4LSHA

Ion selectivity of ompf porin soaked in 0.2m kbr
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
340
structure length
335
Chain Sequence
AEIGNKVDLYGKAVGLHYFSKGGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural study of ion permeation in OmpF porin from anomalous X-ray diffraction and molecular dynamics simulations.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Outer membrane protein F
total genus 98
structure length 335
sequence length 340
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4lshA00
4FSPA 5DL5A 2Y0LA 2OMFA 4D5UA 4FRTA 4FOZA 3T0SA 2ZLDA 1OPFA 2PRNA 2XE1A 3T20A 1GFMA 6PRNA 4KRAA 2K4TA 2XE3A 3UPGA 3POUA 4C69X 1PHOA 3PRNA 1BT9A 4AUIA 3UU2A 1GFNA 2Y0HA 3SYBA 2XE2A 3JTYA 3SY9A 3SZVA 5JDPA 5DL8A 1BH3A 2XE5A 3VZTX 1HXTA 3SZDA 3VZWX 2O4VA 4RJWA 3O0EA 4RJXA 3POXA 1GFPA 3K19A 2PORA 4GCPA 5DL7A 8PRNA 4D64A 5DL6A 4LSEA 3PORA 4FRXA 4KR4A 1GFOA 4GCSA 3EMNX 3VZUX 2FGQX 3SYSA 1HXXA 1E54A 5FVNA 4LSFA 2J4UP 3NSGA 2Y2XA 1HXUA 3A2SX 4JFBA 3VY9X 2QTKA 1OSMA 2XG6A 4D65A 3SY7A 3FYXA 4KR8A 2ODJA 7PRNA 1GFQA 2J1NA 4FMSA 3T24A 1MPFA 4LSHA 4FT6A 2FGRA 3HWBA 4LSIA 3HW9A 3WI5A 3WI4A 3VY8X 1PRNA 4BUMX 2Y0KA 4FSOA 4GCQA 5PRNA 1H6S1 2ZFGA 3POQA
chains in the Genus database with same CATH superfamily
4FSPA 5DL5A 4FZMA 2Y0LA 2OMFA 3BRYA 1ORMA 4FRTA 4D5UA 5T5FA 3LK3A 1T16A 4FOZA 3T0SA 2ZLDA 3AA6A 3DZMA 2LFUA 1OPFA 4AYNA 2KXPB 1S5LO 2PRNA 2XE1A 3QRAA 2KZ7A 4Z3TA 4FUVA 4N58A 3T20A 3G7GA 2JMMA 4IL6O 1GFMA 6PRNA 3AAEB 4KRAA 2K4TA 2KDYA 2MHLA 4O3ZA 1THQA 2R89A 4PR7A 2M06A 4E1SA 2XE3A 3UPGA 4GF4A 5GTHO 3POUA 4C69X 1PHOA 2XTQA 4RLCA 4UB6O 1ZHXA 3PRNA 1BT9A 4AUIA 4XNLA 4CTDA 3UU2A 3VE1A 1GFNA 5ADXL 2Y0HA 2F1VA 4O4XA 3PGSA 3SYBA 2XE2A 2XMXA 3JTYA 4RL9A 2R8AA 2F1TA 1QJPA 3LK42 2KXPA 4FQEA 2M07A 5IYUA 3SY9A 7PRNA 3TZGA 3SZVA 3BRZA 4K3CA 2JQYA 3AAAA 3DA4A 5JDPA 2WVPA 5DL8A 5G39A 1BH3A 3VE2A 2XE5A 2N2MA 2X27X 5GTIO 3VZTX 1HXTA 5D5DA 3SZDA 3LK2A 1QJ8A 3VZWX 2O4VA 1BXWA 3C5OA 4RJWA 2KC0A 3O0EA 5E79O 1MM4A 4RJXA 3POXA 1GFPA 4F4BA 4FESA 4E1TA 3AA1B 2PORA 3K19A 3AA6B 4GCPA 1QJ9A 4FZLA 5DL7A 1YS5A 8PRNA 3GP6A 1Q9GA 3RBHA 2R4OA 3WU2O 4D64A 3PQSA 1IZNA 2X9KA 5DL6A 3AAEA 4LSEA 3PORA 3UAQA 4AKMA 5H2FO 2N2LA 1ZHZA 4O3WA 2W81C 4FRXA 3A0BO 4KR4A 2MNHA 1GFOA 3DA3A 4N75A 5KAIO 3KZIO 4GCSA 3EMNX 4GHBA 4O49A 4U9CA 4C00A 2ERVA 3VZUX 4FZNA 2FGQX 2W80C 3AA0A 3AA7B 2R4PA 3SYSA 1ZHTA 1T1LA 1HXXA 3DWNA 4JCHA 5AFUK 2WJRA 2YPVA 1E54A 4N74A 4AYDC 3KVDD 2Y7SA 1IZNB 4XNKA 5FVNA 4G75A 4LSFA 4C4VA 3AAAB 3LK3B 3JCUO 2J4UP 4AYMC 3NSGA 3HOEA 2Y2XA 3NJTA 4PUXA 1HXUA 3HOLA 5TISO 3A2SX 3LK2B 4JFBA 2QTKA 1OSMA 3VY9X 4AFKA 1ZHYA 4AZLA 3PGUA 2XG6A 5B5EO 4D65A 2F1CX 4O4UA 2R88A 3SY7A 5B66O 2R4NA 3FYXA 4KR8A 2GE4A 3A0HO 4AYID 2ODJA 3AA0B 3AA1A 1GFQA 2J1NA 4G76A 5AFUL 4AKRA 2LHFA 4FMSA 4B61A 3T24A 2WJQA 2XTRA 1MPFA 1ZHWA 3PGRA 4FT6A 4LSHA 5G38A 3V8UA 2FGRA 3HWBA 2IWWA 4N59A 4C4VB 4LSIA 3HW9A 3PQUA 3DWOX 1P4TA 4O3XB 3WI5A 3WI4A 5KAFO 4QQ1A 5G26A 3LK41 4PJ0O 4AYEC 3VY8X 1PRNA 4BUMX 2R4LA 2KZ7B 5G3AA 5GV0A 2Y0KA 1Q9FA 1G90A 3PF1A 4FSOA 4GCQA 4UB8O 5ADXK 2AXTO 5PRNA 2YNKA 2IWVA 5EE2A 2K0LA 1MM5A 4K3BA 1H6S1 3AA7A 4O3YA 3QRCA 4RLBA 2ZFGA 4AKRB 3BS0A 3POQA
chains in the Genus database with same CATH topology
4FSPA 5DL5A 4FZMA 2Y0LA 2OMFA 1ORMA 4FRTA 4D5UA 5T5FA 3LK3A 4FOZA 3T0SA 2ZLDA 3AA6A 2LFUA 1OPFA 4AYNA 2KXPB 2PRNA 2XE1A 3QRAA 2KZ7A 4Z3TA 4FUVA 4N58A 3T20A 3G7GA 2JMMA 1GFMA 6PRNA 3AAEB 4KRAA 2K4TA 2KDYA 2MHLA 4O3ZA 1THQA 2M06A 4E1SA 2XE3A 3UPGA 4GF4A 3POUA 4C69X 1PHOA 2XTQA 4RLCA 1ZHXA 3PRNA 1BT9A 4AUIA 4XNLA 3UU2A 3VE1A 1GFNA 5ADXL 2Y0HA 2F1VA 4O4XA 3SYBA 2XE2A 2XMXA 3JTYA 4RL9A 2F1TA 1QJPA 3LK42 2KXPA 2M07A 5IYUA 3SY9A 7PRNA 3TZGA 3SZVA 3AAAA 3DA4A 5JDPA 5DL8A 1BH3A 3VE2A 2XE5A 2N2MA 2X27X 3VZTX 1HXTA 5D5DA 3SZDA 3LK2A 1QJ8A 3VZWX 2O4VA 1BXWA 3C5OA 4RJWA 2KC0A 3O0EA 1MM4A 4RJXA 3POXA 1GFPA 4F4BA 4FESA 4E1TA 3AA1B 2PORA 3K19A 3AA6B 4GCPA 1QJ9A 4FZLA 5DL7A 1YS5A 8PRNA 3GP6A 1Q9GA 3RBHA 4D64A 3PQSA 1IZNA 5DL6A 3AAEA 4LSEA 3PORA 3UAQA 4AKMA 2N2LA 1ZHZA 4O3WA 2W81C 4FRXA 4KR4A 2MNHA 1GFOA 3DA3A 4GCSA 3EMNX 4GHBA 4O49A 4U9CA 2ERVA 3VZUX 4FZNA 2FGQX 2W80C 3AA0A 3AA7B 3SYSA 1ZHTA 5AFUK 1HXXA 4JCHA 4AYDC 2YPVA 1E54A 3KVDD 2Y7SA 1IZNB 4XNKA 5FVNA 4G75A 4LSFA 3AAAB 3LK3B 2J4UP 4AYMC 3NSGA 3HOEA 2Y2XA 4PUXA 1HXUA 3HOLA 3A2SX 3LK2B 4JFBA 2QTKA 1OSMA 3VY9X 4AFKA 1ZHYA 4AZLA 2XG6A 4D65A 3SY7A 4O4UA 3FYXA 4KR8A 2GE4A 4AYID 2ODJA 3AA0B 3AA1A 1GFQA 2J1NA 4G76A 5AFUL 4AKRA 2LHFA 4FMSA 4B61A 3T24A 2XTRA 1MPFA 1ZHWA 4LSHA 4FT6A 3V8UA 2FGRA 3HWBA 4N59A 4LSIA 3HW9A 3PQUA 1P4TA 4O3XB 3WI5A 3WI4A 4QQ1A 5G26A 3LK41 4AYEC 3VY8X 1PRNA 4BUMX 2KZ7B 5GV0A 2Y0KA 1Q9FA 1G90A 4FSOA 4GCQA 5ADXK 5PRNA 2YNKA 5EE2A 2K0LA 1MM5A 1H6S1 3AA7A 4O3YA 3QRCA 4RLBA 2ZFGA 4AKRB 3POQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FSP A;  5DL5 A;  2Y0L A;  2OMF A;  4D5U A;  4FRT A;  4FOZ A;  3T0S A;  2ZLD A;  1OPF A;  2PRN A;  2XE1 A;  3T20 A;  1GFM A;  6PRN A;  4KRA A;  2K4T A;  2XE3 A;  3UPG A;  3POU A;  4C69 X;  1PHO A;  3PRN A;  1BT9 A;  4AUI A;  3UU2 A;  1GFN A;  2Y0H A;  3SYB A;  2XE2 A;  3JTY A;  3SY9 A;  3SZV A;  5JDP A;  5DL8 A;  1BH3 A;  2XE5 A;  3VZT X;  1HXT A;  3SZD A;  3VZW X;  2O4V A;  4RJW A;  3O0E A;  4RJX A;  3POX A;  1GFP A;  3K19 A;  2POR A;  4GCP A;  5DL7 A;  8PRN A;  4D64 A;  5DL6 A;  4LSE A;  3POR A;  4FRX A;  4KR4 A;  1GFO A;  4GCS A;  3EMN X;  3VZU X;  2FGQ X;  3SYS A;  1HXX A;  1E54 A;  5FVN A;  4LSF A;  2J4U P;  3NSG A;  2Y2X A;  1HXU A;  3A2S X;  4JFB A;  3VY9 X;  2QTK A;  1OSM A;  2XG6 A;  4D65 A;  3SY7 A;  3FYX A;  4KR8 A;  2ODJ A;  7PRN A;  1GFQ A;  2J1N A;  4FMS A;  3T24 A;  1MPF A;  4LSH A;  4FT6 A;  2FGR A;  3HWB A;  4LSI A;  3HW9 A;  3WI5 A;  3WI4 A;  3VY8 X;  1PRN A;  4BUM X;  2Y0K A;  4FSO A;  4GCQ A;  5PRN A;  1H6S 1;  2ZFG A;  3POQ A; 
#chains in the Genus database with same CATH topology
 4FSP A;  5DL5 A;  4FZM A;  2Y0L A;  2OMF A;  3BRY A;  1ORM A;  4FRT A;  4D5U A;  5T5F A;  3LK3 A;  1T16 A;  4FOZ A;  3T0S A;  2ZLD A;  3AA6 A;  3DZM A;  2LFU A;  1OPF A;  4AYN A;  2KXP B;  1S5L O;  2PRN A;  2XE1 A;  3QRA A;  2KZ7 A;  4Z3T A;  4FUV A;  4N58 A;  3T20 A;  3G7G A;  2JMM A;  4IL6 O;  1GFM A;  6PRN A;  3AAE B;  4KRA A;  2K4T A;  2KDY A;  2MHL A;  4O3Z A;  1THQ A;  2R89 A;  4PR7 A;  2M06 A;  4E1S A;  2XE3 A;  3UPG A;  4GF4 A;  5GTH O;  3POU A;  4C69 X;  1PHO A;  2XTQ A;  4RLC A;  4UB6 O;  1ZHX A;  3PRN A;  1BT9 A;  4AUI A;  4XNL A;  4CTD A;  3UU2 A;  3VE1 A;  1GFN A;  5ADX L;  2Y0H A;  2F1V A;  4O4X A;  3PGS A;  3SYB A;  2XE2 A;  2XMX A;  3JTY A;  4RL9 A;  2R8A A;  2F1T A;  1QJP A;  3LK4 2;  2KXP A;  4FQE A;  2M07 A;  5IYU A;  3SY9 A;  7PRN A;  3TZG A;  3SZV A;  3BRZ A;  4K3C A;  2JQY A;  3AAA A;  3DA4 A;  5JDP A;  2WVP A;  5DL8 A;  5G39 A;  1BH3 A;  3VE2 A;  2XE5 A;  2N2M A;  2X27 X;  5GTI O;  3VZT X;  1HXT A;  5D5D A;  3SZD A;  3LK2 A;  1QJ8 A;  3VZW X;  2O4V A;  1BXW A;  3C5O A;  4RJW A;  2KC0 A;  3O0E A;  5E79 O;  1MM4 A;  4RJX A;  3POX A;  1GFP A;  4F4B A;  4FES A;  4E1T A;  3AA1 B;  2POR A;  3K19 A;  3AA6 B;  4GCP A;  1QJ9 A;  4FZL A;  5DL7 A;  1YS5 A;  8PRN A;  3GP6 A;  1Q9G A;  3RBH A;  2R4O A;  3WU2 O;  4D64 A;  3PQS A;  1IZN A;  2X9K A;  5DL6 A;  3AAE A;  4LSE A;  3POR A;  3UAQ A;  4AKM A;  5H2F O;  2N2L A;  1ZHZ A;  4O3W A;  2W81 C;  4FRX A;  3A0B O;  4KR4 A;  2MNH A;  1GFO A;  3DA3 A;  4N75 A;  5KAI O;  3KZI O;  4GCS A;  3EMN X;  4GHB A;  4O49 A;  4U9C A;  4C00 A;  2ERV A;  3VZU X;  4FZN A;  2FGQ X;  2W80 C;  3AA0 A;  3AA7 B;  2R4P A;  3SYS A;  1ZHT A;  1T1L A;  1HXX A;  3DWN A;  4JCH A;  5AFU K;  2WJR A;  2YPV A;  1E54 A;  4N74 A;  4AYD C;  3KVD D;  2Y7S A;  1IZN B;  4XNK A;  5FVN A;  4G75 A;  4LSF A;  4C4V A;  3AAA B;  3LK3 B;  3JCU O;  2J4U P;  4AYM C;  3NSG A;  3HOE A;  2Y2X A;  3NJT A;  4PUX A;  1HXU A;  3HOL A;  5TIS O;  3A2S X;  3LK2 B;  4JFB A;  2QTK A;  1OSM A;  3VY9 X;  4AFK A;  1ZHY A;  4AZL A;  3PGU A;  2XG6 A;  5B5E O;  4D65 A;  2F1C X;  4O4U A;  2R88 A;  3SY7 A;  5B66 O;  2R4N A;  3FYX A;  4KR8 A;  2GE4 A;  3A0H O;  4AYI D;  2ODJ A;  3AA0 B;  3AA1 A;  1GFQ A;  2J1N A;  4G76 A;  5AFU L;  4AKR A;  2LHF A;  4FMS A;  4B61 A;  3T24 A;  2WJQ A;  2XTR A;  1MPF A;  1ZHW A;  3PGR A;  4FT6 A;  4LSH A;  5G38 A;  3V8U A;  2FGR A;  3HWB A;  2IWW A;  4N59 A;  4C4V B;  4LSI A;  3HW9 A;  3PQU A;  3DWO X;  1P4T A;  4O3X B;  3WI5 A;  3WI4 A;  5KAF O;  4QQ1 A;  5G26 A;  3LK4 1;  4PJ0 O;  4AYE C;  3VY8 X;  1PRN A;  4BUM X;  2R4L A;  2KZ7 B;  5G3A A;  5GV0 A;  2Y0K A;  1Q9F A;  1G90 A;  3PF1 A;  4FSO A;  4GCQ A;  4UB8 O;  5ADX K;  2AXT O;  5PRN A;  2YNK A;  2IWV A;  5EE2 A;  2K0L A;  1MM5 A;  4K3B A;  1H6S 1;  3AA7 A;  4O3Y A;  3QRC A;  4RLB A;  2ZFG A;  4AKR B;  3BS0 A;  3POQ A; 
#chains in the Genus database with same CATH homology
 4FSP A;  5DL5 A;  4FZM A;  2Y0L A;  2OMF A;  1ORM A;  4FRT A;  4D5U A;  5T5F A;  3LK3 A;  4FOZ A;  3T0S A;  2ZLD A;  3AA6 A;  2LFU A;  1OPF A;  4AYN A;  2KXP B;  2PRN A;  2XE1 A;  3QRA A;  2KZ7 A;  4Z3T A;  4FUV A;  4N58 A;  3T20 A;  3G7G A;  2JMM A;  1GFM A;  6PRN A;  3AAE B;  4KRA A;  2K4T A;  2KDY A;  2MHL A;  4O3Z A;  1THQ A;  2M06 A;  4E1S A;  2XE3 A;  3UPG A;  4GF4 A;  3POU A;  4C69 X;  1PHO A;  2XTQ A;  4RLC A;  1ZHX A;  3PRN A;  1BT9 A;  4AUI A;  4XNL A;  3UU2 A;  3VE1 A;  1GFN A;  5ADX L;  2Y0H A;  2F1V A;  4O4X A;  3SYB A;  2XE2 A;  2XMX A;  3JTY A;  4RL9 A;  2F1T A;  1QJP A;  3LK4 2;  2KXP A;  2M07 A;  5IYU A;  3SY9 A;  7PRN A;  3TZG A;  3SZV A;  3AAA A;  3DA4 A;  5JDP A;  5DL8 A;  1BH3 A;  3VE2 A;  2XE5 A;  2N2M A;  2X27 X;  3VZT X;  1HXT A;  5D5D A;  3SZD A;  3LK2 A;  1QJ8 A;  3VZW X;  2O4V A;  1BXW A;  3C5O A;  4RJW A;  2KC0 A;  3O0E A;  1MM4 A;  4RJX A;  3POX A;  1GFP A;  4F4B A;  4FES A;  4E1T A;  3AA1 B;  2POR A;  3K19 A;  3AA6 B;  4GCP A;  1QJ9 A;  4FZL A;  5DL7 A;  1YS5 A;  8PRN A;  3GP6 A;  1Q9G A;  3RBH A;  4D64 A;  3PQS A;  1IZN A;  5DL6 A;  3AAE A;  4LSE A;  3POR A;  3UAQ A;  4AKM A;  2N2L A;  1ZHZ A;  4O3W A;  2W81 C;  4FRX A;  4KR4 A;  2MNH A;  1GFO A;  3DA3 A;  4GCS A;  3EMN X;  4GHB A;  4O49 A;  4U9C A;  2ERV A;  3VZU X;  4FZN A;  2FGQ X;  2W80 C;  3AA0 A;  3AA7 B;  3SYS A;  1ZHT A;  5AFU K;  1HXX A;  4JCH A;  4AYD C;  2YPV A;  1E54 A;  3KVD D;  2Y7S A;  1IZN B;  4XNK A;  5FVN A;  4G75 A;  4LSF A;  3AAA B;  3LK3 B;  2J4U P;  4AYM C;  3NSG A;  3HOE A;  2Y2X A;  4PUX A;  1HXU A;  3HOL A;  3A2S X;  3LK2 B;  4JFB A;  2QTK A;  1OSM A;  3VY9 X;  4AFK A;  1ZHY A;  4AZL A;  2XG6 A;  4D65 A;  3SY7 A;  4O4U A;  3FYX A;  4KR8 A;  2GE4 A;  4AYI D;  2ODJ A;  3AA0 B;  3AA1 A;  1GFQ A;  2J1N A;  4G76 A;  5AFU L;  4AKR A;  2LHF A;  4FMS A;  4B61 A;  3T24 A;  2XTR A;  1MPF A;  1ZHW A;  4LSH A;  4FT6 A;  3V8U A;  2FGR A;  3HWB A;  4N59 A;  4LSI A;  3HW9 A;  3PQU A;  1P4T A;  4O3X B;  3WI5 A;  3WI4 A;  4QQ1 A;  5G26 A;  3LK4 1;  4AYE C;  3VY8 X;  1PRN A;  4BUM X;  2KZ7 B;  5GV0 A;  2Y0K A;  1Q9F A;  1G90 A;  4FSO A;  4GCQ A;  5ADX K;  5PRN A;  2YNK A;  5EE2 A;  2K0L A;  1MM5 A;  1H6S 1;  3AA7 A;  4O3Y A;  3QRC A;  4RLB A;  2ZFG A;  4AKR B;  3POQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...