4LSCA

Isolated serk1 co-receptor ectodomain at high resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
186
structure length
186
Chain Sequence
NLEGDALHTLRVTLVDPNNVLQSWDPTLVNPCTWFHVTCNNENSVIRVDLGNAELSGHLVPELGVLKNLQYLELYSNNITGPIPSNLGDLTNLVSLDLYLNSFSGPIPESLGKLSKLRFLRLNNNSLTGSIPMSLTQITTLQVLDLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVTSHPCPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Somatic embryogenesis receptor kinase 1
publication title Molecular mechanism for plant steroid receptor activation by somatic embryogenesis co-receptor kinases.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 61
structure length 186
sequence length 186
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4lscA00
2Y5QA 3GOZA 3PMHG 5LFNA 1O6VA 3TSRE 1O6TA 1QYYA 4U7LA 2P1OB 5A5CA 4PSJA 3UL9A 1P9AG 2ASTB 3RJ0A 1OTNA 4AY9X 4FCGA 5CMPA 3RW6A 3RIZA 2JQDA 2WQVA 1H6TA 4LSXC 3M18A 2BNHA 4Z61C 5GMGA 5GS0A 3OGKB 4KNGA 2V70A 4KXFB 4L3FA 4I6JB 3W3JA 2ID5A 4NKHA 2V9TB 4CNMA 5AWCA 3BZ5A 3WPBA 4MQWX 3UN9A 4RWTC 4CC4A 4CP6A 4XOSA 2Z7XB 2OMZA 4Z94G 3O53A 3WPEA 2P1MB 2Z63A 4PERA 4MN8B 4AW4A 5AWDA 4LXSA 3VQ1A 3E6JA 2Z7XA 2FT3A 4J4LA 4LSAA 4R07A 2Z66A 3G39A 2WQWA 3C6NB 2XWTC 5B4PA 1XKUA 3E2JA 4B8CD 4P8SA 4V2EA 3UL7A 1K5GC 4C2AB 3G04C 4NKGA 2Z81A 1OZNA 3W3MA 4UFRA 3FXIA 2V9SA 3WPHA 4GLPA 3RGZA 3OGLB 4PEQB 5HDHA 4RCWA 1IO0A 5AWAA 1A4YA 1XCDA 5AZ5A 5GMHA 3C6OB 3ZYNA 4V2DA 2R9UA 4R6JA 4Y61B 4BSUA 2OMWA 2Z64A 3ULVA 5IJDA 4RCAB 1PGVA 4LXRA 1ZIWA 4QXEA 4R0AA 4WP6A 4ECOA 3RGXA 4PQ8A 2ASSB 4H09A 1OTMA 2Z62A 1OTOA 2OMXA 4ECNA 1M9LA 1XECA 3W3NA 4C2BB 3CVRA 3CIYA 4R5DA 4QC0A 1OOKG 1K5DC 1P8TA 1W8AA 4R6AA 4K17A 4FS7A 3ZYIA 2P1QB 4CC4C 1JL5A 1KOHA 1A9NA 1KOOA 3VQ2A 1DS9A 1Z7XW 1SQ0B 2ELLA 4TZHA 2O6QA 1P8VA 1O6SA 2IFGA 4U08A 4M7EA 3M19A 4Q62A 4WYKA 4XSQA 3ZYJA 4R09A 5GMFA 3UL8A 2XOTA 5IYXC 3ULAA 4U06A 4R6FA 2Q4GW 4M7EC 2OMVA 4R5CA 2WQXA 4V2CA 5IJBA 2RA8A 5B0TA 1D0BA 2WFHA 4J0MA 3P72A 5GS2B 4Q3IA 3RW7A 1FQVA 4L3AA 4R6GA 4QBZA 3RFEA 2CA6A 4ARRA 4YEBB 2UZXA 4G8AA 4OQTA 4R58A 5CMNA 3E3ZA 1WWLA 4R08A 1FS2A 4LSXA 2WQUA 4FD0A 5D3IA 3CIGA 3OJAB 4Z79A 3W3LA 1U0ND 3E4GA 3WPGA 3G3AA 3KJ4A 3A79B 2A0ZA 3G06A 3G3BA 2P1NB 4ARNA 3WPDA 2Z65A 1LTXA 4XGOA 5FTTB 1M0ZA 4Q3GA 2P1PB 3OGMB 1H6UA 4HQ1A 3OJAA 5GQRK 4Z64C 3WPIA 1GWBA 4P91A 2JE1A 2OMUA 3WN4A 5IJCA 1FO1A 5HZLB 4FHOA 4FMZA 4PKIG 3ZYOA 1G9UA 3WPCA 1OGQA 4U09A 2O6RA 3W3GA 4BV4R 4FDWA 2OMYA 1XEUA 3SB4A 5AWBA 4IM6A 4BSRA 2UZYA 2BEXA 4BSSA 1M9SA 2OMTA 3DZEA 4CNCA 4GT6A 3RFSA 2O6SA 5B0NA 4LI2A 3REZA 1DCEA 4KT1A 4LI1A 1M10B 3WPFA 4LSCA 3RFJA 4EZGA 4CILA 1DFJI 4Z8GA 3C6PB 1FT8A 3JB9j 3ULUA 3O6NA 2RR6A 3W3KA 2Z82A 1YRGA 2JE0A 1XWDC
chains in the Genus database with same CATH superfamily
2Y5QA 3GOZA 3PMHG 5LFNA 1O6VA 3TSRE 1O6TA 1QYYA 4U7LA 2P1OB 5A5CA 4PSJA 3UL9A 1P9AG 2ASTB 3RJ0A 1OTNA 4AY9X 4FCGA 5CMPA 3RW6A 3RIZA 2JQDA 2WQVA 1H6TA 4LSXC 3M18A 2BNHA 4Z61C 5GMGA 5GS0A 3OGKB 4KNGA 2V70A 4KXFB 4L3FA 4I6JB 3W3JA 2ID5A 4NKHA 2V9TB 4CNMA 5AWCA 3BZ5A 3WPBA 4MQWX 3UN9A 4RWTC 4CC4A 4CP6A 4XOSA 2Z7XB 2OMZA 4Z94G 3O53A 3WPEA 2P1MB 2Z63A 4PERA 4MN8B 4AW4A 5AWDA 4LXSA 3VQ1A 3E6JA 2Z7XA 2FT3A 4J4LA 4LSAA 4R07A 2Z66A 3G39A 2WQWA 3C6NB 2XWTC 5B4PA 1XKUA 3E2JA 4B8CD 4P8SA 4V2EA 3UL7A 1K5GC 4C2AB 3G04C 4NKGA 2Z81A 1OZNA 3W3MA 4UFRA 3FXIA 2V9SA 3WPHA 4GLPA 3RGZA 3OGLB 4PEQB 5HDHA 4RCWA 1IO0A 5AWAA 1A4YA 1XCDA 5AZ5A 5GMHA 3C6OB 3ZYNA 4V2DA 2R9UA 4R6JA 4Y61B 4BSUA 2OMWA 2Z64A 3ULVA 5IJDA 4RCAB 1PGVA 4LXRA 1ZIWA 4QXEA 4R0AA 4WP6A 4ECOA 3RGXA 4PQ8A 2ASSB 4H09A 1OTMA 2Z62A 1OTOA 2OMXA 4ECNA 1M9LA 1XECA 3W3NA 4C2BB 3CVRA 3CIYA 4R5DA 4QC0A 1OOKG 1K5DC 1P8TA 1W8AA 4R6AA 4K17A 4FS7A 3ZYIA 2P1QB 4CC4C 1JL5A 1KOHA 1A9NA 1KOOA 3VQ2A 1DS9A 1Z7XW 1SQ0B 2ELLA 4TZHA 2O6QA 1P8VA 1O6SA 2IFGA 4U08A 4M7EA 3M19A 4Q62A 4WYKA 4XSQA 3ZYJA 4R09A 5GMFA 3UL8A 2XOTA 5IYXC 3ULAA 4U06A 4R6FA 2Q4GW 4M7EC 2OMVA 4R5CA 2WQXA 4V2CA 5IJBA 2RA8A 5B0TA 1D0BA 2WFHA 4J0MA 3P72A 5GS2B 4Q3IA 3RW7A 1FQVA 4L3AA 4R6GA 4QBZA 3RFEA 2CA6A 4ARRA 4YEBB 2UZXA 4G8AA 4OQTA 4R58A 5CMNA 3E3ZA 1WWLA 4R08A 1FS2A 4LSXA 2WQUA 4FD0A 5D3IA 3CIGA 3OJAB 4Z79A 3W3LA 1U0ND 3E4GA 3WPGA 3G3AA 3KJ4A 3A79B 2A0ZA 3G06A 3G3BA 2P1NB 4ARNA 3WPDA 4NZTM 2Z65A 1LTXA 4XGOA 5FTTB 1M0ZA 4Q3GA 2P1PB 3OGMB 1H6UA 4HQ1A 3OJAA 5GQRK 4Z64C 3WPIA 1GWBA 4P91A 2JE1A 2OMUA 3WN4A 5IJCA 1FO1A 5HZLB 4FHOA 4FMZA 4PKIG 3ZYOA 1G9UA 3WPCA 1OGQA 4U09A 2O6RA 3W3GA 4BV4R 4FDWA 2OMYA 1XEUA 3SB4A 5AWBA 4IM6A 4BSRA 2UZYA 2BEXA 4NZRM 4BSSA 1M9SA 2OMTA 3DZEA 4CNCA 4GT6A 3RFSA 2O6SA 5B0NA 4LI2A 3REZA 1DCEA 4KT1A 4LI1A 1M10B 3WPFA 4LSCA 3RFJA 4EZGA 4CILA 1DFJI 4Z8GA 3C6PB 1FT8A 3JB9j 3ULUA 3O6NA 2RR6A 3W3KA 2Z82A 1YRGA 2JE0A 1XWDC
chains in the Genus database with same CATH topology
2Y5QA 3GOZA 3PMHG 5LFNA 1O6VA 3TSRE 1O6TA 1QYYA 4U7LA 2P1OB 5A5CA 4PSJA 3UL9A 1P9AG 2ASTB 3RJ0A 1OTNA 4AY9X 4FCGA 5CMPA 3RW6A 3RIZA 2JQDA 2WQVA 1H6TA 4LSXC 3M18A 2BNHA 4Z61C 5GMGA 5GS0A 3OGKB 4KNGA 2V70A 4KXFB 4L3FA 4I6JB 3W3JA 2ID5A 4NKHA 2V9TB 4CNMA 5AWCA 3BZ5A 3WPBA 4MQWX 3UN9A 4RWTC 4CC4A 4CP6A 4XOSA 2Z7XB 2OMZA 4Z94G 3O53A 3WPEA 2P1MB 2Z63A 4PERA 4MN8B 4AW4A 5AWDA 4LXSA 3VQ1A 3E6JA 2Z7XA 2FT3A 4J4LA 4LSAA 4R07A 2Z66A 3G39A 2WQWA 3C6NB 2XWTC 5B4PA 1XKUA 3E2JA 4B8CD 4P8SA 4V2EA 3UL7A 1K5GC 4C2AB 3G04C 4NKGA 2Z81A 1OZNA 3W3MA 4UFRA 3FXIA 2V9SA 3WPHA 4GLPA 3RGZA 3OGLB 4PEQB 5HDHA 4RCWA 1IO0A 5AWAA 1A4YA 1XCDA 5AZ5A 5GMHA 3C6OB 3ZYNA 4V2DA 2R9UA 4R6JA 4Y61B 4BSUA 2OMWA 2Z64A 3ULVA 5IJDA 4RCAB 1PGVA 4LXRA 1ZIWA 4QXEA 4R0AA 4WP6A 4ECOA 3RGXA 4PQ8A 2ASSB 4H09A 1OTMA 2Z62A 1OTOA 2OMXA 4ECNA 1M9LA 1XECA 3W3NA 4C2BB 3CVRA 3CIYA 4R5DA 4QC0A 1OOKG 1K5DC 1P8TA 1W8AA 4R6AA 4K17A 4FS7A 3ZYIA 2P1QB 4CC4C 1JL5A 1KOHA 1A9NA 1KOOA 3VQ2A 1DS9A 1Z7XW 1SQ0B 2ELLA 4TZHA 2O6QA 1P8VA 1O6SA 2IFGA 4U08A 4M7EA 3M19A 4Q62A 4WYKA 4XSQA 3ZYJA 4R09A 5GMFA 3UL8A 2XOTA 5IYXC 3ULAA 4U06A 4R6FA 2Q4GW 4M7EC 2OMVA 4R5CA 2WQXA 4V2CA 5IJBA 2RA8A 5B0TA 1D0BA 2WFHA 4J0MA 3P72A 5GS2B 4Q3IA 3RW7A 1FQVA 4L3AA 4R6GA 4QBZA 3RFEA 2CA6A 4ARRA 4YEBB 2UZXA 4G8AA 4OQTA 4R58A 5CMNA 3E3ZA 1WWLA 4R08A 1FS2A 4LSXA 2WQUA 4FD0A 5D3IA 3CIGA 3OJAB 4Z79A 3W3LA 1U0ND 3E4GA 3WPGA 3G3AA 3KJ4A 3A79B 2A0ZA 3G06A 3G3BA 2P1NB 4ARNA 3WPDA 2Z65A 1LTXA 4XGOA 5FTTB 1M0ZA 4Q3GA 2P1PB 3OGMB 1H6UA 4HQ1A 3OJAA 5GQRK 4Z64C 3WPIA 1GWBA 4P91A 2JE1A 2OMUA 3WN4A 5IJCA 1FO1A 5HZLB 4FHOA 4FMZA 4PKIG 3ZYOA 1G9UA 3WPCA 1OGQA 4U09A 2O6RA 3W3GA 4BV4R 4FDWA 2OMYA 1XEUA 3SB4A 5AWBA 4IM6A 4BSRA 2UZYA 2BEXA 4BSSA 1M9SA 2OMTA 3DZEA 4CNCA 4GT6A 3RFSA 2O6SA 5B0NA 4LI2A 3REZA 1DCEA 4KT1A 4LI1A 1M10B 3WPFA 4LSCA 3RFJA 4EZGA 4CILA 1DFJI 4Z8GA 3C6PB 1FT8A 3JB9j 3ULUA 3O6NA 2RR6A 3W3KA 2Z82A 1YRGA 2JE0A 1XWDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y5Q A;  3GOZ A;  3PMH G;  5LFN A;  1O6V A;  3TSR E;  1O6T A;  1QYY A;  4U7L A;  2P1O B;  5A5C A;  4PSJ A;  3UL9 A;  1P9A G;  2AST B;  3RJ0 A;  1OTN A;  4AY9 X;  4FCG A;  5CMP A;  3RW6 A;  3RIZ A;  2JQD A;  2WQV A;  1H6T A;  4LSX C;  3M18 A;  2BNH A;  4Z61 C;  5GMG A;  5GS0 A;  3OGK B;  4KNG A;  2V70 A;  4KXF B;  4L3F A;  4I6J B;  3W3J A;  2ID5 A;  4NKH A;  2V9T B;  4CNM A;  5AWC A;  3BZ5 A;  3WPB A;  4MQW X;  3UN9 A;  4RWT C;  4CC4 A;  4CP6 A;  4XOS A;  2Z7X B;  2OMZ A;  4Z94 G;  3O53 A;  3WPE A;  2P1M B;  2Z63 A;  4PER A;  4MN8 B;  4AW4 A;  5AWD A;  4LXS A;  3VQ1 A;  3E6J A;  2Z7X A;  2FT3 A;  4J4L A;  4LSA A;  4R07 A;  2Z66 A;  3G39 A;  2WQW A;  3C6N B;  2XWT C;  5B4P A;  1XKU A;  3E2J A;  4B8C D;  4P8S A;  4V2E A;  3UL7 A;  1K5G C;  4C2A B;  3G04 C;  4NKG A;  2Z81 A;  1OZN A;  3W3M A;  4UFR A;  3FXI A;  2V9S A;  3WPH A;  4GLP A;  3RGZ A;  3OGL B;  4PEQ B;  5HDH A;  4RCW A;  1IO0 A;  5AWA A;  1A4Y A;  1XCD A;  5AZ5 A;  5GMH A;  3C6O B;  3ZYN A;  4V2D A;  2R9U A;  4R6J A;  4Y61 B;  4BSU A;  2OMW A;  2Z64 A;  3ULV A;  5IJD A;  4RCA B;  1PGV A;  4LXR A;  1ZIW A;  4QXE A;  4R0A A;  4WP6 A;  4ECO A;  3RGX A;  4PQ8 A;  2ASS B;  4H09 A;  1OTM A;  2Z62 A;  1OTO A;  2OMX A;  4ECN A;  1M9L A;  1XEC A;  3W3N A;  4C2B B;  3CVR A;  3CIY A;  4R5D A;  4QC0 A;  1OOK G;  1K5D C;  1P8T A;  1W8A A;  4R6A A;  4K17 A;  4FS7 A;  3ZYI A;  2P1Q B;  4CC4 C;  1JL5 A;  1KOH A;  1A9N A;  1KOO A;  3VQ2 A;  1DS9 A;  1Z7X W;  1SQ0 B;  2ELL A;  4TZH A;  2O6Q A;  1P8V A;  1O6S A;  2IFG A;  4U08 A;  4M7E A;  3M19 A;  4Q62 A;  4WYK A;  4XSQ A;  3ZYJ A;  4R09 A;  5GMF A;  3UL8 A;  2XOT A;  5IYX C;  3ULA A;  4U06 A;  4R6F A;  2Q4G W;  4M7E C;  2OMV A;  4R5C A;  2WQX A;  4V2C A;  5IJB A;  2RA8 A;  5B0T A;  1D0B A;  2WFH A;  4J0M A;  3P72 A;  5GS2 B;  4Q3I A;  3RW7 A;  1FQV A;  4L3A A;  4R6G A;  4QBZ A;  3RFE A;  2CA6 A;  4ARR A;  4YEB B;  2UZX A;  4G8A A;  4OQT A;  4R58 A;  5CMN A;  3E3Z A;  1WWL A;  4R08 A;  1FS2 A;  4LSX A;  2WQU A;  4FD0 A;  5D3I A;  3CIG A;  3OJA B;  4Z79 A;  3W3L A;  1U0N D;  3E4G A;  3WPG A;  3G3A A;  3KJ4 A;  3A79 B;  2A0Z A;  3G06 A;  3G3B A;  2P1N B;  4ARN A;  3WPD A;  2Z65 A;  1LTX A;  4XGO A;  5FTT B;  1M0Z A;  4Q3G A;  2P1P B;  3OGM B;  1H6U A;  4HQ1 A;  3OJA A;  5GQR K;  4Z64 C;  3WPI A;  1GWB A;  4P91 A;  2JE1 A;  2OMU A;  3WN4 A;  5IJC A;  1FO1 A;  5HZL B;  4FHO A;  4FMZ A;  4PKI G;  3ZYO A;  1G9U A;  3WPC A;  1OGQ A;  4U09 A;  2O6R A;  3W3G A;  4BV4 R;  4FDW A;  2OMY A;  1XEU A;  3SB4 A;  5AWB A;  4IM6 A;  4BSR A;  2UZY A;  2BEX A;  4BSS A;  1M9S A;  2OMT A;  3DZE A;  4CNC A;  4GT6 A;  3RFS A;  2O6S A;  5B0N A;  4LI2 A;  3REZ A;  1DCE A;  4KT1 A;  4LI1 A;  1M10 B;  3WPF A;  4LSC A;  3RFJ A;  4EZG A;  4CIL A;  1DFJ I;  4Z8G A;  3C6P B;  1FT8 A;  3JB9 j;  3ULU A;  3O6N A;  2RR6 A;  3W3K A;  2Z82 A;  1YRG A;  2JE0 A;  1XWD C; 
#chains in the Genus database with same CATH topology
 2Y5Q A;  3GOZ A;  3PMH G;  5LFN A;  1O6V A;  3TSR E;  1O6T A;  1QYY A;  4U7L A;  2P1O B;  5A5C A;  4PSJ A;  3UL9 A;  1P9A G;  2AST B;  3RJ0 A;  1OTN A;  4AY9 X;  4FCG A;  5CMP A;  3RW6 A;  3RIZ A;  2JQD A;  2WQV A;  1H6T A;  4LSX C;  3M18 A;  2BNH A;  4Z61 C;  5GMG A;  5GS0 A;  3OGK B;  4KNG A;  2V70 A;  4KXF B;  4L3F A;  4I6J B;  3W3J A;  2ID5 A;  4NKH A;  2V9T B;  4CNM A;  5AWC A;  3BZ5 A;  3WPB A;  4MQW X;  3UN9 A;  4RWT C;  4CC4 A;  4CP6 A;  4XOS A;  2Z7X B;  2OMZ A;  4Z94 G;  3O53 A;  3WPE A;  2P1M B;  2Z63 A;  4PER A;  4MN8 B;  4AW4 A;  5AWD A;  4LXS A;  3VQ1 A;  3E6J A;  2Z7X A;  2FT3 A;  4J4L A;  4LSA A;  4R07 A;  2Z66 A;  3G39 A;  2WQW A;  3C6N B;  2XWT C;  5B4P A;  1XKU A;  3E2J A;  4B8C D;  4P8S A;  4V2E A;  3UL7 A;  1K5G C;  4C2A B;  3G04 C;  4NKG A;  2Z81 A;  1OZN A;  3W3M A;  4UFR A;  3FXI A;  2V9S A;  3WPH A;  4GLP A;  3RGZ A;  3OGL B;  4PEQ B;  5HDH A;  4RCW A;  1IO0 A;  5AWA A;  1A4Y A;  1XCD A;  5AZ5 A;  5GMH A;  3C6O B;  3ZYN A;  4V2D A;  2R9U A;  4R6J A;  4Y61 B;  4BSU A;  2OMW A;  2Z64 A;  3ULV A;  5IJD A;  4RCA B;  1PGV A;  4LXR A;  1ZIW A;  4QXE A;  4R0A A;  4WP6 A;  4ECO A;  3RGX A;  4PQ8 A;  2ASS B;  4H09 A;  1OTM A;  2Z62 A;  1OTO A;  2OMX A;  4ECN A;  1M9L A;  1XEC A;  3W3N A;  4C2B B;  3CVR A;  3CIY A;  4R5D A;  4QC0 A;  1OOK G;  1K5D C;  1P8T A;  1W8A A;  4R6A A;  4K17 A;  4FS7 A;  3ZYI A;  2P1Q B;  4CC4 C;  1JL5 A;  1KOH A;  1A9N A;  1KOO A;  3VQ2 A;  1DS9 A;  1Z7X W;  1SQ0 B;  2ELL A;  4TZH A;  2O6Q A;  1P8V A;  1O6S A;  2IFG A;  4U08 A;  4M7E A;  3M19 A;  4Q62 A;  4WYK A;  4XSQ A;  3ZYJ A;  4R09 A;  5GMF A;  3UL8 A;  2XOT A;  5IYX C;  3ULA A;  4U06 A;  4R6F A;  2Q4G W;  4M7E C;  2OMV A;  4R5C A;  2WQX A;  4V2C A;  5IJB A;  2RA8 A;  5B0T A;  1D0B A;  2WFH A;  4J0M A;  3P72 A;  5GS2 B;  4Q3I A;  3RW7 A;  1FQV A;  4L3A A;  4R6G A;  4QBZ A;  3RFE A;  2CA6 A;  4ARR A;  4YEB B;  2UZX A;  4G8A A;  4OQT A;  4R58 A;  5CMN A;  3E3Z A;  1WWL A;  4R08 A;  1FS2 A;  4LSX A;  2WQU A;  4FD0 A;  5D3I A;  3CIG A;  3OJA B;  4Z79 A;  3W3L A;  1U0N D;  3E4G A;  3WPG A;  3G3A A;  3KJ4 A;  3A79 B;  2A0Z A;  3G06 A;  3G3B A;  2P1N B;  4ARN A;  3WPD A;  4NZT M;  2Z65 A;  1LTX A;  4XGO A;  5FTT B;  1M0Z A;  4Q3G A;  2P1P B;  3OGM B;  1H6U A;  4HQ1 A;  3OJA A;  5GQR K;  4Z64 C;  3WPI A;  1GWB A;  4P91 A;  2JE1 A;  2OMU A;  3WN4 A;  5IJC A;  1FO1 A;  5HZL B;  4FHO A;  4FMZ A;  4PKI G;  3ZYO A;  1G9U A;  3WPC A;  1OGQ A;  4U09 A;  2O6R A;  3W3G A;  4BV4 R;  4FDW A;  2OMY A;  1XEU A;  3SB4 A;  5AWB A;  4IM6 A;  4BSR A;  2UZY A;  2BEX A;  4NZR M;  4BSS A;  1M9S A;  2OMT A;  3DZE A;  4CNC A;  4GT6 A;  3RFS A;  2O6S A;  5B0N A;  4LI2 A;  3REZ A;  1DCE A;  4KT1 A;  4LI1 A;  1M10 B;  3WPF A;  4LSC A;  3RFJ A;  4EZG A;  4CIL A;  1DFJ I;  4Z8G A;  3C6P B;  1FT8 A;  3JB9 j;  3ULU A;  3O6N A;  2RR6 A;  3W3K A;  2Z82 A;  1YRG A;  2JE0 A;  1XWD C; 
#chains in the Genus database with same CATH homology
 2Y5Q A;  3GOZ A;  3PMH G;  5LFN A;  1O6V A;  3TSR E;  1O6T A;  1QYY A;  4U7L A;  2P1O B;  5A5C A;  4PSJ A;  3UL9 A;  1P9A G;  2AST B;  3RJ0 A;  1OTN A;  4AY9 X;  4FCG A;  5CMP A;  3RW6 A;  3RIZ A;  2JQD A;  2WQV A;  1H6T A;  4LSX C;  3M18 A;  2BNH A;  4Z61 C;  5GMG A;  5GS0 A;  3OGK B;  4KNG A;  2V70 A;  4KXF B;  4L3F A;  4I6J B;  3W3J A;  2ID5 A;  4NKH A;  2V9T B;  4CNM A;  5AWC A;  3BZ5 A;  3WPB A;  4MQW X;  3UN9 A;  4RWT C;  4CC4 A;  4CP6 A;  4XOS A;  2Z7X B;  2OMZ A;  4Z94 G;  3O53 A;  3WPE A;  2P1M B;  2Z63 A;  4PER A;  4MN8 B;  4AW4 A;  5AWD A;  4LXS A;  3VQ1 A;  3E6J A;  2Z7X A;  2FT3 A;  4J4L A;  4LSA A;  4R07 A;  2Z66 A;  3G39 A;  2WQW A;  3C6N B;  2XWT C;  5B4P A;  1XKU A;  3E2J A;  4B8C D;  4P8S A;  4V2E A;  3UL7 A;  1K5G C;  4C2A B;  3G04 C;  4NKG A;  2Z81 A;  1OZN A;  3W3M A;  4UFR A;  3FXI A;  2V9S A;  3WPH A;  4GLP A;  3RGZ A;  3OGL B;  4PEQ B;  5HDH A;  4RCW A;  1IO0 A;  5AWA A;  1A4Y A;  1XCD A;  5AZ5 A;  5GMH A;  3C6O B;  3ZYN A;  4V2D A;  2R9U A;  4R6J A;  4Y61 B;  4BSU A;  2OMW A;  2Z64 A;  3ULV A;  5IJD A;  4RCA B;  1PGV A;  4LXR A;  1ZIW A;  4QXE A;  4R0A A;  4WP6 A;  4ECO A;  3RGX A;  4PQ8 A;  2ASS B;  4H09 A;  1OTM A;  2Z62 A;  1OTO A;  2OMX A;  4ECN A;  1M9L A;  1XEC A;  3W3N A;  4C2B B;  3CVR A;  3CIY A;  4R5D A;  4QC0 A;  1OOK G;  1K5D C;  1P8T A;  1W8A A;  4R6A A;  4K17 A;  4FS7 A;  3ZYI A;  2P1Q B;  4CC4 C;  1JL5 A;  1KOH A;  1A9N A;  1KOO A;  3VQ2 A;  1DS9 A;  1Z7X W;  1SQ0 B;  2ELL A;  4TZH A;  2O6Q A;  1P8V A;  1O6S A;  2IFG A;  4U08 A;  4M7E A;  3M19 A;  4Q62 A;  4WYK A;  4XSQ A;  3ZYJ A;  4R09 A;  5GMF A;  3UL8 A;  2XOT A;  5IYX C;  3ULA A;  4U06 A;  4R6F A;  2Q4G W;  4M7E C;  2OMV A;  4R5C A;  2WQX A;  4V2C A;  5IJB A;  2RA8 A;  5B0T A;  1D0B A;  2WFH A;  4J0M A;  3P72 A;  5GS2 B;  4Q3I A;  3RW7 A;  1FQV A;  4L3A A;  4R6G A;  4QBZ A;  3RFE A;  2CA6 A;  4ARR A;  4YEB B;  2UZX A;  4G8A A;  4OQT A;  4R58 A;  5CMN A;  3E3Z A;  1WWL A;  4R08 A;  1FS2 A;  4LSX A;  2WQU A;  4FD0 A;  5D3I A;  3CIG A;  3OJA B;  4Z79 A;  3W3L A;  1U0N D;  3E4G A;  3WPG A;  3G3A A;  3KJ4 A;  3A79 B;  2A0Z A;  3G06 A;  3G3B A;  2P1N B;  4ARN A;  3WPD A;  2Z65 A;  1LTX A;  4XGO A;  5FTT B;  1M0Z A;  4Q3G A;  2P1P B;  3OGM B;  1H6U A;  4HQ1 A;  3OJA A;  5GQR K;  4Z64 C;  3WPI A;  1GWB A;  4P91 A;  2JE1 A;  2OMU A;  3WN4 A;  5IJC A;  1FO1 A;  5HZL B;  4FHO A;  4FMZ A;  4PKI G;  3ZYO A;  1G9U A;  3WPC A;  1OGQ A;  4U09 A;  2O6R A;  3W3G A;  4BV4 R;  4FDW A;  2OMY A;  1XEU A;  3SB4 A;  5AWB A;  4IM6 A;  4BSR A;  2UZY A;  2BEX A;  4BSS A;  1M9S A;  2OMT A;  3DZE A;  4CNC A;  4GT6 A;  3RFS A;  2O6S A;  5B0N A;  4LI2 A;  3REZ A;  1DCE A;  4KT1 A;  4LI1 A;  1M10 B;  3WPF A;  4LSC A;  3RFJ A;  4EZG A;  4CIL A;  1DFJ I;  4Z8G A;  3C6P B;  1FT8 A;  3JB9 j;  3ULU A;  3O6N A;  2RR6 A;  3W3K A;  2Z82 A;  1YRG A;  2JE0 A;  1XWD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...