4LSLB

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj476), a non-nucleoside inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
428
structure length
417
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 103
structure length 417
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lslB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslB03
5J2QB 4O4RA 3QIDA 4GC7A 4IG0A 3I0RA 4G1QA 3DM2A 4KHMA 2IC3A 4F4WA 3Q8SB 4KBIA 1RT2A 3CJ4A 2D3UA 3MR2A 1IKXB 4J9LA 4IDKA 4KKOA 4U6PA 2WCXA 2ASDA 4KSEB 1IKYA 4DEZA 2WK4A 3OLBA 2FLPA 3OL7A 3JYTA 4ED3A 4ZMMA 2ZD1A 1XR7A 5DG7A 5F8LA 3GQCA 4ECXA 2HWIA 2R2TA 1VRUA 1BQNA 2DPJA 2RDIA 3KMQA 4I7FA 3I5AA 4IG3A 5L1LA 5K14B 2IJFA 3G6YA 4K50A 1FK9B 5HLFB 1HPZB 4NLYA 4RNHA 2BQ3A 1HQEA 3QYYA 4H54A 1TL1B 1DTQA 1LWFB 3IGNA 1RA6A 2VG5B 4ED7A 4ECTA 4ICLA 3NL0A 1LW0A 3JSMB 3QZ8A 1TKTA 2YNHA 4Q0BB 4EYHB 4ECSA 3BJYA 4JV2A 3MEDA 1RT5B 4NLQA 2V0NA 1HMVA 3KK1A 2RKIA 5KFTA 4ZVGA 4TQRA 2JLEA 2WOMB 5KFPA 4R0EA 1C0TA 3H5XA 2OPRA 1RTJA 3OHBA 3H5UA 5CYMA 4EYIB 3DYAB 3MEGB 3RBEA 3DLEA 4DG1B 1EETA 3BSNA 2I5JA 4URGA 4RNOA 1ZETA 5KT2A 1HQUA 2V9WA 3H40A 1TKXA 2UVWA 3GIIA 1N48A 3LANA 3BREA 1FKOB 2JC0A 3NMAA 1HYSB 3DOLB 2ZE2A 4J9QA 1KHWA 2R2RA 4ZPBA 3BQ2A 1SV5B 3IG1A 1W25A 1RT3B 5KFSA 2OH2A 4QWAA 3RB4A 4MIAA 3DLKA 1U09A 1S9EA 3IS9B 3CDEA 3BQ0A 3M8PB 3PVXA 4ZVHA 1JLBA 1BQMB 2YNIB 4NCGB 4DL4A 3KK3A 5KFIA 4RW4A 3CWJA 3NBPA 2OPSB 5JXSA 3QIPA 2JEIA 5KT5A 1S1WB 4F4YA 4EO6A 1NHUA 5CYQB 2B6AB 3V4IB 1N5YA 4R5PB 3QZ7A 1S1VB 4ZPAA 4TQSA 3DRSA 2RDJA 5KG4A 5C25A 2BRKA 4YMEA 4K4VA 3IRXB 3KMSA 5J1EB 5DLFA 4K4ZA 2HNZA 1S9GA 1RT4A 4KFBA 1R0AB 4ZPCA 3TAMA 4TY9A 1RAJA 3FFIA 4NLTA 4ZPDA 2V4RA 3C6TB 5F9LA 1TKZB 3H98A 2F8EX 3T1AA 4ECZA 3BGRB 1IKVB 2UVVA 3H5YA 4KV8B 4QW8A 4NLUA 3OL6A 4RU9A 1S1XA 2IJNA 3SI8A 3BR9A 4PWDA 3MF5A 5F8MA 3PR4A 1OS5A 4Q45A 4DL2A 2UVUA 5HP1B 2WB4A 4Y34A 4QW9A 4HKQA 4FBTA 2FJVA 4RNMA 1JLFA 3V6DB 2W8LA 1TV6A 1N6QA 1DLOB 4O4GB 3IGVA 4YR2A 1JLCA 3Q8QB 2YKMA 3KJVA 5KG2A 4B3OA 5KFAA 4G3IA 3RAXA 1HNVB 4O44A 1S97A 4O3RA 3M8QB 2ZKUA 2RF2B 2OPPA 3CJ3A 1LWCB 4WE1B 5I3UB 2YNFA 4TYBA 3V6KA 3DOKB 1NNDA 2UUWA 4ZP9A 4QWBA 1K1QA 3KLEA 3GIMA 1HNIA 1SH0A 3HVTA 1TL3A 3QLHA 4JV0A 1VRTA 5KFLA 2BANB 4URSA 4MFBA 1TVRB 3DRPA 1KLMB 4IFVA 3N6LA 3KLIB 2V4QA 1RDRA 4J9KA 4NLDA 5L1KA 4WYLA 1LW2B 4J9MA 1JLQA 2FLNA 5D3GA 1T03A 4IH7A 5KT7A 3PZPA 3RB6A 2IM0A 4K4UA 3E01B 1Z4UA 3EPGA 5C24B 2XWYA 3FDSA 2IAJA 4ZP7A 3C6UB 2XCPA 3QGIA 4TYAA 3M9OB 3H4BA 1IKWB 3N6NA 4QPXA 3H4DA 2C22A 1T05A 4K4XA 1DTTA 2HNYA 3QGGA 4O3PA 5J2PA 2BE2A 2OPQB 3KK2A 1LWEB 5J2QA 3PJXA 4MK8A 4U7CA 3T5KA 4WZQA 4KE5A 4TN2A 4I2PB 5KFQA 5KFDA 3KHHA 4J9OA 3KLFA 4O3NA 5F8NA 2WONA 1S6QA 4RW9B 4ECVA 4K4SA 2W9CB 2HMIB 5DLGA 1S49A 1RTIB 1JLEB 4RW8B 4DL7A 3MFIA 4MKAA 4MKBA 4YQWA 3DLGB 4ID5B 3QO9B 5J2MB 3SFUA 5C5JA 5KFFA 3KHGA 3G6XA 4H4MA 5FDLB 4I2QB 2CKWA 4IRDA 4ZHRB 3KLHA 3UDLA 3UQSA 1RTDA 1MU2A 1QE1B 1K1SA 3CVKA 3UR0A 1FK9A 5HLFA 4IG0B 4YR3A 3I0RB 4G1QB 3DM2B 3LP0A 1RT2B 4TY8A 3MTKA 3T5LA 4KKOB 4Y3CA 1RYRA 4J9PA 4IR1A 1IKYB 2B5JB 3JSMA 1C1BA 3DI6A 3MEEA 1S1UA 2ZD1B 4IRCA 4F4XA 3I5BA 1RT5A 2C2RA 1VRUB 1BQNB 3ITHA 1JKHA 5KFKA 4I7FB 2D7SA 4IG3B 1N56A 1I6JA 2J6SA 4RNNA 3PW7A 1HQEB 4ZVFA 1DTQB 2D3ZA 2E9TA 4ECUA 4ICLB 2GIQA 1LW0B 2FVCA 3KOAA 4J9RA 2W8KA 1S10A 1HYSA 4JUZA 2AGOA 5J2NB 2XCAA 1T3NA 3KK1B 2RKIB 1RA7A 4K4WA 2BQRA 1RTHA 2VG6A 4IFYA 1CSJA 2O5DA 1C0TB 5KFXA 2FVQA 1RTJB 4ED2A 3UPFA 2I1RA 4RW7A 5L1IA 1KHVA 4EEYA 4DL3A 2I5JB 3V6JA 3OLAA 4DL6A 2YNIA 1HQUB 1RYSA 3CJ0A 5DQHA 1TKXB 5KFZA 2ATLA 3ICLA 2W9AA 2IBKA 3MR3A 2FLLA 5F8JA 1S1WA 3TQ1A 5JUMA 2ZE2B 4IOBA 1S6PB 5CYQA 1IM4A 2B6AA 3V4IA 3RB0A 4R5PA 4FBUA 2EC0A 1RT7A 5KG5A 3GV7B 2R8KA 5HBMA 3DDKA 3OSPA 4LQ3A 1RT1A 5L1JA 1REVB 3LP1A 3VQSA 5DG8A 5KFUA 3FRZA 3IRXA 1S9EB 4LSLA 1SUQA 2YKNB 2AU0A 1RT6A 2BRLA 1R0AA 2BR0A 2R8GA 2VG7A 4NLVA 4TLRA 4RW4B 3T19A 4ZP8A 3G86A 3M9NB 3KLGB 3T5JA 2AQ4A 1TQLA 5KFYA 3QIPB 1ZTTA 2IM3A 4WFYA 1NHVA 5HROA 5EDWA 4PUOB 4O3QA 4NZ0A 3CDWA 4ECYA 1HARA 5C42B 3MR5A 4WFXA 1C1CA 5EUHA 1QAJA 2ASLA 3BQ1A 2CJQA 3MECB 3NAHA 5C25B 4NLWA 4PQUA 2HNDA 4QWEA 1S9GB 3PR5B 1RT4B 1FKPA 4KHRA 5I42A 3TAMB 4R8UA 3FFIB 1C2PA 2B43A 2UUTA 5KG6A 4ED0A 1S0MA 4O4GA 4YP3A 2IMWP 3TVKA 1HNVA 2GIRA 4RW6A 4H4OA 2FVRA 3EPIA 1J5OB 4WE1A 2AGQA 1C0UA 3BSOA 5EWEA 4PWDB 5KG1A 3DOKA 3V81A 3D5MA 2D41A 3CJ2A 2ALZA 3LP2A 3DRRA 2IM1A 4LQ9A 5DQIA 2HWHA 1XR6A 5KFWA 4XO0A 5KG3A 3I0SA 1D1UA 3DMJA 4KO0A 2ILYA 2BANA 1JLFB 5DG9A 2J6TA 1TV6B 3NAIA 1N6QB 5F8IA 3OSNA 2R8HA 2YKMB 2DPIA 1JLAB 3KJVB 4B3OB 3OHAA 2VA3A 2YNGA 4O44B 1UWBA 3PW0A 2R2UA 4LSNB 4Q8EA 3H2LA 4IH5A 3E01A 1WNEA 2YNFB 3KNAA 4ED6A 3KLEB 1JIHA 4NLOA 1JLGB 1HNIB 1IKWA 3HVTB 4NRTA 3QLHB 1S1TA 4MH8A 2XGQA 2JC1A 2W9BB 2R8JA 1VRTB 1S9FA 2XGPA 4Q8FA 4MFBB 3DRPB 4NLRA 4RUAA 1IKXA 3V6HA 4K4YA 3KHLA 5KFHA 4NLSA 4RW9A 4Y2AA 4F50A 4RW8A 5D3GB 4WXWA 1TP7A 2W7OA 3DLGA 4ID5A 2FVPA 2XI3A 3GV5B 1EP4B 2IAJB 3GYNA 4O3OA 4I2QA 4IR9A 1GX6A 1T05B 5K14A 2HNYB 1YVFA 3FSIA 3BSAA 3H5SA 3CJ5A 1HPZA 1QE1A 2BE2B 5J2PB 3KK2B 2R8IA 4ED8A 2C2EA 2IC3B 4MK9A 3RBDA 1S0OA 4FS2A 5F8HA 1TL1A 4IDKB 1LWFA 2FVSA 3KLFB 3PW5A 4QWDA 2VG5A 2WONB 1S6QB 3D28A 4OL8A 3MR6A 2WRMA 2B5JA 4Q0BA 2JEJA 3JYTB 3CO9A 2WHOA 4WYWA 2AGPA 1JX4A 5KG7A 5T14A 3HVWA 4IH6A 3PW2A 2WOMA 4H4MB 2FJXA 3KLHB 3PW4A 5KG0A 3H59A 3PJWA 1RTDB 5KFCA 1MU2B 3DYAA 3MEGA 2QV6A 3NKYA 4ZP6A 3LALA 5KFRA 4DG1A 3LP0B 2AX1A 4K4TA 4TY8B 1SH2A 4WFZA 4ED1A 4KAIA 4ECRA 1TKTB 2YNHB 1C1BB 3DI6B 3MEEB 1FKOA 5KFMA 1S0NA 1S1UB 3MEDB 3DOLA 1MMLA 1HMVB 4URQU 5J2NA 1SV5A 2W7PA 3ITHB 1JKHB 1RT3A 2GC8A 5EWFA 4QWCA 4X2BA 5DGBA 2OPRB 4TXSA 3MFHA 5KFBA 2JEGA 5CYMB 3GIKA 3DLEB 3IS9A 5KT3A 1EETB 3M8PA 2R2SA 1GX5A 1BQMA 4NCGA 5KFVA 3GILA 2AWZA 3RB3A 5KFEA 2OPSA 4F4ZA 3OL8A 3Q8PB 2QE5A 5L9XA 3OL9A 1S6PA 4XPEA 1S1VA 3IG1B 5KT4A 4GC6A 1RTHB 2VG6B 4IFYB 3IN5A 2JEFA 5DQGA 4ZVEA 3EZUA 1REVA 3DLKB 5J1EA 4RW7B 3GIJA 2YKNA 4RUCA 1JLBB 3ISND 3PHEA 4MK7A 3M9MB 3KK3B 3C6TA 3ISNC 1S48A 1TKZA 5KFOA 2FJWA 3NBPB 2UVRA 3KLGA 3BGRA 4EBEA 1IKVA 4KV8A 4YR0A 4PUOA 1N5YB 5KFJA 4ECWA 3T5HA 3LAMA 2AX0A 3DRSB 1RT7B 5C42A 2XC9A 3G6VA 2BQUA 4M95A 2HAIA 5HBMB 3MECA 1QUVA 1RT1B 3LP1B 5F9NA 2ILZA 5HP1A 1QAIA 2HNZB 3RAQA 4LSLB 1SUQB 5KT6A 4KFBB 1RT6B 3V6DA 1N4LA 4RNFA 5F8GA 3Q8RB 2VG7B 1DLOA 4NYZA 4MIBA 3NGDA 3BSCA 3QGHA 3M8QA 3E51A 5KFNA 5HROB 2RF2A 2E9ZA 3I5CA 1LWCA 1S1XB 1D0EA 2C2DA 5I3UA 2IM2A 1J5OA 1C1CB 4EO8A 2C28A 4M94A 4Y2CA 4IQXA 4DL5A 4PQUB 2HNDB 4NLPA 4WXOA 1TVRA 4ECQA 1KLMA 1FKPB 2WTFA 3KLIA 2E9RX 1JXLA 5I42B 3CIZA 3HVAA 4R8UB 3KLVA 1JLCB 3KHRA 1ZTWA 3FQKA 3HKWA 1JLAA 1LW2A 3CDUA 1SH3A 4XPCA 5KFGA 4RZRA 4RW6B 2OPPB 4H4OB 4LSNA 1S4FA 3SFGA 5C24A 1C0UB 5DGAA 3C6UA 1XR5A 3V81B 4NLXA 1TL3B 4EBCA 3LP2B 1JLGA 3DRRB 4Q43A 3GV8B 2W9BA 2OPQA 4KB7A 1LWEA 3I0SB 3FQLA 3DMJB 4IFVB 4KO0B 4HYKA 4NRUA 1T94A 4I2PA 2J6UA 2VA2A 4WZMA 2W9CA 2HMIA 1JLQB 1JLEA 1RTIA 2YNGB 1T03B 2XI2A 4Q44A 1UWBB 3QO9A 5J2MA 3N6MA 3HHKA 4JV1A 4O3SA 2ASJA 4J9NA 2IA6A 4NLGA 1EP4A 3LAKA 5FDLA 4IKAA 5EWGA 4ZHRA 4IRKA 1DTTB 4EBDA 1S1TB 4J9SA 4FS1A
chains in the Genus database with same CATH superfamily
4MKVA 4GC7A 4FDFA 2EBEA 5HSPA 1PGZA 2Y9HA 2N3LA 3OLBA 3QJLA 1XR7A 2BJ7A 3KNGA 3P4UB 4I7FA 1HPZB 3GSDA 3ZXWA 4QR0A 4DQIA 3NCQA 4MYTA 5IV3A 3KK1A 3ETOA 3H5UA 5SUHA 2X7IA 4DS4A 1AFJA 1HQUA 2OP5A 1HWJA 3GIIA 3PHTA 3LANA 5GMDA 2RD5C 3ILLA 1T9VA 4KY3A 4WP8A 3R7SB 2GS8A 2VONA 1N5YA 4WWSA 2A6MA 2Q66A 4S0MA 2BRKA 2CJ9A 1X5SA 3PEHA 4FP9A 2IRUA 3M2UB 3HHLD 1OPIA 3ENVA 3IMQJ 2WBRA 4HHUA 3ENQA 4OX6A 3BGRB 1SC1B 3JXOA 3H5YA 3JS9A 3SI8A 5A8RB 3KUGA 1XTZA 1VHIA 2HG4A 4M63A 2H1YA 3MMCA 5J1PA 1O8BA 3RAXA 1S97A 5A76A 5B7WA 2VL1A 1CEZA 3QGPA 1VLYA 3MM9B 1RDRA 1IBMF 4J9MA 3OXLA 4P2SA 2YPYA 2B9EA 3DLHA 3QGIA 4YY3J 2C22A 2F40A 1WDDA 3D66A 5KFQA 1IM6A 3LF0A 3H2VE 1S49A 2A6OA 2HVIA 2HVZA 1M1GA 5KFFA 3G6XA 4CT9A 5A8KA 5E7OB 4YR3A 4ZVTB 1RT2B 3A8EA 3K2YA 1RWNB 1P9QC 1VJQA 5I3QA 1HNXF 3MEEA 1NSPA 1VISA 1Q81T 2IMOA 3IR5B 4LF1A 1EX8A 1FRIA 3QT6A 3FZBA 2XCAA 4F2RA 2XO7A 5D0EA 4MIWA 4ED2A 1KHVA 1N32F 5KFZA 2WVEA 3RB0A 2I6WA 2R8KA 3CB4A 3FRZA 4WK3A 3DDNA 2BRLA 1FRMA 4X4QA 3EX7B 2KXHA 3QRRA 1NHVA 2BZ2A 1OPZA 3FK4A 4OHVA 5C42B 2ASLA 3FBEA 2GGPB 2DNPA 2PC6A 2XO6A 4KR0B 2X3GA 2LQ8A 4PWDB 4LBPA 3LPEA 4PYAA 2D41A 2ALZA 3GYGA 4CDIA 3OSNA 1F2GA 3KJVB 2CWXA 4DUZF 1NH7A 2KZZA 3ET6A 3KLEB 4RX6A 1QSLA 1NK6A 4J37A 2W9BB 3RRGA 1S7HA 3X3UA 2XS5A 4K4YA 1S12A 4DFPA 4DR1J 2FY1A 1U25A 3GYNA 2FHOB 3P5BP 4WU3A 1W26A 1RHJB 3CCVS 4EI2A 1NDPA 4FXDA 2MQ8A 1RU2A 1FRLA 3DYAA 2BOPA 3NKYA 4OV1A 2MGZA 1YQHA 1X4EA 2R7WA 3DI6B 3DHXA 1Y5LB 2ALYB 2AEJA 1U4BA 1V5VA 2L41A 5KT3A 4ZK7M 3W66A 1AZSA 2Z2ZA 5KFEA 4OYMA 2ZBRA 4HHHA 3OL9A 2DNMA 5DQGA 4X4NA 4C2MA 3ISND 3PHEA 2FJWA 1DFDA 4UQGA 2YWKA 4ECWA 2VFTA 2RUGA 5D15A 5HBMB 2CPIA 3MMBA 4KFBB 3BPDA 3UN2A 1DLOA 2B4VA 2ACMA 2MKYA 5LMNF 5D8HB 1FVQA 3MWBA 1D0EA 3SQGB 3RTVA 4JI5F 4PG4A 1KLMA 3FRYA 3EXYA 4WKRA 5SZTA 2CIMA 5IXUA 1XNQJ 1UL3A 1TFWA 1JQGA 2W2MP 1FWPA 4LVNP 1YJ9S 2W2PP 4KH1B 1PILA 3W9IA 4I2PA 2QL9B 4DPWA 3Q89A 1RHUB 5E3PA 2YNGB 2JLFA 4BC9A 2CQPA 4O3SA 5EWGA 5AE3A 2E7XA 3I31A 3TOQA 4EBDA 3C15B 2AW0A 3CJ4A 4DV5F 3OL7A 3C16B 4ECXA 3AXMA 1WUUA 5LT5A 1U0HB 1BMQB 2C2MB 3I5AA 4OYXA 2IHR1 2RHQB 3BYPA 4B3RJ 4A8KA 1NXIA 2GO9A 5GADI 2W7AA 2YNHA 1H0HB 1TR0A 1FD8A 1V5IB 3M7VA 3JTPA 4DG1B 2HEKA 4PPDA 4J9QA 3T9ZA 2LQJA 2MJNA 3RB4A 2AJ4A 3DLKA 4LF7J 3IS9B 4ZVHA 3KK3A 2H9ZA 4DPYA 2JEIA 1S1WB 4ZCIA 1NHUA 1FERA 1M1HA 3WIUA 4K4ZA 2E7VA 4F26A 4F0MA 1RADB 1X8DA 2IJNA 5F8MA 4MKYA 1SJ1A 1YJWS 3EMTA 2QSWA 1N6QA 2XMJA 1JLCA 3DGVA 3TEHB 4TYBA 1TL3A 3QLHA 1F5AA 1UPPA 1G2EA 5E0OA 2KJVA 4NLDA 2KFNA 3ZZTA 2DNLA 4RUBA 3TANA 4CI0B 1FKAF 4A8OA 3SCLE 2VODA 2CNKB 3M30B 3AQPA 2DH9A 2HS3A 3QSYB 3NS7B 3Q22A 2HMIB 4FZVA 2R7XA 4ID5B 3QO9B 3CJRA 4V19X 3EVWA 4IRDA 4GKJJ 4ANCA 1CPZA 2NXCA 3P5TL 4USUA 3R5AA 3T5LA 4DSIA 2B5JB 2BBEA 1WHWA 3ZTPA 4DR4F 3PW7A 3A3NB 1S10A 1HYSA 3KXDA 5F41A 4OZ0A 1YBTA 3EE3A 1J5EJ 2KI2A 4DR2J 4I64A 2V67A 3ICLA 2HHHF 2IBKA 2GAHC 4M5IA 2ZE2B 4IOBA 3SCIE 2OI2A 4QCLA 3TARA 2DIUA 4DV4F 3LP1A 5DM7Q 2YX4A 2N4CA 1RTZA 3VAJA 7AT1B 4O23A 2CJKA 5JVHQ 2R7SA 5I42A 5A8WA 5KG6A 1S0MA 3MM8B 2AF6A 4X4PA 2HWHA 3I96A 3GR1A 3SCKE 4OX8A 5F8IA 1T9TA 4CQ1A 2R9LA 4GMKA 2YNFB 4NLOA 2CG8A 4P7VA 3QQCD 3C8YA 1WSVA 5HVHA 1NK7A 5AT1B 4DU7A 2OHDA 2Q3PA 2A0FB 1HPZA 2BE2B 3BYRA 1GXLA 2HS0A 2FVSA 2DNGA 2VFSA 3ZZZA 2XHCA 3KG1A 3QFWA 2D3OR 4Y00A 3A1YG 3PW2A 1MU2B 1ICEB 2D1CA 2QV6A 4Y2KA 5KFRA 5IM0B 3VAIA 4JI3F 1UCNA 4DMZA 2CPZA 2VBZA 1BUXA 3BB5A 2A2DA 1MMLA 3HSDA 2FHJA 3JQMA 3GONA 5KFBA 3QJJA 2FZCB 3TEGA 4F4ZA 1TUVA 2BV3A 2GQQA 5L9XA 2KXFA 2VG6B 2VPYB 3M2UA 4CM2A 1S99A 1PJ5A 5RUBA 1TZ0A 1WF1A 1B7YB 5GAHU 2GQ2A 1JJ2R 3BGRA 3FSYA 4AL5A 5A8RA 3DGPB 4OLPA 3T1HF 1S0VA 4ZCMA 1KBRA 4ATNA 3MOJB 5HANA 2CRLA 4JI7J 2P9GA 2QG9B 4EUVA 1J5OA 3L09A 2VBYA 1FT8A 4Y2CA 4DL5A 3WQPA 5IFMA 4TLQA 3MM9A 4F0HA 4I6AA 1JLAA 4RW6B 2QSFA 4LSNA 1WHVA 3TJ9A 2HFVA 1RI7A 5HI7A 1BGXT 1NB7A 4ENOA 1LK5A 4AL6A 1H72C 2Z57B 1VC6A 3VAHA 3CC4S 3UNYA 4J9SA 4B02A 4ED4A 4YB5A 4DN0A 1RT2A 2ZH5A 3CW2C 2G1DA 3RGIA 3GQCA 2MZQA 1R3NA 4P7TA 2WVCA 4H54A 2DISA 3IAS9 2YX1A 2MQMA 1RT5B 3TX8A 5KFTA 1QY7A 2KYXA 3H5XA 1F3VA 1FJEB 3RBEA 4LF5F 1ZETA 1GK8A 1RHQB 1Q79A 2EW9A 2OH2A 1AT1B 3G96A 4F4AA 4OYWA 1V3SA 4KHPJ 2QFIA 5G4DA 4OIXA 4YHHJ 3D1QA 1BWVA 2QLJB 2DO4A 2E1PA 1RB0A 1WKJA 2RVJA 4RU9A 1RAEB 4PWDA 2GHVC 1LK7A 4DS5A 3UFCX 4Y34A 3M8RA 1N34J 2N7YA 1CJVB 4O4GB 3KJVA 1H2UX 1VQPS 1X4CA 2UUWA 1RBAA 3KLEA 4JV0A 2U2FA 3IC1A 1YJ7A 1FDBA 2ZNYA 3RB6A 4HR2A 1HI1A 2F4VF 5LM7E 1IKWB 3N6NA 1XMQJ 2GNKA 5AJ3J 2R7UA 4RW8B 1HR0J 5F0WA 1FEHA 2DH7A 3PO5A 4G1QB 3RW7A 4IR1A 2CADA 3DI6A 4X66F 2V6AA 2WZ1A 2OELA 1VQSA 2BABA 5ETRA 3CCLS 3P96A 4RBUA 2RKIB 2IBOA 4K2XA 4DV0F 3UPFA 2I1RA 1K8AT 2I5JB 4DL6A 4TNOA 3FKBA 1RYSA 1Q95G 1B7FA 3TQ1A 1BQXA 4LRAA 2HVEA 5HBMA 4X64F 2GIFA 1R43A 2VDHA 2FZKB 2BX6A 3CCSS 4I68A 1PYTA 1NJXA 5LOQA 3SQGA 2CJQA 3NAHA 5HN0A 3NS6A 1RZMA 1Y5NB 3TAMB 2LXUA 4DSKA 5KG1A 3AHPA 2IDLA 3AXKA 1HIYA 2DNYA 5KTQA 1QUPA 2QA2A 3ELHA 3PYDA 4L72B 2YNGA 4ES3A 4IOCQ 1H2VZ 1JLGB 4MH8A 3C15A 4H4KC 1HFEL 4C7QA 3V6HA 5D3GB 3C16A 3DLGA 1TFYA 1UETA 3VV2B 1U0HA 1YJVA 2C2EA 3OBIA 1S0OA 2C42A 1Z2ZA 4DZ6A 2MKJA 3W64A 4P10A 1EJ7L 4X65F 3OUYB 4DG1A 4TU7A 3MEDB 2W7PA 2GC8A 3GFHA 5CYMB 1XQIA 3O5TB 3IS9A 1EETB 1GX5A 3FZ2A 5AE1A 2B7CB 2F4FA 3BO4A 1PAEX 4GC6A 5HQ8A 3S6EA 3EZUA 1REVA 4YS2A 2F9DA 4CLTA 4YR0A 4OI2A 3C19A 3DRSB 3NRBA 2XC9A 1K44A 5F9NA 2C3UA 2HNZB 1S5ZA 1RT6B 1QM9A 2IVMA 3BSCA 1CQNA 3QGHA 1VCTA 3GCXP 2BUNA 2ZH6A 4DQPA 4ELTA 3SQOP 3PEJA 1S4EA 1GAOA 5BYSA 3FQKA 5KFGA 2VPXB 2OPPB 2R7VA 1PKUA 3M30A 3BBCA 4KB7A 3CJ8A 2C2OB 3M1VA 3TWZA 4DFMA 2HMIA 3QO9A 3OJSA 4E2FB 3F56A 1NPPA 2L48A 4EMDA 2ASDA 4YUDA 3VTIA 3JYTA 4ED3A 2HWIA 4WP3A 1IR0A 4K50A 4RNHA 4AD6A 1HW8A 4Q7AA 2OGUA 1LWFB 3AJ1A 2FGOA 1KVJA 1TKTA 3EUNA 3MCOA 2J0WA 2OPRA 2K1RB 2OIHA 2FJEB 4ZPVR 1NU4A 3MUTP 1RKIA 2ZE2A 3J7A1 2R2RA 1CJKA 2D9PA 1F1BB 3IG1A 1NCLA 4UUXA 4OMFG 2F8HA 2MY8A 5L46A 2P9CA 3GFZA 4TQSA 2PDAA 1X4DA 2E1CA 5DLFA 3F73A 5U47A 2ZBQA 2EI5A 1AYEA 2MLYA 1NPRA 3MM8A 2HHTA 1OSCA 3D1OA 4HKQA 2H48B 2EK1A 1Q0NA 4DX6A 4N8NA 4USMA 3T6BA 2O1PA 4KH0B 1VQ9S 2V34A 3BN7A 2FQQB 5IQ6A 2YNFA 2VIHA 4LT6A 1E6VB 1EZZB 4URSA 1TVRB 3W3SA 3B78A 1U02A 1IBCB 3TZWA 1M1KT 1Z4UA 4USKA 4K4XA 1DTTA 2BE2A 4QIGA 2CAJA 4F02A 1N0UA 5DLGA 2BYCA 5C5JA 4ANDA 5CQGA 3U02A 4RBTA 4FVMA 1MU2A 4X84A 1FK9A 5HLFA 3TQEA 4IG0B 4FKXA 5IM0A 1N36J 3DM2B 1VQLS 2R42A 1RAIB 2KHDA 4IYQA 2MDAA 2LCWA 1BQNB 2OAUA 4YB7A 4PEOA 3QAUA 2QO3A 1HQEB 2YH1A 1DTQB 4DHVA 1NDCA 1ZAXA 1SKWA 1JJ4A 2VG6A 2ZEJA 2G2YA 2YQ1A 4EEYA 2ZH4A 1RUSA 2HPUA 4G1IA 1X5OA 3QRQA 1LXJA 2ROPA 2DRAA 1S6PB 3V4IA 2I8EA 3DGPA 1OWXA 4QPTA 2WVFA 2C3PA 1S9EB 3OW2R 3M9NB 2VZ9A 1P27B 2MKIA 2CQ4A 3TO8A 1HARA 3MECB 2HRTA 4FYVB 4DX7A 2QLFB 1HKAA 4RW6A 3CD5A 1BLUA 6FDRA 5EWEA 3DOKA 3FEXB 5DQIA 4DR7J 3HULA 4LMZA 3IO1A 2J6TA 2BANA 1JLFB 2DGTA 3SSSA 2DPIA 2WSFC 2WB1D 4ZPTR 2KVIA 3E01A 2QC3A 1SCJB 2B4UA 1F6TA 2LECA 2H4WB 3DRPB 2QZ8A 1CBKA 2BJDA 3MD1A 1QD1A 1NZAA 3BKUA 3EICA 2G13A 3M4XA 2XZTB 1UW9A 2HNYB 2NXNA 1QE1A 3B54A 2LKZA 4P72A 4OI1A 3PW4A 5KG0A 5GAGU 1F5CA 3ZZPA 4IO1A 5HAOA 1VQ4S 1KFSA 5AXKA 2Z4PA 5CH7B 3SSQA 3TA2A 2G0JA 3SEOA 1VFJA 2X51A 2ZDOA 3ILOA 3OTOF 4XPEA 1WC0A 1FO1A 4W90B 3SDEB 3Q8YA 2HBYB 1MMDA 2XMMA 4RW7B 2YKNA 1DJ0A 1YBUA 1L3UA 3N79A 3NBPB 2CWKA 2ACYA 1IBMJ 3LAMA 4QYRA 4UOGA 1YBAA 1RT7B 3ZZYA 1K47A 1KVIA 5KT6A 2FY8A 4GKKJ 4JV5J 1K9MT 1APSA 3CJSA 1S1XB 2YWGA 2RQCA 2J7UA 3M8SA 2BJEA 4Y0FA 3AB2B 3CIZA 1KC8T 2B56A 1Y7PA 3B6BA 3KHRA 2ZJRQ 3BS9A 1HNXJ 3SFGA 1XR5A 5ADZA 1KP6A 1P1LA 3W2VB 4NEYA 4NRUA 1DQ9A 2IIHA 4Q44A 1VQ8S 3IR7B 4KGKA 4KC5A 5H9EJ 2MHEA 3CCJS 3A8JA 5J2QB 4G1QA 4F7VA 4IDKA 2WCXA 1ZYQA 2CDRB 1N32J 3K5NA 4ZMMA 2H54B 2LU2A 4A8MP 4WFBQ 4ANEA 3UDVA 3NL0A 1RWXB 3AD8C 2DGQA 2RKIA 2BKNA 1SL0A 2MLZA 3I82A 2I5JA 3BSNA 2HK3A 3BREA 2VFRA 1SQGA 3PJ9A 1OY6A 3OXFA 4MIAA 2LU1A 3UN5A 3M8PB 1SPBP 4DL4A 2ZOFA 3CWJA 2D74B 2NLWA 2OPSB 3K8WA 3BDPA 3AAWB 4ZIVA 1DZ5A 4NX9A 4JI0J 3SMZA 4K4VA 4ILRA 5IWAJ 3RZAA 3TAMA 3GJQB 1RAJA 2ZBCA 3CDAA 2V4RA 1YGYA 1NO8A 2RAQA 2J0XA 4KV8B 3K17A 5LXYA 3IRWP 5D4PA 2ZH2A 3DOMB 4OI0A 3FCWA 4JYAF 2MTLA 2WB4A 2FJVA 3BF4A 3GG1A 3GWCA 1HNVB 3EM1A 3HDSA 1FRKA 4ZP9A 1NNDA 1MNEA 4BWJA 3TA0A 1FRXA 2V63A 4OLOA 4O0IA 3AJ2A 4X4SA 1OQ6A 2ZVIA 5T7LB 5D3GA 2GJ2A 5C24B 2KT5A 4ZP7A 1TELA 4WFNQ 4DSEA 4LF9J 2ZH8A 2B8QA 5CCMA 4PG7A 2DHXA 2U1AA 1Q78A 2ZITA 4YDXA 4ALZA 3OUYA 3W63A 2NSCA 2GVZB 4OX9J 4WFAQ 4Y3CA 1RYRA 1UA0A 5FIIA 1HD1A 3GJSB 4DV3F 2Q6BA 3MPWA 1VRUB 3UVJB 3SV4A 4RNNA 2V68A 1M90T 1PCAA 4ECUA 1ZM4A 4ICLB 3W65A 5LMNJ 1HNWF 1FXDA 1M5HA 1RTJB 3FBCA 3VF0B 2J7WA 3MEKA 3W9HA 2XNQA 2ZBPA 1WG4A 2VICA 3VWSA 1M5PC 2EBGA 2IVYA 5CD4A 5D4LA 1RT6A 5CD4H 3KLGB 2AQ4A 2ZH3A 1KTQA 3I4PA 4O3QA 2KRRA 5D0HA 3NCPA 4A8WA 1R7IA 1C2PA 1PIEA 3TA1A 1UVKA 3D68A 5BXIA 5HO4A 2YKQA 4D3GA 2VU5A 4PXEA 3R1HA 1XR6A 4RPFA 3MGJA 1R8HA 1PBAA 4X62F 1WNEA 1GMUA 2Z30B 3NLCA 2UXBJ 1W7WA 2XZDB 5L8RC 4CO3A 2PN6A 4K5SA 5HQMA 3NGRA 3LA0A 4KPCA 3R7BB 2KM8C 1R6VA 3CJ5A 1Y0HA 1F3FA 4KTQA 1Y11A 4FS2A 1LWFA 2AYMA 1F9EB 1M0SA 1QTNB 1HWKA 4M5GA 3W5XA 2HFNA 2K1RA 3H59A 3L7PA 1B4SA 3PV8A 4B9VA 3CD6S 1EHWA 1WC3A 1S0NA 3SBMA 1C1BB 1YJNS 2VV5A 3TI0A 4OZNA 1PJ6A 2OEMA 4TXSA 3DLEB 3FVYA 2XLIA 1SJ3P 5KT4A 4OI6A 1FX2A 1LFWA 3PFEA 2DJWA 1VBYA 1A9NB 1B3TA 1VQNS 2IJRA 4CLUA 2EEYA 4ETXA 2P6SA 5B0GA 2CNOB 3NS5A 4LSLB 3GG0A 3NOGA 3HHLC 1BD6A 4QR2A 2XMUA 1KSPA 1PSDA 1C1CB 2UUBF 1S72S 1E6VA 4U7UD 2B9WA 3DN9A 1VIOA 1MG7A 1TVRA 4ECQA 1YWXA 3HVAA 3UDEA 4B08A 2GVDB 2H5EA 4CYUB 3MAAB 2JDJA 4F3OA 3OTBA 1UVNA 3I9V9 2VA2A 1N5VA 4DLGA 4DR4J 1U24A 2AEMA 4N41A 2CQBA 1S1TB 4OZ5A 4X4VA 4IG0A 3DM2A 4KHMA 3MR2A 2D3UA 1WHYA 2DBBA 1BQNA 3Q24A 1WG5A 2UV8G 4K0KJ 2RDIA 1ZZFA 2NSBA 5L1LA 2VPWB 4FYYB 1U45A 1HQEA 4CCHA 3FBFA 1DTQA 4JV2A 4NLQA 5F0UA 1WACA 3Q8VA 3HMJG 2VQFJ 4RWWA 2MQPA 3VAGA 4RNOA 3HT3A 2BW7A 2CVEA 2XY6A 3NMAA 1FF2A 4USVA 1S9EA 3PVXA 2DEIA 1JLBA 4NCGB 1HNZF 5HVGA 1JWWA 2H3EB 2HQFA 2WW4A 3TNVA 5KG4A 4OHXA 5F9LA 2J5AA 2GA7A 1UFWA 4NXNF 4ES2A 4YDDB 1TK8A 4LF8F 2ZHBA 2OLWA 4DL2A 1JLFA 3GLJA 4G3IA 1NSQA 5H9EK 1LWCB 3H0PA 4BWMA 1KDNA 1K1QA 2BW2A 3AJDA 3P3DA 3DRPA 4DR5J 4DF8A 1TK5A 4LF4F 2NZ4A 3FDSA 5E3QA 1ZM3A 1CJUA 1JK9B 2HNYA 4O3PA 3M05A 4KE5A 2CJAA 2AD9A 1TL4A 5J2MB 1X5TA 1XK8A 5ETTA 2KT3A 3E2EA 2M70A 3AFGA 1KD1T 3TRGA 3GTYX 4J9PA 9RUBA 2C2RA 1SJQA 4KIAA 4DPUA 3UD4P 2AJQA 3HPOA 1U6ZA 3T1HJ 4DSFA 3N5FA 1I51B 2L9WA 4RW7A 3G8SA 1RWWB 1N52B 5DQHA 3QFHA 1H7WA 1KR4A 1MWQA 2DB1A 3F41A 4EZ9A 2IVFB 1RK8A 1RT7A 5KG5A 3ZZUA 2FB0A 3I6PA 4Y2MA 2K7JA 4NMLA 4B9UA 3T19A 1YZ7A 1Q53A 2DR8A 3EZOA 1SJFA 4WFXA 1QAJA 5D0GA 3BQ1A 1H2TZ 5K5MA 4LF6F 4QWEA 4ZJQA 1FNXH 3HK2A 3FFIB 3QBCA 3R8YA 2V94A 4HTIA 2B4OA 4N5SA 3FGVA 3CGIA 4I56A 2M8HA 3D5MA 2XS7A 2V8HA 4X4TA 5KFWA 3W2VA 2ROEA 2ZJPQ 5L38A 2V9KA 2CUYA 1RWUA 4M5KA 1FJGJ 1P9YA 4CZCA 2CPHA 4HDGA 1X0PA 1RGVA 1PC5A 2YVSA 2ZH1A 3J81j 3J7Z5 4A8YA 3D0HE 3P6YC 2ZUAA 2MXYA 4L3NA 3HZGA 1KTVA 3T1YF 2H51B 1QTMA 4TKTA 1ZPVA 4WXWA 4OX7A 5ETMA 3SV3A 4CLLA 3H5SA 3KK2B 2IC3B 4MK9A 4WTYA 4F0KA 2LQ5A 2DR5A 2QT7A 1HI0P 2BJ9A 2UUAF 1G4CA 4M8LA 1RTDB 1Y5IB 4TY8B 4ED1A 1I5OB 2QLWA 4DUYF 3OQ2A 4X2BA 1PG5B 3FBBA 2V50A 2OFGX 3E3XA 3M8PA 1VQYA 4J90A 2CQ1A 3RB3A 2OPSA 1OY8A 3O1LA 3O3LA 2XNRA 1ITPA 2F9JA 5BJRA 1X9MA 2HIYA 3ZZRA 1RISA 1OY9A 1SI9A 4EFAC 2QFJA 1RWMB 4KV8A 3A8IA 1FRJA 3DOMA 3R6LB 3H42A 4LFAF 4U8YA 4CLZA 4RLEA 2HHSA 1UEVA 2GHWA 3I5CA 1WSRA 4EO8A 4OJGA 5E2QA 1PAUB 3OR1B 4NLPA 1JXLA 2MZSA 3CNQP 2HFZA 3UCZP 5T7LA 1AB8A 4OHZA 4XPCA 1FRHA 4X66J 5C24A 2ZHOA 2NQPA 3B4MA 3UO0A 2MYFA 1T9XA 3RR8A 4ERDA 3PX4A 1JLQB 2E5HA 2F1FA 1T03B 4V19J 1TU0B 3LAKA 4IKAA 1VK3A 2HQGA 3HD1A 2CPJA 2GVZA 4C3LA 3Q8SB 4C6AA 4U6PA 4KSEB 2E44A 1VRUA 1KNZA 4P75A 5A6PA 2BQ3A 3J80U 1KFDA 2JH3A 1X4AA 3HFVA 4ICLA 3JSMB 2PT0A 4K7QA 3QZ8A 1YK9A 4B3MF 4YY3F 1HMVA 2CQCA 1HW9A 2M2BA 2B3TB 1RTJA 3S8SA 3MEGB 4URGA 5KT2A 4BS2A 4J9UE 3CC2S 2KFZA 4ZPBA 3BQ2A 5C2CA 1SV5B 4KT0C 2VPZB 4ZIWA 4QWAA 2RQ4A 4JI1J 1RHKB 2MZ1A 5CYQB 2B6AB 4OZ3A 4V1Ak 2ZJQQ 1FWLA 4RUHA 4DX8H 4JI4F 5IQQA 5J1EB 1UEUA 4TY9A 3HF5A 3NG8A 4NYOA 1U1PA 4ECZA 5KAKA 4C0OC 1U1OA 3MF5A 1RCXB 1MROB 3THTA 2VC0A 3UR3C 5BYRA 4EZ6A 1UFKA 3OVSA 3DRXA 3EGNA 4QR1A 1H6KX 4X65J 4NZ6A 2K3IA 2FLNA 3M32B 3PZPA 1TMMA 3MMAB 4U7CA 1NLKL 5KFDA 3PG9A 4DV2J 3MFIA 4MKAA 1LWXA 4XTTA 3CMQA 4CO0A 1YRUA 3OR2B 4ZLPA 1C1BA 1RAGB 1ZH5A 1CG2A 3LGNA 3ZO7A 3I5BA 4ZCKA 4DPXA 2HGMA 1FDDA 3GPAA 3ZTSA 4J5OA 4DR1F 2E9TA 2VC1A 5GMKa 1Q4RA 4CTAB 2C3YA 2GO8A 3OFHA 2A1BA 3SXLA 1C0TB 4E98A 3W5ZA 6AT1B 2BM1A 3DXBA 4ZLJA 2VKZG 4FF4A 4L75A 2G2OA 2PSZA 4RU2A 3KWMA 2GMLA 2KG1A 4LSLA 3ZTRA 1Y9OA 2FZGB 1R0AA 4RW4B 3D7SB 2CPEA 5L9NA 2XLJA 1C1CA 2GX8A 1S9GB 1I1GA 2DNKA 3MPDA 2UUTA 1ZM9A 2GVDA 4LSZB 4CYUA 3MAAA 4DFKA 2XM3A 2N4DA 4HDHA 4XO0A 1V3ZA 1K73T 1KS2A 4O0NA 4U8VA 2YKMB 2BJ8A 4DSLA 1NM2A 1XJWB 2RU9A 4PG8A 2P5VA 1S1TA 2XGPA 4LFCF 4RUAA 2MZRA 4EU0A 3QWUA 3M6WA 3BGOP 3CD7A 1NK8A 3GJRB 1WTFA 5B0EA 2IAJB 4Y6IA 1VDHA 2ZZTA 3FSIA 2HLTA 1B0VA 4DL0C 2HRYA 3W62A 2UXDF 4KRWA 4WYWA 3CJKB 1VC0A 3LALA 1XMBA 4WFZA 1LOUA 4ECRA 5KFMA 5J2NA 3PX0A 5LL6d 4QWCA 3CCES 3DDIA 3MFHA 3M2RB 2K3KA 3LGHA 4X4RA 1X4GA 4NCGA 2PGCA 3R97A 1VIXA 4M5LA 2C2NA 2IY5B 1WORA 2BKOA 2JEFA 5BR8F 4B3RF 3OVAA 3M6VA 4FPIA 5LJ5Y 5CAAA 4EBEA 4M5DB 1TUGB 2QLXA 2EFPA 4F04B 3TZYA 2OUGA 3OPKA 5GMEA 2AYGA 2GFFA 2FHJD 2VG7B 1H7XA 4MIBA 3C3LA 1RSCA 5ETNA 1LWCA 2XY5A 1TTHB 2MSTA 2NPFA 4PQUB 2XMTA 4QIEA 2E29A 2V8PA 1ZTWA 4HL9A 4KGMA 4DQQA 4NXMF 2X1FA 2JFKA 4ZOSA 3D2WA 4IFVB 1OYEA 2EXUA 2EPIA 2FLOA 2KHCA 4NCAA 5J2MA 4CLFA 1EP4A 4PWWA 2OKQA 3US5A 4WCEQ 2AJ2A 1IKXB 2WK4A 4DCPB 3BPSP 2KKHA 4W98A 3MDFA 3KUHA 2M0GB 2RMLA 3J7AN 5HJYA 2E5LJ 5DDOC 2VG5B 4ED7A 2Q1LA 2E7WA 4ECTA 3K59A 1JMTA 2NCKL 3TAQA 1WEXA 1NKEA 2MZJA 5G0RB 3H20A 3W7BA 3UNGC 4GVBB 4ELVA 4F4YA 2DNHA 4WP9A 3QZ7A 3IRXB 1OMSA 2ZNZA 3FFIA 1U2RA 4TVAB 1YG0A 1J5EF 2OEKA 5HP1B 2W4CA 5HMXA 3ZNUA 3M8QB 1AXQA 2RF2B 2OSRA 1FDNA 4WE1B 2DGXA 3VCDA 2RQMA 4DR3J 1D9FA 3I87A 2XHWA 3DLBA 1LW2B 3W8PA 2B9XA 3PM9A 2PI5A 4DZDA 4OI3A 3GMGA 1KOHA 3EXCX 2C3MA 1LV5A 3KK2A 4HT7A 3KHHA 4RW9B 4DV7F 1Q1KA 3AA8A 4DXLA 1JLEB 3TJAA 3OTOJ 1B0TA 2HWTA 4L6V3 1L3VA 3VGVA 4MAKA 1RTDA 1K1SA 4FF3A 4TY8A 1PYSB 3VQTA 1IKYB 2M5YA 1D3WA 5KFKA 3G8TA 3NWRA 1SQFA 3BEGB 4OHWA 3SZ2A 1RBOB 1R8PA 1JB0C 3MR7A 2YNIA 2Q79A 1VJWA 4DR6J 4R5PA 3GV7B 5DG8A 2ZC3A 3BGFA 3F0NA 1HBUB 3QIPB 2IM3A 2BDPA 4PUOB 3MI7X 4ECYA 2AP6A 4UY85 3S7RA 4B3TJ 3OR1A 1N33J 2ADCA 1YZ6A 6FD1A 2HGLA 4Z7YA 1NKBA 3NAIA 1UVJA 1X31C 3JSRA 3CSKA 3H2LA 4IH5A 1FJCA 1NRKA 3HVTB 4FVCA 2J0SD 3O6QA 1XIQA 3M8ZA 1A7GE 4MFBB 2AEFA 4NLRA 1VRQC 1HI8A 5KFHA 2CQ2A 4OJHA 1IWAA 2GHPA 4I2QA 1F9FA 4UZCA 4IR9A 1YJRA 3PKMA 2R8IA 4ED8A 1Y10A 3RBDA 2E66A 4CH7A 2LFVA 3NGTA 2JRSA 2XYHB 3PFOA 3UCUP 4KGZB 5T14A 2V5HG 4WIIA 3MEGA 3N28A 2AX1A 1EKSA 3POTB 2QL5B 4B9SA 3CXCR 2NYIA 1B64A 1SV5A 3PYGA 5EWFA 5D6GA 3RJMB 4DJBA 4U95A 4JYAJ 2DEJA 1X0FA 5B0AA 2NPIA 2EWHA 2R7RA 4TU8A 2LQBA 1N8RT 4AXIA 5J1EA 5ETKA 3WDOA 2FHKA 1NDLA 4DPOA 1GMWA 1N5YB 1KKHA 2FUG9 3NWGA 5EX0A 2E1MC 1Q5YA 1QAIA 1MROA 3MM5B 1BE4A 2C1EB 2BXJA 1JNRB 2IM2A 1X4BA 3W5YA 2B51A 2R3VA 2KFYA 4WXOA 4KHPF 1FKPB 2ABYA 4BBYA 3MMCB 1MWYA 2JWNA 3I9ZA 4B3SJ 1GTHA 4GO5X 3CDUA 3M32A 4RZRA 1AUSL 2HHWA 4IO9Q 3QT8A 4FXVA 3TZXA 3QJPA 1T94A 2J6UA 2XI2A 3AY0A 1XMOJ 4L74A 4JV1A 4QOTA 2HFOA 1N34F 4M5JA 3TYTA 3PKYA 3U1MA 3J7YU 2O67A 4KBIA 3W8GA 4UOFA 2HBQB 3MD3A 3ENWA 3OR2A 4ZVOB 2VB6A 4XAKA 2CPYA 4DLEA 2CQIA 2XBPA 3VAFA 1VQKS 4KJIA 2RB7A 2XYGB 1QSSA 3QPIA 2W4DA 5A8KB 2J9DA 2KXNB 3SIPB 2RUSA 1HBNB 1FWKA 3KDNA 1ELOA 4CTAA 2VBWA 3T6JA 1XMQF 4ZVGA 4TQRA 1U6BA 1TUWA 1C0TA 1XNRJ 3IR6B 3LWMA 2UUCJ 4ZCLA 4CWBA 2YKAA 2DXFA 1WOSA 2L3MA 2G2ZA 1HR0F 5LMUJ 1N48A 2VOPA 3CCQS 4DI6A 1Q86T 4EK2A 2LVWA 1RT3B 1Q16B 3BQ0A 1BQMB 4RW4A 5EX3A 5JXSA 1CJTA 2HHPA 5DZ6A 4ZPAA 3EVOA 1I3OB 2UZAA 1S9GA 3RRKA 4Q5VA 4F25A 2DR7A 1JJCB 2RHSB 3G8QA 1X9SA 3ETMA 4NLUA 2V8GA 2WW8A 4PYDA 3PIPQ 5LSRA 2UVUA 4RNMA 4JOUA 3CE8A 5IC4B 1GFWB 3WC2A 1S6UA 2YKMA 2ZKUA 2HK2A 1RXOB 3DFEA 3QSIA 1PBUA 1R31A 4FPRA 1ROFA 3N6LA 1R8AA 1BXNA 3ET6B 2IAJA 2YY3A 2LP4A 1FNOA 3QGGA 1FFGB 2B9YA 2W25A 4F3MA 4CLSA 4MKBA 4QIWD 2L9NA 1O6XA 2QYGA 3CJKA 2AIRB 5CZXA 1NUEA 3UDLA 1Y00A 2Z2LA 3I0RB 3KJNB 4ZN1A 3GJTB 3JB9k 1J2VA 2P6TA 1FX4A 1KWMA 4DQRA 2ZD1B 4M1KA 3OTCA 4NA3A 3EVMA 1RE1B 3K89A 3KYLA 1T3NA 4K4WA 3CUNA 4CRJA 1CSJA 2KN4A 2ATLA 1VHFA 1X7VA 3OSPA 3CPWR 1Q8KA 5KFUA 3ZTQA 2MB0B 2OFHX 2VG7A 3T5JA 5EDWA 2DNQA 3W9JA 4NLWA 3PTWA 3ZNJ1 4PQUA 1EQ0A 3PR5B 3RAMA 1DRZA 3EGVA 3RYLA 4OYZA 2HVDA 3B8HA 3EPIA 2FVRA 2ZBIA 3V5RA 2FJDB 1T9YA 2ILYA 2R8HA 1WD6A 1N5SA 5B09A 2VA3A 2FPHX 4L73A 3KNAA 1G7CB 3TW0A 3TVYA 2F7VA 1VMBA 1IKXA 3KHLA 2JX2A 3EWGA 5GAEU 2H5IB 3Q23A 4F50A 2KO1A 1TP7A 4Z2XA 2FVPA 3BZQA 1R8CA 3P45B 2VG5A 2WONB 3D28A 4OL8A 2AGPA 1HNZJ 1CQMA 3BBBA 2HZVA 4CLKA 5G0RA 2YNHB 3HSJA 2JZ5A 4FNHA 4NXNJ 1MMNA 4AE5A 1R27B 1S59A 4LFBF 4P2MA 3GIKA 4DFJA 3GILA 4GVBA 1RCOB 3G4SS 1F9HA 3Q8PB 2DITA 4IFYB 3V4MA 3DLKB 4JI6J 1X4HA 4RUCA 4CO4A 3KK3B 2LEBA 4CT8A 3TUPA 5F3TA 2ZM6F 5C42A 2BQUA 3DHWC 2GGPA 5HP1A 2MHNA 4P2XA 1VYAA 4P52A 3M8QA 2RF2A 2OTJS 5EN1A 4UZBA 1NK0A 2A3JA 2LMIA 2HNDB 4DV6F 2XQCA 1JLCB 3HKWA 1LW2A 2EVZA 4F2SA 2CJBA 1G3OA 3TUIC 1TL3B 3LP2B 4FXWA 5IOLA 2W9BA 4QBUA 1KQGB 3BO3A 2Z58B 1IN0A 4CNZA 1U47A 2QTWA 3DKDA 3CMES 1NB2A 1JLEA 1RWKB 3GE9A 2EC2A 3WIVA 5KOXA 2ASJA 1T9UA 4O4RA 3QIDA 3R2CJ 1IKYA 1IWGA 1U6FA 5J1NA 2CQ0A 3C14B 3CTRA 3O8WA 4PQAA 5K14B 2IJFA 4NLYA 2BJ1A 3MZIA 1M5VC 3ADAC 5ETVA 3IBFB 3CCUS 2UU9J 2PMWA 2IRXA 5C2GA 2V9WA 3H40A 1HYSB 2CFXA 1U1RA 1N36F 4OYPA 2CJYB 1F2HA 2RJZA 2M88A 5KFIA 2Y8YA 1HBUA 3C46A 3QIPA 4OYBA 4L3KA 2RDJA 1KN6A 4Q2MA 5IT9Y 3MUVP 4KFBA 4K2JA 2QA4S 4QW8A 2QX0A 3OFGA 2PFFB 4QYZJ 2RE1A 2FDNA 1SQEA 1OS5A 4ZPWR 3IBCB 4ZVQB 3I56S 1YRTA 2VD3A 3D6TB 2KM8B 2OD4A 2UUAJ 3HVTA 3R6GB 3KDOA 3IFEA 3CCZA 3J80Y 2R4FA 4MFBA 2V4QA 4YFUA 4J9KA 4WYLA 4NEZA 1KVKA 2XMVA 4IH7A 2HHUA 2XTJP 3M9OB 3C6UB 9ATCB 4QPXA 3PYFA 2EFQA 3T5KA 4JI2F 3L3CA 4J9OA 3RRHA 4YQWA 3SFUA 3KHGA 4DR7F 2AZ3A 2IPOB 3MPVA 1WG1A 3ILJA 2YWWA 3HHDA 3POTA 2XWXA 3UI3A 3NNHA 2MKCA 2W2NP 2D7SA 2LXIA 2G9OA 1IR1A 4A46A 4LFAJ 5THWA 3BGUA 4UTGA 3MAQA 1AROP 3HHLB 3VGUA 2PO4A 1LKZA 3HHEA 3IM9A 3CJ0A 5JJBA 4PXBA 2W9AA 2FLLA 1S1WA 1B70B 1C4AA 4JB8B 4FBUA 1IM4A 3D9BA 2EC0A 4P2FA 1SL2A 5L1JA 2M4MA 3MM5A 4M5MA 1ZA1B 2COLA 1NK4A 1NJWA 4RO0A 4NLVA 2ERRA 4WFYA 2DY1A 2QN6B 3R7NB 1T11A 4C11B 2V4JB 3ULHA 2DCLA 3M2VB 2LA6A 1GQEA 1FKPA 2WSCC 4N76A 4FN5A 3A4TA 4ED0A 1WC5A 2YWEA 2KRBA 2V2QA 2YKPA 4DV1J 1GEHA 1J5OB 2CPXA 4LQ9A 1UFLA 5KG3A 1D1UA 3HI9A 2ZZMA 3VVUA 5H9FJ 1TKDA 1GH8A 1JLAB 4RJVA 4LSNB 1TL7B 2VFVA 4B3MJ 1RWOB 4GKKF 4JV5F 1MN7A 4MT1A 4LVOP 4OYOA 4I67A 4BDPA 4ID5A 1HBOB 2HVHA 1M5KC 5B0DA 1GX6A 1OQ3A 5J2PB 1HBNA 2ZOGA 4WF9Q 2B5JA 2JEJA 3CO9A 1RAHB 3BM7A 4JI4J 1GNKA 3KUEA 4U9RA 1R6YA 2XLKA 1JKHB 1RT3A 2UXCF 2LA4A 3HSZA 4DX5A 1BQMA 1BY9A 5DZ7A 2HFSA 2AWZA 4NWBA 3OL8A 3NNCA 3MXHP 2QE5A 2HBZB 1RTHB 3NEKA 3Q2SC 2HQ3A 5KFJA 1H73A 1QUVA 4LRDA 1K0VA 2G4BA 1WF2A 2MJUA 3NGDA 4AT1B 3R5DA 3LTOA 4M94A 3TAPA 3AODA 2VQEF 1YJUA 3C66A 2ZDPA 4C8MA 1HBMB 1NKCA 1U49A 4JI0F 1C0UB 5IWAF 3V81B 2RIJA 1FEEA 3FQLA 2LLZA 3IA0A 2FJBB 2PI4A 4K5RA 2ZWOA 3I0RA 2FHMA 4MMOA 3OJUA 3JQKA 2HAFA 2GQCA 1NHKL 2ZD1A 5DG7A 4TU9A 3RG6A 1V6HA 2N3OA 2B7BB 4KYZA 1TL1B 3G6ES 4C97A 1FFSB 3MOZA 1FXRA 2RRNA 5D78A 2CQ3A 4LF9F 3ZC4A 2MKKA 1H38A 4C0BA 4USJC 2FC9A 2UVWA 4F4KA 3R3TA 1WKLA 2BJ3A 4OX9F 4DDFA 3M8WA 2GMJA 3MPYA 3JTNA 1CS4B 3GP9A 3D54A 1UVIA 2XG8A 1IJFB 2P8IA 4RR5A 2YQ3A 1U1LA 2X1BA 4LFCJ 3C6TB 2O01C 2F8EX 5ETQA 3UE2A 3H7HB 4ZLLA 3RW6A 2GZOA 2Y3YA 1SC4B 5GADU 4LRCA 4ETZA 2C2ZB 2UXDJ 2BKPA 1VQ5S 5GVQA 5C7PA 2RH3A 3KLIB 4C8ZA 4OQJA 4XDCA 1M5SA 2RS2A 4AQYF 3CJTA 4K4UA 4B17A 1FI4A 2VKRA 4Y65A 5K20B 3J81U 4E8UA 8AT1B 4MK8A 1EARA 4UUWA 1HHTP 1EKRA 2WONA 3CF5Q 4K4SA 4CO2A 3CCMS 1UA1A 3DLGB 3DU5A 3PACA 3UQSA 5BR8J 2F3JA 1FDAA 2ZOMA 4KKOB 1X9WA 4PG6A 1RT5A 3L7OA 5HMYA 4G6VB 2UXBF 2DVIA 2QMUB 2HZCA 1N56A 3ILIA 3A12A 1SC3B 1FESA 4JBCA 4YEAA 1E6YB 2GIQA 3KOAA 2MKSA 1MW7A 3NOCA 4G1PA 4IFYA 4MTPA 1SKSA 3BH6B 2PD1A 5L1IA 4B9NA 2QEXS 2HQCA 4CO1A 3H8YA 1DAXA 3W1YC 4GO7X 4PPZA 3MR3A 2N7CA 4QYZK 5JUMA 2ZFHA 2NR0A 4A4JA 1REVB 4NXMJ 1ZOTA 5IT4A 3PIOQ 1P6TA 2R8GA 3I32A 4ZP8A 4PRFA 1ZTTA 3ZZOA 3LOUA 5C25B 2DCUB 5DM6Q 2HNDA 2E1AA 1RT4B 1CJVA 5GAGI 1NMEB 3DLJA 3ISZA 4O4GA 3TVKA 4BC7A 2LDIA 3HFZB 3LP2A 2IM1A 1UMJA 1T8EA 2X1AA 3MM7B 1TV6B 2X1GA 3IWNC 1WOOA 2CNNB 5HL7Q 3FC9A 2MQNA 4DN9A 2V2ZA 2HYIB 1IKWA 4PABA 2DRDA 4Q8FA 3M1VB 2F65A 1X60A 4JI8F 1U48A 4EWTA 4Y2AA 1U26A 4RW8A 5LXRA 2XI3A 3C14A 2VASA 4CLYA 5E3RA 1T05B 5K14A 1C4CA 4KGXB 1YKWA 2UV8A 2ZWPA 2QRRA 3HZEA 4AFFA 3JYTB 1JX4A 1FA0A 4UW2A 5H1SV 4QU6A 4WZMA 3BO2A 3LP0B 3TVZA 2B0GA 1F0XA 3DNCA 4KAIA 1TKTB 4OHYA 3OXGA 5K8PA 2OPRB 1Z1ZA 3U1NA 1RKJA 1WELA 4P74A 1UVLA 3G82B 2DGSA 3D3BJ 2R7TA 4K0KF 3FMBA 1YIJS 1U1KA 1CJKB 1LEOA 5CYJA 3IG1B 1ZPWX 3GIJA 3TUJC 1UVMA 4F8RA 3M9MB 4IQMA 5KFOA 2NYHA 2LQ9A 2VQFF 3AD7C 3L4BC 4DUZJ 3IM8A 1TK0A 5H9FK 3LQVA 1L5UA 2E9ZA 2DNZA 5HROB 4DV7J 2AT1B 1PJ7A 3K5OA 2DT9A 2DXEA 4IQXA 2ZZNA 2NREA 3LH2S 1SH3A 4OV6A 1WKKA 1B0PA 1S4FA 1OIAA 1Q5VA 5DGAA 3C6UA 3PRBA 4Q43A 1JLGA 4PZVA 3LW5C 3KTQA 1WOPA 3DMJB 4XK8C 2HKEA 5E3CA 2JJ4D 2CQDA 3D6FB 4ZVUB 4NCBA 3L9ZA 1DTTB 2DY9A 4LJMA 1VQ6S 4U96A 1JJHA 5HQLA 4FYXB 2J0QD 2G1HA 4I69A 2R2TA 3KMQA 4DR5F 1FK9B 5HLFB 3GFYA 1RP5A 5BYQA 3R27A 3M6UA 4NPOA 4EYHB 4YB1P 3MEDA 3HHLA 2RILA 1Y3KA 1NEEA 4EYIB 5CYMA 1BHNA 1EETA 1FD2A 3MCSA 2PIIA 3BGLA 1NPKA 2O3DA 5CXTA 1R0CB 4LIRA 4JI5J 2FIUA 1FHTA 5AXNA 3CMAS 5KT5A 1T02A 3V4IB 4C11A 3DRSA 2V4JA 3ZTOA 3M2VA 2HNZA 3IBWA 4K59A 3IWXA 3AB4B 4ZPCA 3T1AA 2BOAA 3HVRA 4WK1A 1KRPA 3L95X 5B0FA 2KB2A 2FC8A 1VBZA 3PR4A 1IBKF 1VGYA 4USWA 3JTOA 2G0CA 2BEFA 5I3PA 4YR2A 2AYEA 2L9DA 5KG2A 3MURP 1I94F 4DV5J 1TL7A 2OPPA 5I3UB 3DOKB 3GIMA 3B82A 2I38A 2BANB 4F3QA 2K7KA 5L1KA 3LGMA 1Y4ZB 3HXMA 2DR9A 5DDRC 1HBOA 3E01B 2Z2YB 3VGTA 2XWYA 2X3DA 3RR7A 2C2DA 2XCPA 1N88A 4G65A 2HHVA 4WBFA 3ZFVA 5J2PA 2XULA 2Y8WA 1DHMA 4TN2A 4HH0A 3MCNA 1XBWA 1NH8A 5FDLB 4ZHRB 3P8BB 4DF4A 4ER8A 1QE1B 3UW1A 4HH1A 1FJGF 3QMQA 1YRXA 2ZC4A 2N82B 3DCAA 4I4BA 2Y1RI 4F4XA 1JKHA 3RBZA 3AT1B 1SXLA 4UF4A 3O44A 2VBXA 1LW0B 2W8KA 1PYOB 3CCRS 1RTHA 3MTJA 4M5NA 3KJQB 5A2QU 2K8GA 3V6JA 5A0YB 3GYXB 2DTJA 2V8DA 1NDKA 4C48A 4I6WA 2YKNB 2BR0A 3M8YA 4TLRA 1MSWD 2KG0A 1X5PA 4LUBA 1WDTA 2EG1A 2JL9A 4UT4A 1HBMA 1IBLF 4CLPA 1SL1A 1C0UA 5IV4A 3V81A 2CA9A 1G6BA 5ETOA 4C8YA 2HBRB 5ETSA 1Q7LB 3HSGA 3OHAA 4O44B 1S79A 3Q2TC 5E41A 4W4MA 4ED6A 1HNIB 2FTRA 1VRTB 1Q7YT 4MYUA 5HMZA 4NLSA 3K7RA 2QMXA 3VAMA 1U0SA 4HLBA 2MPUA 1SVDA 5FLXU 3BN4A 1SJ4P 2Y1JA 1TL1A 4IDKB 2ADBA 2VF3A 2EFVA 1URRA 3EDQB 2HHHJ 1QLNA 1UJ5A 1F60B 4F67A 5AXLA 1ZS6A 5KFCA 3CULA 4DV4J 2QLBB 2I9SA 5M2RA 4NYPA 3KG0A 4EGLA 2D9OA 2PFDA 5CZVA 3ITHB 3MAHA 3A3PB 3U7JA 5DGBA 3OTDA 2R2SA 2CXEA 4OZ2A 1UP1A 1DBDA 5EHHA 1CS4A 4PXCA 1S6PA 2BE7D 4HACB 4MK7A 3K8VA 3C6TA 1S48A 3O2IA 4A8XA 3G6VA 3K57A 3MECA 2HGNA 4DPTA 2H5JB 3Q8RB 1O5JA 2KYZA 3QT5A 4NYZA 5KFNA 1PC4A 4JI1F 3QWPA 4OI4A 3KLIA 1U2FA 3QATA 2AHOB 4N47A 3DRRB 4USHA 3K5MA 4N8OA 4JI3J 1RJJA 2R7OA 2HS4A 2RSQA 4U67Q 3HHKA 5K8OA 1D9AA 3QRPA 2XSFA 4FS1A 4KKOA 1GT8A 1Q82T 1MN9A 2KJWA 4DEZA 4ED5A 4N56A 3W60A 5F8LA 3HO1A 5K8NA 1VQOS 1Q8BA 3G6YA 5FD1A 4NA1A 3UD3P 2Y1LB 3IGNA 1E6YA 4B9MA 2AMCB 2QGFB 4Q0BB 3BJYA 2DHGA 2Z2MA 5MAOA 3CD0A 4KGVB 5KFPA 3EGWB 2AJ0A 2EKNA 3OHBA 1SC6A 4DOZA 4DV2F 4GVLA 1QAYA 4QZVB 3R5BA 3CC7S 1KHWA 3FSXA 2EFGA 1R8BA 1W25A 2RS8A 3SDEA 4CP5A 3WC0A 2XSJB 1XWLA 2JVOA 1D8ZA 3NBPA 4HHJA 4HVZA 5C25A 3J7ZT 2NXJA 2BM0A 1RT4A 2DO0A 1S76D 2YTCA 1IKVB 2UVVA 1S1XA 3K5PA 3BR9A 3HFKA 4QU7A 4QW9A 4FBTA 3MM7A 2XMWA 1TV6A 2A2CA 3IGVA 4J9VA 4Z7CA 4O3RA 4A8FA 2E1RA 3CJ3A 1NAQA 2J76E 3V6KA 3UCGA 2JVRA 2WVDA 5DO2A 2MLXA 1T05A 3ZZ0A 2DNRA 2PE8A 5J2QA 1LWEB 3PJXA 4LFBJ 3GSIA 4LF5J 5F8NA 1ULRA 3GU0A 2J9CA 1YLXA 5K8MA 3DXSX 2M3DA 3HCXA 3LP0A 2BVZA 4F36A 2XS2A 3UN3A 2BMBA 2ZM6J 2HSEB 3R2DJ 1ZZNA 4IG3B 3ENAA 2L08A 3G82A 5JVGQ 4FKYA 2AJFE 4MJKA 3TP2A 2YH0A 4LF2A 2ZH7A 4JUZA 2AGOA 4ZVRB 2FGCA 3AH6A 2O5DA 5KFXA 2FVQA 4J7CA 2JFDA 3VZIA 4BCAA 1SB6A 4DV6J 1TKXB 2KTQA 4P73A 5F8JA 1IR2A 2KU7A 3DDKA 3F44A 3BKTA 3JAMY 2XEXA 2DGVA 1SJRA 2QA1A 5FJ4A 5KFYA 1KQKA 5HROA 3CDWA 4HT5A 5EUHA 4USIA 3HD2A 1SIZA 3P49B 2F4VJ 2IA0A 1BWEA 3OT9A 2B43A 1YHQS 4JP8A 3S01A 1R89A 5CHCB 1NK5A 1HNVA 3OFEA 5AXMA 1L3TA 4LR8A 2AGQA 2EFOA 3H25A 3DMJA 2RT3A 4B3OB 3FUYA 4PG5A 1IJEB 2YQ0A 4M5HA 5DRKA 3HHNB 3G2XA 1JIHA 3NP5A 2AZ1A 4K8RA 3MPUB 1M5OC 1UJ4A 5IT9U 2GW8A 3H90A 1FFWB 1T3OA 2CYYA 2W7OA 3GV5B 2YPZA 4ITSA 2DGWA 2DKOB 4O3OA 4DV0J 3TX0A 3JSYA 3PDNA 5DDQC 2M8DB 3KKFA 4ZS6A 2FYXA 3HVWA 4IH6A 3UVJA 4H4MB 1FE0A 2JNJA 2ASYA 4X64J 3W2WB 2XB2D 4E0DA 2XMKA 3B4DA 2RRAA 1S1UB 1WI8A 3OD2A 1TAQA 5ETLA 7FDRA 4UOHA 2M52A 4OJ3A 4C9DA 3AOCA 1CULB 4YB6A 4ZKAA 2RDDA 2KH9A 4DBQA 5JMNA 1N0VC 4C8NA 2E5LF 1ACMB 1S57A 1JLBB 1LFPA 2UVRA 3KLGA 3NGKA 4XIUA 7FD1A 2NXEA 4NASA 2PEBA 2AX0A 1YTYA 4M95A 2HAIA 4DCJB 3IAM9 4B9LA 1RT1B 3RAQA 1SUQB 3VHQA 1N4LA 1RWVB 1JXEA 4JI2J 2CNLB 2E5GA 2IDEA 5I3UA 1KEKA 3FMWA 3N0VA 4PCQA 3TZZA 4A8QA 4R8UB 3VVTA 1H74A 1NJYA 4H4OB 1UPMB 5HATA 1GMWD 1VS3A 1CLFA 5IT0A 3I0SB 4HYKA 4KO0B 4I0WA 1RAFB 5LSLA 1ZAWA 1WC4A 2G0IA 2GCFA 5B08A 2KT2A 4AUKA 1UWBB 3CT9A 4NE9C 4XDDA 2WSEC 4NLGA 5FDLA 3VR1A 4IRKA 4ZHRA 1CJUB 5M2UA 2E5JA 2BE9B 4Z37A 2W2OP 1DQ8A 2FLPA 4DR3F 1WC6A 1QVFR 4C8KA 1Q8LA 2ZKTA 3DLLQ 1LW0A 3LO3A 2J7KA 4NMXA 4D3HA 4ECSA 5DETA 2V0NA 3M6XA 1SIWB 2WOMB 2A18A 2DHHA 2DHSA 3DLEA 1ZM2A 3GCWP 5A0YA 3GIRA 3UWTA 1FKOB 4LREA 2JC0A 3DOLB 1PO6A 3CCWA 1H98A 5I4MA 2HLUA 2DXDA 1U09A 3CDEA 1UJ6A 4OYIA 4ZLNA 3G87A 1S1VB 3TR5A 4OZ1A 4YMEA 3KMSA 1NSAA 1U8SA 4LIWA 3D6HB 4OYAA 2CQHA 4NLTA 3H98A 3TUZC 4P71A 3PCOB 3OL6A 4Q45A 1FNMA 3V6DB 3Q0AA 1D8YA 4DR6F 2J9DE 1VBXA 2XMAA 1IVZA 4O44A 3OFFA 2POKA 4YN3B 1HNIA 2J8AA 1VRTA 4GRSA 3IP0A 2HHXA 2B4PA 4FF1A 5KT7A 3KG4A 1A6LA 4B3TF 2H4YB 3WBZA 1WEYA 2F5GA 1N33F 4WTOB 4NA2A 5ITHA 2UXCJ 1SBRA 2JSXA 2OEJA 3GR0A 4ECVA 1VR6A 3EZ5A 2PA8D 4DL7A 1RTIB 5M2PA 5ETPA 4AL7A 2CKWA 3CVKA 4CO5A 2MQQA 1HD0A 1TAUA 1XNQF 5T41A 3ITHA 2VDIA 4OZJA 3SYZA 1I6JA 4ZVFA 2CZVC 2M9KA 1HWUA 1ZA2B 3KJFB 4RBVA 1V9OA 1RA7A 4R25A 1WC1A 4KQZA 4HACA 2VQEJ 1WI6A 1VQ7S 3I4HX 1W2BR 5AE2A 4LQ3A 4R0JA 1NJIT 3BH7B 1QJHA 2E5IA 4L76A 2O66A 3N4WA 3HKZD 2OMOA 3J81Y 5CCLA 1SKRA 2W1BA 1VLOA 4A47A 2P2CB 1RABB 4C8OA 4CLWA 2Y1IA 2BA9A 4ZDNA 1WHXA 3BSOA 4HI2A 4LF7F 3DRRA 1K0TA 2VJVA 2CPDA 4HI1A 2RU3A 2KL8A 2C2KB 2CJXB 2DK2A 2HRUA 1DURA 4NRTA 2R8JA 2JC1A 1UKUA 3Q83A 3CJQA 1WF0A 4DUTA 4CH1A 4I6YA 3D67A 3MCMA 4X4UA 1HL6A 1YVFA 2GV1A 1F5BA 1RLCL 4B3SF 2WBMA 2WVBA 1UTAA 3KLFB 3PW5A 4QWDA 1S6QB 4Q0BA 4LBHA 2NS1B 1AFIA 3WX8A 3KLHB 4YP3A 1MWZA 2W01A 1FTRA 1SH2A 3NMRA 1XMOF 4LRBA 2MQOA 1HMVB 4URQU 4OFZA 1UWAA 2DRBA 1S6OA 2DD8S 2JEGA 2A10A 2XSJA 2QA4G 3FCHA 2HZAA 2VH7A 1FCAA 4GKJF 3IN5A 3T3FA 1Q8IA 4ZVEA 2GMHA 3CCTA 2PEHA 3NY0A 3RUBL 1AUDA 4C3MA 1Z2LA 2YBVA 1KQSR 1XN9A 2VJUA 1IKVA 1CC8A 1XNRF 4AQYJ 1RHMB 3CEDA 2UUCF 2ZHAA 4QJVA 2C3OA 3MM6B 1EQMA 4RNFA 5LMUF 1T9WA 2WAQD 2KVQE 5LJ3Y 1CC7A 3EGZA 3EDRB 4PXDA 1XEZA 3R5CA 4WJBA 4DR2F 2V2KA 2WTFA 1VI7A 4ES1A 1LQ9A 4ILMA 2NUHA 4ILLA 1EAYC 1LWEA 3U1LA 2RQKA 2EG2A 3OTEA 1OSDA 1BC6A 2F63A 2XY7A 3GFXA 3NCRA 2IA6A 1H3DA 2F8MA 2IC3A 4C8LA 4J9LA 1O51A 2W2QP 1G1XA 2DYAA 2PMZD 3PRVA 3N5BA 3I55S 4IG3A 3QYYA 3K0JA 3PX6A 2QMWA 1VK8A 4UY8T 1B99A 2Z0GA 4R0EA 1UZHA 2VOOA 3HJFA 1TKXA 3K5LA 1DQAA 4X4OA 4PR6A 2PA3A 2Z8QA 2D3O1 1OO0B 2EKYA 1V3RA 2R7QA 1WTBA 1P1TA 1HWIA 3RBXA 4ZN3A 3OV7A 4EO6A 4HTJA 4QQBA 2W4PA 3C2PA 3NGSA 1R0AB 1VBKA 1TKZB 1EIYB 2DNNA 3ONQA 4CM0A 4JI8J 2APOA 2AV5A 3G71S 4UQTA 2JLGA 1A0OB 3D0GE 1REGX 2W8LA 5E3AA 1RAOA 2Z56B 3BR8A 4B3OA 5KFAA 5F3ZA 3T9NA 5KOWA 4AYBD 2AJ1A 4W92B 2MSSA 1JLQA 1T03A 5B0CA 3EPGA 3H4DA 4TYAA 3H4BA 1QSYA 4NI2B 2OPQB 2VFUA 4CH0S 3LPYA 3KFWX 3BBFA 5E33A 4O3NA 1NK9A 4JI7F 2Y0BB 2W9CB 3MMJA 1RAAB 1NZ8A 1DARA 4H4MA 4C4WA 3UR0A 2OD6A 3AOAA 2FJAB 2YKOA 3W2WA 4WKYA 4CIOA 3JSMA 1S1UA 1L3KA 4IRCA 3H2UB 2DNOA 1QVGR 3PO4A 4A48A 4I7FB 3L7UA 2LEAA 3EYZA 2D3ZA 1HHSA 4J9RA 1CULA 3A8KA 2CQGA 4DWIA 1AA1B 5J2NB 3KK1B 1HLWA 1XERA 4DL3A 3K58A 2LYVA 4USTA 1HQUB 2OSQA 5DDPC 5HVFA 4C3KA 4ELUA 2HIQA 3IXQA 3DRYA 5CYQA 2B6AA 4Y28C 1RT1A 3VQSA 4FYWB 1SUQA 1HHQA 2AU0A 2YWFA 4U7UK 2V69A 1YITS 2CPFA 1TQLA 2V2VA 4NZ0A 1HA1A 1IXKA 5EGYA 2YWHA 3PYEA 1L3SA 4BLGA 3R5JB 3AQOA 4R8UA 1O0PA 2CZ9A 2MQLA 1GTEA 4H4OA 2EFNA 2IYIA 2DHAA 4JI6F 3HT0A 1T0TV 5D4OA 3I0SA 5HJXA 4PAAA 4KO0A 3D3CJ 1LNQA 4C98A 3GB0A 3WX4A 1UWBA 5LSOA 4ZJOA 4Q8EA 3NGUA 2H65B 2Q43A 4YHHF 4DV3J 2XGQA 3A3OB 1FXLA 1FTCA 1HWLA 3MMAA 4Y2IA 1RACB 4ZITA 2W24A 1OYDA 4AXJA 1EP4B 2V8VA 5D0RA 5A2QY 2NZCA 2DR6A 1HNWJ 3BSAA 3Q86A 4WPAA 5F8HA 4N77A 2WRMA 2HHQA 2JHEA 2WOMA 3VGSA 2FJXA 4YOEA 4LBIA 1N5QA 3PJWA 1RHRB 2K2PA 3OVBA 3JQJA 1S7IA 4DU8A 4K4TA 3HX9A 3D1HA 3MEEB 1FKOA 3DOLA 2MZTA 1NSKL 3GZ7A 3NXZA 5AJ3F 1IBKJ 4P9SA 3FCVA 1FJ7A 3RU0A 1I94J 4LR9A 1U2CA 4N7TA 1S1VA 1U8WA 1IQZA 2FD2A 2QJ3A 1T95A 1U1NA 3J7YI 3ISNC 3JSBA 2UU9F 3MUMP 2M7SA 5DS7A 3T5HA 1KQFB 4BHQA 4B9TA 2IYGA 4X62J 2MKHA 2ILZA 2ZH9A 5D77A 2MY7A 3V6DA 2HURA 2OO4A 4IUFA 3E51A 2B8PA 1S77D 1P8GA 5FLXY 3LUYA 1UZDA 2C28A 4A8SA 3AD9C 4NZ7A 2PMHA 2UP1A 2NUUG 2HFUA 3QAEA 1VQMS 2IRYA 4NLXA 4EBCA 3GV8B 2BACA 1J27A 2NXUA 2ROGA 3HJVA 2ZVSA 2OJ3A 1RTIA 2LXFA 2DIVA 1AW0A 3R9LA 5IC6B 3W61A 4F4WA 2MEWA 3FJ2A 2D69A 4UOCA 3BV8A 1ZAVA 1T7PA 2GJIA 2DPJA 1U1MA 5E5NA 4C0HA 1N54B 2MMYA 1RA6A 1QAXA 2CVIA 3S1TA 3LWLA 5B0BA 2JLEA 3A13A 4ZA1A 3M2RA 3DYAB 5MLCV 1RBLA 2MGZB 3QT7A 5IZHA 3VZHA 1IBLJ 3VALA 1FE4A 5KFSA 3FNNA 4ZJLA 2J9EA 3FEYB 2UUBJ 2YXLA 2GJFA 2YNIB 2P9EA 1AZSB 3FEZA 4PWUA 3WZ0A 4FF2A 3D0IE 4M5DA 2EK6A 4R5PB 3PNIA 2QL7B 1WJ9A 1N5TA 3SSRA 4QIFA 4ZPDA 1RLDA 1NJZA 3MMBB 1IQTA 3N01A 4DQSA 1DLOB 4RKUC 3Q8QB 5L39A 2LEPA 2Q6CA 4QWBA 4PKDB 1SH0A 4WU2A 4Q2LA 5KFLA 3U27A 4IFVA 1KLMB 3D4JA 2HQDA 2J8SA 3CDBA 1YJTA 2VUGA 3X1LB 1JXVA 2CDQA 2IM0A 3CO0P 2ATCB 4RWXA 4QIVA 4WZQA 1QDUB 4I2PB 3KLFA 4DV1F 1S6QA 2IFXA 3HP6A 5GAHI 3DU6A 3E8OA 3D6MB 4I2QB 3KLHA 4ID8A 3DC2A 3MTKA 3VAKA 2AKWB 3IWLA 1CVJA 1JNZB 2Y0SD 3Q8UA 2J6SA 2FVCA 2XYPB 5A6WA 1MLAA 3SCJE 2BQRA 1UW4A 4LF8J 1W2IA 3OLAA 1KLNA 4NL5A 2LDYA 5GAEI 1R0BG 4ZVSB 3IRXA 3MM6A 4OJ1A 5CABA 3G86A 3EJMA 5DJBA 4H4KA 3MR5A 4IOAQ 4WIQA 4LF4J 1UEKA 4KHRA 3AA9A 1UAWA 3UDCA 2IMWP 3THPA 2GIRA 1KONA 4WE1A 2GAGC 1RQ0A 3TJ8A 1IUJA 1DY3A 1GMVA 1X4FA 3CJ2A 8ATCB 3BKFA 2OTLS 5DG9A 2YX7A 2SXLA 2KZMA 1N6QB 3PRDA 2DGUA 3PW0A 2CZ4A 2R2UA 3QLHB 8RUCA 3PXGa 1S9FA 4RW9A 1TL5A 5HMWA 1WWHA 4OZLA 1YI2S 2OMLA 1ZBTA 1NBEB 2HW3A 3QNWB 3MR6A 2WHOA 4HEA9 1Y3JA 5KG7A 3BDEA 1VC5A 1OJ4A 4ZP6A 4ZVPB 1U7LA 2I2YA 1GXUA 5HK4A 3AOBA 4FYDA 1YDLA 4LF6J 5KFVA 1WEZA 3G9CA 4KPYA 1TMJA 2VHGA 5K9FA 1D9DA 4J91A 3THVA 3UD5A 1TKZA 4FNIA 1EB0A 2I0XA 4DSJA 1CJTB 5CA5A 4PUOA 1YX2A 2AYBA 3R1LA 2XZWA 3CIMA 3LP1B 2HQIA 1XC9A 1RWPB 3R5GA 3NNAA 2RRBA 2QYCA 5F8GA 1U1QA 3MHYA 2KDOA 3T1YJ 3WHIA 1D09B 2RNEA 4LR7A 1GXTA 4DCOB 1FVSA 4LRFA 4P6QA 3V2UC 2JOQA 2E9RX 5I42B 5A8WB 3KLVA 4RL1A 3T41A 1VOMA 1KOOA 3N9UC 2DH8A 2K06A 3PY8A 4CNYA 1URNA 4I1TA 2CG4A 5IS2A 4NI2A 2QIFA 1SKUB 2OPQA 1HQ2A 3JAMU 1LXNA 3HM9A 2W9CA 2ZUGA 4NOHA 3N6MA 1RU1A 4J9NA 5D4NA 2DGOA 3HLUA 1YSJA 4DUYJ
chains in the Genus database with same CATH topology
5J2QB 3J7YU 4GC7A 2O67A 4G1QA 4KBIA 2EBEA 1PGZA 4IDKA 4KKOA 1GT8A 2WCXA 3ENWA 2KJWA 3MD3A 3OR2A 1ZYQA 2N3LA 1Q82T 4DEZA 3OLBA 4ED5A 4N56A 3QJLA 2VB6A 4XAKA 2CPYA 3K5NA 4ZMMA 1XR7A 4DLEA 5F8LA 2CQIA 2XBPA 3VAFA 1VQKS 4KJIA 2RB7A 3HO1A 1QSSA 3KNGA 3QPIA 2LU2A 5K8NA 1VQOS 4I7FA 1Q8BA 2W4DA 4A8MP 3G6YA 5FD1A 5A8KB 2J9DA 4NA1A 4WFBQ 1HPZB 3UD3P 2KXNB 1HBNB 3GSDA 3IGNA 1E6YA 1ELOA 4B9MA 3NL0A 4QR0A 4DQIA 4Q0BB 3NCQA 4MYTA 4CTAA 2VBWA 2DHGA 3BJYA 2DGQA 3KK1A 2RKIA 2Z2MA 3T6JA 1XMQF 4ZVGA 5MAOA 4TQRA 1U6BA 2E9RX 3CD0A 5KFPA 1C0TA 3EGWB 2AJ0A 1SL0A 3IR6B 3OHBA 1SC6A 3ETOA 3H5UA 5SUHA 3LWMA 4DOZA 4DV2F 4ZCLA 4DS4A 1AFJA 3I82A 2I5JA 3BSNA 1QAYA 2YKAA 1HQUA 2OP5A 2L3MA 4QZVB 3R5BA 1HWJA 3GIIA 1HR0F 1N48A 3LANA 3BREA 2VFRA 2VOPA 3CCQS 3CC7S 1KHWA 3FSXA 1Q86T 2EFGA 1R8BA 2LVWA 3OXFA 1W25A 1RT3B 2RS8A 4MIAA 3SDEA 2LU1A 2RD5C 1Q16B 3WC0A 3BQ0A 3M8PB 2XSJB 1BQMB 1XWLA 4DL4A 2ZOFA 4RW4A 2JVOA 1D8ZA 2D74B 3CWJA 5EX3A 2NLWA 3NBPA 2OPSB 5JXSA 3K8WA 3BDPA 4HHJA 2VONA 2HHPA 3AAWB 1N5YA 1DZ5A 4NX9A 2Q66A 4HVZA 4ZPAA 5C25A 2BRKA 2CJ9A 1X5SA 3PEHA 4FP9A 2IRUA 3SMZA 4K4VA 3M2UB 3HHLD 3J7ZT 1OPIA 3ENVA 2UZAA 2BM0A 1S9GA 4ILRA 1RT4A 2DO0A 3RRKA 2WBRA 3RZAA 3TAMA 1S76D 1RAJA 2ZBCA 3CDAA 3ENQA 4F25A 4Q5VA 2V4RA 4OX6A 2DR7A 1YGYA 3G8QA 3BGRB 1NO8A 2YTCA 1X9SA 2J0XA 1IKVB 2UVVA 3H5YA 4KV8B 4NLUA 5LXYA 1S1XA 3K5PA 3IRWP 5D4PA 3BR9A 3SI8A 2V8GA 2WW8A 5A8RB 3HFKA 2ZH2A 4QU7A 4OI0A 4JYAF 3PIPQ 5LSRA 2UVUA 1XTZA 2WB4A 4QW9A 4FBTA 2FJVA 4RNMA 2HG4A 3CE8A 4JOUA 3MM7A 4M63A 5J1PA 2XMWA 1TV6A 3BF4A 3MMCA 3WC2A 2A2CA 3IGVA 1O8BA 2YKMA 1S6UA 3GG1A 3GWCA 3RAXA 1HNVB 1S97A 4O3RA 2ZKUA 3HDSA 4A8FA 2E1RA 3CJ3A 2J76E 1FRKA 1NAQA 5B7WA 3V6KA 4ZP9A 1NNDA 3DFEA 2VL1A 1MNEA 1CEZA 3UCGA 4BWJA 2JVRA 3TA0A 3QGPA 1R31A 4FPRA 1FRXA 1ROFA 1VLYA 3N6LA 4OLOA 3MM9B 1RDRA 1R8AA 3AJ2A 4O0IA 4X4SA 1OQ6A