4LSDA

Myokine structure
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
MSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibronectin type III domain-containing protein 5
publication title The structure of irisin reveals a novel intersubunit beta-sheet fibronectin type III (FNIII) dimer: implications for receptor activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 15
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lsdA00
2I27N 3SKOA 2UWEB 4XXCC 5FO7A 2Z4QA 4PRHB 1I9RH 2D9QB 5HHXH 2OMNA 3IDIA 4R7DB 3BSZH 4IMKA 2ZKHH 5EU3B 3M45A 5JIHA 3KYOB 2BFVL 1V7MH 2CRYA 3MUGB 4HHAB 5IT2L 2V2WA 1LE9B 1NGYA 1Z3GL 4JFEE 1IM9D 3KLAB 4IM8A 3U46A 1HKLH 1HIMH 1BJ1J 3QQ9D 4GRWH 1A7NH 4PGBB 2VLKD 3RVWC 5JOPD 1C5CL 4XCYA 2BVUA 4ODWB 2E6QA 4ELKA 2AJYL 5E56A 5BCAA 3ULVC 4G8FB 5GGQH 4NOBA 1U8MB 2PR4H 3HUJE 1IFHH 2GUOB 1T21A 3CVIL 2NY0C 1DEDA 4RDQF 4OGYL 1MHPL 4LDLB 3LS4H 1KN4H 1CDUA 4Z6AT 1PG7W 6CGTA 4HS8H 3P4OB 4TPRH 5DLML 5DVOA 1KIPB 4FTVE 1BD2B 1PY9A 1OF2A 3QHZL 4KJWC 3GI8H 1RULL 3KPMB 5IESH 3RU8H 2JIXA 3VDBA 5I1GH 3ZLQC 1OQXA 4LIQE 2VNCA 3DMMC 4HXBL 3MJ6A 3PHQA 4HIHB 2YXFA 4OB5L 3VJ6A 2O93L 1FL6B 1BHGA 4NCC1 3MV9D 5F9WC 1L7TL 4U1IB 2IPUG 4XX1E 2ADGA 2R0ZH 3TT3L 5LQBH 5C0GB 4XPAH 5DQJA 5E4IA 3DECA 3QJFA 1AY1L 5HGAB 3HZMB 1DL7H 4KKBD 2DQHH 4APQB 1I8KB 1AGCB 1RZ8B 1MWAL 4LEXL 3RBGA 4JRYA 1HXMA 3X3GL 4LAQH 4CVWA 1Q0XL 1I1CA 4PRPB 3IXTB 1GC1L 3GRWH 2FWOA 1NC2D 4F9LC 3BRGC 1ZWIB 4FFZL 1IAOB 1Q9KA 3E0GA 4N0FA 1A1OA 4TNVK 3P77A 2PO6C 3RL2B 1MFDH 2QQQA 4V1DE 5E6IA 1AIFA 5DHYA 1A1MA 3KYAA 1D5MA 4BELD 5H35A 2EDQA 4BZ1H 5IKCA 4P59L 4M48L 3DWTA 5IG7A 2A0LD 1R0AH 1IQWL 5KVDH 5I8EB 3ZYIA 2FR4A 1RK1B 1X5YA 1NCCH 1FN4A 3IKCB 1MHEA 4PYGA 2AJVL 4X5XB 1FNEB 1M7IA 3FZUD 4IS6A 4P2OC 1YY8A 4D0CA 4HUUA 1TVDA 3T0XA 2ZSWA 1DQTA 4JO3L 4MX7B 5C0CB 2OL3A 1IAII 2P8LA 4PJEA 4QEGA 4JN2A 4O58H 1BEYL 2AEIT 1PKQE 3W5MA 1F3DJ 3OJ2C 1OPGL 4KJPD 4ODTH 3VW3L 2XXMB 3PUCA 3QXAA 1CK0L 1Z9OA 2GJ6B 1CG9B 4OLXH 2A74B 2CKBH 2KH2B 1WZLA 4F7TA 4UQ2B 2AGJH 4HC1L 3LS5L 2Y06H 4HT1H 4UIKL 5KSBA 1R3HA 2AJSL 5E5UB 3V0WL 4PJ7F 2ATKB 4LSSH 5DHVB 5JHDA 1UGNA 3IETA 3MBXH 2P5EB 1GGBH 1E4WL 2QQLH 5CEZD 1JNLH 4YFLI 2VABA 4KKBC 3VCLA 5GISH 4YHYB 4D9QD 3MR9A 4PTUA 5HDOA 2BMKB 4Y1AA 3VA6A 2CJUL 1C5BL 2NX5B 1BF8A 1UVQA 3HE7B 3ZT7A 2OQJA 1S9WA 5FFLA 3AB0B 1EJOL 4HH9B 5E8OB 2FB4L 2ARJQ 4WWID 1U42A 4NCDA 2D4FA 1JZ4A 2NW2A 4LCYA 2FSEA 4FABH 4J3UA 4JKPL 3RQ3A 2IF7A 1DLFH 5IJVA 1VCAA 2J8UF 5EZOH 5FYLL 4PJCA 4WUKL 5F1SA 5JDJA 5IMOA 3TGXA 5JOFA 3TC9A 1HILB 2VL5B 1ADQH 2BSTA 2W0FA 1KJ2A 1N6VA 5LCVH 4MVBD 5EH1A 3FZUC 3TYGL 2PXYA 2V9TA 1QR1A 3MBEB 1DBML 4JJHA 4HGKC 5IVXA 5AAMA 1U3HD 3PHOA 4XTRD 1R3LA 4J3TA 4OQTL 3S96A 3VWKD 1KPVB 4PJ7E 5DYOA 3L9RB 2JJVA 5HDQH 4NUGH 1YY9D 3O3EB 5T5NF 5CP3A 2FO1A 5J12B 3RTQD 3LN4B 2Y07L 5FCUL 3FQXA 4NQVB 4M02A 1YNTB 5J11B 2FJGB 2ZP0T 1P7HL 1H0DA 1Y18B 3OZ9L 4UU9B 1QFWI 1OARH 3DO7A 1QBLL 4Y19A 4O2FA 4WU7A 1P84J 2YN3A 2BP3A 3RWHB 5FUOH 1A47A 5FYKD 2XA8L 5LG1A 3WFEH 3QEHB 4YBQD 1I9RL 4U49A 5CGMA 2L0DA 3OAYK 4BJLA 3BSZL 2ZKHL 2YS4A 5EU6E 1JK8A 2J8UE 1V7ML 5D2NE 2ZUTA 3QUKA 1AGEB 4W4NA 5KJRL 5B38A 1WJ3A 3MV7A 3D85B 1HKLL 1OAYH 5IQ9A 3SKUD 5BVJA 1NLBH 1G7LA 3PJSA 1RIUH 4KRPB 1P4LA 5DUBB 2C9AA 1A7NL 2EICA 3HN3A 3UPRA 1BOYA 3VXMB 2OSLA 1I1FB 4NQDB 4Y4FB 4OZGB 2AXFA 2PR4L 3JUYA 3W9DB 4IDJL 1XT5A 5CJ5A 4AIXA 1GL4B 3CNKA 1VHPA 4MVBC 3H9SA 1XR8B 2ATPB 4PV8A 5I1EH 1FC1A 4R96B 3LS4L 5C6WH 3UTPD 3F62A 1C12A 1S7WB 1U2HA 5FAAA 3UTSA 4JQVA 1WBYA 3S35X 4GW4B 3B4NA 1T6WA 3QQ3A 2A77H 4GAGH 4X9FA 3VWKC 3NN8B 3GI8L 2D7OA 3D69A 1QD0A 3GMNB 5IESL 2VWEC 5KANG 4PP1D 5FYKU 1U8JB 2JIXD 3WUWB 5I1GL 4WHTB 2BSRB 2WWKO 4I4WA 4XMLH 2UZIH 3AY4C 2GK0B 4PJFE 2B20A 3OR7A 5BQ7B 5HGBB 3HMWH 4LDEB 2R0ZL 5LQBL 4XPAL 4C56E 5IK3B 1VEOA 4MDIB 5D8JH 3TJHD 1PBYA 1KLUA 5SWZE 2ZNXA 1CVRA 1RIVL 4YBQC 4QHKJ 2ICEA 1QRNE 2YRZA 3PIQA 2J6EL 4JRYD 1X4YA 2YXMA 1Q38A 2DQCH 2D4DA 4TUJA 3GRWL 3LPFA 5D7JC 4BUGA 4U6YA 1MSPA 2XN9E 5F1IB 1UKQA 1GOHA 1QPXA 3FFCA 5EPMA 3G9VA 4QY8B 4EUPB 3TBWA 5GS0L 3EOTL 5E6ID 1BFTA 3QUXC 3W0WB 4R4FL 1VFBA 3GHBH 5C0DB 5D72L 4HFUH 1E4KA 1R0AL 4NRXB 3QUYB 1GGYA 1X5AA 4NQCE 1XCQB 1T0NA 2FLBT 2OXHA 3K3QA 4XX1G 2OM5A 3GMOA 1G1CA 5F7EH 4HX1A 5CIPH 1VKXB 2RGSA 5DK0B 3ZHKA 1H3WM 5DD1H 4NT6B 4BSJA 4LSPL 5JIKA 3EO0A 1MCRA 4OLYL 4OLXL 5IFJA 4PP1C 2CKBL 4TUKH 1LDPL 4TQEL 5KSAA 2Z93A 4LVHB 4NN7B 1ACYH 1I1YB 4Y2DB 1FH5H 2BOBA 4HT1L 1JRHI 1IL1B 1I3RB 1FJ1A 3K74B 1ETZB 2AQ3A 1GIGL 2VE6A 3C8KB 4RDQG 3V95A 3AM8A 5JHDD 4WHYH 3TLRA 3MBXL 4GJTB 1GGBL 3RVUC 3AAZB 4FOMA 2QQLL 4X4ME 3JSSA 4YLQT 2EDYA 3BP4A 5GISL 4NPYB 2AK4D 5E2VH 1PD6A 4H26B 2VMFA 4HF5H 4GBXA 3SQOL 4O00A 4Y1AD 1FFOA 4WW2F 1TJHH 2OXGA 1FNSH 3FQNB 3WSQH 3ARPA 5C86A 4FZEH 3HNSH 5I8OH 4K2UH 4L9DA 4BKLB 1QSFB 3DX6A 4F7PB 3IS0X 4KZEH 4MJID 5KOVC 2FZ3B 2VIRB 3CXDH 4J3VA 1DLFL 5EZOL 5TE7H 2QADD 4CBPA 5F9JA 1R3JB 4S1DD 1SHMA 2J5LB 1ADQL 2DRUA 4BQ8A 1NCDL 2YPVH 5LCVL 3ZTJH 1KCLA 3FOLA 4K7PY 2VLMD 25C8L 2X41A 2PXYD 2HFFB 1EFXA 5J8OA 1BZ9B 4L8SB 3O2DL 3BD5A 4FQJH 4NDMB 3ZDYF 2GK2A 4LCWB 2IEPA 2Y5TB 2Z31A 3RIAF 5DA0B 5I15H 3FCTB 3VMNA 5C07B 4LARL 5E5RB 5HHPA 1XF3A 3L3GA 3MNWB 5D70H 5SWSE 5LKNA 5TDOB 1X5GA 4Q6IB 5HDQL 1T03L 3FB5B 1OHQA 2P7TA 1KJVA 4NUGL 4P3DB 5JPMA 4OZIB 1D7FA 1EBAA 2IWGA 1XIWB 2PYFB 4JFFA 4ZOAA 5FUCC 2X4SA 3VRLF 4YK4C 5EIVA 5I17B 5FGCB 3VXTB 4RAUB 3LKRA 2DWEA 1KBGL 5JNYB 4QWWD 3CU1A 4K8RH 4W4OA 5CAYB 5FUOL 4CNIA 3MLXH 3QAZB 5KS9A 4LVOB 5EU7E 2IC2A 3L95B 3ROLA 1DDHA 4KU1A 2CLVA 3ORJA 5FHBH 3KPQA 4NRYB 2E8ZA 2HAZA 4YGAB 5I8KH 2ZG1A 5CWSA 2NCMA 4MNHA 2N7BA 1QRKA 4KKAD 1XGQA 3VFOB 3MV7D 1OAYL 1NLBL 4YXHL 1RIUL 3SDDA 2E7BA 1N0LA 3DVNA 4P3WA 1KTKE 3MOQA 4HFWA 4OLEA 4YHZH 5MEPB 4XXDB 1HSAA 1DQJA 4WIQA 3KPLA 3OKEA 2QADC 4FHBD 3ZDYE 2H9GA 1YYLH 4LSUL 4UINL 4S1DC 3QFJB 2HG5B 4PB9L 2OR9L 5BXFA 1INDH 4GXVL 2BCKB 3HMXA 3H9SD 2F9BT 5I1EL 3LEXB 2PXYC 3MUZ1 1NMCB 5C7XH 4XH2A 3V52H 3QDMB 4TTDD 1NEZG 4JFZL 3UTSD 3VRLE 5D5MB 1ZS8B 1R24A 3BXNB 2YD7A 5CIPA 3I6LE 4I3RL 4RIRB 2B8OT 4Z76B 1YN6A 4H8WC 4JLRA 2ICWI 1PZ5B 3WEXA 4O9HL 4XMLL 1CFVH 4TULH 3BKJL 1RZGB 3W9EB 2A73A 2RFXA 3HMWL 3WIHH 1G9ML 1QA9B 1T1ZA 2F58H 3QDJB 4QT5B 3DYMA 3U0TB 3KWWB 4X98A 5D8JL 1RVFL 4X6FA 2HVKB 3ZL4L 4L3EB 5IF0B 3NZ8A 4NM4L 4MNQE 1D5XA 5F88A 3LKPB 4R0LC 1R3KB 1N59B 2RQ8A 4PJIB 4P2RB 1R5VB 1IZKA 2CIIA 5E00B 5D1ZB 4BQ6A 1S7UA 1A9EA 3BWAB 2Q8AH 2APBA 4OUUB 3MX0A 4O2CA 4KKAC 5E5MA 2SEBA 4PJXB 1QBMH 1SM3H 3FFCD 1E28A 4ETYA 1LILA 5ERWB 2X40A 3WBDA 3DI2B 2VLRB 1AXSB 1JGEB 1D5ZA 3LQAC 3CC5A 3VD3A 1V7NH 3GHBL 2AKRB 4HFUL 3FO0H 3FMGH 3K2MC 4XZUA 1MFCL 5L7XL 1F13A 1U95B 4LVEA 5DQ9B 1CICD 1HQ4A 3O8XB 3QIUA 1RURH 5F7EL 4BZ2H 3MV11 3CSGA 3TO4A 1FVDA 4P5KA 2G60L 5T3ZL 4XP9L 3UBXG 1RI8A 1OLLA 4D9RD 4TTDC 5IEKB 4QRRA 5DD1L 1FBIH 3X13A 3O4LA 5C09E 3RNKB 4CKVX 1AD9A 1E4JA 2IAMA 4L8BB 4NJAL 1Q94B 5L88H 5KSAD 1VESA 1OM3H 3HS0B 4XVUD 3ZYZA 4UV4H 1IE5A 5D96C 5DC0A 1KTLB 5MP6H 3BE1H 3VFTB 3HAEG 3BP5A 3PV6B 4X4ZA 1FYTA 5I30H 1S7QA 4QTIH 4YNYA 5E2VL 4WWKA 3VXPA 4XBGB 3ULUC 4GBXD 4R7NB 4WU5B 5DHVH 3ROOB 5KSVA 1MRCH 4RFNB 1DUYB 1KOAA 3T3PE 3Q0HA 4PJBA 3HNSL 3STBA 2W1NA 5JA9A 5I8OL 3HG1A 2VN7A 1GGUA 1FZJA 3DVFA 5F71A 2DIBA 2FH6A 4N0UE 2CDEA 4EIZC 4Z7NF 4AEHH 5CKGA 4R4ND 2IG2H 4PRHA 5BS0E 4HUVB 5HHME 5TE7L 1KNOA 4AEEA 3BISA 2EDLA 1G7QA 1E4KC 1YJDC 1KELL 4R7DA 5K9QI 5H2BB 3KJ6L 4TVPE 5EU3A 3VFRB 3C6LA 1CICC 2X9YA 3MUGA 3SDYH 1TZGL 3LN9A 1H3GA 1CLCA 1T89A 2GHWB 4XCCH 3KLAA 1CLZH 1NSNH 3CGTA 2VXQL 1EFXD 4W70A 2WSKA 4FQJL 3AXLA 3EYVB 1IBGH 3KYNB 1VGKB 3SO3B 5I15L 4GRLB 3OL2A 1ZOXA 2Z8WC 5D70L 4D0DB 2WANA 2VISB 2IANE 3AS0A 3BPLC 4G8FA 5DVMA 2GT9B 4ZMAT 1JVKA 4PTTB 1UZ6E 3QI9B 4EN3B 4KJQD 4M7LT 3WFHB 2GUOA 4MSWB 4U1NB 3G6DH 5EOCH 1UWEL 3OG6B 4JFFD 5KSAC 2B0SH 5TF1L 2APTA 4XVUC 1E27B 3RY4A 3AMLA 1N5AB 3CX2A 4M4RA 4QLRA 2P24B 1FVCB 3AM8C 5DZLA 5T5FH 3CSYB 4QRQB 5HHVH 4UTAH 2FNBA 1BD2A 2AEPH 1FPTH 3C08H 4Z7NE 1AHWA 4ZO6A 5FHBL 3MZTA 3VXRE 4GBXC 3O2WH 1IGFL 3S9DB 4GW1B 1MCDA 5I8KL 2Z9TA 3DX7B 3TIDB 1X5KA 1FL6A 3SE3A 3EO9L 4GAJH 3UPCA 4M1DL 2NY1C 7FABH 3CCHB 3MRKA 3BO8A 3FO9A 1X5LA 1TITA 5DEGB 2PYED 1X5ZA 3HZMA 2YD9A 3OKDB 4R4NC 4QXGH 5F72S 1A02N 1MJUL 1RZ8A 4K71C 2VERN 4YHLL 4XWOD 1FAIH 4MD0B 3TWCL 5DMKB 1ZGLP 2GW5A 3B2UD 5L6YL 4Z5RB 3HUJB 1INDL 2RCSL 1ZWIA 1DLHB 1T20A 5K9QG 1HYRC 5F7KC 1TNMA 3RL2A 2BNRA 5C7XL 3V52L 4F37K 3IJHA 2VH5H 2UZYB 5F97E 4H5SB 4AIZB 3ULVL 4XCNB 3D2UA 4NBYB 1K3IA 4NNPL 3N1QC 5C2BH 4RMSA 4YDJA 3BH9B 1FO0A 5I8EA 5C0EB 3OKKA 3WO4C 1RK1A 4M8QB 5L9DH 2R8SH 4KJQC 3IKCA 3SDAB 4G6FB 5AZ2L 4X5XA 1BQLH 1FNEA 1CFVL 3GJFK 3BP6A 4NC1C 2C3HA 3MLWL 2NY3B 3R8BB 3OPZH 1KGCE 5C0CA 3WIHL 1MAKA 5CGYD 1ORQA 1SBSL 3KS0J 3WJJC 3MMEB 5HGDB 12E8H 5T1MB 3GNMH 1H3VA 4W4OC 5FA3B 2GJ6A 1CG9A 5IJKC 4LLYA 1K4DB 4UQ2A 3OG4B 1UYWL 4XP5L 1JF6A 1XCTA 4J1UB 2C26A 1P4BH 4J3XA 5E4EC 3ESVF 4S1QH 1QBML 1SM3L 4YJZL 1JNHB 3QPQD 2P5EA 4QRSB 1TJGH 3V2AR 4YQXL 3UTTE 5J6HA 1IQDA 3MV8B 4O51B 4KRMB 4S0SD 2BMKA 5DTFB 1SY6A 3R4DA 4B7IA 1ORSB 2NX5A 3IFPA 1ZE3C 3IDMA 3U1SH 4AY0A 3RIAK 2GSGA 2XA3A 4EUPH 2AS5M 1FFPB 3HE7A 4OD3H 4MAUH 3RIFF 4OSUH 3RKDC 3QIUD 4HIXL 4HH9A 4BZ2L 3O45A 5E8OA 4GS7B 3TO4D 2OCFD 4HV8B 3EYFB 5D7IB 5FF6B 4LPUA 3DJ9A 3KLSA 3MRIB 4QRRD 3RWIB 3RWFA 3QG6B 3U30B 2BVPB 1U92B 1L0QA 3O4LD 1N3NA 4F8TA 5KG9B 3CFEA 4GG6B 4WDIB 1E4XL 2IAMD 2BOCB 2DQIL 2EXWD 2VL5A 5L88L 5DD6B 1MI5A 1R5IB 3C60C 4R6UA 3T1WA 1MRDH 4UV4L 1N26A 3MBEA 4LK4A 4QHUB 4DN4L 3V5DB 4U3CA 3OKNB 4HUNB 4PRBB 3BE1L 1DQMH 4LASH 5J9PB 2G75A 5I30L 3CDYA 1KPVA 1E6OH 4KTEH 4WWKD 1MCSA 5CHNB 5ID0B 3O3EA 1MRCL 3LN4A 1SJXA 5FOBB 4NQVA 1ZHKA 1YNTA 4AQ1B 3BDYH 1OOAA 3QEQD 2DQJH 3HG1D 3OB0K 2FJGA 3SDXF 1Y18A 4UU9A 5HHOE 1OT1A 1C7TA 3NAAL 4AEHL 3WDIA 3K46A 4QTHB 3QPQC 3WHE0 4AEFA 2Y4SA 2IG2L 3GMPB 3SCMC 3QEHA 3WKNA 1NCNA 5ICXB 4OZFH 3N50A 1NFIB 5FM4A 4RBPK 3LKNB 3GSNL 4G3YH 3MCKB 2CR3A 4Q9QL 3ARUA 3KAAA 3C6LD 4LKCB 4CW1B 4B7LA 3SDYL 1AGEA 1L9NA 4U2ZA 4XCCL 2VDMH 1XF2B 1CLZL 1NSNL 2AJUH 1JWUB 3D48R 3D85A 3REWA 1LO4H 1UJ3B 2OZ4L 1J88A 5DEZA 4NQDA 1I3VA 3EGSA 4LLUA 1MH5B 3S5LG 4Y4FA 4OZGA 3ZE0E 4LBEB 4PJ7B 4R90H 3EJZC 2IAMC 2EXWC 3G6DL 5EOCL 3DTXA 3WDJA 3MA9L 3U4EB 2KQMA 2B0SL 4P5TB 1NBQA 2ATPA 4R96A 2CIKB 1EBPA 3UDWC 4MGXA 4NNYB 4JFQB 1MCHA 2A9MH 2XYCA 1DEEB 4GW4A 4MAYD 4WTWA 4M8VA 5HHVL 4UTAL 1ZMYA 3SDXE 2AERT 4J4PA 1BD2D 3NN8A 4N0CD 2AEPL 2NXYD 3C08L 3R1GH 3T1FA 3KHOA 1U8JA 3FL7A 2CGRH 3WUWA 1MCOL 3O2WL 2IADA 8FABA 3IF1A 2BSRA 1NEZB 3DX8A 2GK0A 3CZFB 5BQ7A 5GSVB 1WT5A 5HGBA 1F2XK 4DKFL 1X6NA 4N8VG 4GAJL 2D7QA 3QIBD 4UV7L 2J8UB 1J9CT 7FABL 1A0QH 3EJYC 3ILPB 3I9GH 5D2NB 4ODHH 1JPTH 5IK3A 4YHPA 5CEZL 1EEYA 4JQXA 3ALWA 2WWKT 5F6IB 4K7PH 4Z7UA 1FAIL 1BBJB 2EYTB 5I19L 3ZKXC 4BSWB 4YPGA 4Z77B 3L3IB 4A2LA 1U0QA 4JHAH 3C6LC 1T1WA 1YPZA 4P23B 1JBJA 2VDPH 4OLZH 4QGYA 4KJYB 3FRUB 3B3IB 2BNRD 1D9KA 1JNNL 1LD9B 2X2YA 2VH5L 4UQ3B 2J8OA 2N1KA 2VQTA 5DK3A 3X14B 4XC1L 3SPVB 3C8DA 3W0WA 3DX9B 3HRPA 3KR3L 4NZUH 3D2UD 5C2BL 3NVQA 4S1RL 2LTQC 5BV7B 4YFEA 5IHBA 3WHXB 1BQLL 3AS3A 3H9ZA 1FFNB 1H8OA 5J1TC 4J3SA 1YQ2A 5JUEL 3IDJB 4FMFA 4KKCD 4PJFB 4JVUA 5C0CD 1T3FA 1O7SA 2WLYA 5A43C 3ZDXE 5H94B 3TA3A 4M1GL 3GNML 4XRCB 4NT6A 4MAYC 3QIWB 4RMWA 4N0CC 2GJ6D 5IHUH 2NXYC 1J5OH 1V3JA 4H8WH 1AHWC 2QR0A 4HIIA 1WWAX 4NO0B 3TYFB 4OIIH 1I1YA 4KC3B 4Y2DA 1IL1A 3C5ZA 1P4BL 4YE4L 1I3RA 1UB5A 1TVHB 1ETZA 4S1QL 3QIBC 3C8KA 5IHZB 4XNUH 1IMHC 4YFDB 4ZFFA 4XMKH 1QKZH 2XN9B 1TJGL 2P5ED 3AAZA 5FYKL 3TCLB 1LO5B 2DBLL 4NPYA 4PY8J 3AROA 1U8NB 4DGYH 3W11C 1PX3A 1CFTB 2NX5D 2AK1L 3ARFB 1NMAH 3HAEB 4OD3L 3B2VL 4POYA 1A6ZA 4NQCB 4MAUL 4OSUL 3ZT6A 4UI2A 2DKUA 4ZNEA 1QSFA 4HAGA 4DQOH 2VUYA 4F7PA 1LE5B 3EFFB 2NLJB 4X99B 5EUKB 2FZ3A 2VIRA 32C2B 3LQAH 4HJJL 3H0TB 5T1LB 2E8YA 1NFDA 3PGFH 4G80B 4MXWH 1R3JA 3NCCB 1ZHNA 1JL8A 5HI3C 1JZ3A 4JRXA 4ZODA 1MI5D 5DJ0A 1EVUA 3IDYB 1MRDL 2HFFA 5SX4I 3MBED 4F15B 3BPOC 1BZ9A 4L8SA 4HS6B 4NDMA 5IROC 2DJUA 3BPCB 3V5HB 4EQ2A 4LCWA 2Y5TA 3FRPG 3FCTA 5DJCB 3B9EA 1CDBA 2CSPA 4KTEL 1NAMA 5TDOA 3RDTD 4MJ6B 4Q6IA 4QOKB 4Y5VC 4P3DA 2B7DT 4OZIA 1PFCA 1EGJH 1T66C 5F7HA 1XZ0B 4U6XA 4NRZA 2PYFA 1UZ8B 3UJTH 3BDYL 4M3KB 1WEJH 5I17A 5BW7A 4JHBA 3VXTA 3WFBH 5JNYA 5D7LE 2EXYD 3OAYH 1IAIH 3JTSB 3SO5A 2FCBA 3L95A 4YGVB 1J0HA 3TPKA 3ULUH 1ZT4A 3CK0L 3QWOB 3EOYG 2H32H 4G3YL 3JWDC 4PJ5E 4NRYA 4YDIH 3O9WC 1RHHB 5L2KD 43C9B 1QFPA 4J8RB 2AJUL 1YNKL 1QHOA 4NM8H 3VFPB 3VFOA 5C1MB 1DBKH 3D85D 3GB7B 5EZJB 4GKNB 3TFKD 2MKLC 4KMQA 1KC5H 1KUMA 1OSZB 2FX9H 1H3TA 4XXDA 4LL9A 5MEPA 4NQDD 3FAXA 3L6FB 3MXWH 4Y4FD 2WAHA 4P9MH 5SWSB 5DF0A 3QFJA 4IMLB 2BCKA 4PY7B 4O5LL 4XCFH 3LEXA 4WW2C 3DGGB 2OR8A 4HWZB 4JG1H 4CMHB 5D1XA 1CGVA 2AQ1A 1FC2D 4OQ1A 3QDMA 1RUAL 1RY7B 2A9ML 2DQFB 4X7CC 3D18B 1JGVH 5IOPA 1MIMH 3BXNA 5GRZA 1SJVA 4OFPA 3FQWB 4J4PD 4RIRA 2V5RA 3RDTC 3F5WA 3R1GL 1L0XA 4Z76A 2CGRL 1G9NC 1CXKA 3OKOB 3KDMB 1PZ5A 5DJ6B 4CU8A 2IMNA 3W9EA 5EC2A 4P2QE 3V4PL 1A0QL 1GOGA 3FFDB 1H15B 4IOSD 4ODHL 4QT5A 1JPTL 3X3FH 3KWWA 1CXIA 1TVBB 2MSPA 2EXYC 1F4XL 4CJ1A 3JV4A 5TJWK 2FATL 4L3EA 5IF0A 1CYGA 5IV2B 3LKPA 1R3KA 4K7PL 2Y36H 1YMMD 4PJIA 2XZAH 3PQYE 4KK5D 1R5VA 5E00A 2W9EL 4K3EH 3CH1B 4JB9H 2NXZC 3BWAA 5I71C 2JJTC 3CH8A 4WI4A 4JHAL 5JW4M 4P99A 4N0RA 3UZQA 4DGIL 1KEMH 3TH4T 1JCKA 4PJXA 2ZCKH 3EYQC 1D9KD 1JPFB 5ERWA 1U58B 2VLRA 1AXSA 1JGEA 5E2UH 1QFWH 1QSEE 2HKHL 1U8PA 3W0WD 4EI5B 4IIQC 3SGKC 2AKRA 4U1GC 3MJ7B 4TSBH 4MXVF 3RVVD 1OL0A 2X6MA 4I77L 1U95A 1NKRA 1ZANL 3WFCH 3ILQD 4OBSA 5DQ9A 4AT6B 4B5EA 4HKZB 4UDUB 3O8XA 2HJLA 2WK2A 3L5HA 3O6KH 1YEEL 3C5SA 2F5BH 4YEFA 4EDWL 2P5WD 2EECA 4I8DA 4KQ3H 3TA3D 3LDBB 2D7TH 4LIQH 4MCYB 5IHUL 3RKPA 3QRFM 1J5OL 4H8WL 4GW5B 4OIIL 4I0PB 4NO2B 3HS0A 3LKOA 4Y2DD 3C5ZD 3WNMA 2F5AH 2JCCF 1NJ9B 4OI9A 5FM5M 3Q5TA 4W6XB 3SGDH 1KPUB 2XZCH 3RZCA 5CILH 1KTLA 3QJHB 1XF1A 1UM6H 3VFTA 4DEPB 5IW1B 5E99L 2ED9A 3ARGC 1GPOL 1MQKH 3BEVB 1G7MB 5DS8B 5ABDE 3M8OL 3MREB 2I07B 2NZ9C 4AEIL 4QHNB 3GGWB 4WU5A 3ROOA 4HIJB 4KK5C 3F58L 1NMAL 2J3SA 1LEKB 3CFKB 1IGYA 1B6UA 1QSFD 3E6HB 2BSSA 1MVUB 4ODBD 4N0YL 5DI8A 1N6QH 3BJLA 1D9KC 4ETQA 3LQAL 4H25A 3MJ9H 4WI3A 4UNTA 3RAJL 2P43B 1JTTA 5HYJE 4YUEH 4PRIA 3RVXD 1WIOA 4M7ZC 1XGRB 1BVKA 3DHJA 5H2BA 5F96H 3VFRA 4JRXD 1I8IB 1TETL 5ILTH 1KJMB 5CP7B 1DANT 3P9LA 4KRLB 3QDGA 4MLIA 3VWJB 3KJ4C 1NC4B 2GFBB 3EYVA 3DUHA 3KYNA 1VGKA 4LCWD 5IW3A 3RNQB 3C09B 1N5YH 4GRLA 5DGRA 3TA3C 1NDGB 3QR2A 2GQHA 1RV6X 5EO1B 2JCCE 2VISA 2A6JB 2GT9A 5A16A 1ROWA 1F42A 4PTTA 4EN3A 3QI9A 3BZDA 5J7CC 3UJIL 2VZVA 3WFHA 1EGJL 1EK3A 2EDEA 4MSWA 2X1PA 4U1NA 1AGBB 1A14H 2DQUH 1YEGH 3B9DA 3TVMB 3UJTL 5K9JH 1MJ8H 1AQKH 5IBTH 3K80A 4PIRF 1WEJL 2DLIA 3C5ZC 1N5AA 3S5LB 5MHSE 4XVSH 2WIIB 1FVCA 1TMCB 1EO8H 3OXSB 4N0UB 3CSYA 4WJ5B 5JXAL 4WTZG 5GSRB 5C0RH 3ULUL 5BS0B 1EV2E 2JKXA 3C5JB 1WSST 2VXVL 3L3OB 1NGZB 3FT4B 1T22B 1NCWH 2WW8A 2EDWA 1WWWX 5ITBH 3TIDA 2WBJA 1DBBH 1U8OB 3P0VH 4JG0H 5ALCL 1DBKL 1WAAA 4K3JL 1JRHH 4KI5F 3QCVL 5DEGA 4LSTL 5GIRB 4Z95L 5I76B 1CDCA 1KC5L 4OGXH 3QHFH 3WIIH 4N8VB 4U1HB 3MRBA 1WCQA 3RVXC 4MNGE 1YJDL 3TZVB 2VLJD 1UC6A 2Y6SC 4OD1H 4MD0A 1T5XB 4RX4A 1OD9A 3QFJD 4Z5RA 4NZRH 1KB9K 2M26A 1UG9A 5INDB 2DM2A 5TDNB 4JG1L 3CFDB 5D1XD 1FL3B 5FECB 2NY2C 5ANME 3QDMD 1ZGLB 1INEL 4ZD3L 5CZXC 3G6JB 4H5SA 3MJ8B 4AIZA 1MIML 4XCNA 5EDXA 2X5PA 3BH9A 5C0EA 4M8QA 3QBTB 4U7SA 5CSZB 4ZUVB 3SDAA 3P40A 4PYHA 3VXRB 1P1ZB 2YPKA 3D3VE 2FHFA 2Z8RA 4L4VE 5BW7C 1A3LH 3LH2H 3X3FL 2XV6B 2YPLE 2RAMA 4RMRA 2AW2A 5I74C 5F1KC 3MGTB 4RRPG 4NKOB 4D8PB 4LLMB 4WV1B 3P11L 1TIUA 4KI5E 2XZAL 4HCRL 4K3EL 5F3BB 1K4DA 1J8HB 1QPPA 3BD3A 5K9KB 5F7DB 3ARQA 4J1UA 4ZAKD 1G0DA 4YO0B 1KEML 4HLJA 3X12A 1JGDA 1S9KC 5D1QB 3MRCB 4QRSA 5ENWB 1CD1B 5E2UL 2VLRD 1QFWL 3MV8A 3BEWA 2GTZB 4JAMB 1Y6KR 4TSBL 4KUZH 2NY4B 1ORSA 4N90D 2DWDB 2PNDA 3RWGB 3FT2B 4NSKA 3PDGA 3NA9H 5GGVY 1GCFA 5I73B 4LCUA 4CAGA 3L1OL 4FQQA 5C3LD 3RPIB 2F5BL 2J12B 4OM1H 4HV8A 3EYFA 5D1XC 5D7IA 5FF6A 2QSCH 4DN3H 5BV7H 4KQ3L 1I85C 2D7TL 3RWIA 3QG6A 1NCBH 1OTSD 3FQUB 4LIQL 1IARB 1F4HA 2GIYA 1MFEH 5LAXB 4BUHA 4GG6A 1GYAA 2EDHA 4XVTH 2FECL 5DD6A 3WNKA 3P3YA 1R5IA 2GITA 3S34H 4M62L 5CBAB 4JFPB 4QHUA 3V5DA 2EKJA 2Z35B 3WS3B 1M7DB 4PRBA 1G0YR 5CILL 4Y4HA 3RZCD 1UM6L 3JWOC 3JV5A 2YZ8A 5J9PA 1PYWB 1MQKL 3P4LA 5IBUG 4NBZB 1I8LA 3UTTB 1AJ7H 5ID0A 4OF0A 1EHNA 2A9NL 1QNZL 2E9JA 3L5JA 4JZJB 3BW9A 1V3MA 3OAUH 4IRSA 1FE8H 4ZAKC 4Z7WA 4MJ2A 3OKYA 4WENB 2X9WA 2ENSA 2JELH 4QTHA 3MJ9L 3MLRL 5KSUB 1LGVA 4ODVL 4PRID 5ICXA 2VXTL 1LWRA 3QXDB 3LKNA 1UEMA 6FABH 3V4VH 1DCLA 1MCIA 3WN5B 5FDWB 4BYHA 5GS1C 4XPBH 5ILTL 4MB3A 3DARA 4HK3N 3QG7L 4GAYB 3DBXB 1XF2A 1IEHA 3QDGD 1JWUA 1WK0A 1A7PL 5GGTH 1Q72H 4YBHA 1FZOA 3ARBD 1UADC 4UUJB 3V4UL 1N5YL 2OMBA 3TCXA 4GRLD 2QHRH 1Q9LB 1OTSC 4IOIB 4GMSH 4H88H 1MH5A 1RJYB 4CVXB 4KVNL 4LPCA 3DV4A 5KOMC 5I1HH 3QI9D 4LBEA 4U1LB 3RUGF 3GJEB 3VXSE 4WO4C 2ITDA 1A14L 1WBZB 1T5WB 4G8IA 1YEGL 3EW3B 1FRGH 2JJUA 4XPGL 1MJ8L 4OAWB 4CGTA 3RWCB 1P5UA 2CIKA 1IGJB 1QFUH 2EH8L 4XVSL 1S7XB 1ZEAH 1Y0LB 2DQGH 3OSKA 4NNYA 1MOEA 3QCTH 5EU5B 1EO8L 4JFQA 3G5YB 3NFPB 5IM7B 5HHOB 3RZCC 1DEEA 1UXSA 2ZUXA 3OXRB 2VDOH 4V2BA 2H1PH 3T77B 5E08H 1A7BA 1SEBB 5FGSA 3EIFA 3MV01 1T83C 1NEZA 1TNNA 2R1WA 4K07A 4U05A 5ITBL 3CZFA 5J4MA 2WBJD 5GSVA 3P0VL 3T0EE 1YDPB 3B9KB 2XTJE 3VG9B 3HCVA 3ILPA 4JG0L 5D2NA 3A6CH 4WEUD 1JRHL 2CLRB 1XGPB 2YD8A 4R97C 5FOJA 1J1PH 3GSOA 4A2MA 3P30H 2VZOA 3WIIL 3QHFL 2D7NA 3MRMB 1DSFH 1L7IH 1MCBA 5E6ZA 3KXFE 4OD1L 2XWBB 1BBJA 2EYTA 4ZS7H 4RX4D 4BSWA 4Z77A 3L3IA 2NY6C 4NZRL 4ERSH 1JHKH 4LSRL 4WGWB 5DUMH 3JBG7 4KJYA 3FRUA 3B3IA 4NKMA 3RUGE 2NY6B 5L2JB 4M4PA 1LD9A 2D7MA 3ARBC 5T3ZE 3X14A 2KZWA 5C6TL 4RMQA 3NCJH 2YOCA 5MENE 3DO3A 3GJFH 4F9PA 2O61B 3T04D 2X70B 3WHXA 4G6FD 5F3HB 1FFNA 4WI5A 1HOCB 4HD9A 3NCBB 3IDJA 4PJFA 1REIA 4UAOC 1A3LL 2K3TA 4JFHD 5EBWB 3LH2L 1OY3B 3VDCA 3GMLB 5IMKB 1XR9B 1Q9OB 4XNXH 1H3XA 5H94A 3AREC 3LAFA 1F3RB 5C0ND 4UT6H 4P0DA 4XRCA 2GI7A 4UMGA 1YEFL 3QIWA 1ZK9A 5FHAL 3Q48A 3U2SB 3LD8C 3UBXA 4DUVA 4OF3A 4X6BA 3G5VA 1ZV5A 4OM0H 2AJZB 4Y88A 5BJTA 1CF8L 5IMLB 1U6AH 2HT3D 2WBJC 1TCRB 5IHZA 3OGOE 1HI6A 4XT1C 3TBTB 4HWNA 3QO1B 1H5BA 1N4XH 5I0ZA 1LO5A 4FG6C 4MMXC 1CFSB 3MV8D 4NP4L 5IB4B 5JXEA 4XNYH 2EEDA 4KUZL 3QYCA 2DLEA 1CFTA 1C5DB 5E70A 1B0WA 3ARFA 4F3FB 3HAEA 3NA9L 2VXSH 4ZFZA 4NQEB 1AO7E 4WRLA 3S97C 1SVZA 3CFJB 3HE6B 2NLJA 4X99A 5EUKA 2QSCL 3MRRA 3IU3A 5HVHC 2FJFB 4JFDE 3VRJB 1DE4B 5ALBH 3H0TA 4WUUB 4K7PX 5T1LA 4RAVB 1NCBL 4LCIL 5C0BE 2ESVA 4HBCH 2DIAA 4OFVA 4ZSOE 4G80A 2X9XA 4P46A 2Q86B 4CMMA 1QEWA 1S5HB 5DMIH 1EEUA 1T1XB 5KTEH 4KPHH 3S34L 2X4OB 3MPCA 3ULVF 4HS6A 1ZT7A 3LSOB 3V5HA 1DVFC 4Y4HD 1O5DT 4RGND 5DJCA 2VDLH 5C0NC 4GQPH 1IILE 4LFHD 2OI9B 4MJ6A 4JY5L 1AJ7L 4QOKA 5FXCH 4JCMA 3UC0H 5A2JH 3MSPA 3OB0H 1WUNT 4KROD 5LGHL 4OZHE 4Y5XC 4PJ9B 5B8CA 1FE8L 2HT3C 1A64A 4IRSD 5L8KB 4PFEA 1ONQB 4M7LH 5JW5B 3PGCA 4KMTH 3TJEH 5FYJE 4RBPH 4MJ5B 3JTSA 5A2LH 4HW6A 5BO1H 3BH8B 3VMPA 3MRNB 1X6LA 5BZWB 4PJAF 4ISVA 3U0PB 1RHHA 4XPBL 43C9A 1QLRB 4J6RL 5MEQA 1CE6B 2NYYD 2RHEA 2YBRB 1CZ8H 4PV9B 3T65B 1LEIA 1Q72L 4E41D 3GB7A 4ODXB 1PZUB 3BGFC 3SKMA 4GKNA 3D25B 1MCQA 4WFFE 1OSZA 4LGSB 5CJBA 3WD5H 1TTUA 3WCYA 1JTOA 3ULVE 3VFMB 5IGXH 1FO0L 4HK0B 5EFIB 5I1HL 3ALPA 4F2MB 1MIEH 1YC8A 1FRGL 1OLZA 2LU7A 4PY7A 4KKLD 4LCCB 5EC1B 3OMZA 3H9HA 4X4XB 4GKZB 3DGGA 3HI6H 1QFUL 2DF3A 2ERJC 1DZBA 1ZEAL 2DQGL 3SKNB 3NH7L 3H42H 5CLWA 1XGYH 4Y7MA 1DFBH 4Y4HC 4RGNC 3D18A 1T1YA 3I3BA 5D7LB 2H1PL 3FQWA 5E08L 4MB4A 4BZYA 5I1KL 1I8LC 3LB6C 2WUCH 3OKOA 4KROC 2QSTA 3KDMA 1XH3B 3CDGB 3LRGA 4NQXB 2XACC 3QRGL 4JO1H 4JGUA 4PJ5B 1Q8MA 1MWAB 2H6PB 4LP5A 2XG5A 2H2PD 5CKAA 4IRJC 1JUFA 2GCYA 4IRSC 3FFDA 1H15A 3WXVH 5T3XE 3A6CL 3VGGA 1K3ZA 1TVBA 3P30L 4XNZC 1YEJH 2PTUA 3IFLL 5IV2A 3FT3B 1DSFL 5DQDH 1L7IL 3IDUA 3JWDL 1LO0H 4TVPH 1SY6L 2CXKA 5EOCJ 2APVA 3CH1A 4ZS7L 3MUHL 3CVHL 4ERSL 3CFBB 5DUML 4URTB 1X7QA 3STZB 4HPYH 5BRZD 2NYYC 3EDEA 2DLFH 1MLCA 1JPFA 2D3VA 3H8NA 4FQXC 5CZVH 2VLKE 1U8IB 1SJHA 5JOPE 4XC3H 3MJ7A 5C0JA 2GTWB 5HSFA 4IOFC 4JREB 1DANU 1BAFH 1N7ML 5IBLD 1P4IL 1R6VA 4ZUTA 2BY2A 4AT6A 4HKZA 4UDUA 2APXA 2R0WH 4KKLC 1R3IL 4Z7QE 3BHBB 4M7KH 5KN5B 1PX4A 4OCNC 4JVPA 4EQ3A 1MHCB 2UV3A 1A4JB 3FONA 4XNXL 2I60H 3U9PH 1TQCB 3HI1B 3VGAB 2XWTB 5D2LF 3CPLB 3QIWD 4BFIA 4MCYA 1N6UA 2JK5A 1G9NL 4PJGB 2R2EA 4ZUSB 2EH7L 2UUDK 2OTWB 3LRSA 1CTNA 4PJ8C 3NPSC 5DSCB 4I0PA 4Z7VF 3IAQA 3OF6A 2ZG3A 4JM4H 3QNYB 2H2PC 1BZQK 1NJ9A 5GHWH 1P5VA 3MV9E 1II4E 3EUUA 1KPUA 4LHUD 5IW1A 3QCUH 3QFDB 1KTDB 3BEVA 4HKXB 4OKVB 4XNYL 2E7HA 5HY9B 1G7MA 5JXED 3QUZC 1QSEB 5EO0B 3GGWA 5FKPB 4HIJA 4LLQB 2VXSL 3ZKND 2CDGB 5IBUB 3CFKA 5ACMA 1LEKA 4WW1A 1AP2B 4WHYG 1HHHA 4K3HA 3E6HA 4YDLC 2X7LB 1MVUA 5DVKA 2A6IA 3DGCR 4Y4KA 4NN6B 5E8NB 4KV5F 4AJ0A 1F2QA 1F97A 1S7TB 1NGWB 4HBCL 4Y16D 2ESVD 1XGRA 2B5IB 3M07A 3IAGC 4P46D 4F9PC 5K9OB 1T04A 5DMIL 3KPNB 5D2LE 1I8IA 3VXUA 3VFGL 4KPHL 1C16B 4HUXB 2MHAB 4P57A 3VWJA 3VFSB 2FRGP 4JN1L 3PWPD 2EE6A 2GFBA 4OF7A 1CGSL 5I0DA 5DK2B 4YXLL 3RNQA 4ACPA 5D71H 4Z7VE 1FGNH 2VDLL 7CGTA 3S7GA 1NDGA 2X4TB 3NIGF 2BY1A 3A67L 5EO1A 4OCSH 5FKAB 2A6JA 3QNXA 1K6QH 4QOKD 4YEEA 4L1DA 3RY6C 3UC0L 5LGJB 3BZFB 1AGBA 4GXUM 4DFIA 4FNLH 3GM8A 3K81A 3TVMA 5HPMB 3EYUH 4JPWL 4CJ0A 3LPGA 4ZTPL 2HT4D 3S5LA 3P9MB 1W72L 2WIIA 4G42B 4M7LL 1CE1H 1CGUA 4HWEL 4TUOB 5EO9A 5B4MD 4KMTL 3I85A 3G6AB 5DZOA 1H5BC 4BK5A 5CEZE 4QHMA 5HHQA 1QO3B 3S35H 5JXEC 4D9QE 3EFDH 5HYJB 5BS0A 3IFNH 4OCRL 5GGVH 3LQMA 3VH8G 3C5JA 4KV5E 3L3OA 1NGZA 3FT4A 1T22A 4HJ0D 5E94B 4MS8D 4CN4A 3SE9H 1CGWA 1U8OA 3ZKNC 1I9JH 2HRPH 1ZT1B 4JPIB 2IFFH 4PGDB 1YC7A 1ZAGA 2NR6D 5GIRA 4GG8B 5I76A 4ZOEA 2F8XC 3DI3B 4N8VA 4U1HA 4Y16C 2BHUA 5HDLA 5IGXL 3TZVA 5HVFB 3ZSTA 5GGUA 1T5XA 1MIEL 4ZUUB 4P46C 2FHCA 1QZ1A 2EDKA 3NIGE 1HDMB 2OK0H 3DUSB 3F7YB 3D9AH 3Q5YA 4XPFL 5TDNA 5MEOB 3HI6L 5JTWA 1FL3A 3D0LA 5FECA 4ESKA 1XGTB 1XGYL 4DKAA 1DFBL 5FB8A 3G6JA 4LOUD 5IFHH 3KPPB 4Z8FH 3IDNB 4I48B 2EEAA 1FL5B 2JF1A 4ZUVA 3MYJB 2AEQH 4JO1L 2AABL 4FN0A 4OI8A 1G7IB 4DW2H 2EE3A 3PDOB 4LPTA 2HT4C 4FFWD 5E7BA 3WXVL 4BFEA 5SWQB 1WTLA 4ONHB 4YDVA 4XPTH 2J88L 5B4MC 1JGLH 5SX4H 4AG4L 1XF5B 2ZJSL 1OB1B 1OAXH 1E4XI 3ARRA 3IJYB 2XQYG 3MGTA 3ARYA 4NKOA 4ZUWB 5FYKE 5TDPB 3O3DB 5DQDL 1PEWA 1LO0L 4WV1A 4TVPL 3ZTNH 5F3BA 1J8HA 1ITBB 2Q87A 4QRTB 4MNGB 4XNQB 4HJ0C 3MYZA 4Z0BH 5K9KA 1EVTC 2G5RA 4MA3B 5IR1B 4HWBH 4YO0A 1F90H 4HPYL 3V7AG 3T8XA 3KPSA 3MO1B 1KB5H 2DLFL 5D1QA 3MRCA 5I1LB 3ALXA 4ONGH 1IGTB 5DJZA 5ENWA 1CD1A 2VDRL 1FZKA 1OP9A 4OF5A 5ANMB 5L0QC 4JAMA 4P4KA 1OQOA 1A8JH 3MA7B 3JVGC 1FSKB 2X44D 3X17A 3VGDA 5F1OB 2EDXA 3I6KB 2DWDA 3THML 1VB9A 5CCKH 1FAKT 2CKBB 1KTRL 4M7KL 3MC0A 1CLYL 1S7SB 5DC9B 4ZOBA 1RU9H 3TPUB 4L4VB 4U1MB 4NKDB 3UTPE 1C08B 2I60L 3PWLB 3NFNB 5IHLB 2YPLB 3TN0D 1Q1JL 4JFXA 1NAML 2BNQD 2DL9A 4KI5C 3RX5A 5LAXA 2A6KA 5LXGH 3DRQB 3L3KB 4PJEF 4ZYKB 1T80A 4PLOB 1GGIH 4I0PD 5E9DB 1C1EH 3OF6D 4JM4L 4JFPA 2OP4H 2OJZH 1J0IA 1HHGA 1KXTB 1U93A 2H3NB 5GHWL 4FFWC 2Z35A 3ULSB 1M7DA 3LHPL 1G9EA 4AENB 4KZDL 4PGEA 4NO3A 3QCUL 3MZGB 3CXHJ 2A6DB 2X4UA 3DIFB 2D9CA 3UTTA 2GY7B 1CIUA 3QEUB 5KSBF 3EYOB 4YR6B 2HN7B 2PN5A 3SBWA 3FRPA 1DQLH 4JRYE 4PP2B 3MACH 4JZJA 3I2CL 4LQFH 4YHMH 4MQ7A 3DRTB 2Y7QB 3HB3C 3W2DH 3BMVA 1MAML 4KHTL 4Y4KD 2GY5A 1TQBC 5KSUA 4M93C 2HA1A 4JE4B 2YD6A 1BWMA 1FG2A 4X7FC 3QXDA 1MCKA 1TQBB 2EE2A 1QVOB 5FDWA 1PVHA 4QRPD 2Q76A 2FEEL 2P44B 3HC4H 4J7RA 5BVPH 3TH3T 3VXUD 1F4AA 3BUYA 1Y6NR 1WZ1H 4X8XA 4WCYL 5DVLA 4U1SB 4Z18A 4O2EA 1A6TB 4PJCF 4F33B 5IB1B 5EUOB 1HH6A 4PJEE 4OFYA 5D71L 1A7RH 4PRNA 2Q7NA 4U1JA 4NIKB 3NGBB 4I1NB 4OCSL 4IOIA 4NFDA 3TN0C 1RJYA 4CVXA 1K6QL 4U1LA 1JZ6A 3GJEA 3V0VB 5JW3H 5IB5B 1WBZA 3IRPX 2WMPA 4FNLL 4KUCD 1EAPA 2FYYB 5IVXF 4OAWA 5T1DH 5TQ0L 3TVMD 3OAZK 3INUH 5IIEB 3RWCA 1OD7A 5D93C 3O4OC 1IGJA 1RZJH 3WE6B 1Y0LA 1BFOB 4YHOL 1CE1L 1YEHL 5JHDE 1QBAA 3JWOL 3G5YA 3NFPA 4JZOA 3O41B 3V6BR 1I3GH 2OYPA 43CAB 3OXRA 1GZQB 5EU4A 1JFQH 3F12A 1SEBA 2AK4E 1EAJA 5GGVL 1D5IH 4FQHB 4MZ3A 5BS0D 3BZEB 4Y1AE 1NGPL 5I75B 5FV2A 3WDHA 5KBNC 2XWJB 5IT2H 3EOBB 2HTLD 1WFTA 1YDPA 1V5JA 3B9KA 3A6BH 1BGXH 1I9JL 2HRPL 2JB5L 3GBNL 1FORH 4NFBA 2A38A 5CJXA 2IH3B 2CLRA 1XGPA 2IFFL 4I18B 4IDLA 4MJIE 4XBPB 3MRDB 4Y4KC 1FVEB 3V6FB 3SDCB 2AJYH 1J11A 1KCUL 4MWFB 4GKOA 1F02I 1F6AB 3QA3B 4PJCE 3TZVD 4AMKH 5F7FA 2XWBA 4GMTL 3FN9A 3CVIH 2BC4B 1LO2L 2G2RA 1JMXA 3CU7A 3D9AL 2VLME 2R9HC 5DRZB 5IEHB 4S1SL 3MCLH 5F9DC 1HNFA 1BVZA 4IJ3B 5IVXE 1NBYB 5IFHL 5I1IL 3QHZH 1KENH 4ALAL 4Z8FL 1S9XB 4LLVB 1BIIB 1A6AB 4HXBH 4L9LC 2O61A 2F19H 2QJDA 2X70A 4OB5H 2YC1B 5F3HA 2MPAL 5KVEH 4CVZB 1HOCA 4U0RB 2FO4A 2PTVA 3V6OC 1MCWM 4L9LB 2WBKA 4LAJH 1OAQH 2I5YH 4UIMB 3T0EB 2XTJB 1WIPA 3GMLA 5IMKA 1XR9A 4XPTL 2EYSA 5BZDA 1UT9A 4PREA 1OAXL 1M1SA 4LRIC 1T0MB 2C1PB 4BSVB 3IYLW 4C83A 3QH3B 2XQBL 1MWAH 3U2SA 2X09A 3ZTNL 5I66B 2WQRA 1J8HD 1GC1H 4G8GA 4X7EC 3ZE1F 3KXFB 5J13C 1ERNA 2RB8A 4FFZH 4F57H 3ZT5A 5IMLA 5F1NB 4OI7A 2EDBA 2WWMD 2HTLC 2IFGA 1F90L 1TCRA 3KPSD 1KB5L 3BESR 3MV7E 2B2XH 4FQ2L 5D1QD 2R2HB 3M17A 3QO1A 1CT8B 4ONGL 3RUGB 1U3YA 4P59H 1CFSA 5AEAA 1QLEH 3MODH 5IB4A 1CD8A 3V6ZA 1RZIB 4P4KD 1DQDH 2DI8A 4Z9KB 5MI0C 1C5DA 1N2RB 3L3HB 2AJVH 3I50L 5MENB 4Q9BA 3T2QA 5CD3A 3S8WA 4NQEA 4K3DL 3NCYP 4AYFA 3CFJA 3HFMH 3H9SE 3AU1B 1F4WH 2P1YA 4U6HB 1RU9L 2VL4A 5I1DA 5I9QC 3VFVB 1OPGH 2FJFA 3RGVD 4WUUA 3MUJA 5HTSA 4RAVA 1UKSA 3UTSE 1CK0H 3N1FC 5GRJH 3UZVB 4G9FB 5EIIB 5CS7A 4EUPG 2OTUB 2Q86A 5LXGL 2V5TA 4HC1H 4H0GA 1S5HA 2MMXA 1FNGB 1D6EA 1C1EL 4N1CA 1HH9B 2X4OA 3P73B 2OJZL 5F93C 5GJSH 3C8HA 2ICCA 3LSOA 1KYOK 4YHNB 1E4WH 3ZE1E 1JJUA 2DJSA 3GKWH 4UDTB 4CDGC 2F53A 5EN2B 4OD2A 1DQLL 4KK6C 1MFAL 4JEGB 4PJ9A 3Q6FB 4YHML 3VD4A 2FB4H 2WWMC 2XRAH 1SMOA 1WITA 3W2DL 1AO7B 2BHZA 1P2CB 5FM8A 4JKPH 3FFCE 2VAAB 4WUKH 4JJ5B 2E7MA 1MFNA 4JFDB 4X6DA 2R2BB 4JHWH 4P4KC 1G7JB 3MRNA 1I7ZB 2IQAB 5C0BB 5BZWA 4PPTA 3U0PA 3VGEA 3TYGH 4KXZI 5BVPL 4WTZA 1QLRA 1CE6A 2EDDA 1WZ1L 4PV9A 5ADPH 5HGHB 3VH8B 2P8PB 2AXGA 4OZ4B 3D25A 1MCCA 4OFYD 4OQTH 4OZFG 2R39A 3RGVC 4D9RE 2X4QA 1I75A 1MNUL 3VFMA 4HK0A 1WC7B 1NPUA 2DJ4A 1IKFH 3PXHA 4G6MH 5C70A 3ARDC 4KDTC 1ZVSB 2Y07H 5FCUH 5JW3L 1BQUA 1F8TH 3P4MB 3VI3F 5T1DL 5EC1A 3INUL 4ZG1A 2CO6B 4GKZA 4CL7A 4OZHB 2VRAA 5AYQA 2YD4A 4PJDA 2QEJA 2XA8H 5HYEA 2VAJA 4JY4B 1I3GL 5D7LA 2AEWA 1JFQL 2OLDA 2BVQB 1D5IL 3SE4A 4X7TB 1XH3A 4NQXA 1BPVA 4PJ5A 5TE4L 4D2NA 2H6PA 5KJRH 3A6BL 1BGXL 5KS9F 2CMRH 1FORL 1P7KB 4FXKB 3LZFH 3LIZH 3RWDB 4LVNC 3WIFA 5C2UB 2AAVA 4L4TD 1QBBA 4AMKL 4IDJH 5TH2A 4CADB 3EDJA 1RSFA 1RPQA 3TV3H 3CFBA 4RRPA 2HJKB 4K55A 1SYSB 4HZLB 5KZCB 3WS6A 2NY0B 3MFFB 2W65A 3MCLL 4M3JA 2WIMA 1T7ZA 4JO2L 5CMAB 1U8HB 2CLZB 3VI3E 2VDQL 1KENL 1JN6B 2HH0H 1DUZB 5A3IC 5DO2D 2GTWA 5CUSL 2F19L 1S8DB 4DZBA 3BGMB 3W82A 1UWGL 5KVEL 3STLB 3HNTL 4NC1E 4RNRB 4JFFE 2B1AL 3DMMB 3O11B 1YEIH 3UZEA 3U6RB 3GBLA 3DXAD 5KN5A 1OAQL 2I5YL 1MHCA 4CVUA 1A4JA 3FQTA 1TENA 3GZKA 4Q74A 5F9WB 4M6OH 1RIVH 3HI1A 2XWTA 3BKML 1YEKL 3L3DB 3CPLA 3VD7A 4F7CB 5KS9E 1K5NB 3C2AL 1KACB 4MDJB 2J6EH 4PJGA 1KF9B 5J1AA 4ZUSA 4HKBB 2OTWA 3BZ4B 5JZ7D 2R15A 2X4NB 3IJSB 4LRNL 5DSCA 5L8LB 4G8GD 1X4ZA 4XP6H 4F57L 3P0GB 1F5WA 4DWHA 2EDNA 3QNYA 2VB5A 2BRQA 4U1KA 1QG3A 3NCYS 3L5IA 3QQ9C 5GS0H 5CJXC 3EOTH 2B2XL 3H7BB 1F3JB 2DYPA 4NO5B 1J0ZA 2PO6B 3GSVB 4R4FH 2PYEE 3QFDA 1QLEL 3MODL 5D72H 4U6VH 4OLWL 5HY9A 2K9UA 3FO2B 1DQDL 5EO0A 2VLKB 1CL7L 2YUZA 1TJIH 5DJYB 5ECJE 4NN5C 1HINL 4LLQA 3FB8B 5J06A 2CDGA 4NQED 1AXIB 3O6FD 5AZEL 1AP2A 1RJCA 1JF5A 3HFML 2X7LA 4U33A 1F4WL 4RZCB 3T4YA 4P2OB 5E8NA 4EKXA 2V2XA 1RJZB 1S7TA 4AK1A 4LSPH 4WUUD 2BNUA 1I7RB 2JB6A 5GRJL 4OLYH 4XI5D 5F6HI 2H45A 3ZHDA 2MQ3A 3EDDA 4OLVL 5DO2C 3DV6B 5CGTA 1LDPH 3PDDA 4TQEH 5K9OA 3C9NB 3KPNA 3NOIA 3MXVH 3SN6N 1JYNA 4HUXA 2MHAA 5GJSL 1GIGH 3VFSA 4YH6A 4HLZH 5JOEA 5DK2A 3VU2A 3B5HA 1EXUB 3OJDA 2VITA 4Y5YA 3DHMA 5E1AA 2VSCA 2ITCB 2VYRE 3GKWL 2F53D 2LV4A 5FKAA 4RGMC 3SQOH 3KG5A 1JYWA 5LGKA 2BERA 1AGDB 3GMMB 1IGIH 5LGJA 4PJHB 3BZFA 5F9OH 3SGJA 5JZ7C 5F7UA 4HEPG 1KIQB 1AR1D 4PJ9D 5CJOL 2R23B 3GSNB 1FHGA 3BFOA 2XRAL 2N56A 4QRUB 1FIGL 5GRVK 4G42A 2V9RA 3PGDA 3AGVA 4ZOCA 3G6AA 4ODSL 2MCPH 1QO3A 4PJBF 2A0LC 5ESAB 4JHWL 5HYJA 3TBSA 1NCDH 2DQEH 4ZFOL 3S98A 1Z9SA 25C8H 4JPKH 2WNGA 1I1AA 4KTDL 3GO1H 3O6FC 3B6SB 5D2LB 1ZT1A 3O2DH 4JPIA 2HT2D 3QO0B 5ADPL 4QCIA 3MQIA 3K1KC 4PGDA 2Y9RT 4LARH 4GG8A 1MELA 4KJPC 3HPJA 3K7UA 4OIBA 4OCMC 5EA0L 4QRRE 5JIIA 3O3AA 4Z7VB 1KLFA 1T03H 3T4AA 1A2YB 1JHTB 1FCCA 3O4LE 1EFQA 1IKFL 4G6ML 1OAUH 1F8TL 5CEYB 3L7FB 2Q7YB 3HRZB 1HDMA 3AUVA 2ICWJ 4NGHL 3UAJD 5MEOA 1L4IA 1AKJB 3K2UH 1KBGH 3B9AA 3P2TA 3G5XB 3TNNB 1PAMA 1XGTA 1R5WB 3SY0A 3PWUB 2L7UA 1FNHA 4Z0XB 3MFGB 1N8ZB 4I48A 2ADJB 3S36H 3IDGB 4H0HB 3E8UL 3MYJA 1BX2B 3KPOB 1V8HA 3P4NB 4EIGB 2Y5EA 4LEOB 4PJ5D 4PG2A 2BDNL 4PJBE 1G7IA 2J6EA 3PDOA 3QEQE 2CMRL 4YXHH 5SWQA 3GRWA 4ONHA 3W81A 1G6RL 1OW0A 4DKEL 3LZFL 3LIZL 4HZAA 1XF5A 3T0AA 1OB1A 1KSRA 3IJYA 5CLTA 4ZUWA 5TDPA 1L9MA 3HTLX 1FNLA 2FECI 3O3DA 4RA0C 3JV6B 1KT2B 2F8OA 4LSUH 4UINH 4YPJA 2J1KA 4GKSB 4NYLB 1J0KA 1M6OB 4PB9H 2OR9H 4MNGA 4XNQA 3SJVB 4GXVH 5FEBA 4ZPVB 3TV3L 3SGDI 3LKQA 5JO5A 4MA3A 3MLYL 1BOGA 4N8CL 3QWQB 4TOYL 2JTDA 3DSFH 3MO1A 2HT2C 3Q2CA 5I1LA 1U3HC 4JFZH 1NDMB 1IGTA 4XTRC 1AXTL 1EZVY 2HH0L 4I3RH 2GSIB 2ZCLH 3MA7A 5GZND 3BQUA 2NZIA 4K7FB 1YY9C 2R0LH 3I6KA 1H8NA 1I7UA 3RTQC 3VWKB 4A6YH 4O9HH 3I75B 3BKJH 4I5BB 3B43A 5HYSG 2CKBA 1YEIL 4LDOB 1G9MH 1LO3L 1RUKH 2X89A 2C5DC 4L4VA 4MQXD 1JYXA 4U1MA 2KPNA 1C08A 1M71B 1LK3L 1RVFH 4M6OL 4JM2A 3ZL4H 3PWLA 1RK0B 3NFNA 5F7LB 4L1HA 4N9GA 4NM4H 2UUDH 5DRWB 1FG9C 2MNUA 2B4CC 2V7NB 3SKOB 1I8MB 4RCAA 2FD6L 5AAWA 3CIQA 3DRQA 2E5EA 4IMKC 3L3KA 4ZYKA 1HEZB 4PG9A 4XP6L 1OTUD 3TESA 5E9DA 3IDIB 1SJEB 5DT1L 5IFAL 2H3NA 5F8QC 3I02B 5D7JB 1BMGA 1EHAA 5J0BA 3QHTC 1QQDB 4ELMA 5IP4A 2DYPD 2ZUVA 2YSSB 1D3CA 2VQ1B 2VLLB 2OBGA 1SQ2N 4ONOA 2A6DA 4KDVA 4U6VL 2H2SD 3OHXA 5ISZA 3TT1H 4YHIB 2DB8A 3B8SA 1MFCH 4PGJA 3QUXB 5L7XH 1IEAB 3EYOA 3MRQB 1TJIL 4YR6A 4G9DA 2WM0A 4YBLC 4PP2A 5FYLD 5C08E 1QFOA 3MRJB 3DRTA 5KVGH 2Y7QA 5LWYL 5TE6L 3G9AB 1ADQA 2G60H 2J4WL 5T3ZH 1OP5H 2V17L 4XP9H 1BJMA 3WS6C 2UY6A 2ZUWA 2BNRE 4MA1C 3V0AC 1Z5LA 1OGTA 1IAIM 1CFNB 5CSGA 2E7LA 3RBSA 4KK9D 1KCVH 4LPYA 4PS4H 4F37F 5GZNC 4NJAH 1I4FB 3IGAA 1IGMH 3KPRA 1OF2B 3WL9B 4HGWB 3MXVL 2HRLA 3PL6A 2JIXB 3WYRA 2CK0H 3AS1A 2W07A 4U1SA 1CN4A 1A6TA 5C0CE 4F33A 2XXCB 5EUOA 4Q97A 1WICA 3TJHC 2XY1A 5F7MC 1TZIB 3NIFF 4XHQA 5IVOA 1ED3B 4HPOL 2GJ6E 1RUML 1IGIL 1MLBA 2R4RH 5F9OL 3V0VA 5IB5A 3FHQA 3I84A 4OZFB 5ID1A 1OTUC 2FYYA 1KXVC 5IIEA 1HXMB 2WP3O 3DPBA 1AGFA 3KVQA 3WE6A 1MCLA 2FWOB 4QF1A 5E6IC 3CAFA 2H26A 4Z78B 3P0YH 3O41A 4NHCL 3P77B 4WFGD 2MCPL 2P5EE 3OQ3B 1GZQA 2VXUL 2H2SC 4ZXBA 1P7QA 4FQHA 1AD0A 1KELH 2ZUQC 3VXOB 4EDXA 3KJ6H 2DQEL 5IKCB 2NX5E 1T2JA 3MGOB 15C8H 1TZGH 4JPKL 5I6XC 1JTPA 1I1AD 3GO1L 4LPWA 2VXQH 3QB7C 3RHWK 2C4XA 2IH3A 1K4CA 4I18A 4XBPA 3MRDA 1VPOH 4D0CB 1FVEA 5IQ7H 2ZSWB 3OX8B 3PHSA 5E8PB 1TPXC 4PJEB 1A4KA 1F6AA 1ZHLA 3QA3A 1OAUL 1NAKH 1UWEH 3F8UB 1CBVL 4P5MA 5TF1H 3NIFE 1MI5E 1MF2L 5I1JL 2FGWH 1JPST 4PR5B 5KW9H 5DRZA 3K2UL 4KRNA 4F7EB 3VFWA 4Y19D 4YK4B 2V6HA 3SGEI 4OZGF 4Y89A 1NBYA 4Y5YC 4HS3A 1QFWM 1YUHB 4F80A 3CFIC 1S9XA 3IETB 2FDBP 3S36L 3G5ZB 4OCXL 1BIIA 4LSVL 5JW4Q 1A6AA 1IGFH 3WJLA 2AK4B 2YC1A 1S7VB 2AVGA 5E1HB 4XPHL 2IALA 3EO9H 1OGAA 1OWWA 4M1DH 3QQNA 1JV5B 4UIMA 5FYJH 3T0EA 4FFVD 4RQQB 2OQJB 3GUTB 4PRDB 3MRLA 2CR6A 2C1PA 4MJIB 4OTXH 3QH3A 1VERA 1MJUH 2NW2B 3A0OA 4YHLH 3DETD 3V79C 3TWCH 5SV3A 5I66A 5IJVB 3LKSB 3WUZA 5L6YH 3WNLA 3MRHA 2QADB 4PJCB 2RCSH 4ZFGH 3QNZB 2R1XA 1I1AC 5L2KE 1U91B 3DSFL 2W0FB 5HXMA 5ESVA 2R2HA 1CT8A 2PXYB 2FJHB 1QR1B 5KVMC 4Z7UF 3ULVH 1GGCL 4RWHA 1G84A 4MA7L 4NNPH 4CRPA 2ZCLL 5IVXB 1RZIA 4R2GD 2R0LL 3BQUD 3TBYB 1YPZF 3ZKQD 1N2RA 4DKDC 3L3HA 5AZ2H 2Z91A 1IC7H 2CDFA 2VTFA 3S96B 4A6YL 5MENA 3FTGB 2APFA 2PW1B 3MLWH 5TFSH 3V8OA 1MCNA 4YHKH 1RFDH 5INCA 1RUKL 3AU1A 2YA1A 1GZPB 2OS7A 2X89D 3FQXB 1SBSH 3DNKA 3WMSA 4QWWC 4JM2D 5JQ6L 4N1EA 1H3UA 5HI5D 4G9FA 5EIIA 3C87A 4HUKB 3BKYL 1UYWH 4XP5H 5T5NG 2F54E 4R0LB 1FNGA 1CFBA 5E9DD 5T3XH 3U4BH 1ZLUK 9CGTA 1NUNB 3MOBL 2XIDA 4FFVC 2XKNB 4YHNA 3UTQB 2VR4A 4YQXH 4H1LH 1ULVA 1OW0C 3RWJB 5B38B 3D39A 3MV7B 4UDTA 4BH8B 3J7HA 1DTUA 1FCGA 3TT1L 2ILLA 5ISZD 3JUZA 3DETC 5EN2A 2DLHA 1YMME 4Z7UE 4QO1A 2E3VA 4HIXH 3Q6FA 4B53A 5KVGL 4KWUA 1CGYA 1K9TA 3MRPB 2ZUUA 4PLKD 1YPZE 1AO7A 1FV1B 2COQA 2MQCA 3FB6A 1WTGT 4L3CA 4IHOB 4JQVC 4RMTA 1QACA 3GFUA 1ITCA 2VAAA 2XTLA 4JJ5A 1KCVL 4PS4L 1T7WA 3W0WE 2R2BA 4X4YB 3O2VL 1G7JA 1I7ZA 2IQAA 3UTSB 4R2GC 1E4XH 5C0BA 3BQUC 1UM4L 2DQIH 3GBML 4IRZL 1IGML 3KPRD 1B3JA 4WY7L 1IKNA 3BRDA 3PL6D 4K94C 4U0QB 4DN4H 2CK0L 3CFCL 3VH8A 2P8PA 2HJFB 1NFDF 1JWMB 5FO8A 4ZS6D 2DAVA 2P5WE 1C7SA 5D96B 4JM2C 4CDHA 1QYGH 1CXHA 1XEDA 5HGGS 3WKMH 2I9LB 2YWYA 5HI5C 3EDFA 4JFOB 1WC7A 3OAZH 3Q3GA 1ZVSA 2J2ZA 2R4RL 1NCAL 5C0AA 3P4MA 2XZQL 1LP9B 3QUMH 4Y8AA 2H32B 4OZHA 1BZ7B 1S5IH 1CDJA 3NAAH 4CN1A 3KGRA 2UWEA 2E6PA 1FGVL 1CCZA 5DUPH 3P0YL 4OZIF 3FFCB 4AM0B 2W0KA 4XXCA 1P9MA 5FGBA 3GSNH 2BVQA 4ZXBD 1P7QD 3HNVL 3CLFL 4X7TA 1OT2A 4Q9QH 1VFBB 3KYOA 5DJ2B 3TP4A 1IT9H 2OJEB 3EYSH 15C8L 4HHAA 1LE9A 2O5YH 2IH1B 4KKNA 1T0NB 1P7KA 4ZNEE 4PLKC 5DXWA 5GRYA 1CICB 1QSFE 2OZ4H 2Z31D 1VPOL 1OAZL 4PGBA 2R0KH 2W91A 5IQ7L 4HX1B 4ODWA 4EXKA 4QKXB 5DFWH 2HFEB 1UCTA 2E7LC 1U8MA 4BFBD 4CN6A 1NFDE 1KV3A 2W38A 4CADA 3PG2A 1NAKL 3BPLB 4WHDA 3MA9H 4JRXE 2HJKA 3U7WH 4XVJH 1SYSA 3F6LA 4HZLA 2FGWL 4UZGA 5IFJB 5KW9L 5D7SH 5BOZG 1A6PA 3NFSL 3P4OA 5KSAB 2Z93B 1KIRB 1KIPA 5CMAA 4GO6B 1U8HA 4K23H 4ZS6C 1KCRH 5HHNB 4LCWE 3WIHA 2B1HH 1EUUA 3OR6B 3ESUF 1YEDB 3N9GH 3KPMA 2IJ0C 1DUZA 1ND0B 2WQ8A 4P2CG 5BMFL 1MCOH 4I13B 4HIHA 1FNFA 1S8DA 3BP4B 4OZIE 5DD3H 3STLA 4DKFH 4GBXB 1WBXB 4RNRA 4U1IA 3DMMA 3O11A 4UV7H 4F7MB 1OGAD 5FYJL 5C0GA 5IB3B 4JFEB 2VZTA 3BPNC 3SDDD 5CEZH 1IJ9A 4X80L 2I9TB 5HGAA 2NY1B 3G04B 3DX6B 5HYSB 3GIZH 3L3DA 4APQA 4OTXL 1I8KA 2ID5A 4F7CA 1AGCA 1K5NA 4MDJA 4U7MA 4J12A 2IPKB 3OBAA 2M8XA 4ZXBC 5I19H 4HKBA 4LQ1A 3BZ4A 3QSKB 2X4NA 1I9IH 4PRPA 3IJSA 3IXTA 1LQSR 3QEGL 3CX5J 4K71B 4ZFGL 1IAOA 5LBSL 1QP1A 3ZO0A 3RA7L 2LAAA 4F9LA 1JNNH 1ZHBB 3VRIB 3FOLB 1F3JA 4NO5A 2QQKH 2Z31C 4XC1H 4KHXH 4PJIF 2PO6A 1EFXB 4FQ1H 3RI5F 3KR3H 2R2CA 1CDIA 4NHUB 3FO2A 4S1RH 3TEUA 4FTVB 5DJYA 2VLJE 1IC7L 4JDVB 4JO4H 4PJXF 3L3GB 5MEND 1SVCP 3QFJE 5TFSL 5JUEH 4YHKL 3WO4B 2P7TB 4KK8D 1KJVB 3TM6A 4MX7A 1RFDL 3S3JA 4RZCA 4P2OA 4JFFB 3PP4H 4M1GH 1YN7B 1UWXH 4R3SB 3U7YH 2D0GA 3QDME 4F58H 2DWEB 4FP8H 4ONFH 5JHLH 2A74A 1ZXQA 3L7EB 4G9FD 4OFIA 4KVCL 5E03A 3DV6A 2CUHA 1JZ2A 2O26U 3C9NA 3WJLC 1DDHB 4D0BB 3CJJA 4QGTA 4YE4H 5T3XL 2OR7A 2LABA 2ATKA 3EOAB 3U4BL 5DHVA 3KPQB 2ZUYA 1EXUA 2DQDH 3R0NA 4U31A 5E4EB 4MNHB 5FYKH 3SDDC 2DBLH 2ITCA 4V1DB 1XGQB 3D39D 2B4CH 2X1XR 4G7VH 2Y25A 3HA0A 5DJAB 5CSBA 2PYEB 3DVNB 3EJJX 3O0RL 4XWOC 1AGDA 2ZG2A 2AK1H 4PJHA 1UCBH 1UM5H 3B2UC 3B2VH 1HSAB 1KIQA 1TDQA 5ADOH 2HFGH 2R23A 2H9GB 3DVIA 1IM3B 2J8HA 3EO1B 3VGBA 3T08A 4PJXE 4HJJH 5DFVD 5BOPA 1FZMB 1PKQB 2VLRE 3UMTA 3WNPA 2VC2L 4DAGL 5ESAA 2FL5B 1HHIB 1HILA 1F58L 4N90E 2YK1H 3E6FB 4HK3J 4KH2A 1ZKAA 3H3PL 1G7PB 2F74B 3BAEH 4M9OA 4KK8C 1WISA 3B6SA 2YWZA 5D2LA 1A7OL 5CGYC 4JLRB 3C60B 2WLZA 5J6GB 3FQRB 4HMEA 4RSVA 2RFXB 1D6VH 4DVRH 1FYTD 1QYGL 3L9RA 1T1ZB 5IWLA 4LSQH 4Z7VA 3WKML 2IBGA 3WHE1 1JHTA 2RIKA 1MEXH 4K8RD 4L4JA 4GSDH 4YFLF 4WI9A 2PCPB 3NZ8B 3L7FA 3SOBH 2Q7YA 5C0AD 3NMEA 1D5XB 1PLGH 2H41A 1NUDA 3QUML 3V7MA 1S3KL 2AJXL 4DVBB 1AKJA 3MLTB 4Q9RL 4Y0GA 1S5IL 1A9EB 1WF5A 1MCWW 2HWZH 35C8L 3G5XA 3TNNA 5I1CH 3L5XH 3RWHA 4R8WL 1FP5A 1R5WA 5DUPL 2OTPA 5DR5L 4XNMB 3PWUA 4PRHD 3E2HC 1X9QA 4LGRB 5IVZB 5EOTB 4YXKL 1N8ZA 3CK0H 2ADJA 4EI6B 2A2QT 2Z92B 3SCMB 2W59A 4OIAA 1BX2A 3D6GA 3KPOA 1IT9L 1XMWA 5TPWL 3EYSL 3P4NA 4KFZC 2O5YL 1IC4H 3QIUC 1YNKH 4XZUB 3ZYJA 3TO4C 5DUBA 5H37H 1RJLB 3VG0H 2R0KL 3VXMA 5CJ8A 5DFVC 1I1FA 2FX8L 1EH9A 3JV6A 1KT2A 4PRIE 3W9DA 4GKSA 1I3UA 1UENA 3SJVA 1OCWH 1WAAF 4ZPVA 1C8PA 4O5LH 4JKLA 1XR8A 3U7WL 4I9WD 4XVJL 2IAMB 2EYRB 5D7SL 5EZLB 2DI9A 5KZCD 2E9WA 3QXWA 1MFBH 1LK2B 1S7WA 2NY0D 3QDGE 3QPXH 1JI2A 1RUAH 1NDMA 1DR9A 4K23L 3NIDF 1KCRL 5M95B 2B1HL 3W5NA 4YC2C 3D0VB 1J86A 3N9GL 3GMNA 2M1KA 4WWKC 4WFHD 4K7FA 3RVTD 4WHTA 4K8RC 2CUIA 3VWKA 5DHXB 4KJWD 4YNYB 3I75A 5DD3L 4I5BA 5TQ2H 3VXPB 3LMJH 5EU6B 3DMMD 3V4PH 3QXUA 4RWYH 4KXZH 4D3CH 1K8IB 3QEQB 1F4XH 1DBJL 1M71A 1PG7L 4I3GA 4MDIA 5HVWA 3CSBA 2FATH 2V2TB 2W60B 3GIZL 5DRWA 4APQD 1KB9J 1MCPH 3UYPA 2V7NA 2FEEI 3O6LH 1I8MA 4RFEB 2Q3AA 1P9MC 5FGBC 2W9EH 1I9IL 4PRPD 1KNOB 1HEZA 1NGQH 4UTBL 4N1HB 1T2QH 4NOFA 1G7QB 5I16B 1SJEA 2EZ0D 3ZKXB 4DGIH 3ET9F 1X4XA 1T89C 5F1IA 3NCFB 4PGCB 1J10A 3I02A 4QY8A 4EUPA 5D7JA 3C6LB 5FK9B 1QQDA 2C3VB 3QP3A 4B0MM 3W39B 2QQKL 1WAAE 2YSSA 4KHXL 3S36X 2HKHH 3A6OA 2VQ1A 2JJSA 2PO6D 1YA5A 4FQ1L 2VLLA 4KGLA 5C0DA 3AXLB 4XP4H 4NRXA 3QUYA 4M5YH 4YHIA 2V7HB 4G6KH 1XCQA 3QUXA 4I77H 1IEAA 1ZANH 3MRQA 3RY5A 1S78D 4FQIH 1F00I 3NIDE 4JO4L 1KJ2H 3QWRA 4YX2L 3MRJA 2LTQB 3LN5B 3RX8A 5ETUB 1YEEH 3FJTA 1VKXA 4KY1H 1O0VA 4EDWH 2BVEA 1ZLVK 4P2OD 3PP4L 5DK0A 2R56H 4MCZB 1PQZB 2VJXA 4C56B 1D5BB 1CFNA 3QXVA 3U7YL 4F58L 4C58B 1CTOA 4FP8L 4ONFL 5SWZB 5JHLL 2L4OA 4XB8A 3N0PB 1YQVH 1NL0H 4P49A 5CP3H 2DBJA 3RVTC 1QRNB 4MAYB 4LHJB 4LPVA 1I4FA 3WL9A 4HGWA 2NXYB 5D7IF 1AHWB 3SE3C 1I7TB 4HMDA 4XAKD 1EHLH 2CUMA 2DQDL 4JFHE 5E99H 3QIBB 4GG6F 2ICWB 1GPOH 5JMRA 1TZIA 2B4CL 4H26A 3MRKB 1AC6A 3BO8B 5EULV 4APQC 3M8OH 3FO9B 4G7VL 5EORL 1ED3A 2UYLB 4AEIH 5HD8D 2EIDA 3F58H 3FQNA 1UCBL 1UM5L 1XFPA 3HE7D 2DMKA 4OZFA 5FCSH 5ADOL 2HFGL 4BKLA 2MCG1 2EZ0C 5C08B 4N0YH 3QDHA 5DD5L 1T20B 4Z78A 3RAJH 5CINL 2BNRB 3MV8E 3IJHB 1CR9H 5DA4A 1F4YH 3MNVB 1PGRB 1AFVH 4GOSA 3VXOA 4UBDD 2WP3T 4ZNCD 4Z7WF 1RAMA 1S78C 3SQBA 2IPUK 2YK1L 3D2UB 3MGOA 1TETH 3BWUC 4YDJB 1FO0B 4KMLB 3BAEL 3OKKB 4KKCC 4XCEB 1JYVA 4G7YL 4LPXA 4WI6A 3CXHK 1Q0YL 4DZ8B 3BP6B 5C07A 2YRPA 1SEQH 3RGHA 5D7IE 3OX8A 1D6VL 3BPOB 4DVRL 3MNWA 5E8PA 1KFAH 4PLJD 3FHAA 1ORQB 4LSQL 4CU6A 2IBZY 3FB5A 5FGRA 1B90A 3UJIH 1MEXL 4GSDL 1XIWA 4BH7B 4GG6E 4OF8A 3SOBL 4Y5VB 1PLGL 2YEZB 4P9HC 3IU4H 4K94H 4PR5A 4LLYB 3IB4A 4NJ9L 4RAUA 1AKJD 4F7EA 2XKSA 2HWZL 5I1CL 2DTMH 3L5XL 1XCTB 2NMSA 5JXAH 1MUJB 4MQSB 4RGNE 3VD5A 2V5SA 1YUHA 4YHYC 3V5KB 3G5ZA 4OF6A 2VXVH 5HD8C 5J6HB 1IQDB 2AK4A 1YNLH 1G7HB 1S7VA 3HE7C 5CEXB 1IC4L 1ZGLM 3AB0C 3RI5K 3IFPB 1T0PB 1JV5A 3IDMB 5ALCH 1Z0MA 3O9WB 4K3JH 1WFOA 1J0YA 2GSGB 4Z7WE 3CVHB 3QCVH 4LSTH 4KRPD 4RQQA 4Z95H 3VG0L 4O02L 1MREH 3GUTA 4GQ9L 4PRDA 3K4AA 3O45B 3VXMD 4MJIA 5GS2D 2FHBA 3QZWG 1YJDH 2W9LA 1NANH 1X3DA 3LKSA 4UBDC 2HG5A 3RWFB 2AV7B 1OCWL 1HKFA 3SJVD 4HXAL 1N3NB 2X4PB 3GJFB 3NPZB 2O5XH 4D9LH 3CFEB 3QNZA 2OL3L 1I1RA 1U91A 3MBEC 1MFBL 1MI5B 1HQRB 3BGAA 3QPXL 4E41E 4WW2B 1INEH 4ZD3H 2FJHA 3O6MH 4EBQH 5D5MA 1ZS8A 1ZA3B 4R26L 1UXWB 1OP3K 4PLJC 3NABH 5IWLC 1QUNA 3TBYA 1LNUB 3MNZB 4L5FL 2XOTA 3PNWB 5KANI 2G75B 5J12C 3FTGA 3RDTB 2PW1A 1RZGA 5TQ2L 3J8F7 3LMJL 1WLHA 3AFLA 5J11C 1QA9A 3QDJA 4RWYL 1GZPA 1HHJB 3U0TA 4D3CL 4JR9H 1ZHKB 4FXLA 4N9OB 2HVKA 2E9BA 2YD5A 1MCPL 1N59A 3BIAX 3O6LL 5JLZB 3P11H 1J8KA 3UXFA 4P2RA 3F6IA 4HCRH 2BXYA 5D1ZA 4PJFF 1CDYA 2P42B 1NGQL 4OUUA 4R0LA 5HHXL 3JZ7A 1T2QL 8CGTA 1GSMA 2KQNA 2NXZB 1KCSH 5I71B 3WFDH 3S37H 5D7JD 2XKNA 3UTQA 5L2KB 1HXYB 2PW2B 4KRPC 3TFKC 3RWJA 4Z7OF 5DD0H 3REWB 4BH8A 1HIML 4XP4L 4M5YL 3QUYD 4G6KL 4Y4FC 5L8JB 3RJDA 4NBXB 3QUXD 4FQIL 2EE9A 4IIQB 4U1GB 1KJ2L 3EGSB 2OX5A 3QWRD 4LLUB 5GGQL 4X5LA 1IFHL 3L1OH 3MRPA 4HUMB 1U9KA 1L6ZA 1WWBX 4KY1L 1FV1A 2ZUSA 5BRZE 3DTXB 4WFED 5FM5O 4M03A 4EOWH 4IHOA 5IEKA 4BA8A 2R56L 1CGTA 1TTFA 1KN4L 1WQVT 1EIBA 4H20H 3RNKA 4HS8L 4J4PC 4TPRL 4EEEA 4X4YA 3BRFA 1YQVL 3PF2A 1NL0L 4L8BA 3VI4F 1Q94A 1A6VH 4MNQB 3OKLB 1UA6H 4ZO8A 2Q1EA 1CXFA 4JGJA 2EDJA 3RU8L 4M62H 3T1FB 3N06B 1WT5C 1EGJA 2F54B 2IADB 8FABB 4MMZC 3IF1B 3NBNA 2YUWA 3DX8B 2HJFA 5HYQB 1JWMA 1EHLL 3UJJH 3PV6A 3BIBX 4U4BA 3TIEB 4JQXC 1CQKA 1W72B 2C3WA 4XBGA 2I9LA 3RVUD 4R7NA 4YHPB 4JFOA 3ARGB 1EEYB 1DUYA 1DL7L 2DQHL 2A9NH 1HCVA 1QNZH 4HIEB 5GRVL 4Y2OA 4Z7OE 1LP9A 1YMMB 1M4KA 2H32A 4MXVE 4Z7UB 1RHFA 5E6YA 5IMMB 1BZ7A 4LAQL 3WNNA 4YPGB 1NQBA 5GS3A 1QLFB 3BN3B 1T1WB 2VKXA 1YPZB 3MLRH 4HUVA 4ODVH 2RJMA 2VXTH 3DLQR 1MFDL 2JJSC 4AM0A 1D9KB 1CR9L 2ZPKH 3RVVC 1F4YL 3QUYC 1AFVL 4PRAB 5C09B 1UH3A 3ILQC 4BZ1L 4NQSB 4M7ZB 4XWGH 3VXNB 5DJ2A 4UNVA 2EC8A 2OJEA 4DUXA 2D0FA 3HMXH 3QG7H 3UTOA 5KVDL 2HLAB 4W68A 1A7PH 1NCCL 2IH1A 3ARWA 3VI4E 1WFUA 5AUMB 1CICA 5GRUH 4JPVH 3V4UH 5C07D 1SEQL 3ECBB 3KJ4B 3U36B 4MYWB 1T3FB 4D0DA 1KFAL 4DTGH 2HFEA 4DFHA 4E42B 4FXGB 4LMQE 2P5WB 4O58L 4KVNH 5B3NA 2ESVE 4P3CH 1PY4A 3TA3B 2W0PA