4LSHA

Ion selectivity of ompf porin soaked in 0.2m kbr
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
340
structure length
335
Chain Sequence
AEIGNKVDLYGKAVGLHYFSKGGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein F
publication title A structural study of ion permeation in OmpF porin from anomalous X-ray diffraction and molecular dynamics simulations.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 98
structure length 335
sequence length 340
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4lshA00
3SZVA 3UU2A 3A2SX 4GCQA 2XE2A 7PRNA 2PRNA 2XE1A 3VZUX 3FYXA 3POQA 3K19A 2XE3A 1OSMA 2ODJA 1GFMA 2XE5A 5DL7A 5DL6A 4LSHA 3WI5A 2Y0HA 1HXXA 4D65A 3SYSA 5JDPA 1GFPA 3NSGA 4FMSA 4FT6A 2PORA 1GFQA 4C69X 1GFNA 3EMNX 4GCPA 3SYBA 3VZTX 4FOZA 2Y0LA 3JTYA 3T20A 5DL5A 3HWBA 3T24A 3VY9X 1MPFA 1GFOA 4KR4A 1PHOA 1OPFA 4D64A 4AUIA 2O4VA 2ZLDA 1BH3A 1HXTA 3SY9A 1E54A 3VZWX 4JFBA 5FVNA 4FRXA 4LSEA 3HW9A 3UPGA 3PRNA 2J1NA 3T0SA 1H6S1 3VY8X 3O0EA 2ZFGA 2Y2XA 4LSIA 2FGRA 3SY7A 4FSPA 4LSFA 4BUMX 4GCSA 2XG6A 3PORA 3POXA 4FSOA 1BT9A 2OMFA 3POUA 4D5UA 4FRTA 1HXUA 1PRNA 2K4TA 5PRNA 4KRAA 2J4UP 3SZDA 2Y0KA 4RJXA 6PRNA 2QTKA 5DL8A 3WI4A 8PRNA 4RJWA 4KR8A 2FGQX
chains in the Genus database with same CATH superfamily
2F1TA 3SZVA 3UU2A 1G90A 3A2SX 1BXWA 3DA3A 4GCQA 2XE2A 3PQSA 4E1SA 4PUXA 7PRNA 2PRNA 1YS5A 3WU2O 4FUVA 5AFUL 3JCUO 2XE1A 3VZUX 3FYXA 5AFUK 4O4UA 3AAEB 5G39A 3AAAB 5D5DA 4AKMA 3DA4A 4AFKA 4N74A 3BS0A 3POQA 2ERVA 1S5LO 2IWVA 2M07A 3K19A 2XE3A 3DWOX 5T5FA 1OSMA 2KZ7B 2GE4A 4FZLA 4AKRB 4AYDC 4AYMC 2LHFA 2ODJA 1ZHWA 2R4PA 4XNKA 1GFMA 2XE5A 5DL7A 3VE2A 3QRAA 5DL6A 3LK42 4FQEA 4LSHA 2X27X 3WI5A 1T1LA 2Y0HA 1HXXA 2FGQX 4O3XB 4D65A 2IWWA 4RL9A 3SYSA 4XNLA 1GFPA 5JDPA 5B5EO 3NSGA 4FMSA 4C4VA 4FT6A 5IYUA 2PORA 1GFQA 3AA0A 4C69X 1GFNA 1MM5A 3EMNX 5G26A 2WVPA 4GCPA 4AYEC 3PGRA 3SYBA 4GF4A 4G76A 3VZTX 3LK2A 4PJ0O 2JMMA 2YPVA 3AA6B 2Y0LA 3AA7A 3BRZA 4FOZA 4PR7A 4QQ1A 5E79O 3JTYA 3T20A 2KDYA 5DL5A 5GTIO 4UB8O 3C5OA 3HWBA 3T24A 1MM4A 1GFOA 1MPFA 4N59A 2KXPB 4KR4A 1PHOA 3VY9X 3PGUA 3NJTA 4O4XA 4JCHA 2K0LA 1OPFA 4E1TA 4U9CA 2M06A 1Q9GA 2N2MA 4O3YA 4C4VB 4D64A 1T16A 2MNHA 2WJRA 3V8UA 3AA0B 5H2FO 2XTRA 4AUIA 2XTQA 5GV0A 2O4VA 2W81C 4K3BA 2ZLDA 5B66O 5GTHO 4O49A 3UAQA 4AYNA 5ADXK 1THQA 1BH3A 3A0BO 1HXTA 3LK2B 3SY9A 3AA1A 3AA7B 4IL6O 1ZHYA 4RLBA 2N2LA 2W80C 1E54A 2Y7SA 3LK41 2XMXA 3PGSA 4G75A 1ZHTA 3TZGA 3VZWX 4JFBA 5FVNA 4FRXA 4K3CA 4LSEA 4O3ZA 4FESA 3HW9A 1ZHZA 3RBHA 2R88A 3UPGA 4FZNA 3LK3A 2MHLA 3PRNA 4RLCA 2J1NA 2LFUA 3AAAA 3AAEA 3BRYA 2F1VA 3PQUA 3GP6A 4B61A 4AYID 1QJPA 3T0SA 1H6S1 3VY8X 3G7GA 1ZHXA 2JQYA 2ZFGA 3O0EA 8PRNA 4CTDA 4GHBA 3DZMA 1ORMA 5KAFO 2Y2XA 4LSIA 2FGRA 3SY7A 4FSPA 4AZLA 3HOLA 3AA1B 4LSFA 2R4OA 4BUMX 1QJ9A 4C00A 4GCSA 2AXTO 2YNKA 3HOEA 2WJQA 1IZNA 1QJ8A 5ADXL 4N75A 2XG6A 5TISO 3PORA 3PF1A 3POXA 4FSOA 1BT9A 2OMFA 4UB6O 3POUA 4D5UA 3LK3B 4Z3TA 2R4LA 3A0HO 4O3WA 1P4TA 3AA6A 2X9KA 1HXUA 3KZIO 1PRNA 4FRTA 2K4TA 5PRNA 4KRAA 3KVDD 5G3AA 2R8AA 2F1CX 5G38A 2J4UP 3SZDA 3QRCA 2KXPA 5EE2A 2Y0KA 4RJXA 4N58A 2R89A 4FZMA 3VE1A 3DWNA 2KZ7A 4AKRA 5KAIO 6PRNA 2QTKA 5DL8A 3WI4A 4F4BA 2KC0A 1Q9FA 4RJWA 1IZNB 4KR8A 2R4NA
chains in the Genus database with same CATH topology
2F1TA 3SZVA 3UU2A 1G90A 3A2SX 1BXWA 3DA3A 4GCQA 2XE2A 3PQSA 4E1SA 4PUXA 7PRNA 2PRNA 1YS5A 4FUVA 5AFUL 2XE1A 3VZUX 3FYXA 5AFUK 4O4UA 3AAEB 4AKMA 3AAAB 5D5DA 3DA4A 4AFKA 3POQA 2ERVA 2M07A 3K19A 2XE3A 5T5FA 1OSMA 2KZ7B 2GE4A 4FZLA 4AKRB 4AYMC 2LHFA 2ODJA 1ZHWA 4XNKA 1GFMA 2XE5A 5DL7A 3VE2A 3QRAA 5DL6A 3LK42 4LSHA 2X27X 3WI5A 2Y0HA 1HXXA 4O3XB 4D65A 4RL9A 3SYSA 4XNLA 1GFPA 5JDPA 3NSGA 4FMSA 5IYUA 4FT6A 2PORA 1GFQA 3AA0A 4C69X 1GFNA 1MM5A 3EMNX 5G26A 4AYEC 4GCPA 3SYBA 4GF4A 4G76A 3VZTX 3LK2A 2JMMA 2YPVA 3AA6B 2Y0LA 3AA7A 4FOZA 4QQ1A 3JTYA 3T20A 2KDYA 5DL5A 4AYDC 3C5OA 3HWBA 3T24A 1MM4A 1GFOA 1MPFA 4N59A 2KXPB 4KR4A 1PHOA 3VY9X 4O4XA 4JCHA 2K0LA 1OPFA 4E1TA 4U9CA 2M06A 1Q9GA 2N2MA 4O3YA 4D64A 2MNHA 3V8UA 3AA0B 2XTRA 4AUIA 2XTQA 5GV0A 2O4VA 2W81C 2ZLDA 4O49A 3UAQA 4AYNA 5ADXK 1THQA 1BH3A 1HXTA 3LK2B 3SY9A 3AA1A 3AA7B 1ZHYA 4RLBA 2N2LA 2W80C 1E54A 2Y7SA 3LK41 2XMXA 4G75A 3TZGA 1ZHTA 3VZWX 4JFBA 5FVNA 4FRXA 4O3ZA 4LSEA 4FESA 3HW9A 1ZHZA 3RBHA 3UPGA 4FZNA 3LK3A 2MHLA 3PRNA 4RLCA 2J1NA 2LFUA 3AAAA 3AAEA 3PQUA 2F1VA 3GP6A 4B61A 4AYID 1QJPA 3T0SA 1H6S1 3VY8X 3G7GA 1ZHXA 3O0EA 2ZFGA 8PRNA 4GHBA 1ORMA 2Y2XA 4LSIA 2FGRA 3SY7A 4FSPA 4AZLA 3HOLA 3AA1B 4LSFA 4BUMX 1QJ9A 4GCSA 2YNKA 3HOEA 1IZNA 1QJ8A 5ADXL 2XG6A 3PORA 3POXA 4FSOA 1BT9A 2OMFA 3POUA 4D5UA 3LK3B 4Z3TA 4O3WA 1P4TA 3AA6A 4FRTA 1HXUA 1PRNA 2K4TA 5PRNA 4KRAA 3KVDD 2J4UP 3SZDA 3QRCA 2KXPA 5EE2A 2Y0KA 4RJXA 4N58A 4FZMA 3VE1A 2KZ7A 4AKRA 6PRNA 2QTKA 5DL8A 3WI4A 4F4BA 2KC0A 1Q9FA 4RJWA 1IZNB 4KR8A 2FGQX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SZV A;  3UU2 A;  3A2S X;  4GCQ A;  2XE2 A;  7PRN A;  2PRN A;  2XE1 A;  3VZU X;  3FYX A;  3POQ A;  3K19 A;  2XE3 A;  1OSM A;  2ODJ A;  1GFM A;  2XE5 A;  5DL7 A;  5DL6 A;  4LSH A;  3WI5 A;  2Y0H A;  1HXX A;  4D65 A;  3SYS A;  5JDP A;  1GFP A;  3NSG A;  4FMS A;  4FT6 A;  2POR A;  1GFQ A;  4C69 X;  1GFN A;  3EMN X;  4GCP A;  3SYB A;  3VZT X;  4FOZ A;  2Y0L A;  3JTY A;  3T20 A;  5DL5 A;  3HWB A;  3T24 A;  3VY9 X;  1MPF A;  1GFO A;  4KR4 A;  1PHO A;  1OPF A;  4D64 A;  4AUI A;  2O4V A;  2ZLD A;  1BH3 A;  1HXT A;  3SY9 A;  1E54 A;  3VZW X;  4JFB A;  5FVN A;  4FRX A;  4LSE A;  3HW9 A;  3UPG A;  3PRN A;  2J1N A;  3T0S A;  1H6S 1;  3VY8 X;  3O0E A;  2ZFG A;  2Y2X A;  4LSI A;  2FGR A;  3SY7 A;  4FSP A;  4LSF A;  4BUM X;  4GCS A;  2XG6 A;  3POR A;  3POX A;  4FSO A;  1BT9 A;  2OMF A;  3POU A;  4D5U A;  4FRT A;  1HXU A;  1PRN A;  2K4T A;  5PRN A;  4KRA A;  2J4U P;  3SZD A;  2Y0K A;  4RJX A;  6PRN A;  2QTK A;  5DL8 A;  3WI4 A;  8PRN A;  4RJW A;  4KR8 A;  2FGQ X; 
#chains in the Genus database with same CATH topology
 2F1T A;  3SZV A;  3UU2 A;  1G90 A;  3A2S X;  1BXW A;  3DA3 A;  4GCQ A;  2XE2 A;  3PQS A;  4E1S A;  4PUX A;  7PRN A;  2PRN A;  1YS5 A;  3WU2 O;  4FUV A;  5AFU L;  3JCU O;  2XE1 A;  3VZU X;  3FYX A;  5AFU K;  4O4U A;  3AAE B;  5G39 A;  3AAA B;  5D5D A;  4AKM A;  3DA4 A;  4AFK A;  4N74 A;  3BS0 A;  3POQ A;  2ERV A;  1S5L O;  2IWV A;  2M07 A;  3K19 A;  2XE3 A;  3DWO X;  5T5F A;  1OSM A;  2KZ7 B;  2GE4 A;  4FZL A;  4AKR B;  4AYD C;  4AYM C;  2LHF A;  2ODJ A;  1ZHW A;  2R4P A;  4XNK A;  1GFM A;  2XE5 A;  5DL7 A;  3VE2 A;  3QRA A;  5DL6 A;  3LK4 2;  4FQE A;  4LSH A;  2X27 X;  3WI5 A;  1T1L A;  2Y0H A;  1HXX A;  2FGQ X;  4O3X B;  4D65 A;  2IWW A;  4RL9 A;  3SYS A;  4XNL A;  1GFP A;  5JDP A;  5B5E O;  3NSG A;  4FMS A;  4C4V A;  4FT6 A;  5IYU A;  2POR A;  1GFQ A;  3AA0 A;  4C69 X;  1GFN A;  1MM5 A;  3EMN X;  5G26 A;  2WVP A;  4GCP A;  4AYE C;  3PGR A;  3SYB A;  4GF4 A;  4G76 A;  3VZT X;  3LK2 A;  4PJ0 O;  2JMM A;  2YPV A;  3AA6 B;  2Y0L A;  3AA7 A;  3BRZ A;  4FOZ A;  4PR7 A;  4QQ1 A;  5E79 O;  3JTY A;  3T20 A;  2KDY A;  5DL5 A;  5GTI O;  4UB8 O;  3C5O A;  3HWB A;  3T24 A;  1MM4 A;  1GFO A;  1MPF A;  4N59 A;  2KXP B;  4KR4 A;  1PHO A;  3VY9 X;  3PGU A;  3NJT A;  4O4X A;  4JCH A;  2K0L A;  1OPF A;  4E1T A;  4U9C A;  2M06 A;  1Q9G A;  2N2M A;  4O3Y A;  4C4V B;  4D64 A;  1T16 A;  2MNH A;  2WJR A;  3V8U A;  3AA0 B;  5H2F O;  2XTR A;  4AUI A;  2XTQ A;  5GV0 A;  2O4V A;  2W81 C;  4K3B A;  2ZLD A;  5B66 O;  5GTH O;  4O49 A;  3UAQ A;  4AYN A;  5ADX K;  1THQ A;  1BH3 A;  3A0B O;  1HXT A;  3LK2 B;  3SY9 A;  3AA1 A;  3AA7 B;  4IL6 O;  1ZHY A;  4RLB A;  2N2L A;  2W80 C;  1E54 A;  2Y7S A;  3LK4 1;  2XMX A;  3PGS A;  4G75 A;  1ZHT A;  3TZG A;  3VZW X;  4JFB A;  5FVN A;  4FRX A;  4K3C A;  4LSE A;  4O3Z A;  4FES A;  3HW9 A;  1ZHZ A;  3RBH A;  2R88 A;  3UPG A;  4FZN A;  3LK3 A;  2MHL A;  3PRN A;  4RLC A;  2J1N A;  2LFU A;  3AAA A;  3AAE A;  3BRY A;  2F1V A;  3PQU A;  3GP6 A;  4B61 A;  4AYI D;  1QJP A;  3T0S A;  1H6S 1;  3VY8 X;  3G7G A;  1ZHX A;  2JQY A;  2ZFG A;  3O0E A;  8PRN A;  4CTD A;  4GHB A;  3DZM A;  1ORM A;  5KAF O;  2Y2X A;  4LSI A;  2FGR A;  3SY7 A;  4FSP A;  4AZL A;  3HOL A;  3AA1 B;  4LSF A;  2R4O A;  4BUM X;  1QJ9 A;  4C00 A;  4GCS A;  2AXT O;  2YNK A;  3HOE A;  2WJQ A;  1IZN A;  1QJ8 A;  5ADX L;  4N75 A;  2XG6 A;  5TIS O;  3POR A;  3PF1 A;  3POX A;  4FSO A;  1BT9 A;  2OMF A;  4UB6 O;  3POU A;  4D5U A;  3LK3 B;  4Z3T A;  2R4L A;  3A0H O;  4O3W A;  1P4T A;  3AA6 A;  2X9K A;  1HXU A;  3KZI O;  1PRN A;  4FRT A;  2K4T A;  5PRN A;  4KRA A;  3KVD D;  5G3A A;  2R8A A;  2F1C X;  5G38 A;  2J4U P;  3SZD A;  3QRC A;  2KXP A;  5EE2 A;  2Y0K A;  4RJX A;  4N58 A;  2R89 A;  4FZM A;  3VE1 A;  3DWN A;  2KZ7 A;  4AKR A;  5KAI O;  6PRN A;  2QTK A;  5DL8 A;  3WI4 A;  4F4B A;  2KC0 A;  1Q9F A;  4RJW A;  1IZN B;  4KR8 A;  2R4N A; 
#chains in the Genus database with same CATH homology
 2F1T A;  3SZV A;  3UU2 A;  1G90 A;  3A2S X;  1BXW A;  3DA3 A;  4GCQ A;  2XE2 A;  3PQS A;  4E1S A;  4PUX A;  7PRN A;  2PRN A;  1YS5 A;  4FUV A;  5AFU L;  2XE1 A;  3VZU X;  3FYX A;  5AFU K;  4O4U A;  3AAE B;  4AKM A;  3AAA B;  5D5D A;  3DA4 A;  4AFK A;  3POQ A;  2ERV A;  2M07 A;  3K19 A;  2XE3 A;  5T5F A;  1OSM A;  2KZ7 B;  2GE4 A;  4FZL A;  4AKR B;  4AYM C;  2LHF A;  2ODJ A;  1ZHW A;  4XNK A;  1GFM A;  2XE5 A;  5DL7 A;  3VE2 A;  3QRA A;  5DL6 A;  3LK4 2;  4LSH A;  2X27 X;  3WI5 A;  2Y0H A;  1HXX A;  4O3X B;  4D65 A;  4RL9 A;  3SYS A;  4XNL A;  1GFP A;  5JDP A;  3NSG A;  4FMS A;  5IYU A;  4FT6 A;  2POR A;  1GFQ A;  3AA0 A;  4C69 X;  1GFN A;  1MM5 A;  3EMN X;  5G26 A;  4AYE C;  4GCP A;  3SYB A;  4GF4 A;  4G76 A;  3VZT X;  3LK2 A;  2JMM A;  2YPV A;  3AA6 B;  2Y0L A;  3AA7 A;  4FOZ A;  4QQ1 A;  3JTY A;  3T20 A;  2KDY A;  5DL5 A;  4AYD C;  3C5O A;  3HWB A;  3T24 A;  1MM4 A;  1GFO A;  1MPF A;  4N59 A;  2KXP B;  4KR4 A;  1PHO A;  3VY9 X;  4O4X A;  4JCH A;  2K0L A;  1OPF A;  4E1T A;  4U9C A;  2M06 A;  1Q9G A;  2N2M A;  4O3Y A;  4D64 A;  2MNH A;  3V8U A;  3AA0 B;  2XTR A;  4AUI A;  2XTQ A;  5GV0 A;  2O4V A;  2W81 C;  2ZLD A;  4O49 A;  3UAQ A;  4AYN A;  5ADX K;  1THQ A;  1BH3 A;  1HXT A;  3LK2 B;  3SY9 A;  3AA1 A;  3AA7 B;  1ZHY A;  4RLB A;  2N2L A;  2W80 C;  1E54 A;  2Y7S A;  3LK4 1;  2XMX A;  4G75 A;  3TZG A;  1ZHT A;  3VZW X;  4JFB A;  5FVN A;  4FRX A;  4O3Z A;  4LSE A;  4FES A;  3HW9 A;  1ZHZ A;  3RBH A;  3UPG A;  4FZN A;  3LK3 A;  2MHL A;  3PRN A;  4RLC A;  2J1N A;  2LFU A;  3AAA A;  3AAE A;  3PQU A;  2F1V A;  3GP6 A;  4B61 A;  4AYI D;  1QJP A;  3T0S A;  1H6S 1;  3VY8 X;  3G7G A;  1ZHX A;  3O0E A;  2ZFG A;  8PRN A;  4GHB A;  1ORM A;  2Y2X A;  4LSI A;  2FGR A;  3SY7 A;  4FSP A;  4AZL A;  3HOL A;  3AA1 B;  4LSF A;  4BUM X;  1QJ9 A;  4GCS A;  2YNK A;  3HOE A;  1IZN A;  1QJ8 A;  5ADX L;  2XG6 A;  3POR A;  3POX A;  4FSO A;  1BT9 A;  2OMF A;  3POU A;  4D5U A;  3LK3 B;  4Z3T A;  4O3W A;  1P4T A;  3AA6 A;  4FRT A;  1HXU A;  1PRN A;  2K4T A;  5PRN A;  4KRA A;  3KVD D;  2J4U P;  3SZD A;  3QRC A;  2KXP A;  5EE2 A;  2Y0K A;  4RJX A;  4N58 A;  4FZM A;  3VE1 A;  2KZ7 A;  4AKR A;  6PRN A;  2QTK A;  5DL8 A;  3WI4 A;  4F4B A;  2KC0 A;  1Q9F A;  4RJW A;  1IZN B;  4KR8 A;  2FGQ X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...