4LSDA

Myokine structure
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
MSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of irisin reveals a novel intersubunit beta-sheet fibronectin type III (FNIII) dimer: implications for receptor activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
molecule keywords Fibronectin type III domain-containing protein 5
total genus 15
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lsdA00
1YEIL 1KJVA 3UTTA 2X44D 2ZUYA 3RGVD 2A0LC 3N1GC 3B8YA 15C8H 4JFYA 5E2VH 5M94B 1NMBL 3F58L 3F65A 2H26A 1NAMA 3LKOA 4HV8A 3GSXB 4DW2L 3EZ8A 4S0SD 3UTQB 4HK0A 3EOBA 4ELME 5JHDE 4LK4A 3VG9B 3VXMB 1PEZA 3HZKB 3FT2A 4GG8A 1OCWL 5I17B 3MOBH 3PGFH 1KB5L 4PJIA 4EDXA 1P7KB 1X5ZA 1Y6MR 1X7QA 1TETH 4DGIH 4LSUH 1U41A 4ZFOL 3PV6A 3MRDA 4HG4J 4XPAL 3B3IB 4UTAH 4JQVA 2WBKA 1S5IH 3QDMA 4PLKC 5EU6E 3RQ3A 3EFDH 3QFJD 2A73A 2FJHB 2DTMH 3BD4A 5MEQA 1QYGH 3MCKA 5I75B 1ES0A 4Q0XL 3HG1E 1RVFL 5FA4B 2A77L 1NGZA 2ITCB 5I74B 3DARA 5EBWA 3OQ3B 1ZHBB 3H7BA 5DMIL 4IEFB 1NCNA 3NH7H 2W59A 5J7CC 1AKJA 5BRZA 2DQUL 5E8EB 4PJEB 4PP2B 3LQAC 4X7FC 5AD0A 1SY6H 5C0DB 1T3FA 3EJZD 4HS8L 4ODVH 4PD4J 5JW4N 1I9RL 1WAAF 2NR6C 3IDGA 5T5NF 2ERJB 2C1OA 3TF7C 5E4IA 5CBEA 1UB6B 1GC1H 4LVOC 2EECA 2FEDD 2HJLA 3OG4B 3Q5YA 3ZE0F 1I1AC 1HOCA 3G04B 1OD7A 3K3QA 1ZEAL 5D4QA 3WBDA 2H32H 2FECL 1AGEA 3Q5OA 1A8JH 4KROB 1NDGA 5JO5B 3V6BR 3MRNA 4TNVF 3D3VD 4L5FL 2DJ4A 4KTEH 2Z8SA 5IVXA 4OZ4A 4MHHI 3ZTJG 4P4KC 3I02A 1ONQB 3NFPB 3QXDA 2JJWA 1EV2E 3UPRB 4XXDA 3ETBF 5E7BA 5F7NC 5F7YC 4UOJA 5D2LA 4KKBC 5C0BD 3U2SA 4HKXB 1EJOL 4V1DB 4CMHB 1OGTB 3TBVB 3ZTNL 2PYEA 1J1XH 5F9DC 3QIWB 2ZUUA 5F44A 2DQFB 2APWA 3QAZC 1QO3A 1T1WB 2D4DA 5IMLB 1QNZH 2Z93B 4MCYA 2DMCA 3OKEA 1J0KA 1U91B 5FYLL 3VH8G 4IIQA 3VFSB 5TF1L 3UTTB 3EYQD 1XGRA 2B4CL 2J12B 5TGBB 5I1CH 2EDTA 2VLJA 3QFJA 2R2EA 4TVPL 5F71A 3LKOB 4DN3L 4JKPH 5GQBA 1SEBB 3WKNA 1NAMH 1ZK9A 4UV7L 1U8PA 4LPVA 5CUSH 1R0AH 3OB8A 4HUVA 3Q1SH 4HFWB 1I8IA 1UJ3C 4O2EB 3HFML 4TVPE 4YHYB 4Z78A 1IM9B 4HIJB 2FIKA 2HP4A 3EOAB 1EHLH 4JGMA 4AEHL 1IKNC 3UTPD 2CJUL 3PE9A 1TXKA 3CUPB 1C12B 1F4WH 1KACB 1IAKA 3IAPA 1FP5A 3V6ZA 1CFTA 2L0DA 3ALXA 4Z18A 3ET9F 4I18A 1ED3B 5EU7E 2D7OA 1U0QA 4G8GB 4DK3A 1ORSA 5J8OA 4PLJD 3QZWB 5F9OL 4GKNB 5DA0B 1XEDA 3T1FA 5EU4B 3K81A 4ODUA 3TC9A 4RBPH 2O5XH 4RMWA 4WW2F 1Y0LB 5ALCL 3P0YH 3X17A 2DWEB 1GYAA 4FQQB 2CKBA 2A6JB 4CKVX 5MENB 4BFIA 3G5YB 3HNVH 2VDKH 2R1WB 5F96L 4MZ2A 4AH2A 1Y6NR 3BPCB 1A6WH 2P42B 3OJMB 1PEWA 4AENA 2ZJSH 1HHIB 2IAND 3JV5A 1CFSA 5D70H 3NGBC 2X9YA 2EYSB 3MOBL 3LEVL 5F93C 3SE3A 4PRDB 2JIXA 4XT1C 1KIQA 4K7FA 3I3EA 3SDAA 4Y19D 1AGEB 3L1OL 4DW2H 2ZCKH 3OKKB 1GZQA 4NRZA 4Q6YA 2CDGA 4E0RA 2IG2H 3QDGE 4KJPD 4X6DE 3RPKA 1J1OL 5DD0L 1RUQH 4Q58C 3RI5F 2UWEB 5FCUH 2JJTC 1BLNA 3BUYA 4BFEA 3NAAL 2BY3A 4D0BA 3RWIB 1JHTA 2CLRA 1FNGB 4X99A 5D9SA 3V0VB 3EAKA 3O4OC 4YUEH 1YJDL 4QT5A 3FTGB 3JSSA 3LB6D 4V1DA 4ORGB 2Y36L 3OV6A 4XC1L 4P0DA 5CLTA 1OSPL 2XIDA 2VXSL 3H9ZA 4ONHA 2BNQB 3CX2A 4XNUH 3CU7A 2WAHA 4HLZG 4JDVB 2C26A 3QO1B 2DQJH 2IWGA 4XH2A 4ZPVA 2BHYA 4YFLI 4HK3N 4NWTL 1HH9A 3U36A 3QIUC 3F12B 4Z0BL 3QEGH 4LFHG 2BDNH 1KXTB 2VABB 3GIVA 4M02A 1CR9H 1V7NL 5C0AE 1EFXB 5IHZB 5IQ9A 5HYEA 3N85L 1F8TH 2AJUH 4G43B 4YBLC 3TA3B 4O51A 3QDHA 3ABZA 1NUGA 2YC1B 2ED7A 2R2EB 3X11A 3H42H 2GTWB 1HEZB 3HZVA 4Y2DD 5DMGD 3NCBB 2PO6B 2F8XC 4C56D 4M43L 4YDIL 1RZKH 5C86A 5GJSL 2IBBA 4KI5E 3ME0A 2AJSL 4RCAA 3CSYB 3REWB 3SJVB 4UT9L 2IADA 5EZLB 4TUJB 4BK4A 3MLRH 3GBNL 5KANI 3JTSB 3D3VB 2FO4A 3GB7A 4QRTA 4PRAA 4ODTH 4Y1AA 3MA7A 1RUPH 2XYCA 3VXPB 3ARDC 3MRCB 1SEQL 2ICEA 5E00A 4KMLB 4F7EA 2XY2A 4GMSH 1FRGH 3HG1A 5EOCH 2NW3A 5FOBA 4KTDL 1OARH 1YEDA 5IGXH 4P5KB 3UTQA 3MRIB 4ZMAT 4PJHF 3L3HB 3NZ8A 5JIPA 3AS3A 4C59B 4F33A 1DDHB 4X6CF 4PUBH 2V2XA 3ZE2E 1HE7A 4Z7UB 1GAFH 4LKXA 4PTUB 3GKZA 1SHMA 1T7VA 1OW0A 3QWRA 3WLBA 3TVMC 2GITA 1AO7A 4OGZA 3ARDD 5JIKA 1JMZA 2F54D 2VLRE 5EA0L 2YPKA 5B4MC 5K59E 1PQZB 2J8OA 4A6YB 3ZHLA 5IHUL 2BMKA 3X12B 3MGAA 4UT6L 4WFEE 1U8HA 5KVEL 2AXGA 4JRXA 1MAKA 3EYFB 2R2HA 1MCFA 4JVWA 2YEZA 1I7TA 1ZANH 5HDOA 4KUZH 3FKUS 5TFSH 3GSNL 3MSPA 3ZL4H 5J13B 5JXAL 3GJFB 4I3GA 2X4SB 4HAFA 3VE0B 2AEIT 1T04A 4KRPD 3S37L 4PLKD 3H9SA 4LAQH 5D7LB 5ELIA 1E4WH 5E5MA 5F1IA 5K9KA 3HR5B 3RWIA 1CDIA 5EIQA 3IDGB 4WUKL 3UJJH 1XGQB 4YR6A 3W2DH 1NC4D 3HRPA 5DUPH 1U8JB 5L9DH 2HMID 1FFPA 1S9WB 4N90D 4R96B 2F19H 1A4JA 1QFHA 5ICXB 2EKSA 4DOHB 4RA3A 2LU7A 4OQ1A 2K9UA 2OL3L 3PL6D 1RZFH 4OCRL 4DQOH 1Q9KA 2ICWJ 4WI7A 2R4SH 2AJXH 4F3FA 2OXHA 4QWWD 4Z76A 3BN3B 4UQ3B 4PJAB 2HFFA 5FV2A 3Q6FB 3AUVA 1TJHL 4U05A 2J8UB 2WBJC 1GCFA 3IFLL 4MDJA 5HHMB 2MQ3A 4NBYB 4YHPB 1N6QH 3S9DB 4NNPH 4RZCB 4KZEL 3UPRA 2R9HD 5FM8A 1MUJB 2Q8AH 2EZ0C 3BI9X 1T1ZB 2CO6B 3IVKA 1QRND 4JFZL 3QG6A 4YHNA 5KJRH 1MJJB 5F3BA 3MCLL 2XNAA 2B4CC 1VSCA 3DX9A 3UX9B 4NO5A 3P11H 5D1XD 3REWA 3ZYJA 4LL9A 4U33A 4PJ7F 1RULH 5GRJL 5EFIA 5ADPH 1FLTX 1D3CA 1HIML 1NCCH 3CAFA 4M7LT 4LHQB 3SGKA 5HGAB 3RA7L 2EXYC 3BQUB 1XCTA 3GB7B 4HK3J 2PTTA 3VXUB 4RWYL 4YGVA 1SJHB 5I1HL 2MPAH 2PXYD 3LB6C 5TQ0H 4CGTA 1XR8B 1FNFA 1AC0A 4NC2B 4JDTH 1YEKL 3VWKA 5ILTH 5D6CA 2BVPA 4PYGA 1JPGB 5CJOL 4L8SB 1I4FA 5H94A 5SX4I 1DDHA 1R5IB 1PZ5A 4M8VA 1JRHI 4NKMB 4X6CB 3CUPA 4NQDA 4LKXB 4NUJB 1H3PH 4YDJA 2J88L 1ZS8B 4OQTA 2ZUQC 2WUBH 1ZT1B 3V6ZB 3KXFB 5D2NC 4ZAKD 3KLHC 5FO8B 5JR1H 1EJ6A 2CXGA 1H3GA 4HXBH 1G7JB 4GAFB 1IGFH 4PRNB 4ELKA 4WCYH 2Z31C 1GPOH 3KPQA 4JRXB 5E8PB 5C9KA 1EHAA 3ECBB 4R4BA 1EHNA 1IM3A 4LSVH 5EC1A 2NXYD 3UPAA 3TCXA 3VXRB 3WL9A 5H2BA 4M1DH 1T04B 3BDBA 1Z3GL 4OLXL 1QOKA 1CYGA 1M05B 4PJGF 4Z7UE 4OD1H 3PWVA 2A6JA 4OLEA 2YKLL 3U0WH 1MRDH 4I2XB 2BVQB 2QADD 3LSOA 3WLWC 1LK3L 4HUNB 2Y06H 2ED9A 3BKYL 5HYJA 2VIRB 1D6EB 3BHBB 1WCQA 1OSZB 4V1DE 5CBAA 2W9EL 4ACPA 2FX7L 2NY4B 3K4DA 4QHLA 2D03H 3NCCB 1OL0A 2D2OA 1YC7A 1YECL 2HRLA 5KS9B 2Z92A 5EUKA 1ODAA 1QSFD 4ZQKA 3SPVB 3D3VE 2HFFB 1LHZA 1QFOA 1YA5A 5KG9A 4JRYD 1YEGL 4XCNA 2J8UA 2XKUA 3AVEA 1T20B 5KSUA 1KPRA 4MB3A 1G1YA 1FL5B 5E2WH 1CDUA 1IGTA 5CIPH 3LKSA 3RY6A 3VFUB 3KXFD 4OQTH 4B53A 1JYVA 2XACC 5FYKU 2VERN 3L5XH 3QPXH 4WFHD 3GUTA 3OJDA 1MHCB 5T1DL 3TBSB 2KBGA 5ACMA 1UH4A 1KCSL 3P73B 2UZIH 3PWPB 4BZ2H 4EI5C 5J06A 5FUZH 3LN5A 3H2WA 3THMH 4F7PB 5D7IF 3UROR 1C5BL 4NCC2 4NQEE 5GHWL 4N0YL 1HH9B 3BPOB 4YHYC 4EN3B 4PBXA 4DWHA 1CD9B 4X8XA 3TBTA 1KJ2A 2XTLA 3TNNB 1NEUA 4NJ9L 3VXUA 4XWOD 2ATKA 4L9DA 5DVLA 3UTSD 3K7UA 1HNFA 3OF6A 3QIBB 5HYSB 3X11B 3FQUA 1Q94B 3VXQA 3RDTA 2CUMA 2VITA 1JGDB 5EU6B 3QCUL 3MO1A 3QXAA 1NCDH 1I1AA 1UXWA 1T66C 5DTFA 3FO1A 4M6NL 1NUNB 4OD1L 1N0XL 5MP6H 4OZGE 1P9MC 1S8DB 3C5SA 1NEZB 4FXGA 2I07A 2VLLA 4DVBB 1IARB 1UCBH 2XTJB 5D1ZD 4WTZA 5J6HA 4ELMB 4FFZH 1W72H 2XG4A 3OB0K 1RIVH 3QB7C 2VR9A 3WIHL 4L8SC 2EXWD 4ODWB 4M03A 2ICEB 5E00B 4GS7B 1EO8L 2J5LB 2B0SH 2IMMA 1KIRA 3TJEH 4XPHL 5HVGB 3WL9B 3DV6A 4OV5A 1WTGT 1ZLWK 4F58L 1WSST 3V4VL 1BPVA 5I8KL 3RNQB 2N7AA 4NOBA 3CJJA 3QHZH 5MENE 2F5BL 3T8XA 4FQIH 4LEOB 4NJ9H 2NYYD 2R4RH 2BVQA 2EDDA 4MB4A 3SDXA 5C6WH 4U7SA 5DUMH 4G6FD 1J8HB 1MNUH 4JM2B 3O6FD 3E6FB 4L4VD 5GGQH 1FIGH 4K3JL 3PWNA 1IEAB 5ILTL 4IHOA 3KLDA 4HIXL 4C56E 3ZMRA 5IMKB 4XMKH 4DUXA 5HI4C 5I1HH 3MRKB 4K2UH 3MLUH 3HNSL 4ZQKB 5FGSA 2FJFA 4C4KO 4PGJA 5KG9B 1P7HL 2CLVA 4OZIF 1NCCL 2BNRD 4Z7VB 2WP3T 4KQ3H 5C92A 4KRPB 4OLUH 5DUBA 1NFDE 1KULA 1NGZB 3OXRA 4Z7QF 4QTIH 3GUTB 1N5AB 2DQEL 2WWKT 3D2UA 1YECH 4JFZH 1U8JA 1YNKL 3FHAA 3OKOA 5I9QB 1AD9B 1F3JB 3NZHL 4JPWH 1CXFA 4PJEA 4PP2A 5IJVB 3FQRB 4HFUL 1UG9A 4NNPL 4U1LB 3E2HB 1WV7T 3K80A 1TJHH 3D18A 3BKYH 1KCRH 3F7VA 2FO1A 4Z76B 4LLDB 2Q8BH 3PP4H 4KVNH 1JWUB 1HNGA 3QR2A 2AJXL 3KDMB 1T0NB 4KAQL 5JHLH 2DDQL 2FBOJ 2OL3H 2OMNA 1T7ZA 4F37K 4Y4HB 1LO3H 5EO1A 5EOQL 3MXWL 5I6XB 3MRNB 2AV1A 4YHKH 1J5OH 3NTCL 4YFDB 4O4YL 2EDLA 4LRNL 2ZSWA 3VI4F 4HWBL 1E6JL 3WS6A 1DBAL 5D93B 5GS0L 3B9VA 1U8IB 2YD3A 5E8OB 4R3SA 3V5DB 3FB6B 1NKOA 1UWEH 2EYTA 4YDLB 5JXAH 4OZIA 2V9TA 1MWAA 4UV4H 4OB5H 1XCTB 1K85A 3CDGA 4UUJB 2GFBA 3QJHA 2AJYL 4O02H 3EZJB 4TUOA 3DOSA 3GI8H 3BIAX 1W8OA 1JWMB 1RUMH 2BXZA 3GMRB 4LLUB 3D1MC 3OKEB 1HKFA 4X4XA 3SCMC 2DWDB 2XN9A 1GZPA 4R90L 4R97C 4F7CB 1NFIB 4OD2B 5FHBH 4H8WC 1BX2B 3MLZL 1G6RB 4PJ9B 4HX1A 1CGUA 4RWYH 3TFKC 5AZ2L 1MREH 4FFWC 3QULA 1SMOA 3QUML 1E6JH 4WJ5A 4HD9A 2H2PD 4OZHB 4JM2A 3SGEH 3MUJA 4A6YH 2ZSVA 3F6IA 2PXYB 3CVIH 1I8KB 3S4SB 3EJZC 5IP4A 5IMKA 3ILPA 2G5BB 4BYHA 3C6LA 4MWFB 2JK5A 4LPXA 4JDZA 4QGYA 5DR5L 4LAJH 3I9GH 4BA8A 2OZ4L 4HWZB 2UYLB 4JQIH 4PRPA 3VGDA 4L8CB 4JO1L 2UUDK 1GOHA 1PG7X 4KRMB 3CH1B 1M05A 4FFWD 2I27N 3KYNA 4MJ5B 4J3SA 1C5CH 4ENEC 1NGQL 3O6FB 3ARFC 2MKWA 1K8DB 3VXSE 4WWID 3ULVH 1JN6B 1HDMA 4PRBA 3WNPA 3VXME 5C0RL 2AK4B 3GMOA 3BHBA 2CKBH 5C0GA 1F3JA 2BHUA 1TJGH 5HGBB 1II4E 2AV7A 2CKBB 5MEOA 5I2IB 4PJ7E 3BKJH 5J11C 1TNNA 3LQZA 1NKRA 2NY5C 4JFFD 3WCYA 5CJBA 1S3KL 4FQCL 4M8QA 5L2KE 2AJZA 2NY2C 4FQXD 3ARYA 1KLUA 5DVOA 4OF7A 5JIIA 3LD8C 3ILQC 4M6OL 1YPZA 5FUOH 2ARJQ 3QEUA 4JRYE 1KTKE 4YPGA 5KSUB 2DQJL 3TN0D 3ZZ1A 3I6LD 2RCSH 3PV7A 4ZOEA 3IXAA 1BQHG 1V5JA 4Y4KD 2I9LB 4Y5YA 4ETYA 4WW2A 3M1BB 2Z31D 2R2CA 1MHCA 2ZUVA 4RX4A 3FHQA 3OMZA 1JNHA 4PJHE 2XN9E 4P5MA 2D9QB 1OP5K 4YUEL 3E8UH 5K9QG 5T3ZD 2VSDA 1F97A 2BVTA 3QIWC 4LLWA 2ZWLT 2R4RL 2AEPH 4JM4L 4GAGL 2AEWA 3V5DA 5TPWL 1LP9A 1G9ML 4HUKB 4XNYL 3T1WA 1LMKA 3CDGB 2LABA 1T21A 4LPYA 3U0TB 5E8NB 4XPHH 1NBYA 3TJEL 1CFNB 1D5XB 1U8NB 12E8L 3KLAB 5IR1A 1CGWA 1EO8H 3LEXA 1ZHNA 5D2NB 1KELL 3DXAE 3F12A 2CMRH 5IJKC 4NQVA 1AR2A 2YSSB 3D9AL 4JPVH 1GRWA 4OIBA 2V5YA 4LMQE 4EI6B 4XTRD 5EU6D 1EFXA 5IHZA 2P4AB 1I1AB 1FORL 1OAXH 3C2SA 4LIQE 2NY0B 3QUZD 5ID1A 4YHZL 2CDFA 2JTDA 5TE6L 2ICCA 3RUGA 3ZDZF 1J0ZA 3DSNA 4MNQA 1T0MA 2PXYA 3SGEI 3BEWA 3MLRL 1P4LB 1BQHA 2DI9A 1G9NL 1GH7A 4PJBF 3SJVA 3DVFA 1NGPL 5FYJE 5T5FL 3GRWH 4ZO9A 1FGNH 4F57L 3SEPA 3QUZC 1VFAA 5JHDA 1MOEA 4X7TA 5HDLA 5ID0B 4LVHB 3LRSA 2OL3B 5TDOA 4AMKH 3GSUA 3AS2A 3QJFB 5DURB 4BSWB 3MCG1 1T1YA 4CU6A 1IQDA 1F11A 3QA3A 2VB5A 3UBXG 2PXYC 3C5ZD 4DN4H 4YZFE 1CFQA 3TIDB 2MSPA 3THML 2W9DL 1EUUA 4BZ2L 4YQXH 4ODSL 2PW1B 4HIHB 5F7DA 3VD7A 3QPQC 4TTGA 3E6FA 4JG0H 3WFEL 4JKPL 4F7TA 2Z31A 3PWNB 4TVPH 2AV7B 3MRPA 3T0BA 2P8LB 3HKFA 3DMMB 3ZSTA 4X7SL 1XR9B 2Q3ZA 2VXVH 3SKJL 5I66A 2SEBB 2B4CH 5I1CL 3L9RA 1PW3A 3P4LA 3DETC 5D5MB 2XQYG 5DHYB 3TZVC 1E4XH 2D0HA 1F45A 4R4FL 1KLUB 2VISB 1QP1A 2X10A 3CFDB 2ZCLL 5SWZD 1FVEA 3SDXE 3QUYD 2DQIH 4OGYH 3BUTA 4PJDF 4WI3A 3UMTA 4FQXC 4XPFH 3BD5A 4TTDC 1CLOL 5ENWA 3MV7A 4RNRA 4LP5A 4PD4K 3GJFK 2ADFH 1ADQA 4UT7L 1OY3B 2FL5A 3MRHA 5E03A 1IAMA 3VMNA 3OG6B 4GW4A 4X7DC 4B50A 5HHVL 5FDWA 4OSUL 2Y06L 3QFDA 4QOKE 4ZTOH 3D25B 4P2OB 3RUGE 3LV3A 43C9A 1CLOH 3ALWA 4V2CB 1YEFL 5CCKH 3HNVL 5E6IB 4XNXH 3O8XB 4LSVL 1VESA 1YJDC 1T0NA 1FCCA 3S4SG 1D5XA 1U8NA 5JW4M 5LCVH 5C6PB 1MCLA 2C4FU 3LEXB 1ZHNB 4U1NB 1MPAL 4JE4B 3MZGB 4P49A 3QRGL 1MCNA 2C3VB 1YMMA 4GS7C 4GFTB 1EFXD 3IKCA 1S7WB 4NQSB 2E9IA 3QDAA 5EZJB 1U8IA 1WWWX 4O9HH 4WI9A 5KVFL 5C3LD 1A5FL 1MUJA 4JFPA 1J0YA 1RJLB 5DMIH 2BFVL 2XNAB 3RVTD 3FCTA 1F4WL 4N8VB 4NZRL 4NKIL 1ZHKA 3H9HA 4FMKA 1EHLL 3DLQR 1J87A 1FPTH 3ARDB 3TN0B 3GSWA 3LN4A 3EJYD 4U6HA 2V5RA 4N0UB 4W4NA 3K2UH 4X7TB 5HGAA 3RBSA 4M7KH 2P45B 4DKDC 1BIIB 4OCNC 2EDHA 3MRGA 3PWJA 3T0XA 1NGXB 4KMTH 4BSWA 4NKQB 1T1YB 2RJMA 3RA7H 3UDWC 1IQDB 3HB3C 4XP5H 4JZJA 1I1YA 1VEOA 3IU4H 3UXFA 1K8IB 4IRJC 4P3WA 4JFYB 1PG7W 4XAKE 3MROB 1RU9L 1ZVSB 4WENB 1OCWH 3OR7B 1G9NC 5BV7B 4XCCH 2VR5A 5TE6H 5E9DB 4XNQB 1MFBH 1C5DB 3VXMA 4N68A 3O81A 1X9QA 3HPJB 5JOEA 3DSFH 3MACH 1G7PA 3TA3C 5ECJE 4NQDE 5DEFB 3HE6A 4QHKI 3LZFL 3N50A 3QUMB 4ZDHA 1JNLL 3HE6D 3V52L 2C9AA 1JI2A 5EORL 1MCHA 1ZT1A 3O0RH 3BN9D 1IKFH 2EEBA 1ZKAA 2BNUB 5BCAA 1JIBA 1A6UH 5FIEA 1TJIL 5J1SC 4LSDA 2APFA 4OCRH 5SWSE 2YPLB 3OKYA 3OTTA 5FA4A 1V3MA 5CINH 1BEYH 4MQXC 2I25N 4G5ZL 3MV7B 2B5IC 4RNRB 5DMJB 2CRIA 1FNSL 5F7HA 4QHUB 5DJCA 1X3DA 2J6EA 5BRZB 2VWEC 5E99H 3S96B 4IOFD 3TBWA 3SDAC 3T4YA 3W2DL 2F8OA 4J1UA 3NIFE 4H1LH 5L88H 1EPFA 5FAAA 3LSOB 1MEXL 2G75B 5GRVL 5GGTH 3RAJL 4F80A 1VFUA 4EVNA 2AJZB 2X09A 2VIRA 2Z91A 3O2VH 3QQNA 1EXUB 4X7SH 4FQXB 3ZT6A 4ETQA 5E6IA 1A9BB 1IGIL 5C0EA 4NQCD 1INDH 43CAA 4F2MB 2YXFA 3SO3C 2DQUH 1WK0A 4NKDA 3C9NB 3MFFB 3Q5TA 4P99A 2ESVA 1FC1A 3CMOH 4JZNA 5I1DA 4WW2B 4CJ0A 3J7HA 1E27B 1U2CA 5EA0H 3BDXA 3S37X 1AGFA 2NY5H 4JY6A 4UU9B 5DD3L 4JFHD 1T20A 2G5RA 1NQBA 4OZ4B 1VKXB 4Y5XC 4YHOH 1IGTB 3W0WE 3WEXA 3TO2B 4X5WA 4AMKL 5FA3A 3EFDL 3UYRL 3CNKA 4PUBL 4AT6A 1DCLA 5FGCB 3ALPA 2W92A 3O9WA 4HKXA 3O2DL 3MBEA 4GKOA 3WN5A 4PJ9C 3OAUH 1WIUA 4P9HH 1J05A 5E8NA 1VGEH 2XRAL 3CZFB 3BESR 1OQXA 2QQNH 1AGBA 4JO1H 3PL6C 4ZS7L 4ZUSB 5C08A 4YXHL 4N0UA 1BFVL 3MJ6A 1UKQA 2YD1A 4JQIL 1OTTD 1U91A 2YZ1A 4JPIB 4KTYA 3TNNA 2J8UE 4JN1H 4JQXA 2BJMH 5I16A 5JUEH 3P4NA 1TZIB 1NLBH 5HYSA 1UWXH 1VEMA 1ZVSA 4QHMA 3O11B 2DLEA 5TH2B 2VAJA 2VITB 3CU1A 3S36X 4HCRA 4LCYA 3NFSH 2A6DA 1A2YA 4MA3B 5GGUA 1YPZE 1NMCB 4O2EA 4BQ6A 1IGCH 3HLAA 1RFDH 2GAZA 2A6IA 4JFDB 1KF9B 4U6VL 3ZT5A 1G9MH 1SY6A 3EOBB 4TULH 5FECA 2IFFL 5DFWH 4JM4H 5TDOB 2H2SC 3WIFA 8CGTA 5F7FA 2ED8A 1P7QA 1Q38A 2A83B 2R1YA 4PJ8C 4RIRA 4WWKB 1FZOA 5IW3A 3QNZA 2CXKA 2XXMB 5CEZL 4BH8A 4GKNA 4FN0A 4XWOC 3PV6B 2CLZB 1WEJL 4GXVH 3CD4A 4ODUB 4XNUL 2AXFB 4HIHA 3MYZA 5F7DB 4A2MA 3U7WL 3DXAD 4R26H 4L29A 3GBMH 3EJYC 2K3TA 3ULUH 3RZCB 4J1UB 1BVZA 1XAUA 3PP3K 3G5YA 4Y4FD 3MYJA 4LSPL 5IBTL 5EBWB 2AXHA 4JG1L 1MHEA 5D2LF 1Q72H 3QI9C 1JYXA 5EZIL 3D0VA 1JZ7A 3BKJL 4AENB 4CL7A 3WFBH 5C0AB 1OGAE 4NSKA 4P5TC 4RMTA 4HS3B 3H9SE 3QZWG 5LVEA 3SGDH 2VTFA 3GFUA 4WHTB 5SWZB 2IQAB 3MLSH 4TSAH 3SDAB 3WN5C 1ZHLB 2OS7A 1YY9D 2L7UA 4NPYB 4NJAH 2YR3A 1MFDL 1U3ZA 1JTOA 3SDYL 4Z7VA 4P48A 4MD0B 3U82B 4EQ3A 5B3JF 5DUBB 1ULVA 1N6VA 2W60B 4PY7B 5IK3B 1NDMB 3QUKA 4KHXL 1JHTB 2CLRB 3SN6N 2OJZH 3FFCB 4TPRL 4LHJB 4AT6B 3WXWH 1ZTXL 1QBLH 5EIIB 1KT2B 1EZVY 3HMWH 3QDJD 3O9WB 3INUL 5I8OH 1AD9A 1O7SA 1JPSL 5KOMC 4WW2C 2VAAB 3O8XA 2OBGA 5BVPL 4YPJA 3PIQA 1IGML 3P9LB 3PF2A 3BZFB 4G6AC 5ITFA 4N0CD 5HYJD 5FM5O 3TPUA 1TQCB 2DB8A 3GM0A 5HYFA 1YMMB 2VLJE 1BVLA 4ODBD 3SO5A 5EU3A 4U1IB 1HH6A 3TZVD 1TZIA 4PJ9D 4G43A 5B39G 2PR4H 3R4DA 3D0LB 1OOAA 4XHQA 2VOTA 2YC1A 3SE8L 5ADOL 1PSKH 2X4RB 3QEQB 1JMXA 4QY8B 2D7TH 2PNDA 2A6DB 1JHKH 5I71C 1XGRB 2HKFL 4LF3B 2XXCB 5C0NC 1U95B 1NAML 1G1CA 2AJYH 2ZG2A 4O02L 3WFCH 1JF6A 3G6AA 5CHNA 4TUJA 5MHSD 2P46B 1C16B 2AGJL 4UV4L 2WQRA 4YNYA 4GKZA 1HXYB 1Q0XL 1M7IB 1PLGH 2DL9A 3F7QA 5EBGA 4BSVA 1OM3L 1DZBA 3MUGB 4YX2H 4HFWA 3RWCB 5ICZA 1FZMB 5DF0A 2W0PA 1FO0B 3D3VA 4Z78B 3GMPA 5GSRB 4FQ1L 4XBEL 1CU4H 1NGWA 5DRNB 3U4EA 4ZXBA 3FQWA 1XGUB 3MRCA 1BQUA 2WIMA 3OKLB 4NNXB 4O5LL 1EDQA 1YEJH 5I1JL 4F7EB 3DUHA 5TDPB 4EN3C 3IB4A 1UCBL 5GGVY 2AI0L 4P5KA 3TYFA 1O7VA 4JM2C 3OXSA 1YY8B 3NZ8B 3L3HA 2KQNA 1JI1A 1DBJL 1IC7L 4KHTH 4OD2A 1B0RA 3SE3C 5DEFA 5CEYA 4X9GA 1QFWL 3DROB 1A7NL 4MNGA 1QR1A 1CFBA 1RJYB 3LQAH 4TVPD 5IFHH 5CKAA 1H8OA 4C57C 1T1XA 1YMME 1AO7B 2VDOH 5T3XH 4JM2D 1KN4L 2DWEA 4LSSH 4NSKB 4ZO7A 4M61A 2GCYA 1EIBA 4IOIB 2FJGA 3X12A 3C6LB 3EGSA 1KCKA 4MNGE 3TVMA 2FWOB 3RZCC 3DI2B 3DXAB 1AR1D 1WZ1H 5T5NG 1HHGA 3MV7D 4CMHC 5HYJE 2WBJD 1VFBA 4X98B 3JXAA 3MREB 1HQ4B 4RBPK 3HR5A 4OLVH 2ZNXA 4ZOBA 1KIQB 4WU5A 1RK0A 5F21B 5I73C 4P5TB 3GDBA 3BMVA 1NLDH 1GIGH 1MCWM 4TYUA 1XF4A 1J8HE 4G80A 2Z91B 2E6PA 3GMOB 1I3UA 1NSNL 1INEH 3CZJA 4G3YH 5JPNB 2EH8H 4I77L 4JHWL 1A4JB 5ICXA 2WBJA 3B83A 4JREC 1CE1H 4LCIL 5FM4A 1R3IH 3JWDH 2IFGA 2Q7YA 4FFVD 2XPGB 3TA3D 1K4DB 2WINA 3WKMH 4UNTA 1BQLL 5JDJA 4M8QB 5KVDH 5C09E 5C09D 1S7XB 4ORGA 5DGQA 4K9EH 3VFTA 5T33H 3NIDE 3TPUB 3ZYZA 1H3UA 3FB5B 2BNQA 5DC9B 1BVLB 2W07A 3E1F1 2IPTH 4QRSA 1KTDA 1IC1A 4JKLA 1U8LA 3RPIB 5B21A 5D7JC 5ALBL 1PG7H 5I15L 4WUUD 5FA3B 1WAAE 5IKCA 1CGSH 2XTJE 4WTZG 1CGSL 5GSVA 1QD0A 5E4EB 3F7YB 5JMRA 1IL1B 4YO0A 4NO5B 1I8MB 2IAMB 1NCAL 3G08A 4NM8L 3G6JA 4FFZL 2VLKD 1OTSD 4PGCA 3MGOB 8FABA 2C5DC 4M93B 4DKAA 4AEIL 4MLIA 1FZMA 5HGDB 5IEKB 1P53A 3GMPB 3U0TA 2WLYA 4ZUUA 2IADB 2F74A 3TEUA 2OR8A 1CFNA 3FQWB 4AQOA 4OM0L 1CE1L 4LCIH 4JY4A 1FN4B 2VO5A 5KAQG 1KN2H 3RWJA 4HT1L 4Z7NE 4WFFD 4J23A 1M71A 2BXYA 5IB1B 3HS0A 5KS9E 4C58B 3PXHA 2YSSA 2APVA 3V2AR 2IANB 1T89A 4YFLF 5EBLA 4L8SA 1YY8A 4GW1B 2DQHL 4O2FA 1WBXB 5ISZA 1DQJB 2F54B 4Y4HC 4M1CD 1Q0YH 3CDCA 5TQ2H 4X6CA 2MQ0A 1CDBA 4ODHH 4YDJB 1ZS8A 2R8SH 3MRIA 1G6RH 3F6LA 4ODHL 3EYSL 1T1XB 3KXFA 1YEKH 2IPUK 3B9KA 4Y5VA 1BQHB 1NC4B 2FJGB 4PRNA 2QADB 1XCQB 1G9EA 3C8KA 4P3DB 2XICA 4EIZC 1VHPA 2UUDH 4HHAA 4ZS6D 1MFEH 3LRSB 1HHGB 2ARJB 2YPKB 3EDJA 2DBJA 2DKSA 5DQJA 4HT1H 2Y07H 4DAGH 5JPMA 1QRKA 1F11B 2XKNA 4P46B 5FEBA 5JW5A 1U8HB 3VI3F 2FX8L 3EYFA 3D39E 5I1AA 1DBJH 2NY6C 1I9IH 4WGWB 5EG6C 2DN7A 2PW1A 3MBED 1D6EA 5BOPA 5D1QC 5JA9A 1FNEB 1JK8A 5DJ8B 4XPTL 2LTQC 3VGHA 3WSQL 2I5YH 4NM8H 1NCAH 1BAFL 2RIKA 4F7MB 3HA0A 4PJ5D 2Y1VA 4LCWA 4Y2DB 1U36A 1BJMA 2V7NA 1A4KA 1EEQA 4MZ3A 4HC1A 4MXVE 3DV4A 4KJPC 1PG7L 5I15H 4Y4FB 1Q0XH 2HTLD 1KTDB 4OGXH 4OLXH 1DLFL 1LO2L 2BNRA 3BKML 2IGFH 4AK1A 4U1SB 4RA0C 1XIWD 4F3FB 2X9XA 4N9GA 3TNMA 5DO2C 1HSBB 3VXRE 2NY3B 3I3DA 1YQVL 4CVXA 2UV3A 5BRZE 5KBNC 3MRHB 3UTSB 4MJID 1X5JA 5IHBA 5E2UL 3P73A 3QIBD 4G8EA 4HPOL 3SDAD 4GMTL 5C0IA 1F00I 3G08B 5JR1L 3C6LD 4ZTPL 4KFZC 5JQHC 4ERSH 1INEL 5D72L 1AJ7L 5GISL 4JFEB 4X4YB 4BZYA 4K8RD 1FYTD 5IEKA 2MKLC 5GXBB 1JRHL 2F74B 5DRWA 4LPTA 3FB8A 3NN8B 3V95A 4NN5B 1MRCL 2OK0H 2LQRA 4HWNA 1DE4B 1JUFA 3RDTB 5E6ZA 2HKHH 2PTTB 3MJ8B 2LVEA 5D1QD 3GMQB 1GOFA 4O2FB 4GAJH 3SOBH 2J3SA 2AQ2A 2LE9A 5M7QA 1NBQA 1YDPA 2KH2B 5LWYL 1DJSA 2IEPA 3N0PB 1M7IA 2EO9A 2NY0D 3QUZB 2YD6A 4HK0B 1MF2L 3NCYS 5E9DE 1FO0A 4IRJD 4OFIA 2ERJC 4MMXC 4J3TA 3KJ4B 5D6DA 4EKXA 4QGTA 3SDCC 4M5YL 4PJAE 1S9YB 2NX5A 2HVKB 5CJXC 1UM6L 4Z7WE 4LSPH 5IBTH 3VFMA 1T2XA 1J7VR 2AJSH 3WIIL 1CU4L 1TCRA 5I1AB 4DUWA 4YDLC 4R4BB 3UJIL 3M45A 5H2BB 5A2JH 4M7LH 1RV6X 4PJGA 1J8HA 1C5DA 3ZSSA 3FO2A 2DBLH 4YXKH 1WEJH 1FNEA 3KPNB 5DJ8A 2PF6A 5C0DA 5IROC 2E3VA 5E95B 2PCPB 4QCIA 3IJHB 1M6OB 5FO9B 1NCWH 2PN5A 5IJKA 5TDNB 3K8LA 3VU2A 3UJJL 3DXAA 4Z0BH 2R69H 3MA9L 4IRSB 5KSAD 3TLRA 3L7EA 1UH3A 1AGCA 1KGCE 3SGKC 4AL8H 3SJVD 1JZ3A 2PR4L 1AQKH 4U1SA 1JWSA 2XFXB 3MODL 4MA8H 2LTQB 3TNMB 5MEND 4I3SH 3VCLB 1GVIA 1Z5LB 2R23A 2EDRA 4CVXB 3ZDZE 4LOUC 3IU3B 3QSKB 1N59A 3RVWD 5DJCB 3ARGA 1KPRB 5IQ7H 2ENYA 3B9EA 1RY7B 1NLBL 4MDIA 5B8CA 1CIDA 4P2RB 1CICD 4HJJL 5EO9A 2DM7A 4APQA 4P2OD 5KOVC 1DQML 3NIGE 4XI5C 2E8YA 5J0BA 4HS6A 1LE9A 1CDGA 2FEEL 1U92A 3VFNA 1BFVH 2NNAA 2HFEA 3UTPE 1I3GH 5CS7A 5GGVH 2ZJSL 4D8PB 4JZNB 3H3KA 4RQQA 4YE4L 3RWGB 3JVGC 3LKQA 3CFKA 1RZGA 4PREB 1UEYA 4PV8A 5GSVB 3WHXA 2J8HA 3EYOB 5CMAB 5A1AA 1A6AA 1RI8A 1I8MA 2P49B 3BPLB 2NXZB 4GW5A 3G6JB 2VDMH 5DS8B 2VZUA 4HKBA 4R97B 5BJTB 1IC5H 1U8PB 1A1OA 5D7SL 1TENA 2YMXL 1I8LA 3TYGL 1XF3B 5F9OH 1NMAH 5DTFB 4JFQB 1Z0NA 1FO0H 5KVGL 2WSKA 32C2A 4X4MA 1NEZA 2I07B 2PO6C 1IAKB 3O8XD 4LLUA 3ORJA 1GGCH 2B1HH 1A7QL 1ZLSL 4X83A 3C6LC 4WI5A 4I18B 4RGNE 2EDNA 1DLHA 2AJUL 3DGGB 5DSCA 4CVZB 1MCEA 4TOYL 1JZ2A 4X5XB 1EGJA 4QYOA 3U0PA 3QO0B 3BPNB 1ZLWH 4JVPA 1ZAGA 3B2UC 4HX1B 4RISL 5I1KH 2FB4L 5E99L 5EU7C 4JRXE 4XC3L 4QTHA 4LHUG 4OV5B 5CGYD 3C08H 1F42A 1PBYA 1PYWA 2HJFA 1Y0LA 3MGTA 5FKAA 3BRFA 2YK1L 4UAOB 1F2XK 1J1PL 2PCPA 2DQTH 2HH0H 3GHBL 3B5TA 5E2TL 2VXSH 5E6YA 3MRQA 4LU5L 2YD5A 5HI4D 4AH2B 1CGXA 4Y8DC 3VWKD 4HHAB 2AK4D 1RURL 1WGOA 5DRZB 3FFDB 5SV3A 1UM6H 2V2WA 5FCUL 2HT3D 3PABA 4NKOA 3ARGC 1IT9H 5C6TH 1J1OH 5EO0A 3P30H 1ZT4A 1A3LH 4OZFH 1OPGL 4CVWA 5ESVB 1P2CA 2XWTB 1IAOB 3SGDI 1OLZA 3IU3A 1N59B 2R0LL 2EDQA 4KQ4H 5KANG 4S1QH 3RZCA 5HHPA 3HZMA 2XRAH 4MDIB 4Y8AA 4BK5A 4LVHC 1N5AA 3D2UB 4MAYB 4QT5B 1A6VH 2FLRT 4WGVB 4W70A 3QEQE 1W0YT 3NFNA 1VCAA 1R5WA 5GRZA 1LE9B 1CZ8L 3OL2A 5IJVA 1VACB 4WHYH 1J11A 4IMLB 4JDVA 3C8HA 4Z5RB 3VDCA 4G42B 4P23A 3Q6GL 5ALCH 3EOTL 2IQAA 1WUNT 3U36B 5ESQA 3DVGB 4X8JB 1E4KC 1D6VH 5JZ7C 5FFLA 1FNHA 3MR9A 1JWUA 4NQTA 1F90L 3FL7A 4C55A 4N9OB 5L6YL 4HZLB 1MY5A 1A6AB 3HNTH 3T3PE 3PQYA 1INDL 3FONA 1MVUA 1WCBA 3FQTA 4O51B 3HNTL 5C0IB 1NDMA 4G6MH 1QACA 4U1MA 5EO1B 4NQCE 2GTWA 5L6YH 1F90H 1SYVB 3IDYB 4PJXB 4IMKC 5C0CA 1MJ7H 2AV1B 2PO6A 5B38A 2A38A 1EZVX 1WJ3A 1CGVA 1U8MB 4NN7C 2BY0A 4ZTPH 35C8L 3QUXD 2Q20A 4UQ2A 4WW1A 1MEXH 3BVNA 3MNVB 2VAAA 3Q6GH 1N4XL 5DRWB 1NANI 4JHAL 4GRWF 4GJTB 3PDOA 4R0LC 5EIVA 3FN9A 3O3AA 2M1KA 1BF2A 4GRLC 1MWAB 1WFOA 1A6TA 1JPFB 4DVRH 1FG2B 4QRTB 2OTWA 5D7LE 4L9LB 1BFOB 3MJ8A 3CXDL 2C3WA 1KB5H 1MCPL 3QHTC 3SDDC 4QHNB 3QO0A 1D5ZA 5KSBB 4JJ5B 5J13C 4QO1A 4DUVA 3LPGA 1YEDB 3QUZA 1VADB 5DURD 2D3VA 3RUGB 3RWHA 1IE5A 3IJSA 1BAFH 1AP2A 3DYMA 4KUCF 4LF3A 1MI5B 4I4WA 4KK6C 4TQEL 4F33B 3P30L 2VLRB 5JOPE 3OHXA 2V2XB 2YWYA 4RDQG 1CDYA 4OGYL 5ANMA 3MRQB 4Z7OF 3C09C 3P3YA 3RIAK 4DKEH 3DRTA 1U3YA 1FIEA 3FFDA 4GKSA 4RAHA 4LHUA 2OQJB 1QUNA 3H9YA 5GSRA 1P4IL 1OTSC 1MCPH 5HSFA 1A22B 1XGUA 2OZ4A 1B0GA 1SYSB 3GHBH 4JDZB 5EO0B 4MYWB 4PJCF 1FL3A 4HWZA 3G9AB 1UADC 5DD5L 2EDEA 4K3DH 5D1XB 3C08L 4MQTB 5CD5C 4XCFL 1RPQA 4PJGB 3SKNB 3H9SB 5I1KL 5K9KB 3KPNA 1BFSA 2Z31B 4I13B 4M1GH 4QCIB 1J0IA 2WQ8A 1OAYL 1ZA3A 4XMLL 1XGQA 3H6JA 4MAYA 5TF0A 4JO3H 1R5WB 1J12A 5DD6B 3ZKND 1S9WA 4M4PA 4R96A 1VACA 5DXWA 5AUMA 2VZOA 5MEOB 5I2IA 4POZD 1OTTC 1BGXL 5GRXG 1IKNA 1FGNL 4F57H 4MSWA 4JFFB 3NH7L 1JWSB 4BQ8A 3TYGH 2OR9L 1H8SA 3U83A 1R3KB 3K46A 4H1LB 1YEEH 4D3CL 2C3GA 4RFOL 2R23B 3FRPG 5DGRA 2FL5B 1VFBB 4X98A 4YDVB 1NAKL 1DUYB 4NN5C 1V05A 1HCFX 1LNUB 2E7LA 2RGSA 5LCVL 3S36H 5C07D 4NM4L 2NQCA 4M48H 1S5IL 4NQUA 4NO0D 1JHLL 4MB5A 4AEIH 4APQD 1LVEA 2XOTA 1CBVL 3FFCD 5B38B 5GS0C 2ESVE 3QG6B 3MZTA 4LGSB 1F3DH 3AM8C 3DX9B 4NBXB 2AVGA 5JPNA 1O0VA 5CJ8A 4PTTA 3F7PC 3W9DB 2HFEB 4I1NB 1I3GL 4KQ4L 3O3DA 3VXSD 3WJLC 1K3IA 4D8PA 1P7QD 2WINB 3B9KC 3O3AB 3OKMA 4Y5VC 3D5OF 4RQQB 3RWGA 5GJTH 4KJQC 1HCVA 4XNYH 5KZCB 2J4WH 4L4VB 1LD9B 1AI1L 4KXZI 1BFOA 4LLYB 2C7UA 5A16A 4MX7A 1IBGH 3EOYG 1ZV5A 3OJ2C 3WHXB 1Y6KR 1GGUA 3KLAA 5IR1B 2ZCLH 5T33L 1SVCP 4QHNA 2E6JA 3I2CL 1YEIH 3I6KB 1EBPA 1XR8A 4X6EB 2X4UA 1MJUH 3RKDD 1REIA 4Q9QH 3GKWH 4R4FH 4JKWA 2A74B 1DP0A 4EN3D 4JPKH 1U3HD 3U48A 1XF3A 4MXQD 4I77H 4JHWH 4WO4B 4YO0B 3A6CL 4WU7B 4OCMC 5A2KH 4JZJC 3QNXA 3GSWB 1XGTB 3RJQB 1UFUA 2Y7QA 1YEHL 2CDFB 2QQKL 4NUJA 5K59F 3LPWA 4G6JL 2P8PB 4MNQB 2EKJA 2Y72A 5AYUH 2FGWH 5HPOA 1DQLH 1F5WA 1S9VA 2V2TA 1NGXA 1AGDB 1DLHB 3JWOC 5MERB 4N1CA 4X5XA 4X6DF 3R8QA 1FN4A 1K8IA 3BAEL 5E8PA 3KYMA 3DMMD 2XTJC 4YXKL 4Z8FL 4QTHB 3K0WA 4M7LL 3BP4B 5IUSA 3QUYB 3GSUB 3QJFA 5EBLB 2PKDA 3PNWB 3ULVL 3CVHH 1WBXA 5I19H 4IRJA 5IB2B 2YPLD 3DX6B 2E7LC 1QA9A 3NA9L 4U2YA 4ZDHB 1V7MH 4M00A 3CIQA 1KIUA 2JKXA 3VH8B 1I7RB 1MQ8A 1QFWH 1RIUH 1AY1H 2VC2H 3HZKA 3FT2B 3O4LE 2VDRL 4GG8B 4YHZH 2VDML 4QNPF 1QSFB 4I48B 3O6LL 2VZTA 2QEJA 1RHFA 3DMMA 4OZFA 3KPRA 4NRYA 5F8RC 4HC1H 4YGAB 2SEBA 3WNMA 2BZDA 1EEZA 3CFBA 3LKNB 1OTUD 1N26A 4CN1A 5D5MA 1UQSB 3UTZB 5DJ2B 3EJJX 4P9MH 5ESVA 4MJ6A 1XH3A 5EZOL 1LNUA 12E8H 5HYSG 3PHSA 1ZA6B 2ZG3A 3ARFD 3ARXA 2JIXD 4FQPA 2X4PA 1PZUB 5DT1H 3LRGA 3C2AL 5HHQB 3DX7A 2VLKB 3HCVB 4EVNB 1A9EA 4GW4B 3RIFF 2H2SD 2EO1A 3GNMH 1JK8B 4ETQB 5AD0B 3PWPA 4OKDA 3Q3GA 3O2WH 1FVCA 1ND0A 1VGKA 1JGEB 43CAB 4F2MA 2FRGP 4IM8A 5EC2A 1QZ1A 5T1LD 5DZOA 4OD3L 3DVGA 4X8JA 5T3ZL 5CBEB 5I1DB 2UZXB 1CFVL 2XWBB 4Y16C 3WXVL 3BRDA 1V8HA 3TBTB 5F70A 2JJUA 3O3EA 3RBGA 4AIOA 3HUJF 3VGFA 1QSVA 3GJFH 1OP3H 4BUGA 2A1WL 3HC4H 4Y89A 2X4UB 5FUOL 4JFDE 2KKQA 4M6OH 3RVUD 1IGMH 4H26B 1A1NB 3HRZA 3OX8A 4PRHB 5EU6A 3EBAA 5DHVH 1Q1JL 2VDPH 4MA1C 3MXWH 4NQED 4NQSA 3BKMH 3AROA 3FO1B 3HMWL 4OKVA 3QNXB 2EC8A 1UVQB 4FNLH 5TE7H 1AXTL 1G7LB 3O45A 4HF5L 4YWGH 4K3EH 1CS6A 1RHHB 5IB5A 4LGRB 5C2UB 5J6HB 3TBVA 3AY4C 5T1KB 5GS3A 1NGQH 3BFOA 4PJFF 2OI9B 1D9KC 3UZVB 1D5ZB 5KSBA 4JJ5A 3KYMB 5I1IL 3T0EB 4HFUH 2W0FA 5D5ME 2Z93A 4PGEA 1VADA 2Q87A 2UWEF 4RWHA 3IFNL 5TGBA 4I4WB 1MI5A 1MIEL 3O4LB 4JY5L 4G6KL 3CX5K 3T0VA 1JNNH 1ZLUH 1RQ5A 4F15B 5EZIH 5I1GH 2QADC 3RX7A 3OR7A 4Y4KB 3I85A 3MRBA 4PR5A 5E9DA 1OAQL 2IALB 5FECB 4HUVB 4EUPG 2GTZA 4JN2B 3WHE1 1T2QH 2DD8H 4IHOB 1FSKC 5F7WC 3VWJD 3ZE1E 2K1MA 2JJSA 3MLWL 4NC1E 3RKPA 3HE6B 5DJAB 1DSFL 2WIIB 3QNZB 3C60D 1KFAH 5IVOA 3STLA 1EEZB 3CFBB 5JXEA 1X5IA 3CLFL 1FYHB 3KPPA 4L8BA 4EBQL 5IW1A 1G7QA 1R6VA 2V7HB 1CFTB 5CEZH 3QAZB 2PYEE 5GGQL 4J6RH 1ED3A 5SX4H 1MRCH 3O3BB 1XH3B 1XGYL 1BBDL 4L29B 4WO4D 4ESKA 4U49A 3VFMB 2IFFH 2YHGA 5FK9B 3GIZH 5GGSB 2X89D 2X4PB 1DQDH 5GPRA 1A7RH 3T1FB 5HHQA 1PFCA 4MVBC 4NIKB 1CK0L 3HCVA 2VLKA 4XMPL 1X5FA 4NZTL 5IVXF 4QHUA 1P1ZB 4P3CH 1QQDA 3TBWB 3EW3B 1HZHL 4M6ML 4MS8C 4NFBA 2E27L 4TRPH 2GJZB 3STBA 4HPOH 4HXAL 3DIFB 5FO9A 3BP5A 5IBUB 1F58H 1UACL 3C60A 4WHTA 5SWZA 5TDNA 2NMSA 1BOGB 4YDKH 2NCMA 3JV6B 4H1LA 1LO3L 2BJML 2GT9A 3MV8D 4XVJL 2JELL 4N0CC 4KAQH 3LMJL 4G7VL 2I9TB 3QUKB 5C09A 4RX4D 2ESVB 5FXCH 3TZVA 1LDPL 1Z5LA 4N8CL 4PG2A 2BX5A 1KT2A 3MPCA 4DTGL 4JB9H 4LCCC 5D96B 5SWQA 4YBQD 1WISA 4W6YB 3WUWB 4DEPB 3O2DH 4N5ED 5B8CB 3V0VA 2M26A 3GO1H 2DOCA 1G7LA 4K9EL 3L6FB 4YBHA 1YZZA 4Z7QE 1FBIL 1ORQA 2FX8H 3NPZB 4LLYA 2NNAB 2EDXA 4J4PC 3T3MF 4KI5D 5AZEL 4P23D 4RFEA 4UDTA 2YPLE 2DICA 3IDIA 2F5AL 4OT1H 3SKOA 1JBJA 4K7PH 4DGVL 3HE7C 2A74A 4JVUA 4I9WD 4R0LA 4K2UL 3JWOL 4WO4A 2F5AH 2VUYA 2DLGA 4LSTH 4GW5B 2JCCF 5CHNB 5I8EB 5LKNA 4LRIA 4QHMB 4P57B 1XGTA 1RK1B 2OI9C 4HKBB 1HXYA 4GKZB 3WS3B 4OIAA 3MV9D 1A1OB 2P5WE 2VN7A 3O4OB 5TQ2L 2QV2A 1J86A 5DWUL 4OCXH 4JFQA 2HFGL 2NW2B 3WFDL 1T7XA 4Y5XA 1G7HA 3TN0C 2WIIA 2D03L 1FNSH 5C07A 4CW1B 1MQKH 2JK5B 2A6IB 3RTQC 3SY0B 4LSSL 3STLB 4G5ZH 3W39B 3WIHA 3P9MA 1QLFB 5L7XL 2X4QA 1CT8B 4PRID 1TJIH 2FR4A 2AK1L 3AU1B 4L8CA 4U0RC 3WIFB 1CDHA 3MX0A 3QIUB 4NYLB 2B0SL 3OXSB 4K3HA 1MAJA 4HEPG 1LK3H 2R1YB 4RIRB 4NN6B 2DYPD 3WIHH 1NC2B 5CEYB 3LMJH 4G7VH 2NW3B 5FOBB 1QR1B 4PJXE 4RGNC 4U1GC 3V6FB 1JN6A 4HZAA 5C9JA 4W6XB 1P1ZA 1AQDA 4B5EA 1CD8A 2HWZH 3N9GL 1KJ2H 4M6NH 3L3IA 2ZNWA 1GPOL 3DIFA 5GZND 5A40E 2VL5B 2AW2A 3EKCA 1RSFA 2GJ6E 1J0JA 2FX9H 4EEEA 1MHEB 4H88L 1ZVHA 3D0VB 1GOGA 3UTZA 4JZOB 3SCMD 1YC8A 5ALBH 1QLRB 4G8IA 3KJ4C 3KPOA 4HS3A 3L5HA 1HQ4A 5IB4A 1C1EH 1H9VA 1ITCA 3IDMB 4U6XA 1JNJA 2GJ6A 2C4XA 2I9TA 4KKCD 4EXKA 2ADGA 3IXAB 2X5PA 3OR6A 3P77A 3TZVB 3M1BA 2YEZB 4LBEB 3VXTA 3DX7B 1OP5H 3IDNA 1XF4B 2R39A 2PTVA 5IF0A 2E6QA 3DO3A 3MLTA 5DMKB 3N1MC 4F9PC 5D7LA 4PJCB 2NY0C 5GHWH 4L4TE 4NZRH 1I7UA 3Q48A 2CR3A 3PWLB 1FVCB 4P4KB 1YYML 3LVEA 4JR9L 3O2DA 5HGGS 1U2HA 1BJ1H 3VFTB 1NC2D 4WFHE 1ZGLM 4YHML 3PHOB 5ICYA 3U4AA 4KVCL 4OLVL 4QRSB 5E2WL 1RULL 5GRJH 4IRSD 4P4RB 1H8NA 5D2NA 4KI1A 4G6KH 2ATPB 3BZFA 2XV6B 4GQPH 5GZOD 3MRMA 3SBWA 1OGAD 4MDJB 2MCPL 3TO4A 1IL1A 1KG0A 3O41B 3D0LA 1GC1C 3FRPA 3REVB 3GBLA 2FX7H 4OKVB 2VDOL 3IAGC 3KLSA 4PGCB 2DKMA 1SYVA 4PJXA 3G5ZA 5C0CB 3IFLH 4Q6IB 1KCVL 4YHNB 4OFVA 5I18L 5GRWA 3ULUD 5CEZE 2ADFL 3F5WA 4UT7H 3WD5H 3PDOB 1B6DA 1NCTA 4OZIE 2X1WL 4XPFL 2X4QB 3VD5A 3MUGA 4YXLL 2P5EB 2DQIL 4IIQC 2FR4B 1A6TB 1JPFA 1Q1JH 2VDPL 5F89B 4FXLA 5DK0A 2YPVL 4KKLD 4L9LA 4GRWH 4O5LH 5L2JA 1SJHA 5DRNA 3QYCA 4K8RL 5E08L 5DA4A 2LFGA 1JGLL 4M5ZL 1NC2A 3FQNA 2VWEE 3GBML 4R26L 2AJVH 2BVPB 4AM0A 4Y4KA 2VDNL 4DZ8A 3TYFB 2IALA 5IVNA 5TFSL 1EGJL 3G6DL 2QBWA 1TVBB 2LV4A 2A6KA 3NCFB 4OD3H 5T3ZH 3WFEH 1B0RB 4P2OC 3L3IB 1S5HB 3G9VA 1LO4L 4QXTB 1UKSA 3C8KB 4P3DA 2X70B 1OAZH 5IHUH 3EFFA 2YD2A 3OKDA 5IW1B 1JGVL 4NDMB 5EUOF 2DLFL 3QDJA 4MQSB 1PSKL 4AEFA 1FFQA 3SE8H 5ADOH 2BERA 5L8JB 7FABL 1UT9A 3S88H 2A73B 2GCYB 2ITDB 1ADQH 1S78D 3MCKB 3ARUA 3LEYH 5DT1L 3CSBA 4OTXL 3SE9H 5DQ9A 3OR6B 3K2MC 3GSQB 1IM3B 1IAIM 3QDJE 5FYJU 4OBRA 1U8QA 3NFSL 5BVJB 2Z8WC 4P9ML 1TZHB 3EYVB 5E56A 2V9RA 1ZOXA 1MHPL 2F54E 2VLRD 1T3FB 5I1LB 4P4KA 5E6ID 1IVLA 4XPGL 1DL7L 2RR3A 4PRPD 4PY8J 3D25A 1RUPL 4JN1L 4MA1B 5DC4B 4HGWA 3JV6A 1V3LA 3LQMA 5LG1A 4FA8A 4XGZB 4W68A 4OFDA 4ORZC 1H5BB 5GIRA 1E4JA 1L7TH 4Y4FA 2B1AL 4LVNC 3BDYL 3C5JA 4PJBB 1AE6H 5E2JA 2VNCA 2Q7YB 3CDFA 3LS5L 5C09B 1H3VA 1C7TA 2FEDC 4EI5D 5A2IH 4TSCH 4OTXH 3FB7B 3TO4B 2GY7B 3VD4A 2Y25A 3HC0A 1A7OL 1J8HD 3VFUA 1BIHA 7FABH 3HAEH 1I85C 1F8TL 5JOFB 2JJTA 3JVGA 1JTTA 3G6JF 4G8GD 4AJ0A 1RJLA 5KW9H 3LHPH 4P2CG 2AEPL 1FLRH 1FFOA 5CKGA 1OAZL 4F15C 5D7IB 4KDWA 4QRPB 3MLPA 2IAMA 1MCRA 4Z9KB 1KGCD 3KR3H 2E5EA 1JYWA 4K07A 5I76A 3MGOA 8FABB 3S37H 5IMLA 1MFCL 3IDIB 1CTNA 2Q86B 3EO9H 2P5EA 2MHAB 5HHNB 1KJ3L 4JPKL 5F9AC 4RRPG 5F89A 5DFTA 5DVKA 3KAAA 4XRCB 4KDVA 4Q6IC 2ATKB 4KK9C 3ZYOA 1MJUL 4UT6H 3QFJB 3AREC 2YPVH 1I3RA 4AIZB 3MOQA 3JTTB 3DUUA 1IBGL 4DZ8B 1E6OH 1J8KA 1QPXA 4Y19B 2BC4A 1BM3L 2HJKA 3E3QC 3KYKH 4YC2B 3UCRA 2ZCKL 3B6SB 1KC5H 2VR4A 4H25B 2BVOA 1X5YA 2BP3A 4U31A 3QT2A 2F15A 3C5SB 1C12A 5I18H 1T03H 1IKFL 2VZ1A 5D70L 1LO5B 2NXYC 3BZ4A 1CT8A 1RZ8B 1EO7A 1FFNB 5IGXL 4Z7WB 4PRIB 3QCVL 3SO3B 1NC4A 3WJJC 2ITDA 5CP7A 2X1QA 5JUEL 4KH2A 1TCRB 5BS0D 2EIBA 4QOKA 5C0CE 5DRXB 4HUWA 1DL7H 4ZS7H 3ZDXF 5IG7A 1RU9H 1I7ZA 2R1XB 3CVIL 1MHPH 2ZPKL 2CD0A 3W0WD 1A7BA 4X0KB 4OFKA 4X9HA 5C0BE 1QA9B 3ELAT 4YHMH 2G75A 4Z7UF 3LN9A 5GS0D 5HPMA 1HWHB 4YDIH 4CAGA 1ZLVH 4GAYB 3MLZH 1EXUA 1DFBH 1OP3K 5ISZE 4OGAC 1CFSB 1QLRA 2ZKHH 1KXQE 1FPTL 4E9LA 3BPNC 5IB4B 5EPMA 2EDKA 3SKMB 5JTWA 2IAMC 1KLGA 3OGCA 2DLFH 3JUZA 1C08A 3AM8A 1CDCA 3DHJA 2V7NB 1MFAH 1UQSA 3CMOL 4HLZH 2BSSB 1RIHL 3IDNB 5B38G 1AGFB 2CLVB 3MLTB 3BW9B 4JY6B 5DMKA 3FB7A 5KVFH 4OIIH 4OLWH 5HHOA 1FH5L 4XP6H 4F37F 3TJHD 5J12B 5DJ6A 1HHHA 5C07E 1A64A 1BLNB 2VXTL 3BUYB 3WEXB 3V0WL 4K7PX 1W0VB 2Q76A 1HSBA 2NY3D 3OXRB 4PB9H 5EO9B 4LIQL 4R9HA 1J9CT 1NH6A 1WT5C 3WHE0 5D7IA 4OAWA 4G8EB 4ONHB 4DKEL 2ZG1A 3Q3GB 2H41A 1KJ2L 3CZFA 3N9GH 4U1LA 5FO7A 4KK8C 1JGEA 4WHYG 3VFRB 2PO6D 1JZ6A 2HLFC 4FZEH 4YH6A 3BP7B 3D18B 4MAUH 2DQDH 5IV2A 1DEEA 2IG2L 2O61A 2DDQH 1RZGB 3B2VH 4PREA 1U8OA 5JHLL 5F9WC 4WUUE 1U42A 4OCYH 2X2YA 1KG0B 2N4IA 2ZOLA 4NQDD 2JB6B 4JQVC 5D71H 3I50H 3RDTD 4MAYC 1BWMA 3MV8A 5BJTA 2AJ3A 2Y6SC 2VXUH 1A6WL 5CJQL 1INQA 3V52H 4OF5A 1QG3A 5F96H 1FJ1A 4WFGD 1H3XA 4FG6D 2MWCA 2VZVA 2ZZUT 5GRUH 3B6SA 4R2GB 1R24A 1F13A 1YDPB 3H7LA 4K71B 1L9NA 1WBYB 4J12A 2BY1A 3O45B 3ARPA 4KKBD 5FYJL 2FIRT 2O5XL 5I71B 4ENED 2X4OB 2AEQH 2NLJA 3IRPX 4Z7WA 5T1KA 2GFBB 2YD8A 3QJHB 5DK0B 1PVHA 1P7QB 5D8JL 4JFHE 3T2PA 2VXTH 1JWMA 4ODVL 4G6ML 2L4OA 4KMTL 3OWEA 5C8JA 2V17H 4PGEB 4X4XB 2AXFA 1WITA 3AFLA 3CVHA 5LXGH 1CXIA 4JR9H 4BQ9A 5IG7B 3UTOA 1IILE 2NXYB 3MGTB 5FKAB 2HVJB 2ICWI 3MMEA 1BBJB 5D7JA 2J2ZA 4AEHH 1S5HA 1XIWB 3EOTH 1MNUL 1TVHB 1Z2KA 4Z7UA 3MYJB 3R06B 4OZHF 4J7RA 2Z35A 1LEGB 3MJ7B 1B88A 4FABL 2AABL 2GTZB 4JN2A 4OLYH 4PJEF 2HG5B 5C0AA 4DN3H 5I8KH 1A6VL 2P7TA 1JCKA 1TETL 4DGIL 4HQQL 3ILPB 3LRHA 5KSAC 1N7ML 2BMKB 3JV4B 5KSBF 5EPMB 5C2BL 4MAYD 2R2HB 3WNKA 4UDUB 4OI7A 3KPPB 4J3WA 4L8BB 4NPYA 5F6IB 4N8CH 1XF5B 3L3JB 1TPXC 5FYLH 3BOVA 4FQHA 3CH1A 4J4PD 2VZ3A 3HUJA 5FYLD 1U58B 2W60A 1NMBH 3F58H 4PY7A 4XX1G 5C6TL 2EDBA 3O6FA 4NQEB 5CEXB 1YYLH 3D9AH 4JPVL 3ZTJH 4IS6A 4QF1B 1OQOA 3BWAB 5LGKA 1BJ8A 1N2RA 5CSZA 4EDWH 3BXNB 4UOW1 3F8UB 1NCDL 2EYRA 3F62A 1JF5A 4P2RD 3ULVF 2NR6D 4G42A 4P23B 1CGYA 3BKCL 4P3CL 3RNKA 2FDBP 1B4JH 3KYKL 2WMPA 1BM3H 1X6NA 5ESQB 4F9PA 4L5FH 4IMKA 3IFOB 4PG2C 5C08D 4ISVB 1OWRM 2HT2D 3VFNB 4FZEL 3GSVA 4HIIB 5EU3B 4OFYD 5HI5D 5EWIL 2DKUA 1MLCA 2HLFD 5E24E 1AH1A 3O9WD 2VLJD 1QFUH 2P1YA 2X7LA 3K1KC 3QDGA 4OGAD 5FUCE 3RU8L 1T1ZA 3N1QC 2FHFA 4ONFL 2DI7A 3VG9C 3ARFB 1H3TA 1DUZA 1U95A 1FDLH 3BVNB 3MNVA 4X4ME 3SJVE 1FE8H 1RJZA 4RAVA 3GMLB 4XBGB 5DS8A 1C16A 5B22A 1T2QL 3L5XL 3QPXL 5F7LB 5GGRA 1RUAL 3ARVA 4BSVB 1FO0L 4OT1L 5KVGH 1UB5A 4YQXL 1G0XA 1A3QA 5C3TA 1QBML 2MHAA 2EIEA 1FLRL 4ONGH 2YMXH 2CIKA 3FOMA 4EZMA 2A77H 5D1ZB 1IC5L 1LGVA 32C2B 1P9MA 1PY4A 2RQ8A 2YUWA 2Q6WB 4F8TA 3BYYA 3MLVL 1A7OH 1FBIH 5C0BB 4RFEB 4UDTB 5L0QB 4LLVA 3KNBB 1NUDA 5BQ7A 3JTTA 4APQC 1MVFA 7CGTA 3FAWA 3O6KH 4QRPD 2X4TA 5IBLC 1WQVT 5I1IH 1CF8H 4WTXA 1AO7E 3IFPB 2VLRA 1AE6L 1XIWA 1UENA 5GGVL 2HN7A 4P57A 2APXA 3DTXA 4XNMB 1RJYA 5FGCE 2GIYA 3JV0A 3GI9H 4KJQD 3RVXC 2VKXA 4GQ9H 5A3ID 1DEDA 1DQMH 2VMFA 4M3KB 4FNLL 4UIKL 4YHLH 5FO8A 1MCWW 3I9GL 2OQJA 1VERA 4E42B 1D5BB 2X40A 1OAXL 5CP7B 1G7HB 2LU3A 1EK3A 5A43C 4LGPB 1BMGA 3SY0A 2FWOA 5C0ND 4JAMB 4POZC 4UDUA 4G8FB 3ECBA 4YDKL 2CMRL 3I6LE 3KS0J 4WIQA 4HUWB 4IRZH 1T03L 3QIUA 4NYLA 1DBBL 4B0MM 3RFZC 1UM5L 4LSQH 5J4MA 4PJIE 4HG4K 4KRPC 4XP4H 3A0OA 3KPRE 4L3EA 4NZTH 1RK0B 5CZVH 4R90H 1T22B 3FAXA 5HPMB 1F4YH 1R3LB 2B8OT 4G80B 3HB3D 3VRLF 1T5WB 1OSZA 5F7KC 4ZFOB 2P8LA 2O5YH 5CEZD 2E9JA 3GNML 1NBZB 4X6BB 1UZ6E 4UIMA 1C08B 4EBQH 3CLFH 4HJ0D 4HUMB 4HWBA 5DHYA 4J3OC 4PRIE 4PS4H 4ZSOB 4JKKA 4IMLA 3MLWH 4NT6B 4KMQA 1PDKA 3HE6C 4LVEA 1DBAH 4S1DC 5DVMA 2GJ6B 2Y5TB 1MELA 5J57B 2J1KA 3GRWA 3P77B 4ZSOE 2CKNA 5T1LA 3GM8A 1BD2D 4QXGH 2P8MB 1A3RH 2Q3AA 3MR9B 5CZKA 4GRLA 5EOQH 4HZLA 2E9BA 4UMGA 1G9MC 1WCBB 1FYTA 3GMLA 3MCLH 4M62H 5BMFH 4RGOH 1NL0L 1HINH 2CK0H 2YRZA 5H8DA 1K2DA 1U8MA 3LV3B 43C9B 1NFDF 5LGHH 4I0PD 3NA9H 4S1DD 2E9WA 4ZUUB 1F6AA 4ZUVA 2ZOLB 1AHWC 5FGBA 4FTVB 4U1NA 2XTJD 3U6RB 5BQ7B 1Q94A 3MV8B 1KXVC 4KDTC 1Q9WA 4DQOL 3L95B 2DQEH 1RZFL 1FG2A 2A9NH 3RTQA 2HKHL 3P2TA 1UXSA 5GGSY 3MTRA 3ULSA 3IKCB 1DQJA 3VGAC 4NNYA 4P2YA 1T5XB 1A3RL 4P4KD 1E4XI 5C0FB 2HN7B 4LPCA 1Y18A 4H0HB 2EE3A 2NY7L 1MREL 3FCTB 3T77B 3IF1A 1S9VB 2V2TB 1B2WL 3BP6B 2V9QA 1VA9A 2FSEB 3NGBB 2WBWB 1SJEA 5BV7C 3PUCA 4NN6C 4U3XA 4PJBE 5MI0B 3LN4B 2E7BA 5JNYA 1KIRB 1S7QA 5IFJB 5L2KA 1SJVA 1JGVH 4Q9QL 5IEHA 1RZJL 3DV6B 4GKSB 2ARJA 1SMAA 5GS1B 3CFCH 3O6MH 1D7FA 2G9HB 2LAAA 3O2WL 3QIUD 2P5WD 1LO4H 3QHZL 5DJYA 2YA0A 4K7PY 1A6ZB 4U7KA 4QRRD 1AI1H 5DMYA 3V4VH 4CVUA 3G6DH 2OLDA 3MXVH 2APBA 5GJTL 1R3LA 4YZFF 1AXSA 4ZOCA 3DO7B 4RFNB 3V6OA 3QWOB 3RY6C 4R7NA 1DBBH 1UKTA 5C0JB 3HN3A 2P7TB 4OZFB 2F8VA 3LS4L 2UZYB 4OUOA 3VI3E 4NRYB 5IBLD 3MRKA 4O4YH 3PWPD 2HWZL 4UIMB 3LKNA 1A4KB 3ARWA 3TH3T 5HD8C 4NDMA 3PP3H 2NY2B 4IOFC 3DV4B 3OSKA 4FXKB 5AUMB 4M48L 2BNUA 4YJZL 3IETA 3MJ9L 4NT6A 4D2NA 1HHJB 4GG6B 1N0XH 5DJDA 1QSEA 2GSIA 2BHZA 4JRYA 4URTB 2VC2L 4LMQI 3MV11 5CEXA 4IRSC 3QH3A 1SJXA 2AK1H 4FRWA 5BVJA 4GRLB 1KEML 2CGRL 2VLME 1BD2A 3QBTB 1WFTA 3OKOB 4U1HB 1N2RB 4M3JA 4PJ8A 5CSZB 5I19L 2EYRB 3SQBA 5I1LA 1FYTB 4K55A 2P48B 1HYRC 5GJSH 1VGKB 2HFGH 5C08E 3WFDH 3LDBC 4EIGB 2XQBH 5DFVC 3MLVH 3FQXA 4FQJL 5F1OB 4MD5A 3A67H 1WFNA 3HMXL 3FB8B 3NN8A 4ONGL 4LSTL 3C5JB 4PJBA 2BDNL 2VQ1A 3E6HA 4PG9A 4NKDB 3T2QA 1X5AA 1OF2A 5DYOB 5ITBL 3JWOH 3OKMB 4I0CC 4KKCC 1DE4A 4G6JH 3HNSH 3P0VL 4H26A 3MRJA 3U4BH 3SCMA 2C7UB 3ZDXE 4UBDC 2QSTA 1UXSB 4C83A 4XWGL 1F4XL 2ZSWB 1JPTL 1YYMH 2BNQD 2R9HC 4LLMA 1MWAH 1KN2L 5AZEH 2EZ0D 3U9UB 1YJDH 2JF1A 4XXCA 3CK0H 5GGRB 1QFUL 1CXLA 2P47B 3TH4T 3W9EB 2JB5H 4Q2ZA 1WAAA 3NAAH 1N0LA 3V6OE 3IF1B 3EDKA 3IYLW 1PX3A 2NXZC 1WTLA 1PY9A 4P2QB 4YLQT 4JLRA 1AGBB 1TIUA 2Y7QB 5C0BA 4AYFA 3MJ9A 1ACYH 2FZ3B 3CPLA 1CN4A 2P8PA 5LBSH 2Q86A 2BOCB 3VJ6B 5B4MD 1FGVH 1DBKH 2A9MH 2X4TB 3W11D 1GJIA 1J88A 2MFNA 3DX8A 4OV6F 4D9LH 1TZGL 5HVHB 1Q9OB 1EUTA 5I16B 3P9WB 4DFIA 3U0WL 4LHUD 5DQDH 3SDDB 1L0XA 1SBSH 4KPHH 5HYQA 4X9FA 5JDSB 2AQ1A 3U30C 2UY6A 3DUUB 3VXUD 4LCYB 3DO7A 2GQHA 1QLEL 3FO2B 4MA3A 3VFGL 2VLMD 1QSFE 4UTBH 3HLAB 1OGAA 4G9FB 4UB0L 5HHMD 1XF2B 1N4XH 5IFAL 3DX6A 2EDJA 3EDEA 2F53D 3ZKMD 4JJHA 5IW6A 4M1CC 1JP5A 3W11C 3C09B 5DDHA 1URLA 3FO0L 1OW0C 5JXED 4IRSA 4PRIA 5D7JD 3WJLA 3O3BA 2QSQA 3IETB 2A83A 2EDYA 3DBXA 4YIQA 4NCDA 2XFXA 5J6GA 5IIEB 1EVUA 5DWUH 3B43A 3TPKA 5JW4Q 1BBDH 3BGFC 4QOKB 3RGVB 3LAFA 3W5MA 2IH1B 4DFHA 2DIJA 2M2DA 1TDQA 4U1HA 1NEZG 3ARGB 1UJTA 1H5BC 4U3HA 3R1GH 3UYOD 2R29L 4IDLA 3V7MA 4N5EC 5LXGL 3AAZA 1KCSH 3FN0H 1NBZA 3BMWA 3DWTA 5JORB 4XB8A 3D85A 1A9EB 4WI4A 1MIML 1AD0B 3ZE2F 4GSDH 3PGDB 5IFHL 3TWCL 3DRQB 4L4TA 3UC0L 3SKMA 4LQFL 5EC2B 2CK2A 2C1PA 3S35X 1OF2B 5DYOA 1ZHLA 4HGKC 5DEZA 1A6PA 1IC7H 4KI5C 4M4RA 5KJRL 1L4IA 1W72A 3ZE0E 3T0AA 5IB3B 2H8PA 4PV8B 1CL7I 5DFVD 4WFGE 4ELMF 4MD0A 3EYOA 1QKZH 4AG4H 3BRGC 1N8ZA 1WC7B 2VXUL 5I1JH 2W9EH 3D85D 4S2SB 3EO1A 1BZQK 5F97E 3OX8B 4PRHA 1QFWI 5DO2D 3ARRA 4PY8I 4ZAKA 1DN0A 1EEYA 4LU5H 3WO4C 2FLBT 4PJEE 3SDCD 5DJZA 1MRDL 4OCYL 1OM3H 3H9SD 4HF5H 2DQTL 1P84K 2ZUXA 1TTFA 3ZYIA 5FO7B 1JV5B 2D4FA 3RY4A 2AGJH 3PIQB 1S7RA 1W0WA 3VWJB 1RHHA 3ARGD 4H20L 1YMMD 5L9DL 5I30L 1K6QH 4XVUC 3RTQB 4WUKH 5I6XC 4QRQB 5FF6A 3DGGA 3KG5A 3OPZH 1KPVB 1JFQL 4LVNB 1JPST 1OVZA 4TOYH 4QYOB 2E27H 2FYYA 4TRPL 4G7YH 4FP8L 3X14B 2W0FB 1A14H 1BREA 1RK1A 1MJ7L 3BX7C 3SGJC 1KEGL 4QY8A 1N3NA 5HGHA 4HUXB 4KUZL 1PYWB 3WXVH 1DVFB 3BEWB 2EDWA 5C1MB 3M17A 2IQ9H 1NFDB 3ROOB 1SJEB 2H26B 5FDYA 5BVPH 1PAMA 4CU7A 3GSXA 5CAYB 1HWGB 1J0HA 1VFAB 4J6RL 4PJFA 2YBRB 1U9KA 4H8WH 2Y9RT 3QIWD 2XA8H 5ID0A 3ISWA 2X4OA 2WNGA 2QHRL 1AXIB 1JJUA 5GS1A 4JO4H 1BQSA 1NGWB 3WXWL 5ERWB 5HD8D 3M07A 4RDQF 4EDXB 1L0QA 4XPAH 5IIEA 4NWUH 1ZT4B 1CFQB 4HKZB 3TIDA 3I84A 3VXSB 3KWWB 3MRDB 4X6FA 5C9JB 3CVHB 3CXHJ 1P2CB 1IAOA 2HT2C 3SE4A 1HIMH 5H35B 5LAXA 2BRQA 2MTPA 1BECA 1LK2B 1TMCB 4N90E 3HZYB 3AB0C 1OAUL 5HHPB 2Z0BA 5GGSA 1JF1B 4HC1L 1U93B 2QQLL 3R06A 1I8LC 3IFNH 4GBXD 4MLSA 4NOFA 1A7PH 1T0PB 3NFNB 1A1MA 2BSRB 5IWLA 4JZOA 2VISA 5L8KB 4LPWA 2H6PB 1Q72L 3PHQB 1V7ML 3KHOA 3NCEB 5C0AD 3JV4A 3DRQA 4DCQA 5SWSB 3BP5B 3WMSA 2C1PB 4KK9D 1RURH 25C8L 4H1LG 1UB6A 4S1RL 5F72S 1E28A 1W72B 1XF5A 3L3JA 4NFDA 4L1DA 4OLZH 4G6AD 5BS0B 4P5TD 1HILB 3G04A 5ACZA 3PWLA 2FECI 4POYA 2EIDA 2C4FT 4RMSA 4WU5B 4U1MB 3W81A 1R3HA 3EUUA 4NQEA 2X42A 4NZJA 5DUPL 4NZUH 3BWAA 4E5XA 4UQ2B 1D5MB 3FQXB 4TULL 3G5XA 4YAQB 3I02B 1WF5A 3QXDB 4PJHB 4MD5B 2QLVB 2BVYA 4XXDB 1KJ3H 5BZDB 2B1HL 4P4RA 2DBLL 1FL6A 4PJFE 4TSBH 4IOSD 3U2SB 2X1XR 1S7XA 1HHKB 3IFOA 3WFZA 5BW7C 3EIFA 5EU5A 5D7KE 3CFJA 4C83B 1U6AL 2P24B 2WW8A 2DIAA 4WI6A 3QUXC 1S7WA 5KSAA 2FYYB 2MJWA 4DJMA 2X7LB 4KGLA 4NQXB 5CD3A 5GS1C 3BO8B 4RMRA 3S34H 4Q6IA 1N3NB 5EBMA 2J4WL 3HI5L 1BWWA 2QTEA 2VDQH 1PX4A 1GAFL 2VQUA 3X13A 1HN1A 1LO0H 4LLQA 5J12C 3VDBA 5GRVK 1QSEE 1QEWA 2YOCA 5AYQA 4P2QA 2V5TA 2CH8A 4M6AA 2EE6A 1A0QH 1I75A 1MHHA 1KBGH 2D0GA 4XCEA 1M1SA 5KN5A 1KBGL 3WUZA 4JFDD 2VN4A 3GEWB 1BIIA 5T3ZE 1L7TL 2OSLB 1DVFC 4JZJB 4CW1A 5C7XL 4U1KB 5F6HJ 1B90A 1OTUC 3W39A 3P9MB 4HKZA 3RVXD 3L3GB 1ZSDA 2AQ3A 4NQCB 1M71B 4ZD3L 3TJHC 2P5EE 4AM0B 3BJLA 2XA8L 4XPGH 3ZHDA 1IRAY 1QR4A 2Y23A 4PJDB 3UBXA 1F4HA 1TVBA 2HTKC 2R0WH 2VXQL 3IFPA 4G8GA 4Z7VE 5CLWA 5IQ7L 4DK6A 5ISZB 1G7PB 4UT9H 3QZWA 4FFYL 5KZCD 1T7WA 2NY4D 3EFFB 3PGCB 2RAMA 4HIEB 4L4VE 1GGBH 2N1KA 2R2BB 1KCUH 3H42L 4M93C 3DETD 1KYOK 2Y5EA 1Z9MA 4OM1H 4GRMA 1D5BA 4LCCB 5FYKD 5D6DC 3QQ3A 4LCUB 4BFIB 1SQ2N 1QVOB 1T83C 4XCYA 3D6GA 2CO7B 1XF1A 1DQLL 5DQ9B 2Z9TA 3QEGL 3T2NL 3RGVA 1JTPA 4LASL 4F9LA 4R4ND 4D94A 3AY4A 3U9PL 2QQKH 1YEHH 4G8IB 3KPOB 1DUYA 1YN6A 3ULVC 2E8ZA 1BEYL 2XKNB 4KI5F 4U6XB 3S96A 4P46A 3I6GB 4CBPA 5IM7A 2XZQH 4K7FB 4X7CC 3AAZB 1OSPH 1GZQB 2AJVL 3ULUC 1GGIL 5CILL 3RHWF 2X9WA 2AERT 4M5ZH 2XT1B 3WIIH 2B2XL 1X5LA 5FB8A 2UWEA 3RWEB 1IZJA 3UJTL 4L4TB 1DQQB 5DD0H 3L7FB 4XP1L 2ADIA 1FL6B 3B8SA 3RP1A 3DSFL 3U79A 1E27A 4EOWH 4WHDA 2V5SA 1KJMB 1QTYT 2QQLH 4Y5YC 1WWBX 5DJ0B 1KNOA 3PHOA 2A2QT 4MX7B 4WFFE 4XCCL 1IEHA 2KZ1B 2ZUWA 3S5LA 2NY1D 2UVEA 3TWCH 3BN9C 3UZEA 1MF2H 3TM6A 1UM4L 3OAZK 1TQBB 4GBXB 5DD1L 5T1LB 1TPXB 1DN2A 3B9AA 4DVRL 1HSAB 2WWMC 1ZWIA 4HPYH 3MBEB 3X13B 1JHLH 2MCPH 1GHFH 2DQCL 4NM4H 5B8CC 2R29H 1EMTL 3PQYE 3O8XC 4Y16D 5F1NA 4NKIH 2AKRB 4Y2OA 1KB5B 2DAVA 2VE6A 5D7IE 1AGDA 2DLIA 3K8KA 3RWDB 4XXCC 5F88B 5EZLA 5MERA 3E2HC 5J89A 3X14A 1BZ7B 3U6RA 1I3RB 4AIZA 1R5VA 5AAWA 1JUFB 3JTSA 4JO3L 3KPSB 2H45A 3QUYA 3HE7B 1JL8A 4ERSL 2WUCL 5HGHB 5L2JB 1A2YB 3PNWA 3GMQA 4PJDA 3UBXB 1OAYH 4WDIB 2HJKB 5I0DA 1WWAX 3M17B 3BIKB 1NFDA 4X80L 1JFQH 4NNYB 3TCLA 4GG6F 3NIDF 5C0FA 3Q1SL 2ESVD 2DQGL 1K5NA 5CUSL 5F9JA 3RVVD 3VH8A 1KB9K 1RZ8A 3G5VA 2ADJB 3QI9A 4HPYL 2XKSA 5DI8A 4CADA 4WV1C 4LSUL 1JGUL 1CGTA 2F53E 4U6YB 1K9TA 2FSEA 4GRMB 3VFOB 4CJ1A 3KPRB 1SBSL 4KPHL 4WEMB 4NP4H 4Y4HD 3VXOB 4JFXB 1KPUA 3VRIB 1P4IH 4ZXBC 3N1FC 2FX9L 4OSUH 3VXSA 1S7QB 3QDGD 5HHVH 5IFJA 2PW2A 1S9YA 3GJEB 2NXZD 4A6YA 2HVKA 3S35H 1YN6B 2AK4E 5E7FA 2X41A 4XPTH 1IC4L 15C8L 3D69A 1YN7A 3GGWA 5L0QC 1J1XL 4ZNEA 3WE6B 3GSQA 4MJIE 1I7TB 2NTSP 5CGMA 4RAUA 2JB5L 3GJFA 1ZXQA 3V8CA 1TZHA 1Q8MA 3JWDL 3QWOA 4N1EA 4XNZC 2ENSA 2J7LA 3WNOA 4QRRE 3RWEA 1MWAL 3IJHA 4K3GA 4OF3A 4DCQB 3MRRB 2P43B 5BO1H 3SKJH 4KZDL 4G3YL 2CRZA 2EDOA 5L7XH 1MFEL 4HGWB 5IVZA 5EUOB 3FOLB 3RRQA 4WNQA 4U1JA 2XWBA 3HI6H 3QI9D 3U9PH 2VJXA 3L7EB 3O3EB 2OTPA 5ITBH 4XC3H 4OCXL 3BW9A 4ODSH 4G9FE 2A0LD 3TT3L 2BNQE 4LP4A 3FZUC 4FFVC 4E41B 4DN4L 3H3BC 4LNRB 3VCLA 1R3HB 4GBXA 3ZKQD 4UINL 1R3JA 2OCFD 4DZBA 3OZ9L 2EH7H 4HS8H 3CCHB 6FABH 3TIEB 5A3IC 4LARH 1RZKC 3QPQD 1GGTA 1YUHA 3BISA 5F6IC 5IB5B 5LQBL 1FSKB 5FYJD 1H0DB 2R0WL 5K33A 5CGTA 5IV2B 5F3BB 1EA9C 4XPBL 2O61B 2AAVA 3QXUA 1CG9A 1ERNA 1TQBC 1U92B 4GBXC 1JYNA 5EU5B 3BH8A 4PV9B 2MQCA 1XGPA 4HWEH 1QYGL 4I5BA 4S1SL