA 3C8NA 3IPWA 3PF3A 4MUPA 3PSWA 2YX0A 1W1VA 6CGTA 4IIEA 1Z42A 1SW0A 4PFHA 1K9TA 3WK1A 2YA0A 1E6QM 4UTUA 5BRPA 4Y9AA 1U5JA 3VE7A 1T8QA 4DXKA 2PBOA 3K30A 2G96A 1MNZA 3RCMA 1O5KA 2V5CA 3BVJA 1JG9A 3SCPA 4V1XA 3MI6A 4P2VA 4BF9A 1DWFM 2BP1A 2WHKA 3S5YA 1BWLA 4IMCA 3OYXA 4M29A 3ERPA 3WFLA 2YZRA 4GQBA 3CHFA 1WUEA 4PSRA 4Z1CA 1DJYA 1M1BA 1Y65A 4LVAA 4AY8A 3WLSA 3IJQA 1FCUA 3FVMA 5DBTA 3RPTA 1RVGA 4ZO9A 3QY7A 4U10A 1KCLA 4HTBA 4ERIA 2WSYA 3TX9A 1KGWA 4GJJA 2E1WA 1RJRA 2J9YA 3TR9A 4KGLA 1JZ7A 3W83A 1B9BA 2YSWA 2YOCA 8CGTA 2GJRA 1H49A 1SW7A 4QTGA