4LS9A

Structure of mycobacterial nrna homolog reveals multifunctional nuclease activities
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
319
structure length
319
Chain Sequence
GARVDARGAADLLTAASSVSVICHVYPDADTIGAGLALAQVLAASGKHVEVSFATPAQLPESLQSLPGGHLLVAPEAMRRDADLVVTVDIPSINRLGALSGLAGPGREVLVIDHHASNQLFGTANYIDPSADSTTMLVAELLDAWGKPIDEKVAHCLYAGLTTDTGSFRWATARAHRLAARLVELGVDNASISRTLLDTHPFAWLPMLSRVLATARLLPDALDGRGFVYAVVPHDEWSEARPEEVESIVDIVRTTQQAEVAAVFKEIEPMHWSVSMRAKSVNLASVASAFGGGGHPHAAGYSATGSADDVVQALARALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique subunit packing in mycobacterial nanoRNase leads to alternate substrate recognitions in DHH phosphodiesterases
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Hydrolase
molecule keywords DHH family protein
total genus 105
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02272 DHHA1 DHHA1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.30 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4ls9A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 4ls9A01
4RPAA 4LS9A 2ZXRA 2QB7A 3DEVA 2ZXPA 1I74A 1K23A 1WPNA 1K20A 2QB6A 2QB8A 3W5WA 2ENXA 2ZXOA 2IW4A 2HAWA 4PY9A 1WPPA 2EB0A 1IR6A 1WPMA
chains in the Genus database with same CATH superfamily
2GKEA 2ZXRA 3ICJA 1GQZA 1U1XA 2YMAA 2AZPA 1TM0A 5ANPA 1YM5A 2Q9JA 5GL2A 4JCIA 4JD7A 3PW9A 5GL3A 2QB6A 2QB8A 3FVEA 2MPBA 4JUUA 1IR6A 3EKMA 4K7GB 1QYAA 5HA4A 4DWZA 1U0KA 2LT2A 4IJZA 2ZXPA 1SDJA 1U1WA 1K20A 4DUNA 1U1VA 3W5WA 5H2YA 3G7KA 1XUBA 4LG3A 4PY9A 2Q9HA 4OA3A 2KW7A 2H9FA 1XUAA 3DEVA 3PVHA 1I74A 2ZVFA 4J9WA 4Q2HA 5GL4A 4LB0A 2PVZA 3G98A 5GKXA 2KPTA 3PTJA 2ENXA 5H2GA 2GKJA 4Q60A 2HAWA 4GL6A 1WPPA 3EJXA 2EB0A 4K8LA 4J9XA 1T6KA 2OTNA 5M47A 4IK0A 4RPAA 4LS9A 3EDNA 2QB7A 1W62A 3WQZA 5IWEA 1K23A 1WPNA 1S7JA 4JBDA 2ZXOA 2IW4A 4K7XA 1W61A 1BWZA 1WPMA 3IGHX 4FC5A 2PW0A 1QY9A
chains in the Genus database with same CATH topology
2GKEA 2ZXRA 3ICJA 1GQZA 1U1XA 2YMAA 2AZPA 1TM0A 5ANPA 1YM5A 2Q9JA 5GL2A 4JCIA 4JD7A 3PW9A 5GL3A 2QB6A 2QB8A 3FVEA 2MPBA 4JUUA 1IR6A 3EKMA 4K7GB 1QYAA 5HA4A 4DWZA 1U0KA 2LT2A 4IJZA 2ZXPA 1SDJA 1U1WA 1K20A 4DUNA 1U1VA 3W5WA 5H2YA 3G7KA 1XUBA 4LG3A 4PY9A 2Q9HA 4OA3A 2KW7A 2H9FA 1XUAA 3DEVA 3PVHA 1I74A 2ZVFA 4J9WA 4Q2HA 5GL4A 4LB0A 2PVZA 3G98A 5GKXA 2KPTA 3PTJA 2ENXA 5H2GA 2GKJA 4Q60A 2HAWA 4GL6A 1WPPA 3EJXA 2EB0A 4K8LA 4J9XA 1T6KA 2OTNA 5M47A 4IK0A 4RPAA 4LS9A 3EDNA 2QB7A 1W62A 3WQZA 5IWEA 1K23A 1WPNA 1S7JA 4JBDA 2ZXOA 2IW4A 4K7XA 1W61A 1BWZA 1WPMA 3IGHX 4FC5A 2PW0A 1QY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RPA A;  4LS9 A;  2ZXR A;  2QB7 A;  3DEV A;  2ZXP A;  1I74 A;  1K23 A;  1WPN A;  1K20 A;  2QB6 A;  2QB8 A;  3W5W A;  2ENX A;  2ZXO A;  2IW4 A;  2HAW A;  4PY9 A;  1WPP A;  2EB0 A;  1IR6 A;  1WPM A; 
#chains in the Genus database with same CATH topology
 2GKE A;  2ZXR A;  3ICJ A;  1GQZ A;  1U1X A;  2YMA A;  2AZP A;  1TM0 A;  5ANP A;  1YM5 A;  2Q9J A;  5GL2 A;  4JCI A;  4JD7 A;  3PW9 A;  5GL3 A;  2QB6 A;  2QB8 A;  3FVE A;  2MPB A;  4JUU A;  1IR6 A;  3EKM A;  4K7G B;  1QYA A;  5HA4 A;  4DWZ A;  1U0K A;  2LT2 A;  4IJZ A;  2ZXP A;  1SDJ A;  1U1W A;  1K20 A;  4DUN A;  1U1V A;  3W5W A;  5H2Y A;  3G7K A;  1XUB A;  4LG3 A;  4PY9 A;  2Q9H A;  4OA3 A;  2KW7 A;  2H9F A;  1XUA A;  3DEV A;  3PVH A;  1I74 A;  2ZVF A;  4J9W A;  4Q2H A;  5GL4 A;  4LB0 A;  2PVZ A;  3G98 A;  5GKX A;  2KPT A;  3PTJ A;  2ENX A;  5H2G A;  2GKJ A;  4Q60 A;  2HAW A;  4GL6 A;  1WPP A;  3EJX A;  2EB0 A;  4K8L A;  4J9X A;  1T6K A;  2OTN A;  5M47 A;  4IK0 A;  4RPA A;  4LS9 A;  3EDN A;  2QB7 A;  1W62 A;  3WQZ A;  5IWE A;  1K23 A;  1WPN A;  1S7J A;  4JBD A;  2ZXO A;  2IW4 A;  4K7X A;  1W61 A;  1BWZ A;  1WPM A;  3IGH X;  4FC5 A;  2PW0 A;  1QY9 A; 
#chains in the Genus database with same CATH homology
 2GKE A;  2ZXR A;  3ICJ A;  1GQZ A;  1U1X A;  2YMA A;  2AZP A;  1TM0 A;  5ANP A;  1YM5 A;  2Q9J A;  5GL2 A;  4JCI A;  4JD7 A;  3PW9 A;  5GL3 A;  2QB6 A;  2QB8 A;  3FVE A;  2MPB A;  4JUU A;  1IR6 A;  3EKM A;  4K7G B;  1QYA A;  5HA4 A;  4DWZ A;  1U0K A;  2LT2 A;  4IJZ A;  2ZXP A;  1SDJ A;  1U1W A;  1K20 A;  4DUN A;  1U1V A;  3W5W A;  5H2Y A;  3G7K A;  1XUB A;  4LG3 A;  4PY9 A;  2Q9H A;  4OA3 A;  2KW7 A;  2H9F A;  1XUA A;  3DEV A;  3PVH A;  1I74 A;  2ZVF A;  4J9W A;  4Q2H A;  5GL4 A;  4LB0 A;  2PVZ A;  3G98 A;  5GKX A;  2KPT A;  3PTJ A;  2ENX A;  5H2G A;  2GKJ A;  4Q60 A;  2HAW A;  4GL6 A;  1WPP A;  3EJX A;  2EB0 A;  4K8L A;  4J9X A;  1T6K A;  2OTN A;  5M47 A;  4IK0 A;  4RPA A;  4LS9 A;  3EDN A;  2QB7 A;  1W62 A;  3WQZ A;  5IWE A;  1K23 A;  1WPN A;  1S7J A;  4JBD A;  2ZXO A;  2IW4 A;  4K7X A;  1W61 A;  1BWZ A;  1WPM A;  3IGH X;  4FC5 A;  2PW0 A;  1QY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...