4LSLB

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj476), a non-nucleoside inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
428
structure length
417
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 103
structure length 417
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lslB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslB03
3JSMA 2OPQB 4ICLB 4NLUA 4J9QA 4RW6B 4ZPBA 5C5JA 4QPXA 1JLAB 4ECQA 5F8LA 4I2QB 4O44B 5KT7A 4RW4B 5KFYA 2ZE2A 1S0MA 3DYAA 4NZ0A 3KMQA 4EYIB 2BE2A 3DM2A 2AU0A 1VRUB 2OPPB 3M9MB 2VG5A 3NBPA 1XR6A 1HNVB 4NRUA 4NLDA 2D3ZA 1RT2B 2HAIA 4Y3CA 3HKWA 4IRDA 2YNFA 3SFUA 1C1CA 4F4ZA 1QAIA 3KHGA 2WONA 4G3IA 1IKYA 4RW7A 4RW8B 5HLFA 3IN5A 1WNEA 3MTKA 4EO8A 2WOMA 3M9NB 1CSJA 3DRSA 2D3UA 2VG7A 1SH0A 2WK4A 4K4WA 5L1IA 1RT5A 4ED2A 2R8KA 4MIBA 5KT6A 3GYNA 4IOBA 4TY9A 4TYBA 5J2QB 3MEEA 3I0SB 3OL8A 2IC3A 4KV8B 1YVFA 1R0AB 3PHEA 2ALZA 4IR1A 4DL6A 4ICLA 3TVKA 1RTHB 4H54A 5C25A 4HYKA 1RA7A 4Q0BB 3IS9B 4XPEA 2HWHA 3DRRA 2XCAA 2UUTA 4FS2A 3FQKA 2V9WA 3UR0A 1QE1A 2VG6A 5I42A 3T1AA 3V6DB 4FBUA 4O4RA 3KLFA 3NGDA 3KLFB 2BQUA 1RYSA 3GV7B 1JLFB 2HNZA 1GX6A 4LSLA 1LWCB 2ZD1B 4Q8EA 1C2PA 3IRXA 2QV6A 3UQSA 4JV0A 1JLCA 3NBPB 2XGQA 4LQ9A 1S0OA 1HPZA 1KLMA 5KFSA 2YNHA 2YNGB 3DMJA 2WB4A 3KNAA 4KKOB 3D28A 1DLOA 4QWAA 4PUOA 2OPRB 4ZPDA 3KLVA 2BRLA 5L1KA 1TKTB 2V0NA 4DL5A 4H4OB 1OS5A 3KHHA 3RB4A 1RT6A 1S9FA 4FBTA 3QGHA 4NLSA 4Q45A 4B3OB 2IM2A 3H5XA 3DRPA 3CJ5A 4NLYA 4IFYB 5CYQB 1JLQB 4Y2CA 2HMIA 3V6DA 1C1BA 3CWJA 1QE1B 2VG6B 1S1UA 4TY8A 3BR9A 3G6VA 2AX0A 3QZ7A 4RZRA 4JUZA 4O3SA 4ZPCA 2BE2B 3DM2B 1IKVB 2FLNA 3KK2B 1IKWB 1C0TB 4YP3A 2W9BB 5J2NA 3V6HA 5KG1A 4F50A 5KFEA 3BGRA 3IGVA 4RNFA 1S10A 2E9RX 3H5UA 2FJWA 2IM0A 4KFBA 4FS1A 1JKHA 4TN2A 1QAJA 3KLHA 2EC0A 4QWBA 3V81B 2FVSA 2R2SA 4IKAA 3DLKB 4IG0A 4J9OA 1S1WB 2FVRA 3T5LA 3EPIA 3H59A 1N6QB 4LQ3A 3C6TA 4TY8B 3OHBA 5J2MB 2FVPA 2J6UA 3LP0B 2VG5B 3H4BA 4KSEB 3FFIA 5KG6A 3DYAB 4KAIA 3VQSA 1GX5A 2ATLA 1SH2A 2YKNB 4K4UA 1RTHA 3DI6A 4IG3A 4RW6A 5D3GA 3KK1B 4IG3B 1XR7A 3HVWA 4O4GB 1J5OB 3ICLA 4ZVEA 1N4LA 3CDWA 4J9KA 2W9BA 3KK3B 3QLHB 3M8QB 2B5JB 4MK7A 1S1VB 5HROB 3E51A 3M8PB 3M9OB 3CO9A 2OH2A 2W9AA 1LWEB 3TAMA 4ECUA 2YNIA 1EETB 3KLEB 2HNYB 4I2PA 4MIAA 4U7CA 5KFTA 4ECWA 3RAQA 5F9NA 1LWCA 3C6TB 2W9CA 4GC7A 1K1QA 2GC8A 4DG1A 4NLVA 2R8GA 2YKMB 5L1JA 2YKMA 3DLKA 3FQLA 4EBCA 4LSNB 2AGOA 4X2BA 4PQUA 1S48A 1RT6B 4PWDB 3QYYA 3KHRA 4NLPA 1JKHB 2BANB 2B43A 3RB0A 2OPRA 5EUHA 4Q0BA 5F8IA 5KFDA 2J6TA 3GV8B 3LP2B 3DOKA 2ASLA 4NLWA 1Z4UA 2ZE2B 4K4ZA 3QLHA 5KFOA 3OSNA 4R5PB 4ED7A 4NLOA 3KK2A 3DOKB 4RW9A 2ILYA 3PJWA 3C6UB 4WXOA 3H4DA 5CYMB 2WRMA 3LALA 1RTJB 2RDIA 2C2EA 1S9EA 4RNHA 4Q8FA 4J9MA 1REVA 1HMVB 5C24B 4R8UA 3MFHA 1RTJA 1N5YA 5KFJA 4YR0A 3CVKA 2ZKUA 1S6QA 2RF2A 3MEDB 3CJ0A 1MU2B 3E01B 5KFRA 4IG0B 4DL2A 2IAJB 2ILZA 4DL4A 3TAMB 2IC3B 3PJXA 5J2QA 1TL1B 2CKWA 4RNMA 2V4RA 1IKXA 5KT4A 4I2QA 4O44A 2ASJA 3FSIA 3HVTB 1NHVA 1TP7A 2F8EX 4O3RA 2OPQA 2UUWA 3G86A 5JXSA 2UVWA 3KOAA 2YKNA 3SFGA 4ED6A 4NCGB 1S9GB 1S6PA 2XI3A 3PW0A 4WE1B 4U6PA 1IKVA 1XR5A 4ED1A 2IJFA 3BQ0A 3HVAA 3CJ4A 4IH7A 4ZP8A 1JX4A 2C22A 1FKOA 1C1CB 5KT5A 2AWZA 4RUCA 1RT4B 5EWGA 3MR6A 1RT2A 3SI8A 4JV1A 4JV2A 2XI2A 1LWEA 5K14B 2UVRA 4RW9B 2IA6A 2FVQA 4IFVB 3N6NA 4WZMA 1T03B 3M8QA 3V81A 2JC1A 5C42B 1HYSA 3KLHB 3BQ2A 2BQRA 4J9RA 3MF5A 1D1UA 3BSCA 3CJ2A 3MECA 5KFWA 4KKOA 5EWEA 4IH6A 1JIHA 1TL1A 4K4XA 1BQNA 1RTDA 4Q44A 1C0UB 1IM4A 3LAMA 2HNDB 4ECXA 4MFBA 2W8LA 4LSNA 2IAJA 2JLEA 5HBMB 3KJVB 1TVRB 5KFXA 4WFXA 5F8MA 4F4WA 5I3UB 1TL3A 1FKPA 1VRTB 5DLGA 4K4TA 2JC0A 5DQGA 2BQ3A 1RT1B 1LW0B 1W25A 5I42B 1SV5B 4K4VA 3RB3A 3I5BA 5KFCA 2AGPA 2I1RA 1S1TB 3CIZA 4MH8A 5KFLA 3PZPA 4ED3A 1J5OA 5KFKA 1LWFA 2JEIA 5D3GB 2VA2A 2IJNA 1RYRA 3QIPB 1DLOB 4QWCA 1RT7B 3NAHA 4DL3A 3PR4A 2YNGA 3DMJB 5FDLA 2VA3A 4IRCA 1KLMB 1HPZB 5K14A 3OLAA 2J6SA 1S0NA 3DRSB 2WTFA 2UVUA 3IGNA 2WOMB 1MU2A 3E01A 3EZUA 3CJ3A 4MK9A 4NLXA 5I3UA 3BSAA 1JXLA 2IM1A 5DGAA 1TVRA 1S1WA 5F9LA 2B6AA 4ZPAA 1RAJA 1HNIB 1JLEA 1U09A 5F8HA 3MR2A 5L9XA 3OSPA 1SUQB 2QE5A 4IH5A 4IR9A 4WFYA 1TKZB 3V4IB 2E9ZA 3QZ8A 2DPJA 4ED8A 4O4GA 1JLCB 4NLQA 3KK1A 4IQXA 4HKQA 4ZVFA 4NYZA 1RT5B 3H5YA 3MFIA 3V6KA 1N5YB 4YR2A 4TYAA 4TXSA 1ZTWA 1REVB 3LANA 5C24A 4TQRA 4PWDA 1DTTB 3DOLB 4RW8A 3OLBA 3EPGA 1DTTA 3DOLA 2WHOA 4ZHRA 2XCPA 4J9NA 2JEFA 1S49A 4B3OA 1SH3A 3IS9A 3GV5B 4URSA 3OL9A 3DLEA 5C25B 1TKTA 1JLBB 4XPCA 5HBMA 3MEGA 5T14A 4ED0A 3I0SA 4NRTA 1BQNB 4R5PA 4EO6A 3PW7A 2RDJA 5KFGA 1S1XB 3I0RA 1KHVA 1S1XA 1BQMA 3I0RB 3LP2A 2I5JB 1HQUA 3H5SA 4RW4A 3TQ1A 4IRKA 3GQCA 4DEZA 1JLGB 2RKIA 3DI6B 4ZP6A 2ZD1A 2IM3A 5DQHA 1HNIA 5C42A 1S1TA 4WZQA 1IKYB 1JLFA 1IKWA 1C0TA 4IFVA 1SV5A 1HMVA 1LW0A 4ZHRB 1LW2A 4IDKB 3N6LA 4F4XA 2AGQA 4NLGA 1S9EB 4H4MB 2W9CB 1NHUA 2GIQA 1RT4A 3BQ1A 2BR0A 2HNYA 4I2PB 2E9TA 5JUMA 4I7FB 4G1QA 5KFMA 5F8NA 1LW2B 4IDKA 4EEYA 5DG8A 4DL7A 2DPIA 5DLFA 1RT7A 3H40A 4GC6A 3ISNC 1C0UA 4KHMA 2IMWP 1HARA 1JLAA 2AX1A 3HVTA 3GIKA 1T94A 2BRKA 3NKYA 2W8KA 4J9PA 2JEJA 1UWBA 1BQMB 3GIMA 4Q43A 2HWIA 3FFIB 1RTIA 4KO0B 5J2NB 1FK9A 5KG4A 4YQWA 5EWFA 3MEGB 1TKXB 1EP4A 5J2PB 4ID5A 1TL3B 4F4YA 2WONB 4LSLB 2GIRA 3H2LA 3H98A 4KB7A 2R2UA 1TKXA 1FKOB 1EETA 3KLEA 2FVCA 3PR5B 4EBDA 2FLLA 3LP1A 3QO9A 1ZTTA 4QWEA 4ECSA 3M8PA 1TV6B 2R8HA 4RUAA 1S1VA 3D5MA 2OPSB 5J1EA 1I6JA 4QWDA 2D7SA 3Q8RB 3MR3A 3MECB 4ECVA 1T3NA 4H4OA 2D41A 4RNOA 5KFAA 3KHLA 4ECZA 2FJXA 1R0AA 4ECTA 4KV8A 3DLGA 1HYSB 4PUOB 1IKXB 1N56A 1MMLA 1RDRA 3PVXA 4QW9A 3IG1B 4MKAA 4KE5A 1ZETA 3FDSA 5KG0A 1S1UB 5J2MA 2BANA 1JLBA 4TLRA 1JLEB 1FKPB 2HMIB 3DLEB 2R2TA 5KFHA 4MKBA 2XC9A 1RT3A 4IFYA 5CYQA 2XWYA 5DGBA 3PW2A 2B6AB 4WFZA 5KG7A 3NAIA 1EP4B 1S6PB 3GIJA 2W7OA 4KHRA 3RBEA 4MK8A 3KLIB 2YNIB 3HHKA 2ASDA 2JEGA 3MR5A 3C6UA 1VRUA 4ZP7A 5HROA 4TQSA 5F8GA 4RU9A 3MEEB 1S4FA 4O3PA 4URQU 3QIPA 2W7PA 1T03A 2XGPA 4ZVHA 3V6JA 1DTQA 3JYTB 3MEDA 3G6XA 1S6QB 2RF2B 4WYLA 3Q8SB 4G1QB 4K50A 5KFVA 1K1SA 2OPSA 5J1EB 2CJQA 3BJYA 4K4SA 1JLQA 2R2RA 5DG7A 1KHWA 2V4QA 3ITHA 4J9SA 4EYHB 3CDEA 3T5HA 1VRTA 4WE1A 3T5KA 1S9GA 3BSOA 3DRRB 2C2RA 5CYMA 1RT3B 4M95A 1TQLA 3NMAA 4ECYA 5KFPA 3KJVA 2YNFB 3QIDA 2AQ4A 5J2PA 3GIIA 4Y34A 3N6MA 1HNVA 1S97A 3G6YA 2OPPA 1RTIB 4KO0A 4QW8A 1HQUB 1T05A 4WYWA 4RNNA 5DQIA 2B5JA 1TKZA 3PW4A 3KK3A 3QGIA 3BREA 3UPFA 2VG7B 3BGRB 3PW5A 3IRXB 1LWFB 3BSNA 5KFIA 5KFFA 5KT3A 2O5DA 4Y2AA 4RW7B 2HNZB 5HLFB 4PQUB 4EBEA 4O3QA 3Q8QB 4R8UB 1TV6A 3RB6A 5KFBA 3ITHB 3KLGA 1NNDA 2FJVA 4NLTA 5KG5A 3LP0A 3QGGA 5HP1B 3OL7A 3KMSA 5L1LA 4K4YA 4ZP9A 1N48A 1C1BB 4ZMMA 3FRZA 3Q8PB 1N6QA 3GILA 3KLGB 4URGA 1QUVA 3IG1A 4R0EA 5KFZA 1DTQB 4ID5B 3JYTA 3OHAA 4NCGA 4MFBB 2HNDA 3T19A 1FK9B 1RTDB 5KG2A 3T5JA 4O3OA 1HQEA 1JLGA 2RKIB 3LAKA 2R8IA 4J9LA 3V4IA 4NLRA 1UWBB 3JSMB 4YMEA 4ECRA 4OL8A 3OL6A 1SUQA 2I5JA 5KG3A 3I5AA 3KLIA 4O3NA 4XO0A 1T05B 1HQEB 3RAXA 2YNHB 1RT1A 3LP1B 3QO9B 3UDLA 2IBKA 2R8JA 4M94A 1D0EA 3I5CA 4YR3A 2C2DA 5F8JA 4DG1B 4ZVGA 2UVVA 4I7FA 3NL0A 5KFUA 5EDWA 5KFNA 3DDKA 3RBDA 2FLPA 2C28A 5KT2A 4H4MA 2WCXA 5HP1A 3DRPB 4WXWA 5FDLB 3CDUA 5KFQA 4KFBB 5DG9A 3ISND 1RA6A 4KBIA 3DLGB
chains in the Genus database with same CATH superfamily
3HT3A 2QT7A 1RSCA 4DPYA 4PYDA 4OYZA 4LF4F 3R3TA 4O44B 3HX9A 3H2UB 2ZE2A 2MDAA 4HTIA 1Y5IB 4NZ0A 1YDLA 2BE2A 3DM2A 3D3BJ 1VRUB 4C0OC 1NK7A 3BBBA 1Y5NB 2D3ZA 2DCUB 2KL8A 4Y6IA 4W90B 4F4ZA 1J5EJ 3KHGA 2AMCB 5H9FJ 4C9DA 4G3IA 3IFEA 1LFWA 4KTQA 2IMOA 3LGMA 3WBZA 4RW8B 2PA3A 2CZ4A 1PSDA 2YQ0A 3IXQA 4CM2A 1WNEA 1QSLA 1NDKA 3CJ8A 2PFDA 3OV7A 1CSJA 3R5GA 2VG7A 1WG1A 4K4WA 5L1IA 2YPYA 3UVJB 4MIBA 5KT6A 1ZYQA 2X51A 3MCOA 2FHMA 3U1NA 3VAGA 1GH8A 2ZOMA 3EJMA 3MEEA 3Q8UA 3I0SB 1Q4RA 4ANEA 4E8UA 3QBCA 3ILJA 5DDQC 2XQCA 1XMBA 5CABA 2XB2D 1ZPWX 5G4DA 1VMBA 3TVKA 3MM9A 1QDUB 1RA7A 1VHFA 3IS9B 1YJVA 2DNPA 3FJ2A 1HNXJ 1LXNA 1ZBTA 2HS0A 4AL6A 1VQ8S 4BDPA 3NCQA 1Y0HA 2L48A 3RGIA 5IZHA 2HRUA 1DARA 1RYSA 1T7PA 2P5VA 3U27A 2HS4A 3POTA 3CEDA 4ZCMA 1GX6A 3PCOB 2QTWA 2DEJA 1NSPA 4JI2J 2EKYA 5I3PA 2QV6A 3CSKA 3ZZOA 2BOAA 4KC5A 1FTCA 4MYTA 3AB2B 2YWWA 4Q2MA 2HURA 2XGQA 1TKDA 1H7XA 1HPZA 4UOGA 1S0OA 1U6BA 2R7VA 1D09B 3FEYB 3BGOP 4KKOB 2B4VA 2UV8G 3J80Y 1DY3A 3W9JA 4N8NA 4LRDA 1NO8A 1TTHB 3C15B 3NWRA 3TX8A 3KLVA 3FVYA 4JI3J 2GGPA 1SL1A 1TKTB 4RJVA 5HQLA 3AD9C 2PEBA 3KHHA 4FBTA 1RQ0A 3QGHA 2BOPA 4Q45A 3MPWA 4E0DA 5HJXA 2HFZA 1FXDA 4B9LA 3H5XA 2CVEA 3DRPA 2Q1LA 4P7VA 1DQAA 2XLJA 4NLYA 4IFYB 1RU1A 1JLQB 2WBRA 4Y2CA 3V6DA 1U0HB 2RU9A 2VG6B 4F67A 1S1UA 3OTEA 4LSZB 4DSKA 1S76D 1NZAA 2DYAA 2LXFA 4JUZA 5E2QA 4ZPCA 2BE2B 3DM2B 2UUAF 3C16B 1FNOA 2RH3A 1FRIA 2COLA 4YP3A 2E5LF 1FCAA 1HWKA 2L9WA 3MAQA 3V6HA 1I94F 3KJQB 2BBEA 3DOMB 3ETMA 5F0UA 5KFEA 3D68A 3SSQA 2F5GA 3H5UA 3ZZUA 3MDFA 2R7SA 1JXVA 5CZVA 4KFBA 2K1RB 3T9NA 4AFFA 4TN2A 3AQPA 2CPEA 1KDNA 2YVSA 1T9WA 5K20B 2LQJA 2BV3A 2ZBRA 2R2SA 3AA8A 3O5TB 3HT0A 4IG0A 4IKAA 4PXDA 5DS7A 3ZZRA 3E3XA 3CCMS 4ZA1A 4WCEQ 3H59A 4OZJA 2Z0GA 3A8JA 3KKFA 1W2IA 3CF5Q 1HLWA 1YJTA 1U1LA 1FRKA 1IR1A 4JI6F 3H4BA 1GMWA 4J37A 5KG6A 3TYTA 1NK5A 1JMTA 1SJRA 4WK1A 4YS2A 4UW2A 2FDNA 4JI2F 3MWBA 3MUMP 2ATLA 2YKNB 2C3MA 2NXCA 1X4FA 2IVFB 2H5IB 3DI6A 1FFWB 3M8WA 4HACB 4RW6A 7AT1B 4IG3B 3FGVA 3K89A 4M63A 1J5OB 4J9KA 3CDWA 2AJ0A 1NSKL 4MMOA 3KK3B 2YKOA 2Q43A 3W2VB 1BUXA 3CD7A 1NU4A 3R7NB 1VLOA 1WOSA 3MMJA 1N52B 2M88A 2QJ3A 3IAS9 3H42A 4DR1J 2W9CA 1HFEL 1VRQC 3CJTA 3QATA 4H4KA 4OI4A 5THWA 4DQPA 4FYDA 2YKMB 4DV5J 3R6GB 3OVBA 2H4YB 2CQPA 5ETRA 4NLPA 2R7XA 2A6MA 2Z57B 3AJDA 2BZ2A 2LMIA 1G6BA 2EK1A 3SQGB 4EGLA 2J6TA 3R8YA 3MM9B 1IN0A 3Q0AA 1Z4UA 1S6UA 3BYPA 2HHWA 3QLHA 3TWZA 5KFOA 1VC6A 1NH8A 3CC7S 4FF4A 3JB9k 1NKBA 2KFNA 4ZKAA 2E7XA 2P8IA 4B3RJ 3EXCX 3NP5A 4WXOA 4NYOA 2WRMA 3LALA 2HEKA 5IT4A 2ZH7A 1ZS6A 1JJ4A 1RTJB 2CNNB 3ENQA 4B9TA 1XERA 2FLOA 2XY7A 1S9EA 2V94A 3AA9A 4Q8FA 1MROA 1RI7A 4PXEA 2CPIA 5C24B 2VH7A 1IXKA 2KZZA 4R8UA 3MFHA 4L75A 1N5YA 1M0SA 1VQSA 2GW8A 5KFJA 4NL5A 4JI6J 1O8BA 4JI0J 2D9OA 3MEDB 2JLFA 3FCVA 3CJ0A 1MU2B 3FUYA 2CA9A 3VWSA 2CWKA 3W5YA 3G71S 2OIHA 4NXNF 4FF3A 3TAMB 2IC3B 3ZZTA 2J7UA 3PJXA 2NSBA 3T3FA 2V8PA 2EFNA 1BQXA 2CKWA 4DI6A 4RNMA 3BKFA 1S79A 2V50A 4PXBA 4USJC 4N77A 6AT1B 3U7JA 3ZTOA 2LCWA 3W63A 4OYXA 1FRMA 2OSRA 4IOCQ 2ASJA 3QPIA 3HVTB 1NHVA 1TP7A 2J0XA 4I6YA 2OPQA 3C66A 4ED4A 1H98A 1UW9A 2OGUA 1KP6A 3I4HX 3TP2A 5IS2A 3QJLA 4NCGB 3V5RA 2LVWA 2IVMA 2XI3A 3MCNA 4PAAA 4USHA 4JYAF 1XR5A 4NEYA 4P2SA 2RQMA 1DZ5A 4LF1A 4IH7A 4ZP8A 2O3DA 3F44A 3Q2SC 2AWZA 3M8ZA 1G2EA 1OPZA 2EVZA 2KI2A 2RIJA 3MR6A 2RILA 4DV5F 1SL2A 3WZ0A 5K14B 1M90T 4FP9A 1XQIA 4RW9B 4LF6F 1R8AA 1T03B 3EYZA 3V81A 1HWUA 2BEFA 5C42B 1HYSA 1OIAA 1T0TV 3MTJA 3R5JB 2L9NA 1QTNB 1WF0A 2XSJA 1FD8A 4K5SA 2WAQD 3PJ9A 4L76A 4DSLA 3BSCA 2MQ8A 1KQSR 4CLKA 3PX6A 5L8RC 2OHDA 3KJFB 5EWEA 2KJVA 1WTBA 2DNYA 1JIHA 3WIVA 1TL1A 3MM7B 3IMQJ 4DV6F 4DR2F 4B3RF 5RUBA 4DZDA 1UJ6A 1UMJA 4MFBA 2K3IA 4LSNA 4R25A 3MMBA 5BYRA 4CH7A 4FKXA 2W8LA 4FF1A 1AUSL 4I56A 1TVRB 3EDQB 1HI0P 3VGUA 1DRZA 1L3SA 3V2UC 3EE3A 4B3TJ 2HK3A 4WFXA 1RADB 4LF8J 3DU6A 4TU9A 4K4TA 3K5MA 4X4QA 1M1HA 4UZCA 1LW0B 1OMSA 1IBMJ 4UUXA 1SV5B 1O6XA 3MM8A 2XNRA 4YHHF 2PEHA 3TUPA 3W2VA 1N33F 3HHLB 3D6HB 3GJRB 4KGKA 3RAMA 1S1TB 3FBEA 5ETTA 1WC0A 4RO0A 5CQGA 4X65J 3PHTA 4ED3A 3PZPA 2JEIA 2IJNA 4QWCA 1ZM2A 4P72A 4DL3A 3PR4A 3DMJB 2KB2A 4IRCA 3G6ES 4DDFA 2UUCF 2H9ZA 2UVUA 1QSYA 2DGWA 1MU2A 1SIWB 3EZUA 3D1HA 3OFGA 4NLXA 3ZTPA 1JXLA 1WSVA 4JYAJ 1KN6A 1FA0A 2IM1A 1DQ8A 2NZCA 2MXYA 1VCTA 2B9WA 2DNGA 1OQ6A 3KWMA 3I56S 2CZ9A 2KH9A 3EZ5A 4ALZA 3HLUA 1HNIB 1PJ7A 2B8PA 3HFVA 4NZ7A 2KT5A 4C3MA 4NCBA 1PJ6A 3TEHB 3RBXA 4OX9J 1K0VA 1V3ZA 4IR9A 3BN7A 4WFYA 1TKZB 1F3FA 3V4IB 4ILLA 5LSOA 4K0KF 1RHQB 2A2CA 2BA9A 4C6AA 2KG0A 4UOCA 2CPYA 1GMWD 2XHWA 4NLQA 4ZVPB 3TUIC 8ATCB 1HNWF 4ZVFA 3ET6B 4OHXA 2EBGA 1RT5B 1FI4A 4OLOA 3ZZYA 4GVBA 1N5YB 2BYCA 4YR2A 4F7VA 4RBVA 4EFAC 1REVB 1V9OA 2QZ8A 3ZO7A 2XM3A 4RW8A 1Y5LB 5JMNA 3AD8C 3DOLA 2ERRA 4A46A 1NJWA 4YN3B 4UOFA 2AP6A 2M8DB 3UW1A 5E3AA 5LXRA 3OL9A 2HFUA 2C2ZB 5HBMA 2E5GA 1U1MA 1NK8A 2X1FA 1KC8T 4I0WA 4ZIVA 3I0SA 3NCRA 5GADI 1XC9A 2CQHA 3IBFB 1S1XB 5A8RA 2AV5A 2I5JB 1HQUA 2HRTA 1PJ5A 2DJWA 4X64F 1NDPA 1X9MA 1WC6A 4QJVA 2QMUB 1TK5A 1JLGB 2MEWA 5DQHA 2AJFE 3GLJA 5C42A 3I32A 1DURA 2HQDA 1JLFA 1IKWA 3HHLA 5HO4A 2CJYB 1SV5A 3BGLA 2CUYA 2HHXA 3HF5A 1U02A 4HHJA 3NXZA 4PXCA 3TA1A 1KSPA 4C4WA 4ZCLA 1TAQA 3K58A 2DR7A 1Q79A 2HNYA 2E9TA 1ULRA 5JUMA 2AYMA 3VALA 4EEYA 2CNKB 3ZXWA 4DL7A 1AW0A 3W8GA 5DLFA 3T1YF 4OV1A 2E7WA 2KXFA 2GIFA 3QNWB 1BE4A 1YX2A 3HVTA 3GIKA 2UUBJ 3NKYA 4ZIWA 1FE4A 2X1GA 1B4SA 5D4PA 1AXQA 3N5BA 4Q43A 1HNWJ 3A4TA 4A8SA 2HWIA 4Y65A 3CMAS 4NI2A 3UD5A 1FF2A 2F9JA 2NXJA 3A3NB 3JSBA 2D1CA 1OJ4A 5J2PB 1XMQJ 1KQKA 4FYXB 4C3LA 4F4YA 5H9EK 2C42A 2KKHA 3CJSA 2GIRA 1FTRA 2V63A 2CJXB 2GHWA 3H2LA 1U6ZA 2WW4A 1XK8A 1H0HB 4LVNP 1TKXA 2MQMA 1EETA 3VVUA 4ZOSA 2FLLA 1NJIT 1IBKF 2HHHJ 3EVWA 2B4UA 1VHIA 2HHPA 3M8PA 2BW7A 2OEMA 2C2OB 5M2PA 4XIUA 2ABYA 3Q8RB 1SPBP 2R8HA 4DR4F 2K3KA 1WC3A 4ECVA 3MECB 4X62F 2VOOA 2H54B 1M5HA 1X31C 1AUDA 4MKYA 1JNZB 1YG0A 3DCAA 4F3MA 4ECZA 1VQKS 4ECTA 1KD1T 3DLGA 3QAUA 5EX0A 3MR7A 4M1KA 3SXLA 3UCZP 3FC9A 2VPWB 1U47A 1MMLA 1RDRA 3N28A 5D0GA 4YDDB 4QW9A 4MKAA 4KE5A 4ES2A 2X3GA 3FDSA 3TAQA 3NNHA 3THVA 1RAEB 2QLWA 3DLEB 4KJIA 4QCLA 2POKA 2B6AB 2QLBB 5LSLA 4F3QA 1EP4B 3IR6B 3GJSB 4LVOP 3TO8A 3PRBA 3D7SB 2W7OA 2HZVA 3VZIA 5GAGU 3QT7A 2HHVA 3OFEA 1N0UA 1RISA 1UW4A 3BPSP 4DFPA 4W4MA 1ZAWA 1NPRA 2AKWB 3BPDA 4OZLA 4QQBA 2VQEJ 3EVMA 2GZOA 2LU1A 2MZRA 5IFMA 1ROFA 1ELOA 4RU9A 3MEEB 4O3PA 5GAHU 2HIYA 4EMDA 2HPUA 2Y1JA 4ZCIA 2XGPA 3FZ2A 4ZVHA 2PD1A 1DTQA 1KR4A 3G6XA 1S6QB 2RF2B 4WYLA 2Q6BA 4ED5A 4FZVA 4K50A 2KRRA 2ZDPA 3IM9A 1K1SA 2CJQA 1TUVA 2ALYB 3PG9A 2NXUA 2W2MP 1SXLA 3UWTA 4LF7F 1T9VA 3QT5A 2ADCA 2HS3A 1O51A 1K44A 2CJBA 3BR8A 3L9ZA 3SBMA 4OHZA 2DY9A 3TOQA 3KDNA 4J9SA 3T5HA 1N36F 1S9GA 4HLBA 1PAEX 2DXFA 5CYMA 1RT3B 4JI3F 1FHTA 4JI8F 3SV4A 2AQ4A 3E2EA 1HNVA 3BZQA 4EI2A 3DLJA 1HBOB 1UFKA 5GMDA 3MUVP 1S97A 2KDOA 2ZOFA 3AXMA 1T05A 4LREA 4Y2KA 3U1LA 4ZN1A 1PYOB 4DBQA 3CXCR 3TAPA 2RHSB 4P2FA 3KK3A 4OYOA 4WKRA 2H65B 2RDDA 3GZ7A 4HL9A 1BXNA 2HHSA 2JWNA 2YPZA 5IQ6A 3PW5A 1LWFB 2AZ1A 5AXLA 2GHPA 2BE7D 2O5DA 2DGTA 4Y2AA 2HNZB 4ANCA 4L73A 4NOHA 2HBZB 4CLSA 4O3QA 4NWBA 3Q8QB 4R8UB 4EUVA 4DSIA 2ZHAA 2A2DA 2EG2A 4NLTA 2HVHA 3G8SA 4F8RA 3OL7A 3KMSA 5EX3A 2YWHA 4ZP9A 4BWMA 4DUTA 3KG4A 3FRZA 4YB7A 1M5OC 2CQ2A 3RRHA 4UY85 3TRGA 3G82A 4Y2MA 2LXIA 4NEZA 2C1EB 3JYTA 3THTA 3OR2A 2ZWPA 2JLGA 4NCGA 2HNDA 1UCNA 3PEJA 3N01A 4A8MP 4NI2B 4O3OA 2FIUA 1B0VA 3RZAA 3LAKA 2V8DA 4AQYJ 1FRHA 3R97A 4ELTA 2HVZA 3NS6A 3L95X 4LBIA 1T11A 4OL8A 1S6OA 2NXNA 1BGXT 1RHJB 1S7IA 4OZ0A 4R0JA 5KG3A 3W60A 3IWNC 1Z2LA 1KFDA 1HQEB 3OBIA 1N5SA 1UEKA 2GQCA 2ZEJA 3LA0A 4KY3A 5HATA 3UDLA 2IBKA 4A8FA 4M94A 3D1OA 1RE1B 2VKZG 4YR3A 4ZPWR 1T3OA 2C2DA 4DG1B 1UL3A 2KHCA 3QSYB 5KAKA 1RBAA 5C2CA 5KFNA 3UR3C 1YBTA 2FLPA 4A4JA 4QU7A 3VAFA 2VQFF 2DGOA 2VODA 5HP1A 1UTAA 3BKTA 3BB5A 1FXRA 2VF3A 2BJ9A 4PG8A 4X4SA 4C8YA 1PG5B 2G0CA 4USVA 4KBIA 1RA6A 3SMZA 3N5FA 3CTRA 4Y00A 2PN6A 3ONQA 3JSMA 4RW6B 4QPXA 1KFSA 3GG0A 2DGXA 4RW4B 1B64A 4DZ6A 5I4MA 4X4VA 3KMQA 4DV0F 2KFZA 2VG5A 1XR6A 1HNVB 4NLDA 3UN2A 1RT2B 1G3OA 3R5AA 3HKWA 2DGSA 4MKVA 2UU9J 4LIWA 1B7FA 1C1CA 1NPPA 2DH8A 1KVKA 1QAIA 2MQOA 3CO0P 1NB7A 2DB1A 4UTGA 3ZNJ1 5B0BA 3RG6A 1VK8A 1L5UA 1CS4A 2CG8A 1WC5A 4RW7A 5GVQA 3CCQS 4C3KA 4DR5J 1OQ3A 2YTCA 3CMES 2F65A 2MHNA 2R7OA 3I9V9 2WOMA 1ZOTA 4RWWA 2HBQB 2ZUAA 3M9NB 3D67A 1SH0A 1RT5A 1VR6A 3W2WA 3LO3A 2BKOA 5GAEU 4YB5A 4AQYF 1N34J 1FJGJ 2O67A 3LPYA 5L9NA 4P6QA 3DN9A 3OL8A 3J7A1 4KV8B 4USTA 4DN0A 3PHEA 2W2OP 4UF4A 1YRXA 4ICLA 3SCLE 2ZH9A 4IR1A 3AJ2A 3C19A 4M5GA 4JI5J 5AXKA 4Q0BB 2HWHA 3LUYA 2VB6A 2VG6A 5LM7E 3BO3A 2PT0A 1YJ9S 4Z2XA 3J7YU 3P96A 4FBUA 4O4RA 2M0GB 3S7RA 3OJUA 1MROB 2NREA 4UY8T 3FBCA 1UFWA 3HD2A 4EWTA 4KIAA 4LF9F 3GV7B 2HNZA 4DV2J 4LFAF 4LSLA 1LWCB 2MLYA 2ZD1B 2WVDA 1C2PA 3ET6A 5AJ3J 1JLCA 3NBPB 5AT1B 1RUSA 5L46A 4W98A 5GAHI 5KFSA 5D0HA 2YNGB 1QY7A 2DH9A 2WB4A 1C4CA 2BKNA 3KNAA 3TQEA 3D6FB 4PPDA 3D28A 4N7TA 5F3ZA 3MMAA 3MMCA 3MAAB 3QMQA 4OLPA 4AXJA 4ZPDA 2X1AA 4AD6A 2RU3A 2V0NA 2K7JA 5CCMA 4CLLA 1S9FA 3RB4A 1RT6A 3I4PA 1YJ7A 1M5VC 4NLSA 4OHYA 5I3QA 4B3OB 1S5ZA 2Y8WA 3GR0A 3UD4P 1VS3A 2CPZA 4LUBA 3PKYA 3OTCA 1KBRA 2HMIA 1TUGB 2OLWA 3ZFVA 1C1BA 4C7QA 4CLPA 1D8ZA 3BR9A 4IQMA 4YFUA 1WKLA 2MZTA 3PYGA 4FDFA 2FLNA 3GSIA 1HA1A 2Z56B 3KK2B 3HI9A 1C0TB 4U8VA 1UPPA 2DR9A 3VTIA 2Q6CA 1F9FA 2P9GA 3MPDA 2VQEF 2RS8A 1T9XA 3H0PA 3M1VA 3CCLS 1KLNA 4DQIA 3AOBA 1B70B 2AGOA 1IQZA 1SB6A 3ELHA 2YQ3A 1PBAA 2E9RX 3CD0A 2WW8A 2QFIA 4C8MA 2IM0A 1U4BA 1AFJA 2AZ3A 5ETNA 2EFGA 2KT3A 2Y0SD 2YKAA 1VBZA 1B7YB 4J9OA 1E6VB 2JRSA 2QYGA 3T5LA 4OMFG 2V2ZA 5A6WA 3OPKA 2P2CB 3JAMY 4CO4A 1N6QB 4RU2A 4B9MA 4TY8B 3OHBA 3HMJG 3T6BA 1YI2S 2XMUA 3Q8VA 1RWOB 3TARA 2VG5B 1F3VA 3JQMA 3FFIA 3A8KA 2QL7B 5K8MA 2W2QP 2OMOA 3DYAB 2XMVA 3VQSA 1VQ4S 1GX5A 4DSJA 4KHPJ 1RTHA 4CYUB 4IG3A 4ATNA 4DHVA 4OZ5A 1IQTA 1XR7A 1T9UA 4ZVEA 3ICLA 5JJBA 1N4LA 3C14A 3N9UC 2W9BA 2LEBA 4FF2A 3QLHB 5HMYA 2B5JB 1T8EA 1URNA 2Y1LB 3R7SB 2OH2A 2W9AA 3PX4A 4Z7YA 4X4RA 1N33J 2FC8A 2YNIA 3KLEB 4MIAA 4I2PA 3O6QA 3SDEB 4U7CA 1NSAA 2RUSA 3R5CA 4PQAA 5KFTA 5F9NA 4GC7A 3C6TB 1YK9A 5EGYA 1K1QA 2PO4A 3UO0A 1RAIB 1NXIA 2KFYA 5HN0A 3DLKA 4X2BA 2ZH1A 3ZC4A 3C46A 4PABA 1JKHB 4U7UK 1PIEA 1YQHA 3RB0A 2OPRA 1HHSA 4RL1A 5KFDA 1UVNA 4GKJJ 3GV8B 3EGVA 5FIIA 3NGKA 3I31A 4K4ZA 2E1RA 1H2UX 4J90A 4A8XA 4KGXB 5B0FA 3RW7A 2IIHA 5E0OA 1M5KC 3VZHA 2ILYA 3LOUA 1FDNA 1PAUB 3PJWA 4TNOA 3C6UB 1U26A 2Y0BB 5CYMB 1QTMA 3MUTP 2GV1A 4F02A 5ETPA 1IJEB 1HNZF 1SKUB 3J81U 2RD5C 1AFIA 1BD6A 2E5JA 4PKDB 3MPVA 2ZJPQ 1Y00A 1UJ4A 2GMJA 3M6XA 5D4NA 1RTJA 2E5LJ 4DS4A 2SXLA 4YR0A 3CVKA 1RLDA 3E01B 5CD4A 1MW7A 2B9EA 4WIIA 1HR0J 1P1TA 3MGJA 4LFCF 3ADAC 3Q23A 1SL0A 3AY0A 4F4KA 1QAXA 2L3MA 1E6YA 2LFVA 3EZOA 3RRKA 2ADBA 5D8HB 4I2QA 1SQFA 2DNZA 3FSIA 1EHWA 2HQGA 3T6JA 2F8EX 4V1Ak 3OR1B 2UUWA 5E33A 5JXSA 4GO7X 1VQNS 1VK3A 2GFFA 2UZAA 1B3TA 4HI2A 1IJFB 1S6PA 2AEJA 3MHYA 4X4OA 3OR2B 3OXLA 4M5MA 3PW0A 1SJ4P 4ED1A 2IJFA 2W2NP 2KN4A 1RWVB 3QFHA 2XLIA 1JX4A 4L3KA 1S99A 1SVDA 2HRYA 2UUBF 3PY8A 3SI8A 1NKCA 4JV2A 4H4KC 2VOPA 2XI2A 2OUGA 3JS9A 3S01A 1LWEA 1N88A 2FJAB 4GRSA 1WHXA 3UFCX 2UVRA 1E6VA 1SKSA 1CPZA 2ZC4A 3N6NA 2J76E 3K7RA 2CDRB 4M5IA 3M8QA 3HSDA 2HBYB 4WZMA 3B6BA 2BMBA 3R5BA 1EZZB 1MN9A 4UOHA 5E3RA 5F3TA 3W5XA 4DV1F 1U48A 1HWIA 1OO0B 4J9RA 4ELVA 2C3PA 1HI8A 3O8WA 1MWZA 3KJNB 5KFWA 4KKOA 3HJVA 1HQ2A 2F9DA 4K4XA 1BQNA 1C0UB 1IM4A 1IWGA 1FO1A 2VFTA 3ISZA 5ADZA 3OW2R 2IAJA 4ECXA 4WFNQ 3UNYA 1WKJA 2YH1A 2HZCA 3BH6B 3NGTA 4X62J 3HZEA 5KFXA 2E1PA 2MY7A 3G82B 3TUZC 2CPDA 2N4DA 5F8MA 1P9YA 2G4BA 4XDDA 2ZBIA 3HHNB 4DR4J 1VRTB 3RYLA 2AJ4A 3NLCA 4KYZA 3MMBB 3Q86A 1RBLA 4QIVA 5D15A 3MURP 5DQGA 2HFOA 1KWMA 1W25A 2RRNA 5I42B 3B78A 2FPHX 4OZ3A 2CQ3A 1VLYA 3HHLC 5BYQA 1HBUA 5GMEA 3OUYA 3RB3A 5KFCA 2AGPA 1U1RA 3PTWA 1PYSB 3GONA 4ZJLA 4A47A 2DR5A 2V2KA 1MLAA 3L7UA 5D3GB 2GJIA 4IO9Q 2VA2A 3K0JA 2BX6A 1RYRA 3QIPB 2QO3A 2FC9A 1Q8KA 3MMAB 1DLOB 1URRA 4HVZA 1RT7B 4O23A 3FNNA 2VA3A 1I51B 3NS7B 5HQ8A 5DDRC 3KDOA 4NCAA 1VISA 3OLAA 4C48A 3VV2B 2EFVA 2B0GA 2WOMB 3E01A 1X7VA 4I64A 3HVRA 2KJWA 3BSAA 2HVEA 2CJAA 5DGAA 4F26A 1IWAA 3A8EA 1NSQA 1TVRA 1ZPVA 1GTHA 5F9LA 2GO8A 2RMLA 3X1LB 5J1PA 4NYPA 4WP8A 3M2RB 4U9RA 2BJEA 1JLEA 1IBCB 2EI5A 3CJRA 1QJHA 2VC1A 4KGVB 3OSPA 2XY6A 1CJUB 1VQ6S 1ZM3A 2OKQA 2GVZA 2A1BA 3R27A 3DOMA 2NUHA 3QZ8A 1BWVA 2NPFA 2ROPA 4ED8A 3VF0B 2DHGA 1VC5A 4IQXA 2Z2ZA 1I1GA 4G1PA 3MOZA 2IBOA 1KKHA 5KTQA 2B9YA 5L39A 3H5YA 4E98A 3V6KA 1VJWA 3TR5A 2M52A 4PWDA 3DOLB 1RGVA 2F63A 3MCSA 3OLBA 4KR0B 4DSFA 3CCWA 2XCPA 3DLLQ 3M6UA 2QRRA 2FUG9 3HDSA 3RBZA 3IAM9 1SH3A 2BE9B 2QA4G 3GV5B 3WQPA 2VV5A 2J9DE 1GXUA 4JOUA 2IPOB 3EGNA 3TVZA 1V3SA 2WSCC 1LQ9A 1CULB 4ED0A 2AIRB 2M8HA 3FBFA 1BQNB 4EO6A 4J91A 3PW7A 4P52A 2YX4A 1IR0A 5KFGA 2GX8A 1YZ7A 2J0WA 5HMWA 3QRPA 3I0RB 1BQMA 5E7OB 2RS2A 4ERDA 3H5SA 1UVMA 4RW4A 2RRBA 3C14B 1UP1A 2DHSA 1KOOA 2NUUG 4IRKA 3GWCA 1RABB 1R6YA 3TI0A 4NA1A 4JI0F 3DI6B 3I96A 4HACA 2ZD1A 2IM3A 4LRCA 5IXUA 1J2VA 1CS4B 4B9NA 1K0TA 4IFVA 1QSSA 1HW8A 4PWUA 5B0EA 5BXIA 1HMVA 2N3OA 1UETA 1LW2A 1AZSB 1FWPA 1H3DA 1LWXA 1SCJB 2K2PA 4QIWD 4RBTA 5B0GA 1S9EB 4H4MB 2IRYA 3VR1A 2W9CB 1RT4A 3PEHA 5F0WA 4X4TA 3VVTA 3BQ1A 1APSA 2CZVC 1VYAA 5F8NA 2ZDOA 3CNQP 1YBAA 3OTDA 5DG8A 2G2OA 1SJ3P 1RT7A 3H40A 1H6KX 3ISNC 2CYYA 4GC6A 3NNCA 3DDNA 1R7IA 4ZLLA 1HARA 2KYXA 1JLAA 2IMWP 1RWMB 2FY8A 2RNEA 1D9AA 2AEMA 1T94A 2W8KA 2MKJA 4K2XA 2OO4A 2FB0A 1UWBA 2GHVC 5C2GA 3IBWA 2KVIA 4CT8A 3M30A 1U1QA 4CNYA 5J2NB 1FK9A 2CRLA 4RBUA 5ETKA 5A8KB 4DQQA 3MEGB 1D8YA 5HK4A 4C98A 4ES3A 4ID5A 3M2UA 1TL3B 3A8IA 2WONB 1NAQA 1X60A 4CM0A 3UDEA 3H98A 4KB7A 3DRXA 2GQ2A 2LU2A 2KZMA 1R0CB 4EBDA 5HSPA 3Q89A 4WIQA 4ECSA 3LH2S 1TK0A 3EXYA 4FYYB 2HIQA 4RUAA 4YY3F 2ZH2A 2UUCJ 2IVYA 4YB1P 4UQGA 2ZHOA 4JB8B 4RNOA 1ITPA 5KFAA 1F5CA 2FJXA 4U67Q 8AT1B 4PUOB 2MKHA 5C7PA 3DXSX 1S12A 4ZVQB 3AHPA 5K8NA 2MB0B 4YOEA 1CJUA 4USUA 2DO0A 2HHQA 5KG0A 3H20A 2CG4A 2R7TA 2RQCA 4TLRA 5KFHA 1JLEB 1H2TZ 2UXDF 2J8AA 4MKBA 1RT3A 4KPCA 4B3MF 4FPIA 3MM6A 5DGBA 5A2QU 1PC4A 1XNQF 1ZZNA 2PE8A 4P9SA 2VPZB 5KG7A 3NAIA 4K0KJ 3CGIA 3CB4A 3G9CA 3K8WA 3VAMA 1JXEA 5HANA 2VBZA 4KHRA 3RBEA 4MK8A 1MMNA 1TK8A 2YNIB 4GKKJ 3UDCA 1UVKA 4TVAB 4B3SJ 2RT3A 4RR5A 3C6UA 4QYZK 4GMKA 4AE5A 1P6TA 3PXGa 5HQMA 5F8GA 4PR6A 3SYZA 3NY0A 4C8KA 3GR1A 2CIMA 3LQVA 5M2RA 2MY8A 2W7PA 4DR5F 5D78A 4USMA 1TL7A 4LBPA 4OYWA 3IWLA 3Q8SB 2LQ5A 2IJRA 3Q8YA 5CAAA 3SQGA 5KFVA 3R6LB 5ETOA 5K8OA 2OPSA 5J1EB 4OI0A 1Q7LB 4OQJA 3BJYA 4PPZA 2HZAA 2MPUA 5DG7A 3OXGA 3U02A 2V4QA 2J8SA 2RJZA 3JSRA 1VRTA 2B3TB 3T5KA 2MLXA 4QU6A 3DRRB 4M95A 1CG2A 2QA2A 3A12A 3NMAA 4LRAA 1UEUA 5EHHA 1OY6A 2CNOB 2CAJA 3L3CA 3N6MA 3CCTA 3QQCD 3G6YA 3A13A 2L08A 4QW8A 2C2KB 2YKPA 2C2MB 2HHTA 4WYWA 1FNXH 1RWXB 3FSYA 1TKZA 2V8HA 1H2VZ 3W5ZA 4DF4A 2XYPB 3QGIA 4B9SA 4B9VA 4CLUA 2VG7B 2MSTA 4DOZA 3BSNA 2M4MA 2Y1RI 2G2YA 4USKA 4IUFA 4PWWA 2XY5A 1O0PA 3K2YA 4RW7B 4NA2A 4EBEA 2FHJA 2RQKA 1WG4A 2D74B 5U47A 3K8VA 1OY8A 5KFBA 3KLGA 4DR3F 1NNDA 2Y8YA 2N7YA 3M4XA 3QGGA 3AODA 3L09A 5L1LA 4B3MJ 1XNQJ 1FXLA 1HKAA 1C1BB 1R8CA 2AYBA 4PCQA 5D6GA 1OSDA 2CADA 1N6QA 4QR1A 1L3TA 3KTQA 1N54B 5SUHA 2NYIA 2FJEB 3LTOA 5T7LA 5D0RA 3NGRA 4RWXA 1CJTA 2MGZB 4ID5B 3M2UB 5D4LA 1NK9A 1WEZA 4U7UD 1YJNS 2ZBCA 3T5JA 2V8VA 1KTQA 2DRDA 1TMJA 2WVEA 3P8BB 2RKIB 1WF1A 1GMVA 3M7VA 3ZTSA 1AA1B 2ROGA 4B17A 3KNGA 3JSMB 3AAWB 3UI3A 4ECRA 1RTZA 3Q83A 2W4CA 1NBEB 3EMTA 4RX6A 2I5JA 1Y3JA 3SQOP 2ZH8A 4DV3F 3KLIA 1Q8LA 4LF2A 1A6LA 3D4JA 3PV8A 5GAGI 1RT1A 3LP1B 3QO9B 4TU7A 2ZZNA 5B08A 2R8JA 1D0EA 3ILLA 1T95A 3CJQA 3I5CA 3FEXB 4KHPF 1RAAB 3OQ2A 1R3NA 2XS5A 2FZGB 4ZVGA 3PYEA 3TW0A 5CYJA 5DM6Q 5LMNJ 1U2FA 3D6TB 2C28A 5HL7Q 2OJ3A 3R2CJ 1R8BA 2ZFHA 4B08A 3VGTA 1VBKA 2APOA 3DRPB 2LXUA 2BVZA 2B9XA 2CPJA 5FDLB 2LKZA 1OSCA 3RW6A 2J7WA 4DL0C 3ISND 1FVSA 2LEAA 2VPYB 4FYWB 3DLHA 4J9QA 1SI9A 5K5MA 2IRXA 4OZ2A 2DEIA 4ZPBA 2J9EA 1RWPB 1SIZA 4ZLPA 4ECQA 3PYFA 4ZLNA 4I2QB 1FKAF 1M5PC 2UP1A 5KFYA 3TEGA 3OTOJ 4ZK7M 4A8KA 1FERA 3KUHA 4EYIB 1RHKB 3AFGA 3T1HJ 2DHXA 2OPPB 4CLWA 4CLTA 2OAUA 3M9MB 1U0SA 4IRDA 4DCPB 2NCKL 4MT1A 4Y3CA 3K5NA 3SFUA 3VCDA 2E7VA 3DC2A 1TELA 4KQZA 3CD6S 1GAOA 4QR2A 3X3UA 3G87A 4N47A 8RUCA 5H9EJ 2CQ0A 1FT8A 3DNCA 1EJ7L 1RAFB 5HLFA 1K9MT 1HBMA 3IM8A 1YGYA 3MTKA 3QWPA 1PYTA 1VQ7S 4LF6J 2WK4A 4HI1A 5LSRA 3MMCB 4LF7J 1D3WA 3A3OB 2ZITA 2R8KA 4CCHA 2FGCA 1FJEB 2I2YA 1Q8BA 1RB0A 2YWFA 2MQPA 3GYNA 1YBUA 4TY9A 4LFBF 3BBCA 1TFYA 2IC3A 1YVFA 4DLEA 1R0AB 2VFVA 4M5DB 2V68A 3HHEA 2VBWA 2X3DA 4H54A 2MYFA 3CJKA 2MGZA 4A8YA 4NXMF 2WVBA 4XPEA 2MKIA 3DRRA 2V9WA 2UUTA 2DKOB 1ACMB 3CDBA 3FQKA 3W1YC 3UR0A 1W7WA 3B82A 5I42A 3NCPA 5HJYA 1VQPS 3NS5A 3KLFB 2J0QD 4ZDNA 2F3JA 3G2XA 3CD5A 5LMNF 5B0AA 1JLFB 3HP6A 2M70A 1EKRA 3W3SA 4FXWA 3GYXB 4MJKA 2MJNA 4IYQA 4AT1B 1IBMF 3IRXA 2LLZA 4Q8EA 3QJPA 3UQSA 3OVSA 2GAHC 2AW0A 3RR7A 3O44A 4JI4F 2K06A 4DV4F 2YNHA 5AXMA 1X0PA 3SCJE 4W92B 1UFLA 2HGMA 3FRYA 4WU3A 2DNQA 4OYAA 4ZVTB 1DLOA 1JK9B 4LRBA 4PUOA 4M5HA 1N36J 1FD2A 3UE2A 4DPTA 2DRBA 2HQIA 2O66A 4YUDA 2BRLA 2ZH6A 5L1KA 4WBFA 2FZKB 4CI0B 5B09A 4H4OB 1DAXA 1KTVA 1OS5A 4F0HA 4D3HA 2IM2A 2P9CA 1CJTB 1U8WA 3F73A 2VHGA 4MIWA 3W66A 1N5TA 1F5BA 1GTEA 4JBCA 1RHUB 2XMAA 1QE1B 4C2MA 6FD1A 3G6VA 4TY8A 1WHWA 4KT0C 3WX8A 3QZ7A 3M32B 4FVCA 2LQ9A 4BC9A 4RZRA 4O3SA 1M5SA 1IKVB 3TNVA 2FJDB 1H38A 4QYZJ 3FCHA 1IKWB 2J9DA 2W9BB 5J2NA 3O3LA 1DJ0A 3KG0A 3WC0A 4ZJQA 3TUJC 4G6VB 4F50A 2QLXA 3GB0A 4CYUA 1HL6A 2F40A 3IGVA 4RNFA 1S10A 4LT6A 1NJYA 1Q5VA 2FJWA 2F7VA 1VQMS 1MNEA 4O0NA 3TJ8A 4CIOA 2UV8A 3ZNUA 1GQEA 4FS1A 3M1VB 2HGNA 3HO1A 4QIGA 4LFAJ 2EC0A 2EFQA 3V81B 2FVSA 5AXNA 3N0VA 4DR7F 3TJ9A 2GVDB 2XS7A 3Q22A 2FVRA 2GS8A 2QA4S 1RCOB 2DHAA 3IWXA 2OEJA 4YB6A 4Z7CA 2XNQA 3C6TA 4OI1A 4C8LA 3UN5A 5J2MB 4DF8A 1TAUA 1VIOA 3LP0B 4C8NA 4KSEB 1UJ5A 2G1DA 1Z1ZA 4KAIA 3HULA 2G0IA 2BJ8A 2LECA 4RKUC 3OXFA 1YJWS 4L74A 4D3GA 4K4UA 1KEKA 1NUEA 4ILMA 5D3GA 4Y0FA 3HVWA 2VONA 4O4GB 1HHTP 1XNRJ 1EX8A 1WEYA 3PYDA 1T9YA 3PIPQ 2Y9HA 3NMRA 2EWHA 2G1HA 4MK7A 1S1VB 5HROB 3E51A 3MM8B 3M8PB 2UXCF 3CO9A 3J81Y 1RHRB 2N3LA 1JNRB 2DGVA 1NCLA 2I9SA 1K47A 3TAMA 1UEVA 3K5PA 3KUEA 4G65A 5LJ3Y 4ECUA 2AJQA 1GT8A 2BM1A 3DKDA 4ECWA 3HSJA 4DR3J 3RAQA 3MD1A 1WDDA 4KRWA 2XZDB 4DG1A 4NLVA 1HHQA 3NWGA 5L1JA 2R8GA 3FQLA 2IDEA 2OSQA 4LSNB 1NDLA 4DUZF 4PQUA 1OY9A 1NK0A 2OMLA 3KHRA 1RU2A 3QYYA 5HI7A 3RJMB 2BANB 2B43A 3B4MA 3C15A 2HVDA 1WWHA 4WF9Q 3BYRA 5F8IA 2UU9F 1PILA 1I94J 1U1NA 3LP2B 3DOKA 2IYIA 4NLWA 3GE9A 1GXTA 4UUWA 5D77A 2ZJQQ 4ED7A 4OI2A 4OYPA 2B4OA 3UDVA 1Q16B 3C16A 4CP5A 4RW9A 2JSXA 2CFXA 2ACMA 2GMHA 2MSSA 5IM0A 1X5TA 5AJ3F 1SC1B 4I4BA 4K2JA 2ZZMA 4V19X 3PACA 1JJHA 1HWLA 4RNHA 4J9MA 2QMWA 2WVFA 2CJ9A 4BLGA 1REVA 1HMVB 2H4WB 3G96A 3SZ2A 5ETSA 1H72C 1FRXA 2DTJA 3I55S 2QYCA 3D1QA 3HZGA 1S6QA 2RF2A 1C4AA 4ZITA 2DNNA 3F56A 4ZPTR 5IV4A 2GGPB 4IG0B 4ZVRB 1SKRA 2ILZA 3P49B 3IP0A 3JSYA 1PGZA 1H74A 4X65F 4X66J 4J9UE 1VBYA 1CC7A 1VOMA 1TL1B 3MM7A 4LF4J 3W2WB 3GJTB 2V4RA 3THPA 1IKXA 2DNMA 2XYHB 3FEZA 2JFKA 4C0HA 5B7WA 1CBKA 3J7YI 3G86A 4CH0S 1XTZA 2W01A 2YKNA 3M2RA 4FNHA 3SFGA 2DBBA 2XO7A 2OP5A 2VUGA 2DO4A 5JVHQ 1S72S 3H90A 1IKVA 4P2XA 4DMZA 2A0FB 4DX5A 2R42A 3HVAA 1XEZA 2H3EB 3AOCA 3I87A 1P8GA 3MM6B 3BQ0A 2QL9B 1FKOA 1C1CB 1TZ0A 4RUHA 2C22A 2HQ3A 1RT4B 1X5PA 3HKZD 5EWGA 1RT2A 4JI1J 4ID8A 4JV1A 1F9EB 3FKBA 4PG7A 9RUBA 2IA6A 2FVQA 4LRFA 5IT0A 2JH3A 3SV3A 2JC1A 2XMWA 4BHQA 3BQ2A 3DGPA 4NMXA 2MZQA 1X4HA 3HXMA 1D1UA 4OJ1A 2L41A 1QLNA 3L7PA 1SC6A 2WVCA 3CJ2A 3MECA 2YQ1A 4UT4A 2B7BB 2XO6A 4NXMJ 2W2PP 3RUBL 2HYIB 3TZYA 4Q44A 2ROEA 2HNDB 3A1YG 4QIEA 4I69A 2JLEA 5HBMB 1ZA1B 3D54A 4JP8A 1WACA 2LA4A 3MAHA 4AUKA 1X4CA 2QLJB 1RK8A 5DLGA 2HKEA 5D0EA 2JC0A 2BQ3A 3EDRB 3BO4A 3BO2A 2FJBB 1D9DA 3JTOA 2IY5B 2O1PA 3ILOA 5IQQA 5ITHA 2NPIA 2D3O1 3CIZA 5H9FK 1J5OA 5KFKA 3V4MA 2FZCB 4JV5J 2UXDJ 1KONA 2JNJA 1EB0A 4CZCA 1SJQA 2BJ3A 3G8TA 2BM0A 2YNGA 4GVLA 3W9HA 1FDBA 4WTOB 1KLMB 5K14A 1U1PA 1GNKA 2DCLA 5FJ4A 5DO2A 3DRSB 1WUUA 4C97A 2OD6A 4B3SF 1U7LA 3QRQA 1X9SA 2XMMA 3CJ3A 4GKJF 5I3UA 3EVOA 2LP4A 2ZNYA 2MKSA 3MOJB 2F4VJ 2GA7A 2Q79A 2YWEA 1S1WA 3PKMA 5M2UA 3GFHA 3OFHA 4PG6A 4DR6J 2B6AA 4ZPAA 1RAJA 3ZTRA 2D9PA 2MLZA 4NZ6A 1VBXA 2Z2YB 4DCJB 5AE1A 3MR2A 2E1AA 3BDEA 3TJAA 5L9XA 2Y3YA 1SUQB 4U95A 2JOQA 2QE5A 4IH5A 1IM6A 3LWLA 4M5LA 2KRBA 3T41A 2E9ZA 3QRRA 1HBOA 2M9KA 1JLCB 5A0YB 3KK1A 4P71A 1DHMA 2ACYA 4HKQA 2QA1A 4HT5A 4QIFA 5ETLA 4A8OA 2ZUGA 2XYGB 2CPFA 2A10A 2V2VA 3MFIA 4WJBA 4TXSA 5C24A 3LANA 1F1BB 1X5OA 1NK4A 3MXHP 2YX7A 1DTTA 2WHOA 1AZSA 1YJUA 2VFUA 4M5KA 1S49A 1S7HA 4QBUA 2HHHF 4B3OA 2BJDA 2YX1A 2VQFJ 4X4NA 2VJVA 4URSA 3DLEA 4PEOA 2KHDA 2V6AA 1TKTA 1JLBB 2GMLA 2V9KA 4J9VA 1LK5A 4MYUA 1V3RA 4YHHJ 2ZH5A 1YSJA 5DM7Q 3BGFA 1HNZJ 3FK4A 4NRTA 4DU8A 7FDRA 1RBOB 2FHJD 2V2QA 2RDJA 3I0RA 3G8QA 2B51A 3MEKA 2LA6A 3CDAA 4CDIA 5SZTA 2N4CA 1SQEA 1CLFA 1S4EA 1X4GA 5IC4B 2H5JB 4ZVUB 2BW2A 1UKUA 2OD4A 2GJ2A 3M8RA 2NYHA 1HNIA 2PDAA 3G4SS 2XZTB 1S1TA 3UCUP 2V34A 3I9ZA 1HR0F 2QN6B 4AL5A 4Z37A 1JQGA 2CDQA 2VDIA 2M7SA 2DRAA 3B4DA 1U49A 1LW0A 4ZHRB 4IDKB 2Z2MA 1S77D 1D9FA 1Y9OA 2ZVSA 3DDIA 4OZ1A 2R7WA 1WC4A 4WP9A 5D4OA 4I2PB 4AYBD 4DR6F 4CRJA 5KFMA 4I67A 1LW2B 1YRTA 2MHEA 2D69A 2ZKTA 4F04B 3GP9A 5ETVA 2DR8A 1UVJA 2AF6A 2BACA 1EKSA 2DNOA 4LFCJ 5HMZA 4B02A 1PKUA 3ZZPA 2QEXS 2QX0A 3EUNA 4I68A 3K5LA 1NK6A 1HD1A 1WJ9A 1RACB 3BH7B 4J9PA 2JEJA 1F2HA 1E6YB 4DUYF 1BQMB 3GIMA 3HHDA 2RRAA 2VL1A 1R27B 1HD0A 2ASYA 1RXOB 2IYGA 2RB7A 1FWLA 4KO0B 5KG4A 4A8QA 3QAEA 4YQWA 5DETA 2RVJA 5EWFA 2PIIA 1EP4A 3FZBA 4DX6A 3O1LA 3PNIA 1FFSB 1NDCA 2LDYA 3OFFA 1U24A 4EZ6A 3GG1A 3EWGA 2R3VA 3AT1B 3CW2C 3KLEA 2JL9A 2FVCA 4DV3J 1U25A 1U2CA 2V4JA 1X8DA 2ZNZA 2WB1D 3ZZ0A 3AOAA 1S1VA 1Q8IA 3HSGA 2XSFA 2R7UA 4C11A 4X66F 4OV6A 1WHYA 4H4OA 2DGQA 2G13A 2I6WA 5MLCV 2AT1B 1HWJA 1R0AA 4M5DA 2JVOA 1QD1A 1Q1KA 5CZXA 3GJQB 1IKXB 3QT8A 1N56A 2L9DA 4V19J 1WSRA 1L3UA 3FSXA 3PVXA 1HW9A 2OEKA 5GADU 2R7RA 3IG1B 1NRKA 2IHR1 5A8WB 4ILRA 5T7LB 2Q66A 4ZVSB 3MI7X 1S1UB 2PMHA 5J2MA 2BANA 1JLBA 2X1BA 4X84A 1FKPB 3ENAA 3SIPB 4JI1F 2XS2A 1NH7A 5CYQA 2XWYA 3CCRS 3PW2A 3WIUA 2HW3A 1FJ7A 1KQGB 1V5VA 3POTB 1GK8A 4BCAA 2RE1A 2VD3A 4WFZA 3PX0A 1S6PB 3H8YA 4HT7A 3GIJA 4A48A 1WD6A 2R9LA 1R0BG 3F0NA 2ZM6F 4ELUA 5EN1A 4K7QA 3KLIB 3EX7B 3SDEA 3LW5C 3T1YJ 2ASDA 2JEGA 4TLQA 5H1SV 4ZP7A 2XG8A 5HROA 4TQSA 4DPWA 3Q24A 1CVJA 1S57A 2CVIA 4WP3A 1CJKB 3Q2TC 1S4FA 3H2VE 1UPMB 3QIPA 4URQU 3GYGA 4P75A 3K57A 4LBHA 4JI7J 1YZ6A 3JYTB 4P7TA 3UN3A 1WHVA 1OPIA 3MD3A 2VICA 3D0IE 2R4FA 4CO3A 1WEXA 5J1NA 1JLQA 2C3YA 2O01C 4LF8F 2V5HG 3K5OA 4FN5A 4I1TA 2W4PA 4EYHB 2E1CA 1KRPA 4WE1A 4ZVOB 2G0JA 1BY9A 3R1HA 1R8PA 5A2QY 1TQLA 1VQ5S 3KJVA 4OFZA 2YNFB 4LIRA 5J2PA 3GIIA 5CH7B 4K5RA 2OPPA 4KO0A 2RQ4A 4KH0B 3TVYA 1HQUB 2W24A 5DQIA 1Z2ZA 1WOPA 2XTJP 2GVZB 3PW4A 5IOLA 3BDPA 2RSQA 3UPFA 1XMOF 3RRGA 3CUNA 3BGRB 3SCIE 2W4DA 3CT9A 5CD4H 4ETXA 2VKRA 3ILIA 5HLFB 4PQUB 4C11B 4DV4J 5MAOA 3ITHB 1Q81T 2B4PA 2YWGA 3LP0A 3PM9A 3P5BP 4B9UA 3R2DJ 4K4YA 4ZMMA 1VGYA 4N8OA 4YEAA 3PRVA 4CNZA 4ZLJA 3GILA 1U6FA 3KLGB 2MQQA 2RAQA 3IG1A 5T41A 5KFZA 1DTQB 4WK3A 3PIOQ 2HQFA 2HQCA 2UXBF 3BKUA 3T19A 2WZ1A 1K8AT 2PFFB 1OYDA 2VFRA 1LEOA 4J9LA 1JLGA 2R8IA 2KVQE 2G2ZA 5E5NA 1TMMA 2KXHA 1EAYC 4YMEA 5AE3A 5FD1A 1NLKL 4DPUA 1CQMA 1RWUA 4XO0A 1T05B 4Q2LA 2HSEB 4OX7A 2ZJRQ 2MMYA 1ZAXA 1QVFR 1VJQA 3VGVA 1UA0A 3MPUB 2C3UA 2KT2A 3LPEA 3QWUA 5F8JA 2MZSA 2UVVA 2FGOA 5EDWA 3DDKA 3RBDA 2PC6A 4ZN3A 5KT2A 4H4MA 1GMUA 2MJUA 2WCXA 2F1FA 1YKWA 3DFEA 4DFKA 4WU2A 1IBLJ 2AJ2A 2HBRB 2HFVA 2PGCA 1EQMA 1YWXA 3CDUA 4WXWA 4RLEA 2UXCJ 2CQ1A 1JWWA 2DITA 2A3JA 1GFWB 5HAOA 3JAMU 5ETMA 3WX4A 1CJVB 3DLGB 3EICA 2OPQB 4ICLB 2OELA 4NLUA 1NEEA 5C5JA 1QAYA 1JLAB 4HH0A 5F8LA 5E3PA 5KT7A 2OFHX 4ER8A 1ZM4A 2QSWA 3NGSA 1XMOJ 1S0MA 3DYAA 3TZXA 2AU0A 1X9WA 4OI6A 3M32A 3NBPA 4NRUA 2ZVIA 4OYBA 4QR0A 4FS2A 2HAIA 1AB8A 2YNFA 2F8MA 3M6VA 4L72B 3AD7C 4TU8A 2WONA 2NS1B 1XNRF 2VPXB 2WSFC 3R9LA 4S0MA 1NKEA 1IKYA 1NMEB 4NASA 5CA5A 3IN5A 2XULA 4EO8A 2DY1A 3FCWA 1FWKA 3K17A 1Q5YA 3DRSA 2D3UA 2DNHA 1JJCB 3R7BB 3MAAA 4GVBB 5IV3A 3J80U 4DR1F 4ED2A 1PO6A 4O0IA 2KM8C 3C3LA 1VDHA 1Y3KA 2W1BA 2M5YA 4IOBA 4TYBA 5J2QB 5LL6d 4EK2A 1CULA 1VQLS 1F60B 1TL4A 3M8YA 2ALZA 4DL6A 1RTHB 2ZBPA 5C25A 3NG8A 5KOWA 4HYKA 5F41A 3TZWA 3GFZA 2XCAA 4GKKF 1LXJA 3W61A 4A8WA 1QE1A 1WI8A 1XWLA 3T1AA 3V6DB 2GQQA 2K8GA 4WFAQ 1LV5A 3KLFA 3NGDA 2VIHA 2FQQB 4CT9A 3RU0A 1NHKL 1AROP 2BQUA 2E29A 3TX0A 6FDRA 1TR0A 1WOOA 4DX7A 2N82B 1DQ9A 1JJ2R 4CTAB 1SJ1A 4JV0A 2JX2A 1R8HA 4LQ9A 4ZCKA 3U1MA 4U96A 1KLMA 5CXTA 1H7WA 4DU7A 3DMJA 3DXBA 2BUNA 2DD8S 3TA2A 5LMUF 3OTBA 1ZM9A 4QWAA 3QJJA 2PI5A 2QMXA 4NE9C 4Q7AA 2OPRB 1KVJA 3GIRA 4LR7A 3VHQA 3K59A 2MQLA 3P45B 4DL5A 2GAGC 4NXNJ 4FXVA 4HH1A 4DPXA 4DPOA 1FX4A 1REGX 3PO4A 1QVGR 1LKZA 2YBVA 3CJ5A 3I6PA 1RWKB 3JTNA 5CYQB 4QZVB 1VQOS 4P73A 5DZ6A 2YKQA 1F0XA 3CWJA 1WTFA 1U0HA 4ES1A 5BR8F 1CC8A 2AX0A 1X4EA 1HBNA 3BEGB 2ZM6J 5LXYA 1K73T 1B0TA 4UZBA 1XBWA 1L3VA 5A0YA 4N41A 4HHHA 1S0VA 2JZ5A 2YXLA 4XDCA 2E5HA 5KG1A 1YHQS 3CE8A 3BGRA 1O5JA 3MM5A 1OWXA 1MG7A 1XN9A 2EKNA 4OX8A 3D0GE 3HK2A 1P27B 5B0DA 2DT9A 1FNMA 3HFKA 1JKHA 3MR3A 1QAJA 3ZZZA 3KLHA 2XLKA 1UAWA 2GJFA 4QWBA 4DFMA 1R6VA 1MWQA 1Q82T 4M5JA 1Y11A 1BLUA 3DLKB 2MKKA 4MTPA 1S1WB 5E41A 4XAKA 3EPIA 4LQ3A 2PMWA 3KXDA 3LWMA 2FVPA 4ZJOA 2GVDA 1TUWA 2NLWA 3IR5B 4ZS6A 2J6UA 4LF9J 1N32F 1HIYA 4DR2J 4N5SA 2XMJA 1G4CA 1SH2A 4WFBQ 1CQNA 4L3NA 3QT6A 1AT1B 3BBFA 3KK1B 2HWTA 4E2FB 3OL6A 2WSEC 3M8QB 4NMLA 4QYRA 3WHIA 2HGLA 2JDJA 1RAHB 2ZWOA 1RHMB 3CCES 1G7CB 2CQBA 2EK6A 3M9OB 1LWEB 3CMQA 2QFJA 1EETB 2B8QA 2HNYB 2Z58B 4BWJA 1F6TA 1R89A 3GU0A 4CTAA 3GFXA 3F41A 1LWCA 1F2GA 2HFNA 2CPHA 2Z2LA 2GC8A 2MQNA 2VU5A 3B54A 2QL5B 4NX9A 2KM8B 3R1LA 3ZTQA 1VC0A 3CC4S 2EG1A 2YKMA 2ZBQA 5DDPC 2U2FA 2X7IA 3D2WA 4EBCA 1S48A 2VASA 3LGNA 4Y28C 2KU7A 1RT6B 4PWDB 4WWSA 5CHCB 4J7CA 1FFGB 3P3DA 1ZH5A 4OJ3A 4OI3A 5EUHA 4Q0BA 4C8ZA 2EC2A 4DV1J 5HVGA 1NJZA 5FLXU 2ASLA 2EFPA 1UWAA 2HAFA 2ZE2B 1MMDA 2EW9A 2RUGA 2XBPA 3OSNA 4R5PB 4OIXA 3E8OA 4BC7A 2CWXA 3W65A 4NLOA 3JTPA 3KK2A 4DCOB 3DOKB 4IOAQ 2OI2A 3VAJA 2ZC3A 3H4DA 2HHUA 2H1YA 2DIVA 2E5IA 2RDIA 1FVQA 3OUYB 2JJ4D 2Z8QA 2J0SD 2C2EA 2W7AA 4G1IA 5K8PA 1OYEA 1MWYA 3JQJA 3L7OA 1V6HA 1FE0A 1FRJA 1UVLA 4KGMA 3TA0A 2E66A 3NOGA 2ZKUA 5IC6B 4DSEA 1VIXA 1RWNB 5KFRA 3S8SA 4DL2A 1N32J 2IAJB 3CCVS 4K4VA 3BV8A 3IA0A 4DL4A 2PSZA 1U1KA 5B0CA 5J2QA 2BABA 2Q3PA 2XEXA 3B8HA 4PG4A 4CO5A 1NJXA 3P6YC 2DVIA 2MKCA 5KT4A 5DZ7A 2IA0A 4O44A 2M3DA 2F8HA 2VBXA 2E44A 3FMWA 2DIUA 5IWAF 3VAHA 1VFJA 4DLGA 4O3RA 1EQ0A 3WDOA 1Q7YT 2UVWA 1MN7A 1FX2A 1M1GA 5JVGQ 4ED6A 3KOAA 2BDPA 3M05A 2DGUA 1FDDA 2CQGA 1S9GB 3LF0A 3UD3P 4WE1B 4U6PA 4JI4J 5E3CA 4CWBA 4WPAA 5BYSA 3CJ4A 1FESA 2H48B 5KT5A 4RUCA 3C2PA 4DUYJ 1N8RT 1R43A 4USWA 3J81j 3GMGA 5K9FA 4DJBA 3KFWX 2AHOB 3RR8A 2PMZD 1M1KT 4IFVB 1SC4B 3NEKA 1WG5A 1XJWB 3BN4A 4DV7J 4DFJA 4DR7J 1XMQF 2AEFA 3KLHB 1NB2A 1X4DA 4PZVA 2BQRA 2C3OA 3DLBA 4F2SA 3MF5A 4OHVA 2AJ1A 3IC1A 2HFSA 3W62A 1V5IB 1F9HA 2DXEA 4IH6A 4BBYA 1EIYB 2XMKA 3VAKA 1IBKJ 2ATCB 2UUAJ 1YITS 4EZ9A 4JI5F 1RTDA 1IUJA 5G0RA 3W8PA 3LAMA 4F0KA 1N0VC 3W64A 2PI4A 4M8LA 4ENOA 3KJVB 1WORA 4CO1A 3HJFA 4KGZB 2CNLB 4OZNA 1XIQA 5I3UB 3ETOA 1TL3A 1FKPA 4F4WA 4LF5F 3J7Z5 5DDOC 2I0XA 2J9CA 3T9ZA 3HD1A 1Q86T 3UNGC 4AXIA 2BXJA 1TL5A 5HVHA 1RT1B 4RUBA 1KNZA 4F25A 2DK2A 3I5BA 4KH1B 3AJ1A 4DN9A 2I1RA 2A18A 4MH8A 5KFLA 4N76A 4ANDA 4FNIA 3PFEA 1LWFA 3GSDA 4FPRA 2IRUA 3MCMA 1UVIA 3S1TA 5IWAJ 3NAHA 1KOHA 4EU0A 5FDLA 3M2VB 1HPZB 1PBUA 3CCZA 1PC5A 2J6SA 2QGFB 2ZZTA 1U45A 4ZPVR 4ITSA 1S0NA 2WTFA 3HM9A 2CQCA 4QPTA 2CJKA 3IGNA 1GXLA 4MK9A 2H51B 1RP5A 4CO0A 4C8OA 1T9TA 2G9OA 2AYGA 2HLUA 3TZZA 1RAGB 1GEHA 2V67A 4ETZA 4JI7F 2NZ4A 2QLFB 3PO5A 1U09A 5F8HA 1QM9A 5E3QA 2DHHA 2Z4PA 3IR7B 4DV7F 4WKYA 2MTLA 1U1OA 1SJFA 1CEZA 1Q53A 2DISA 1B0PA 5IT9Y 1P9QC 2BJ7A 1FRLA 4LJMA 1WDTA 4OYMA 1RKJA 3D6MB 2DPJA 1U2RA 2HG4A 4HHUA 1VQ9S 4O4GA 2XZWA 4OJHA 2YY3A 2GO9A 1LK7A 5HVFA 1WELA 1Y4ZB 1WI6A 4MAKA 4NYZA 3UVJA 3W9IA 3CCJS 1SQGA 3M8SA 4NA3A 3GTYX 1HBUB 1WC1A 4TYAA 1ZTWA 2D3OR 2DXDA 4TQRA 1Q78A 1DTTB 4CLYA 4F0MA 3AB4B 4Q5VA 3J7ZT 3EPGA 3NOCA 4ZHRA 4J9NA 2JEFA 3IO1A 5GAEI 2WBMA 4LF5J 1Y10A 3D9BA 1KVIA 2CXEA 3IS9A 3ENVA 1W2BR 5DJBA 3CJKB 2ZHBA 5C25B 2BJ1A 2DNKA 2EXUA 3TANA 4XPCA 4LMZA 2QC3A 4YY3J 3MEGA 5AE2A 5T14A 1IR2A 1RAOA 5A8WA 1LNQA 4R5PA 2EEYA 2KO1A 4LR9A 3CCUS 3J7AN 2GCFA 3GPAA 1KHVA 1S1XA 3TQ1A 4FKYA 3LP2A 3CULA 1NZ8A 4X4UA 1LOUA 3H25A 3GQCA 4RPFA 4DEZA 4F3OA 4YDXA 2JVRA 4CO2A 4DX8H 2KTQA 2RKIA 3L4BC 2IDLA 3ENWA 2F4FA 2QIFA 4ZP6A 4JI8J 3UCGA 1G1XA 1P1LA 2HVIA 4WZQA 1IKYB 2LQ8A 1C0TA 1VQYA 1SKWA 2XMTA 3N6LA 4F4XA 1A0OB 1YTYA 2V4JB 2AGQA 1PCAA 1J5EF 4NLGA 2B56A 4HDGA 1NHUA 2GIQA 2P9EA 2BR0A 4M5NA 1Q95G 4I7FB 4G1QA 3SSRA 4IDKA 2FD2A 4HEA9 2AYEA 3M2VA 4DV6J 4OX6A 4P2MA 3VGSA 7FD1A 2DPIA 4DWIA 3KG1A 1A7GE 5BJRA 1C0UA 4KHMA 3GFYA 4OJGA 1ICEB 4CLFA 2OTJS 3AXKA 1DBDA 2AX1A 2LDIA 3OR1A 1I3OB 3OT9A 3HPOA 4B3TF 1FEHA 3P4UB 3PDNA 2NR0A 1CJVA 2BRKA 1S59A 4P74A 2I38A 4QWDA 1J27A 3ULHA 5LJ5Y 1F5AA 4CH1A 1R31A 1X5SA 4AL7A 2DR6A 2MKYA 3QFWA 2UXBJ 9ATCB 3FFIB 1RTIA 2VFSA 4XK8C 1TKXB 1HNXF 2J5AA 2VJUA 4LSLB 1HBNB 2F4VF 1RJJA 4JV5F 4X4PA 2R2UA 3IRWP 2YWKA 1FKOB 4HR2A 1ZAVA 3PR5B 4I6WA 3KYLA 2AD9A 3LP1A 3QO9A 1ZTTA 3BM7A 4QWEA 1YLXA 1YIJS 1TV6B 3R5DA 3D0HE 1T02A 2OPSB 5J1EA 1I6JA 3D5MA 2D7SA 1UZDA 1Y7PA 2QG9B 4IO1A 2ZOGA 4LR8A 2FHKA 5DRKA 2D41A 2XHCA 1T3NA 1WF2A 3KHLA 1TL7B 1U8SA 4KV8A 2MZJA 1HYSB 4F36A 1X4AA 1CJKA 3SSSA 4OYIA 5ETQA 1IBLF 3VQTA 1ZETA 1N5VA 1EARA 3JQKA 2PA8D 1TU0B 4DQSA 3A3PB 4OX9F 2XC9A 2KXNB 2HMIB 3VAIA 2R2TA 1I5OB 3EM1A 1X4BA 4IFYA 2YH0A 4DXLA 2MZ1A 2V69A 4U8YA 3MZIA 2LQBA 3CIMA 3EGWB 4CQ1A 1HI1A 1NPKA 1YJRA 4HDHA 3DRYA 4DV0J 3NNAA 2CPXA 1BWEA 3HCXA 3M30B 2FHOB 5GMKa 3RTVA 5L38A 3SCKE 4TKTA 3IBCB 1YRUA 2J7KA 2DH7A 3HHKA 3MR5A 1VRUA 1AYEA 1A9NB 4BS2A 4I6AA 3MM5B 1ZZFA 4N56A 3DGPB 1BHNA 2H5EA 1RLCL 2Y1IA 1FEEA 2DNRA 1VI7A 1T03A 1SBRA 2V8GA 3MPYA 2OTLS 4DV2F 3V6JA 2HLTA 2NSCA 2RHQB 3H7HB 3MEDA 4UQTA 2U1AA 1MSWD 4G1QB 3EGZA 1Q0NA 2DNLA 5HMXA 3W7BA 2XWXA 4WTYA 2NXEA 1UA1A 4FXDA 4K4SA 2BKPA 2R2RA 1N34F 3D3CJ 1KHWA 1FJGF 3BS9A 5LMUJ 3ITHA 3CDEA 2I8EA 1UZHA 2A6OA 2P6SA 2VZ9A 3BSOA 1IVZA 1SC3B 2C2RA 4NPOA 5IM0B 4ECYA 5KFPA 3QIDA 2EPIA 3DU5A 2P6TA 1RCXB 3AQOA 2GNKA 4Y34A 3FBBA 1RTIB 3JXOA 2CQ4A 1WKKA 5A8RB 1RZMA 1KS2A 4HTJA 5KOXA 2B5JA 3C8YA 5A6PA 4RNNA 3OD2A 1KQFB 3N79A 1ZA2B 3OTOF 2JHEA 3BREA 5BR8J 5FLXY 3DHXA 2XSJB 3IRXB 1L3KA 3NRBA 4FVMA 4XTTA 5KFIA 4DS5A 3T1HF 5KFFA 2M2BA 5KT3A 1HBMB 1FJCA 5A76A 3PRDA 3NGUA 2OFGX 2NQPA 4F4AA 4KPYA 1TV6A 3PFOA 3RB6A 1QUPA 4Y2IA 2FJVA 3N4WA 5KG5A 1BC6A 5HP1B 2W25A 3QGPA 4OHWA 4X64J 2FY1A 1N48A 1DFDA 3GCWP 3Q8PB 2VBYA 3M6WA 4DUZJ 4PRFA 2CQDA 3GCXP 2ZH3A 4URGA 3OHAA 1QUVA 4R0EA 1NM2A 3CPWR 2FYXA 2JFDA 4F2RA 1JB0C 4MFBB 3HFZB 2B7CB 1FK9B 4CLZA 1RTDB 3QSIA 3HHLD 5G0RB 5A8KA 5LT5A 5KG2A 1X0FA 1HQEA 2HK2A 3LGHA 1W26A 4USIA 3V4IA 4K59A 1UWBB 4NLRA 2KG1A 1LFPA 3I82A 4LFBJ 3S6EA 3BGUA 1B99A 4PYAA 1SUQA 2ZH4A 5IT9U 2R7QA 3P5TL 3CCSS 3I5AA 4O3NA 1RKIA 2FTRA 2LYVA 2QSFA 4C0BA 2YNHB 4GO5X 3CC2S 2LEPA 3RAXA 3AH6A 3DGVA 4QOTA 3OVAA 1RWWB 3DHWC 2EBEA 3SEOA 4FYVB 3WC2A 1TFWA 2EFOA 3US5A 3KUGA 3FMBA 2E1MC 2VDHA 4K8RA 4I7FA 2N7CA 5KFUA 5LOQA 3NL0A 4PG5A 2CQIA 2Z30B 3D66A 4L6V3 2VC0A 3BF4A 3HSZA 3O2IA 4J5OA 5CCLA 1BMQB 4DQRA 1FDAA 5KFQA 1H73A 4KFBB 2K1RA 5DG9A 2KYZA 4P10A 2IFXA 3OJSA 2C2NA 1N5QA 2K7KA
chains in the Genus database with same CATH topology
3HT3A 2QT7A 4LF4F 3R3TA 4O44B 3HX9A 3H2UB 2ZE2A 2MDAA 4HTIA 1Y5IB 4NZ0A 1NK7A 2BE2A 3DM2A 4C0OC 1VRUB 1Y5NB 2D3ZA 2DCUB 4Y6IA 4W90B 4F4ZA 3KHGA 5H9FJ 4C9DA 4G3IA 3IFEA 1LFWA 4KTQA 2IMOA 3LGMA 3WBZA 4RW8B 2PA3A 2CZ4A 1PSDA 3IXQA 1WNEA 1QSLA 3OV7A 1CSJA 2VG7A 1WG1A 4K4WA 5L1IA 4MIBA 5KT6A 1ZYQA 2X51A 3U1NA 2FHMA 3VAGA 1GH8A 2ZOMA 3MEEA 4E8UA 3I0SB 1Q4RA 5DDQC 1XMBA 2XB2D 1ZPWX 5G4DA 1VMBA 3TVKA 3MM9A 1RA7A 1VHFA 3IS9B 1YJVA 2DNPA 3FJ2A 1LXNA 1ZBTA 2HS0A 4AL6A 1VQ8S 4BDPA 3NCQA 1Y0HA 2L48A 5IZHA 2HRUA 1DARA 1RYSA 1T7PA 2P5VA 3U27A 2HS4A 3POTA 3CEDA 4ZCMA 1GX6A 2EKYA 5I3PA 2QV6A 3CSKA 3ZZOA 4KC5A 1FTCA 4MYTA 3AB2B 4Q2MA 2XGQA 1TKDA 1S0OA 1U6BA 1H7XA 1HPZA 2R7VA 1KVIA 3FEYB 2UV8G 4KKOB 2B4VA 3J80Y 4N8NA 1NO8A 3TX8A 3KLVA 3FVYA 2GGPA 1SL1A 1TKTB 3KHHA 1N32F 4FBTA 1RQ0A 3QGHA 2BOPA 4Q45A 3MPWA 4E0DA 2HFZA 1FXDA 4B9LA 3H5XA 2CVEA 3DRPA 2Q1LA 4P7VA 1DQAA 2XLJA 4NLYA 4IFYB 1JLQB 2WBRA 4Y2CA 3V6DA 2RU9A 2VG6B 4F67A 1S1UA 3OTEA 4DSKA 1S76D 1NZAA 2LXFA 4JUZA 5E2QA 4ZPCA 2BE2B 3DM2B 2UUAF 1FNOA 2RH3A 1FRIA 2COLA 4YP3A 2E5LF 1FCAA 1HWKA 2L9WA 3MAQA 3V6HA 1I94F 2BBEA 5F0UA 5KFEA 3SSQA 3H5UA 3ZZUA 3MDFA 2R7SA 5CZVA 4AFFA 4KFBA 2K1RB 3T9NA 4TN2A 3AQPA 2CPEA 2YVSA 2LQJA 2BV3A 3O5TB 2R2SA 3AA8A 4IKAA 4PXDA 4IG0A 5DS7A 3ZZRA 3E3XA 3CCMS 4ZA1A 4WCEQ 3H59A 4OZJA 2Z0GA 3KKFA 1W2IA 3CF5Q 1YJTA 1U1LA 1FRKA 4JI6F 3H4BA 4J37A 5KG6A 3TYTA 1NK5A 1JMTA 1SJRA 4WK1A 4UW2A 2FDNA 4JI2F 3MWBA 3MUMP 2ATLA 2YKNB 2C3MA 1X4FA 2IVFB 3DI6A 4RW6A 4IG3B 3FGVA 4M63A 1J5OB 4J9KA 3CDWA 2AJ0A 4MMOA 3KK3B 2YKOA 2Q43A 3W2VB 3CD7A 1NU4A 3MMJA 1N52B 2M88A 3IAS9 2W9CA 1HFEL 4H4KA 4OI4A 4DQPA 5THWA 4FYDA 2YKMB 3OVBA 2CQPA 4NLPA 2R7XA 2BZ2A 2LMIA 1G6BA 2EK1A 3SQGB 4EGLA 2J6TA 3MM9B 1IN0A 3Q0AA 1Z4UA 1S6UA 2HHWA 3QLHA 1VC6A 5KFOA 1NH8A 3CC7S 4FF4A 3JB9k 1NKBA 2KFNA 4ZKAA 2E7XA 3EXCX 3NP5A 4WXOA