4LS9A

Structure of mycobacterial nrna homolog reveals multifunctional nuclease activities
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
319
structure length
319
Chain Sequence
b'GARVDARGAADLLTAASSVSVICHVYPDADTIGAGLALAQVLAASGKHVEVSFATPAQLPESLQSLPGGHLLVAPEAMRRDADLVVTVDIPSINRLGALSGLAGPGREVLVIDHHASNQLFGTANYIDPSADSTTMLVAELLDAWGKPIDEKVAHCLYAGLTTDTGSFRWATARAHRLAARLVELGVDNASISRTLLDTHPFAWLPMLSRVLATARLLPDALDGRGFVYAVVPHDEWSEARPEEVESIVDIVRTTQQAEVAAVFKEIEPMHWSVSMRAKSVNLASVASAFGGGGHPHAAGYSATGSADDVVQALARALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DHH family protein
publication title Unique subunit packing in mycobacterial nanoRNase leads to alternate substrate recognitions in DHH phosphodiesterases
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Hydrolase
total genus 105
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02272 DHHA1 DHHA1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.30 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4ls9A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 4ls9A01
1WPPA 2IW4A 1K23A 3DEVA 4PY9A 1K20A 1WPNA 2ZXRA 2QB8A 2ZXOA 1IR6A 2ENXA 3W5WA 1WPMA 4RPAA 2ZXPA 1I74A 2QB6A 2EB0A 2QB7A 2HAWA 4LS9A
chains in the Genus database with same CATH superfamily
4DWZA 1W61A 1WPPA 3ICJA 4PY9A 2QB8A 5M47A 3IGHX 2OTNA 3PTJA 1S7JA 3PW9A 1I74A 4LG3A 4LS9A 1U1WA 2IW4A 2KPTA 4OA3A 3DEVA 1SDJA 5H2GA 5GKXA 4FC5A 3EKMA 2ZXOA 3EDNA 1T6KA 1BWZA 4JD7A 3WQZA 2KW7A 2PVZA 1TM0A 2LT2A 3G98A 2AZPA 1GQZA 1W62A 1WPMA 4RPAA 1U1VA 4JBDA 1XUBA 2EB0A 4JUUA 4Q2HA 2ZVFA 2HAWA 2YMAA 2GKJA 2MPBA 4IJZA 1YM5A 4GL6A 1WPNA 1IR6A 5H2YA 4K8LA 3PVHA 3W5WA 4J9XA 1XUAA 2H9FA 4Q60A 5IWEA 5GL4A 2QB7A 4K7XA 4DUNA 4LB0A 1K23A 2PW0A 4J9WA 1K20A 2ZXRA 4IK0A 4JCIA 2ENXA 2Q9JA 5GL3A 4K7GB 5GL2A 3EJXA 3FVEA 1QYAA 2Q9HA 1QY9A 5HA4A 2ZXPA 2GKEA 1U1XA 3G7KA 2QB6A 1U0KA 5ANPA
chains in the Genus database with same CATH topology
4DWZA 1W61A 1WPPA 3ICJA 4PY9A 2QB8A 5M47A 3IGHX 2OTNA 3PTJA 1S7JA 3PW9A 1I74A 4LG3A 4LS9A 1U1WA 2IW4A 2KPTA 4OA3A 3DEVA 1SDJA 5H2GA 5GKXA 4FC5A 3EKMA 2ZXOA 3EDNA 1T6KA 1BWZA 4JD7A 3WQZA 2KW7A 2PVZA 1TM0A 2LT2A 3G98A 2AZPA 1GQZA 1W62A 1WPMA 4RPAA 1U1VA 4JBDA 1XUBA 2EB0A 4JUUA 4Q2HA 2ZVFA 2HAWA 2YMAA 2GKJA 2MPBA 4IJZA 1YM5A 4GL6A 1WPNA 1IR6A 5H2YA 4K8LA 3PVHA 3W5WA 4J9XA 1XUAA 2H9FA 4Q60A 5IWEA 5GL4A 2QB7A 4K7XA 4DUNA 4LB0A 1K23A 2PW0A 4J9WA 1K20A 2ZXRA 4IK0A 4JCIA 2ENXA 2Q9JA 5GL3A 4K7GB 5GL2A 3EJXA 3FVEA 1QYAA 2Q9HA 1QY9A 5HA4A 2ZXPA 2GKEA 1U1XA 3G7KA 2QB6A 1U0KA 5ANPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPP A;  2IW4 A;  1K23 A;  3DEV A;  4PY9 A;  1K20 A;  1WPN A;  2ZXR A;  2QB8 A;  2ZXO A;  1IR6 A;  2ENX A;  3W5W A;  1WPM A;  4RPA A;  2ZXP A;  1I74 A;  2QB6 A;  2EB0 A;  2QB7 A;  2HAW A;  4LS9 A; 
#chains in the Genus database with same CATH topology
 4DWZ A;  1W61 A;  1WPP A;  3ICJ A;  4PY9 A;  2QB8 A;  5M47 A;  3IGH X;  2OTN A;  3PTJ A;  1S7J A;  3PW9 A;  1I74 A;  4LG3 A;  4LS9 A;  1U1W A;  2IW4 A;  2KPT A;  4OA3 A;  3DEV A;  1SDJ A;  5H2G A;  5GKX A;  4FC5 A;  3EKM A;  2ZXO A;  3EDN A;  1T6K A;  1BWZ A;  4JD7 A;  3WQZ A;  2KW7 A;  2PVZ A;  1TM0 A;  2LT2 A;  3G98 A;  2AZP A;  1GQZ A;  1W62 A;  1WPM A;  4RPA A;  1U1V A;  4JBD A;  1XUB A;  2EB0 A;  4JUU A;  4Q2H A;  2ZVF A;  2HAW A;  2YMA A;  2GKJ A;  2MPB A;  4IJZ A;  1YM5 A;  4GL6 A;  1WPN A;  1IR6 A;  5H2Y A;  4K8L A;  3PVH A;  3W5W A;  4J9X A;  1XUA A;  2H9F A;  4Q60 A;  5IWE A;  5GL4 A;  2QB7 A;  4K7X A;  4DUN A;  4LB0 A;  1K23 A;  2PW0 A;  4J9W A;  1K20 A;  2ZXR A;  4IK0 A;  4JCI A;  2ENX A;  2Q9J A;  5GL3 A;  4K7G B;  5GL2 A;  3EJX A;  3FVE A;  1QYA A;  2Q9H A;  1QY9 A;  5HA4 A;  2ZXP A;  2GKE A;  1U1X A;  3G7K A;  2QB6 A;  1U0K A;  5ANP A; 
#chains in the Genus database with same CATH homology
 4DWZ A;  1W61 A;  1WPP A;  3ICJ A;  4PY9 A;  2QB8 A;  5M47 A;  3IGH X;  2OTN A;  3PTJ A;  1S7J A;  3PW9 A;  1I74 A;  4LG3 A;  4LS9 A;  1U1W A;  2IW4 A;  2KPT A;  4OA3 A;  3DEV A;  1SDJ A;  5H2G A;  5GKX A;  4FC5 A;  3EKM A;  2ZXO A;  3EDN A;  1T6K A;  1BWZ A;  4JD7 A;  3WQZ A;  2KW7 A;  2PVZ A;  1TM0 A;  2LT2 A;  3G98 A;  2AZP A;  1GQZ A;  1W62 A;  1WPM A;  4RPA A;  1U1V A;  4JBD A;  1XUB A;  2EB0 A;  4JUU A;  4Q2H A;  2ZVF A;  2HAW A;  2YMA A;  2GKJ A;  2MPB A;  4IJZ A;  1YM5 A;  4GL6 A;  1WPN A;  1IR6 A;  5H2Y A;  4K8L A;  3PVH A;  3W5W A;  4J9X A;  1XUA A;  2H9F A;  4Q60 A;  5IWE A;  5GL4 A;  2QB7 A;  4K7X A;  4DUN A;  4LB0 A;  1K23 A;  2PW0 A;  4J9W A;  1K20 A;  2ZXR A;  4IK0 A;  4JCI A;  2ENX A;  2Q9J A;  5GL3 A;  4K7G B;  5GL2 A;  3EJX A;  3FVE A;  1QYA A;  2Q9H A;  1QY9 A;  5HA4 A;  2ZXP A;  2GKE A;  1U1X A;  3G7K A;  2QB6 A;  1U0K A;  5ANP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...