4LS9A

Structure of mycobacterial nrna homolog reveals multifunctional nuclease activities
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
319
structure length
319
Chain Sequence
GARVDARGAADLLTAASSVSVICHVYPDADTIGAGLALAQVLAASGKHVEVSFATPAQLPESLQSLPGGHLLVAPEAMRRDADLVVTVDIPSINRLGALSGLAGPGREVLVIDHHASNQLFGTANYIDPSADSTTMLVAELLDAWGKPIDEKVAHCLYAGLTTDTGSFRWATARAHRLAARLVELGVDNASISRTLLDTHPFAWLPMLSRVLATARLLPDALDGRGFVYAVVPHDEWSEARPEEVESIVDIVRTTQQAEVAAVFKEIEPMHWSVSMRAKSVNLASVASAFGGGGHPHAAGYSATGSADDVVQALARALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique subunit packing in mycobacterial nanoRNase leads to alternate substrate recognitions in DHH phosphodiesterases
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Hydrolase
molecule keywords DHH family protein
total genus 105
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02272 DHHA1 DHHA1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.30 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4ls9A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 4ls9A01
2ZXPA 2QB6A 1WPNA 1K23A 2EB0A 2QB7A 2ENXA 3DEVA 2ZXRA 1IR6A 4RPAA 2ZXOA 1K20A 2QB8A 4PY9A 1I74A 3W5WA 1WPPA 2IW4A 4LS9A 1WPMA 2HAWA
chains in the Genus database with same CATH superfamily
2YMAA 3PVHA 4IJZA 4J9WA 1XUBA 2ENXA 2MPBA 2QB7A 2KW7A 1BWZA 4RPAA 3PTJA 3WQZA 5H2YA 3IGHX 1GQZA 1U1VA 2LT2A 1WPPA 2IW4A 2QB6A 4GL6A 1U1WA 4Q2HA 1QY9A 3G98A 5GL4A 2KPTA 3FVEA 1K20A 4LB0A 2OTNA 1TM0A 2GKJA 3PW9A 4DWZA 2Q9HA 1U1XA 1WPMA 2ZXPA 4FC5A 1WPNA 4JUUA 2Q9JA 3EJXA 1U0KA 2ZVFA 5ANPA 5IWEA 3DEVA 5GL2A 1IR6A 5GKXA 4JCIA 2QB8A 4PY9A 2H9FA 2PVZA 5GL3A 5H2GA 1W62A 4LS9A 2HAWA 4DUNA 4IK0A 1S7JA 1YM5A 1W61A 1T6KA 4JBDA 4K8LA 1K23A 2EB0A 5HA4A 2AZPA 1QYAA 1XUAA 3G7KA 2ZXRA 4K7GB 5M47A 2ZXOA 4K7XA 3EDNA 4JD7A 1I74A 4LG3A 3W5WA 1SDJA 3ICJA 2GKEA 2PW0A 4J9XA 3EKMA 4OA3A 4Q60A
chains in the Genus database with same CATH topology
2YMAA 3PVHA 4IJZA 4J9WA 1XUBA 2ENXA 2MPBA 2QB7A 2KW7A 1BWZA 4RPAA 3PTJA 3WQZA 5H2YA 3IGHX 1GQZA 1U1VA 2LT2A 1WPPA 2IW4A 2QB6A 4GL6A 1U1WA 4Q2HA 1QY9A 3G98A 5GL4A 2KPTA 3FVEA 1K20A 4LB0A 2OTNA 1TM0A 2GKJA 3PW9A 4DWZA 2Q9HA 1U1XA 1WPMA 2ZXPA 4FC5A 1WPNA 4JUUA 2Q9JA 3EJXA 1U0KA 2ZVFA 5ANPA 5IWEA 3DEVA 5GL2A 1IR6A 5GKXA 4JCIA 2QB8A 4PY9A 2H9FA 2PVZA 5GL3A 5H2GA 1W62A 4LS9A 2HAWA 4DUNA 4IK0A 1S7JA 1YM5A 1W61A 1T6KA 4JBDA 4K8LA 1K23A 2EB0A 5HA4A 2AZPA 1QYAA 1XUAA 3G7KA 2ZXRA 4K7GB 5M47A 2ZXOA 4K7XA 3EDNA 4JD7A 1I74A 4LG3A 3W5WA 1SDJA 3ICJA 2GKEA 2PW0A 4J9XA 3EKMA 4OA3A 4Q60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXP A;  2QB6 A;  1WPN A;  1K23 A;  2EB0 A;  2QB7 A;  2ENX A;  3DEV A;  2ZXR A;  1IR6 A;  4RPA A;  2ZXO A;  1K20 A;  2QB8 A;  4PY9 A;  1I74 A;  3W5W A;  1WPP A;  2IW4 A;  4LS9 A;  1WPM A;  2HAW A; 
#chains in the Genus database with same CATH topology
 2YMA A;  3PVH A;  4IJZ A;  4J9W A;  1XUB A;  2ENX A;  2MPB A;  2QB7 A;  2KW7 A;  1BWZ A;  4RPA A;  3PTJ A;  3WQZ A;  5H2Y A;  3IGH X;  1GQZ A;  1U1V A;  2LT2 A;  1WPP A;  2IW4 A;  2QB6 A;  4GL6 A;  1U1W A;  4Q2H A;  1QY9 A;  3G98 A;  5GL4 A;  2KPT A;  3FVE A;  1K20 A;  4LB0 A;  2OTN A;  1TM0 A;  2GKJ A;  3PW9 A;  4DWZ A;  2Q9H A;  1U1X A;  1WPM A;  2ZXP A;  4FC5 A;  1WPN A;  4JUU A;  2Q9J A;  3EJX A;  1U0K A;  2ZVF A;  5ANP A;  5IWE A;  3DEV A;  5GL2 A;  1IR6 A;  5GKX A;  4JCI A;  2QB8 A;  4PY9 A;  2H9F A;  2PVZ A;  5GL3 A;  5H2G A;  1W62 A;  4LS9 A;  2HAW A;  4DUN A;  4IK0 A;  1S7J A;  1YM5 A;  1W61 A;  1T6K A;  4JBD A;  4K8L A;  1K23 A;  2EB0 A;  5HA4 A;  2AZP A;  1QYA A;  1XUA A;  3G7K A;  2ZXR A;  4K7G B;  5M47 A;  2ZXO A;  4K7X A;  3EDN A;  4JD7 A;  1I74 A;  4LG3 A;  3W5W A;  1SDJ A;  3ICJ A;  2GKE A;  2PW0 A;  4J9X A;  3EKM A;  4OA3 A;  4Q60 A; 
#chains in the Genus database with same CATH homology
 2YMA A;  3PVH A;  4IJZ A;  4J9W A;  1XUB A;  2ENX A;  2MPB A;  2QB7 A;  2KW7 A;  1BWZ A;  4RPA A;  3PTJ A;  3WQZ A;  5H2Y A;  3IGH X;  1GQZ A;  1U1V A;  2LT2 A;  1WPP A;  2IW4 A;  2QB6 A;  4GL6 A;  1U1W A;  4Q2H A;  1QY9 A;  3G98 A;  5GL4 A;  2KPT A;  3FVE A;  1K20 A;  4LB0 A;  2OTN A;  1TM0 A;  2GKJ A;  3PW9 A;  4DWZ A;  2Q9H A;  1U1X A;  1WPM A;  2ZXP A;  4FC5 A;  1WPN A;  4JUU A;  2Q9J A;  3EJX A;  1U0K A;  2ZVF A;  5ANP A;  5IWE A;  3DEV A;  5GL2 A;  1IR6 A;  5GKX A;  4JCI A;  2QB8 A;  4PY9 A;  2H9F A;  2PVZ A;  5GL3 A;  5H2G A;  1W62 A;  4LS9 A;  2HAW A;  4DUN A;  4IK0 A;  1S7J A;  1YM5 A;  1W61 A;  1T6K A;  4JBD A;  4K8L A;  1K23 A;  2EB0 A;  5HA4 A;  2AZP A;  1QYA A;  1XUA A;  3G7K A;  2ZXR A;  4K7G B;  5M47 A;  2ZXO A;  4K7X A;  3EDN A;  4JD7 A;  1I74 A;  4LG3 A;  3W5W A;  1SDJ A;  3ICJ A;  2GKE A;  2PW0 A;  4J9X A;  3EKM A;  4OA3 A;  4Q60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...