4LSLB

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj476), a non-nucleoside inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
428
structure length
417
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 103
structure length 417
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lslB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslB03
1S9FA 1C0UB 3MEEB 3DM2B 2FVCA 1S1XB 1S49A 4ECXA 3GV8B 1S0MA 3PW4A 2D7SA 4IRKA 1EETA 3MR3A 2JEGA 2BQUA 5KFNA 5KT4A 5CYQB 2XI2A 4I2PB 3LP0A 4I2PA 2HMIB 3I0RB 4KV8A 2HMIA 1K1SA 1HMVB 3CJ5A 3I5BA 4ZPAA 1SV5A 4O44A 5KT3A 1TKTB 4ECTA 1RTHB 3LP2B 3RB3A 2OPSA 3KMQA 2FLNA 1S9EA 4KB7A 4F4WA 3RB4A 1SH3A 3N6NA 3HVTB 2QE5A 3KK1A 3GQCA 2ASLA 5KFWA 4Q44A 1REVB 2HNDA 1TV6A 1TL1B 4TY8A 1FKOA 2IJFA 1HQEA 4M95A 3G86A 1EP4A 4NZ0A 5KT5A 4KO0B 2UVUA 5HP1B 1JXLA 4NLXA 1HNVB 4ZMMA 2ASDA 1LW0A 3PW0A 3N6MA 1S0OA 2RF2A 5J2PB 1C1CB 3QIPA 1K1QA 3I5CA 2I5JB 2UUTA 3PZPA 4MKAA 1LWEA 3FFIB 5J2QB 1IM4A 4RW8A 3NAHA 1N4LA 1HQUB 3QGIA 4O3QA 1C1CA 3QIPB 1S1TA 5J1EA 4RNHA 1LW2A 2RF2B 1GX5A 4LSLB 2R8HA 4PWDB 1DLOB 2OPQA 2WOMA 5L1JA 2BQRA 1SUQB 1S1UB 1HARA 3TAMA 2E9RX 2B43A 2UUWA 4O3PA 3MR5A 3KK3B 4EBDA 3CIZA 2B6AB 3PJWA 4MK9A 4X2BA 3H4BA 3Q8PB 3DLKB 3IRXB 1FKPB 3TQ1A 1BQMB 2E9TA 2AX0A 2OPSB 1XR7A 4RW9B 3Q8QB 3BQ1A 4TYAA 4ZVHA 3T5JA 3HVAA 3OL9A 3H40A 3DRRA 2R2SA 4QWDA 1S97A 4RW6B 4IG0B 3ITHB 3KMSA 4DL2A 1JLEB 4IG3B 1C0UA 3MEEA 2I1RA 5EWEA 3KLVA 4TXSA 1MU2A 4K4XA 3KLHA 4EEYA 3CJ3A 4O4GB 3KLEA 3V4IA 2IJNA 4NYZA 1RT6B 4R8UB 4IG0A 5KFIA 2XGPA 1S6PA 3KLGA 3DLEB 3PVXA 4Y2CA 2UVWA 2OPRA 5CYQA 4K4TA 2WRMA 2AGPA 3DOKA 5JUMA 2R2TA 5KFMA 1VRTA 2HWIA 4IDKA 3OL6A 4EYIB 3IRXA 2VA3A 2OH2A 3OSPA 2YKMA 1GX6A 1RYRA 1OS5A 3IS9A 3KK3A 5KT2A 4WE1B 2D41A 5KFBA 3OL8A 2JLEA 3BQ0A 4F4YA 1S10A 4Y3CA 4ZVGA 1MMLA 4XPCA 4RNFA 3V81A 4Y2AA 5DQGA 4Q43A 4YQWA 1IKVA 2W7OA 5I42B 4GC6A 3QLHA 1LW2B 5KFZA 5EWFA 3V6KA 3DOLA 1RTDA 1QAJA 4WYLA 4PQUA 5J2MB 1Z4UA 1RA7A 3JSMB 5J2QA 3MECA 4J9LA 4WZQA 3M8QA 2J6UA 5KFXA 3JYTA 2IC3B 2R8IA 1XR6A 5KFQA 4WFZA 4H4OA 3C6TA 1HNVA 5KG5A 3FQLA 2YKNB 5J2NA 5KG3A 5KFCA 3EPIA 4YR3A 3M9OB 2W9BB 1S1WA 4ICLA 1TKXA 5F8IA 5DG8A 4ZP7A 2XGQA 1C1BA 4FS1A 3KK1B 1UWBB 3HVTA 3KHGA 1HPZA 1HPZB 1JLQA 1RTHA 3LP2A 5C42A 3NGDA 1R0AA 1JLAB 1HYSA 1TKXB 1KLMA 1S9GB 3KLFA 3I5AA 2JEFA 3DYAA 3BSOA 2WONB 3LP0B 4IKAA 2BANA 3T1AA 3N6LA 5KG4A 1CSJA 2YKNA 4NRTA 4K4WA 3PW7A 2WHOA 4KE5A 5KT7A 4TQSA 1RT2B 4ECQA 2V9WA 1T03A 4EYHB 1DTTA 1DTQB 4NCGB 3I0SB 2W8KA 5KFPA 3CO9A 1LWFB 2YNIB 3IG1B 4IFVA 3HVWA 3V6DA 3M8PA 1C2PA 5C24B 4LQ9A 3H4DA 5HBMB 4R0EA 4URGA 5HLFB 5T14A 4NLOA 2ZD1B 3QO9B 1KHVA 4MFBA 3LAMA 3UPFA 1RTJB 5KFRA 4U6PA 3M9NB 3DLGA 2B5JA 4MKBA 5HLFA 5F8NA 3UQSA 5C24A 1S1VB 5HROA 4K4ZA 3LAKA 3CJ4A 1RAJA 3MF5A 4RW7A 4H54A 5CYMB 3I0SA 5CYMA 3BSNA 3SI8A 4ECZA 5KFVA 1RT2A 1S1VA 4YR2A 5KG1A 2BE2A 4G3IA 4QWEA 3G6YA 4DL4A 2BQ3A 1FK9B 1JLGA 3ISND 1RT4B 4MH8A 2AX1A 3HKWA 2AU0A 4ZP9A 1C0TB 5EUHA 5C42B 3D5MA 4Q8FA 4NLTA 2VG7B 4IFVB 3D28A 4NLWA 3RBEA 4MIAA 1T94A 4I2QB 2YNHB 4I7FB 1JLEA 4IG3A 1N6QB 1J5OB 3H2LA 3QYYA 4EO6A 4JV1A 4K50A 5D3GA 3DRSA 1JX4A 5KFAA 5L1KA 3ICLA 4K4YA 4EO8A 2FVSA 2GIRA 5DQIA 2BANB 1HNIB 5F8MA 3BQ2A 4TLRA 4ED2A 4EBEA 5D3GB 5EWGA 3KOAA 1R0AB 1HYSB 1J5OA 1RTIB 3PR4A 2HAIA 4ECWA 1QE1A 5F9LA 4XO0A 4URSA 3MECB 5DLFA 3DLKA 3KHLA 2FVQA 2YNFA 3EPGA 3NKYA 3MR6A 2UVVA 1JLCA 4QW8A 5KFTA 2C2RA 2HNYB 4RUCA 4DL3A 4IQXA 1RT4A 1SUQA 3BR9A 4NLYA 3RAXA 2IM1A 5DGBA 1TKZB 3NL0A 3KJVB 3BSAA 4LSLA 2BE2B 1ZTTA 2JC1A 1S6QB 4R5PB 3E51A 5K14B 3QGHA 2AGQA 3T5LA 1T3NA 1W25A 2YKMB 5KFDA 1TVRB 4J9KA 3G6XA 3V6JA 2FVPA 4ZVEA 2XI3A 4QPXA 5J2MA 4NLSA 4PQUB 2I5JA 5KFGA 4J9SA 5F8JA 2VG6A 1RT3A 4K4UA 1LW0B 4MFBB 2OPRB 4ED6A 4WZMA 2ZD1A 5KFUA 2IMWP 2YNGB 4RU9A 3QZ8A 4JUZA 3CJ0A 3SFGA 4WE1A 4ZHRB 4NLGA 3Q8SB 5DG9A 1LWFA 4H4MB 3GILA 1N48A 4IFYB 1SH0A 1NHVA 3CVKA 4IDKB 1RT7B 5FDLA 3GIIA 2DPIA 2OPPB 4RW6A 3H5UA 5C5JA 4ECUA 3PW2A 1HMVA 3DRRB 3V6HA 1S48A 1JLBB 3KNAA 3OHBA 1KLMB 3KLFB 3PW5A 4RW9A 4KHRA 2AGOA 3KHRA 2C22A 2ZE2A 1RT7A 2D3UA 1BQMA 2QV6A 1FKPA 4DL7A 1S1XA 3DM2A 4FS2A 3RBDA 2IAJB 5KFLA 3IGVA 3KLIA 4Q0BA 4KHMA 2W7PA 2B6AA 2XCPA 4TQRA 1IKXA 1SH2A 4M94A 2W9BA 3TAMB 3H5SA 5J2NB 3MEGA 4DEZA 3GV5B 2IM2A 1DLOA 1S4FA 4PWDA 4ZP8A 3RAQA 2C2DA 2JEJA 1I6JA 4K4SA 4PUOA 4ZPDA 2ILYA 1RT3B 5L9XA 3DDKA 4RW4A 2BRLA 2XC9A 2ALZA 1HQUA 3MFHA 2RKIB 4JV2A 3PR5B 1JKHA 1LWEB 3FFIA 5EDWA 3DOLB 1RTDB 4OL8A 4WXOA 1IKWB 4B3OB 3E01A 3KK2B 2W9CA 5I42A 2R8JA 1IKVB 4IH6A 2AWZA 3UR0A 4GC7A 1TKZA 3LP1A 3LP1B 4KAIA 1EP4B 1QAIA 1IKXB 3KK2A 2W9CB 1JLCB 5KFJA 3NBPA 3OHAA 3BJYA 4KFBA 3T5HA 5KFYA 2RKIA 4TY9A 3PHEA 4ECVA 4EBCA 1VRTB 3OSNA 2ZE2B 4RW4B 3FSIA 2F8EX 4WYWA 2WB4A 4DL5A 1SV5B 4O44B 4PUOB 1N56A 3I0RA 4KV8B 2FJWA 5DGAA 1HNIA 3MEGB 1ZTWA 5F8LA 4KO0A 4QWCA 2HNZB 1RT6A 4IRCA 4IOBA 4RZRA 1RA6A 1TL1A 5KFOA 1TV6B 2EC0A 1MU2B 4ZVFA 4Q0BB 3BSCA 4I2QA 3QZ7A 4ID5A 4H4MA 2IAJA 3RB6A 4RUAA 5DG7A 2RDIA 1S9EB 3HHKA 2VG7A 5F8GA 4YR0A 4DL6A 2HNZA 3DRPB 1TKTA 1IKYB 3BGRA 5F8HA 5DLGA 1ZETA 2IBKA 4J9QA 2XWYA 4LSNB 3PJXA 3EZUA 5C25A 1EETB 4O4RA 4MK7A 3LALA 2R2UA 3NAIA 2ASJA 3GV7B 1BQNB 4WXWA 4HKQA 3CDUA 4NRUA 4RNOA 3UDLA 4KFBB 4ED1A 4KKOA 4IH5A 5F9NA 4J9RA 2C28A 2J6TA 4NLUA 4IR1A 5K14A 4U7CA 5HROB 3DMJA 3DLGB 2YNGA 2WOMB 1D0EA 3VQSA 3GIMA 1N5YB 3QO9A 5KG7A 3E01B 1IKWA 4B3OA 1RT5B 3CWJA 1JLFA 4J9NA 3DI6B 3M8PB 1JKHB 4NLVA 4IRDA 3CJ2A 4O3RA 2VG5B 1DTQA 4NCGA 2V4QA 4KSEB 1RTIA 4ZP6A 5L1IA 2AQ4A 1TL3B 3MR2A 3OLAA 4DG1B 4FBUA 4HYKA 5HP1A 4O3NA 4MK8A 1YVFA 2WONA 3DYAB 1HQEB 3DRSB 2IA6A 1JLAA 4YP3A 5I3UB 2V4RA 2HNDB 1REVA 5KG0A 2YNHA 5KFEA 1JLQB 3KLIB 1U09A 3KHHA 1UWBA 3T5KA 2E9ZA 4KBIA 4RNMA 2UVRA 1JLBA 3G6VA 5DQHA 1FK9A 4Y34A 4ED0A 4QWAA 3C6TB 2OPPA 4H4OB 2VA2A 4NLQA 5FDLB 4XPEA 1RT1B 1T05B 2HWHA 3RB0A 4I7FA 1N6QA 2C2EA 4IFYA 3M8QB 1XR5A 2W8LA 4ZHRA 1JLFB 4G1QA 3ISNC 4Q45A 3FDSA 1TP7A 4FBTA 2FJVA 1C0TA 1RTJA 5KFSA 2O5DA 2BRKA 3GIJA 1JLGB 3H98A 2VG6B 2ATLA 2ZKUA 2JC0A 3QIDA 1S0NA 3IS9B 3IG1A 2BR0A 1TVRA 4ED3A 4ZPBA 3FQKA 1S6QA 1RT1A 4R5PA 3T19A 1T05A 1BQNA 1JIHA 3QGGA 2FJXA 1QUVA 4NLDA 3KJVA 3DOKB 2IM0A 2JEIA 1KHWA 4TN2A 2HNYA 2J6SA 3BREA 2R8GA 1WNEA 1S9GA 4URQU 3MEDB 2WTFA 4R8UA 5KG2A 5HBMA 4O4GA 2YNFB 4F4ZA 4ECSA 2FVRA 4ECYA 2YNIA 2FLLA 3C6UA 2XCAA 1VRUA 4O3SA 5L1LA 1QE1B 5KFFA 4NLPA 1T03B 2WK4A 2IM3A 2ILZA 3M9MB 1RYSA 4ICLB 2V0NA 4K4VA 3ITHA 2W9AA 4J9MA 3Q8RB 1LWCA 4IR9A 1LWCB 4ECRA 2CKWA 4O3OA 4YMEA 1TL3A 3FRZA 4TYBA 3GYNA 4ED7A 3JYTB 3MTKA 3NMAA 1VRUB 3C6UB 3LANA 4JV0A 5KT6A 1C1BB 2GC8A 3NBPB 4QWBA 5I3UA 3MEDA 2WCXA 4J9PA 2GIQA 1S1WB 2R8KA 5KG6A 3H5XA 3CDWA 1S1UA 4IH7A 4LQ3A 1RDRA 2OPQB 3TVKA 5KFHA 3H5YA 5KFKA 4DG1A 3DMJB 2FLPA 3GIKA 1S1TB 5J1EB 3MFIA 2IC3A 4J9OA 2VG5A 3OLBA 4RW8B 4RW7B 3IN5A 3H59A 3JSMA 2CJQA 4ZPCA 4QW9A 3DI6A 1D1UA 1RT5A 5J2PA 3OL7A 4Q8EA 2B5JB 5C25B 3QLHB 4WFXA 5JXSA 4WFYA 1NHUA 4F4XA 4LSNA 1N5YA 3CDEA 3DLEA 3V81B 1S6PB 3KLGB 1NNDA 2R2RA 3IGNA 1IKYA 3BGRB 3DRPA 1TQLA 4MIBA 2RDJA 4RNNA 4G1QB 3V4IB 4NLRA 3KLEB 4ED8A 1FKOB 3SFUA 4TY8B 3V6DB 2D3ZA 2DPJA 3KLHB 4F50A 4ID5B 4KKOB 1DTTB
chains in the Genus database with same CATH superfamily
3K58A 2IBOA 1S9FA 2EFNA 1RJJA 1S49A 4DSKA 1KNZA 1I1GA 1S0MA 4CI0B 1VQNS 3G8TA 5MAOA 5LJ3Y 4R25A 4C0OC 3PW4A 3A12A 4HT5A 4LBIA 4NWBA 5KT4A 2WVFA 3LP0A 4KV8A 1UVMA 1OY9A 3CJ5A 3RB3A 2NSCA 3LP2B 3GFZA 4JI1F 1HBNB 2CQ0A 2OPSA 2YH0A 3IR5B 1WC4A 3MOZA 4C48A 3LUYA 4LREA 5ETTA 1RI7A 4CLZA 1CLFA 4GKKF 2YX7A 2ASLA 3KK1A 2XHCA 4HEA9 2DNHA 4Q44A 1REVB 2I6WA 3GYXB 1TV6A 3G8QA 3MPYA 4Q2LA 4TY8A 4X4OA 1AUDA 1RZMA 1SIZA 2UVUA 3G86A 1EP4A 3FEXB 4FF4A 5FIIA 4KHPJ 5K8NA 1DBDA 4OYBA 4YOEA 4ZMMA 1NK9A 3RAMA 1ZA1B 1VC6A 1DAXA 1UEVA 1WHVA 2JWNA 1Q4RA 1C1CB 3QIPA 1K1QA 2VC1A 2I5JB 3CMAS 3PZPA 4X84A 4O0IA 2HZVA 1T95A 4WKRA 3W9IA 5E7OB 1IBLJ 3NWGA 4DL0C 2QFJA 1G7CB 4X4QA 1RQ0A 3TJAA 3C3LA 1N4LA 3B78A 3QGIA 3W8PA 4DQQA 4TU8A 3PX4A 1S1TA 1IBKF 3NCQA 3QATA 4PWWA 2HHWA 4PWDB 1U2FA 3R7BB 2OTLS 2Z56B 3SSSA 1N34J 3T9NA 3DOMA 1S1UB 4YDDB 3HSDA 5THWA 2E9RX 1CBKA 1F5BA 2UUWA 1RHUB 5B0FA 4O3PA 4RPFA 3KJQB 4XAKA 3ZZYA 5GMKa 1HNXF 4CT8A 1EQ0A 2BM0A 4MK9A 4QBUA 4X2BA 2EC2A 3FEYB 5CQGA 1BQMB 1RGVA 4DR6F 2QA2A 1IR0A 1WC3A 3GFYA 1HBNA 1UWAA 2PDAA 3MPUB 4YY3J 4EU0A 1AZSB 3CUNA 2XMAA 1K0VA 3ENWA 4FN5A 4ZVHA 2XY6A 3LGHA 3DRRA 2G0IA 4OIXA 1S57A 5L39A 4B3MJ 4BWMA 4USTA 5LMUF 5FJ4A 1JLEB 2C2NA 1C0UA 2I1RA 2R3VA 3VVUA 3MUTP 1UFWA 3K2YA 5F3ZA 5DDPC 1EB0A 1N33J 4K4XA 3KLHA 3O6QA 3RG6A 4NXMJ 3CJ3A 3OTOF 4CZCA 1O0PA 3V4IA 2NS1B 4BWJA 5KFIA 4R8UB 5HQ8A 1S6PA 1NH8A 4LBHA 3R1HA 3LPYA 3C8YA 3AH6A 4YY3F 4K4TA 3DOKA 3CCVS 3NG8A 5KFMA 1ZPWX 1X9MA 4FKYA 2YPYA 3J81j 2HWIA 3G9CA 1Y11A 1SBRA 2J7UA 3GR1A 3VAIA 1LK7A 4LRDA 2E1AA 3OSPA 1WG4A 1GX6A 3RRGA 6FDRA 2ZVIA 2R7UA 3TA0A 1TK0A 1M1KT 1NXIA 4EUVA 3B4DA 4JBCA 3BQ0A 3MI7X 4Y3CA 1MMLA 4XPCA 4RNFA 4S0MA 4DS5A 1VIXA 5HQMA 2RJZA 4JV2A 7AT1B 1PILA 4YQWA 2W7OA 3T1YJ 3KFWX 4I4BA 2FGOA 3EGZA 3PTWA 3MPWA 1VLYA 3B82A 2PE8A 1RA7A 3JSMB 3BH6B 1Z1ZA 5J2QA 4OX9F 2YKOA 4RUHA 5DDOC 2J6UA 2OHDA 5CD4A 3O1LA 1Q8BA 4ED4A 2ZJQQ 2HRTA 1F3VA 2A18A 2FZGB 2F9DA 2W4CA 4WFZA 5KFQA 3RU0A 4H4OA 1H6KX 3C6TA 2JLFA 5DZ6A 3X3UA 2DK2A 3FQLA 2YKNB 5B0CA 1JXEA 2HIYA 2ZNZA 5KFCA 1VQMS 4OX7A 1NK7A 2OFHX 2B9EA 3UO0A 4PG8A 1TKXA 2B8QA 4M5IA 4ZP7A 2UP1A 1NB2A 3SCLE 4NXMF 2CRLA 4DV5J 3GFXA 3G71S 1HPZB 2L3MA 2Q79A 4NMXA 4F25A 5D15A 5SZTA 1RTHA 3GG0A 2G2OA 3NGDA 1HYSA 4TLQA 4BC9A 5DETA 1KLMA 3KLFA 1W7WA 2FC9A 3H90A 3DYAA 3I5AA 2VQFJ 1NJYA 4IKAA 2BANA 2VFSA 3CF5Q 2CJKA 4F4AA 4Y6IA 4MT1A 2WHOA 1YBUA 4NOHA 3UDCA 4KE5A 1DQAA 2HBYB 4A46A 3V2UC 4CQ1A 1RU1A 2W2NP 1M5SA 1AFIA 1DTTA 2OFGX 4ZPVR 5C7PA 1P8GA 1E6YA 1LWFB 1OY8A 3CDAA 4LUBA 5ETPA 3IG1B 5B0GA 1JXLA 1C2PA 2ROGA 4LQ9A 3KHLA 3SV4A 4R0EA 4A8YA 4CTAB 2F65A 4DPUA 2A0FB 2EEYA 3CGIA 4DF4A 2V67A 2BW7A 4LF7J 2ZD1B 1N36F 1XTZA 3CC2S 4QIGA 1IQZA 3L3CA 2MEWA 2HS4A 1DFDA 4WU3A 2QLWA 4MKBA 3BO2A 2KXNB 4U9RA 3TAPA 1S1VB 1FEEA 2B9WA 3LAKA 3CJ4A 1RAJA 3PYFA 2DGSA 3MF5A 3FBFA 3JQJA 5CYMB 4ERDA 1UMJA 3BSNA 1VBZA 2DNMA 3SI8A 2VODA 1T9TA 4ECZA 1PAEX 2ZWOA 1S1VA 2AT1B 2HBQB 2XYGB 4QWEA 4G3IA 3EX7B 5HVHA 3TUZC 5FLXU 3MAQA 1C0TB 2DHSA 2DVIA 3R8YA 3K5PA 2EFQA 1FRKA 2GMJA 4B9MA 3DRXA 1J5EF 1YK9A 2CJ9A 5CAAA 4I2QB 3PNIA 3GR0A 3TR5A 2H48B 4EO6A 4ZPWR 4U7UK 2QTWA 3DRSA 4JI1J 3BZQA 5D6GA 3HM9A 1S6OA 1ZOTA 1R0BG 4M5MA 4N47A 4EO8A 5KOWA 4GRSA 4TLRA 1E6VA 2F4VF 5EWGA 2X3DA 1FO1A 1HYSB 3RRKA 3KOAA 1BD6A 3NCRA 3HVRA 1J5OA 3NMRA 1H98A 4MJKA 1QE1A 5F9LA 3KNAA 4FYVB 1NM2A 1VQ5S 2X1GA 4KH0B 3G82A 3EPGA 3B54A 2UVVA 2QL9B 3AA9A 3M30B 2LQJA 3Q0AA 5L1KA 4DF8A 2HNYB 1CQMA 4DL3A 3CCSS 1SUQA 1SC6A 4NLYA 3RAXA 1F60B 2IM1A 1TKZB 4DXLA 2C3PA 1ITPA 2X1BA 3BSAA 1HHTP 4LSLA 2BE2B 1TU0B 1VBYA 1EJ7L 2JC1A 3JAMU 2ALYB 3E51A 2AJFE 5K14B 3I4PA 3K8VA 2OTJS 4FF1A 2ZH5A 1T3NA 5JJBA 2YKMB 1IR2A 2ZC4A 3G6XA 1D8YA 3V6JA 4C8LA 3J81Y 5E3CA 4OHYA 1APSA 2ZUAA 2PFFB 2ZVSA 4QR1A 5KFGA 3DNCA 2M8DB 1FTRA 1WSRA 2QLFB 1K9MT 4K4UA 2OPRB 3NNCA 4LBPA 4BLGA 4DN9A 2YNGB 3NS6A 4CM0A 3QZ8A 3HSJA 4JUZA 3CJ0A 1RCOB 3H7HB 5HO4A 2MGZA 1PBAA 4N56A 2DGUA 2ZDPA 1PJ7A 1RP5A 2CAJA 2DNKA 3FCHA 1VCTA 2DR7A 2E5LJ 1U1LA 1SH0A 1WC0A 5IZHA 3CVKA 3EUNA 2L41A 2ZZNA 4USIA 1A7GE 2AF6A 2K3KA 3C14A 4A8FA 3GIIA 4NI2A 1RISA 1W2IA 2BEFA 5C5JA 4ECUA 4ID8A 2V34A 1HMVA 5F41A 2R7TA 2OP5A 1S48A 2AV5A 4PQAA 2AEJA 2F3JA 4ZLLA 3PW5A 1KTQA 1AZSA 4UF4A 5K8MA 5E3RA 1Y4ZB 2ZE2A 1JXVA 4MMOA 2OO4A 4JI3F 2KFNA 4DSJA 1NSKL 3J7AN 1WORA 5KTQA 1AXQA 4K2JA 4FS2A 1NAQA 4Q0BA 1YRTA 4KHMA 2ZITA 3OJSA 2HVDA 2VIHA 3C2PA 5LXRA 1Y5NB 3NWRA 3TP2A 3H5SA 2NR0A 4P2XA 1U2RA 5J2NB 4M5LA 4DEZA 1M5PC 2Y8WA 1N52B 4LIWA 4DPTA 4PWDA 4EZ9A 2QLXA 2RQMA 1UL3A 2AYMA 2DEJA 2GS8A 5L9XA 2BRLA 3I87A 3SCKE 2DISA 4P7TA 4CDIA 2XC9A 2ALZA 2UUBF 3MFHA 4WP9A 4F0HA 2LXFA 5IFMA 3ZC4A 3SQGA 2NQPA 1KRPA 2F9JA 3C16A 3GJTB 3T3FA 3E01A 4HTJA 4LFCJ 1ZAWA 5BYQA 1FRHA 4IH6A 3EDQB 4DR1F 2JDJA 2KXFA 2CQHA 2WSCC 1SXLA 4WPAA 2CQGA 1SIWB 2F4FA 3AB4B 3MCSA 4KAIA 3TUJC 4YUDA 3Q2TC 3N5FA 2YQ3A 1FI4A 4CH0S 4USVA 5D4PA 2CFXA 1Y0HA 3C16B 3NBPA 3GJSB 4CRJA 5A0YB 5IT4A 3RGIA 3OHAA 4RU2A 3KG1A 4NX9A 4RBUA 3HHNB 1KTVA 1WUUA 4F67A 3PHEA 4LRCA 2E5HA 1VRTB 4P74A 3CJKA 4RW4B 3FSIA 2DITA 3BDEA 3K89A 4V19X 1N56A 4KV8B 5DGAA 5M2UA 1HNIA 3T9ZA 3VAHA 2DD8S 3M8YA 4KC5A 4I1TA 5F8LA 4KO0A 4IRCA 2OLWA 2DGVA 4IOBA 1RA6A 2AZ3A 2DCLA 3L95X 1MU2B 2MLXA 3M8RA 3R6GB 2LA6A 1T9VA 2KO1A 2QL7B 1XERA 4H4MA 3QZ7A 2KVQE 2X1FA 1YKWA 4FPIA 2IA0A 2DH9A 2C3UA 5IC4B 1UEKA 4YR0A 2UXBJ 3DRPB 1ZAVA 3BGRA 3POTA 5F8HA 1TR0A 3R7NB 4CNZA 4J9QA 2XWYA 4P9SA 1KKHA 2XLJA 2FHOB 2ZDOA 1H0HB 4Z7YA 2KKHA 3HFKA 2R2UA 4AQYF 2RS2A 3RTVA 2ASJA 4G1PA 5AE1A 2NCKL 1U47A 1X4CA 2E1CA 4B9UA 3MUVP 4U7UD 1VR6A 3IA0A 2M3DA 1O5JA 1G2EA 2VFVA 2VC0A 5T41A 4B3RF 4IH5A 5BYRA 1LFPA 1U0HA 2YX1A 3NXZA 4U7CA 3FRYA 3HPOA 5AE2A 1VQKS 3N0VA 3W61A 2YNGA 1EAYC 1ZPVA 1S59A 4HACB 4B9SA 2F5GA 3W62A 2DNGA 4LRBA 3E01B 4FNHA 2XULA 4NA2A 8RUCA 2F63A 4EK2A 1WSVA 2BBEA 5AJ3J 1SJ3P 3DI6B 3M8PB 1JKHB 3PRVA 3SQGB 1XNQF 3S8SA 1ELOA 2GCFA 3H42A 1HHSA 4YB6A 1DTQA 4RL1A 4KSEB 1RTIA 1H3DA 3HD2A 4HDGA 1GQEA 5L1IA 2AQ4A 1Y7PA 1YRXA 1XJWB 4P72A 2QRRA 4DG1B 3MM7A 4W4MA 2M0GB 3ZNJ1 2MQQA 2H4YB 3RR8A 5HP1A 1VQ6S 4KPYA 1U8WA 1XN9A 4W98A 2ZJPQ 1LV5A 2WB1D 2F8MA 2G13A 1X4AA 1IQTA 2YNHA 2WSFC 1JLQB 2XTJP 3A3PB 3AJ1A 4ZVQB 3KHHA 1OY6A 2I0XA 4DZ6A 2IPOB 2P2CB 5J1NA 1RAOA 4DFKA 2HKEA 2JL9A 5D0GA 4FVMA 4Z2XA 4FF2A 1GXUA 2DO0A 1X9WA 2KZMA 5DQHA 4CLPA 2XSJA 4Y34A 4TU9A 4Q8EA 2V9KA 1T05B 4QCLA 2VQEJ 2BYCA 1N5TA 4P7VA 1L5UA 1JNZB 2KB2A 1ZM9A 3HHLD 5LMUJ 3OR1B 1M5OC 3QJPA 2KT3A 1R8PA 3NGRA 1NH7A 1TP7A 3PYGA 2RS8A 2RU9A 1C0TA 1RTJA 2RUGA 2G2ZA 3G96A 4CO2A 1OJ4A 2BRKA 1NKCA 2K8GA 1JLGB 1LWXA 2CDQA 4FXWA 2I2YA 1WHYA 4HH1A 1CJTA 4NYOA 3QIDA 2V2ZA 5JMNA 2EBGA 3HO1A 2C2ZB 1TL5A 1DRZA 1RT1A 1JIHA 2JX2A 3GSIA 1Y3KA 3QGGA 4NLDA 2FJXA 1QUVA 4OI4A 3G4SS 3KJVA 1XMBA 2IM0A 4M5HA 1SL0A 3HJFA 2JEIA 3CJ8A 3D0GE 1KHWA 2VICA 3RJMB 1T9YA 2J6SA 3BREA 2CVEA 3S1TA 5FD1A 5IWAF 1RWMB 4JI6F 4ILRA 1EX8A 1ROFA 3UVJA 1FRXA 3DN9A 2FVRA 5ADZA 2KDOA 4MAKA 4DX5A 2CVIA 3DLBA 3RR7A 1QE1B 4UOGA 2RUSA 2DXFA 5DZ7A 1P9QC 1TMMA 3I56S 1FERA 2W9AA 4F02A 3X1LB 4J9MA 3Q8RB 1LWCA 3CCLS 4IR9A 4F2SA 1N5VA 2APOA 4QIEA 2HQCA 4P52A 3FRZA 2VUGA 4TYBA 1Q82T 2QG9B 3MAAB 1RLDA 1RBOB 1VRUB 2OGUA 1WF0A 5IM0A 1U1QA 2MQMA 1HWKA 4ZJLA 4USKA 1GFWB 4JV0A 4DQSA 4LF6J 2RE1A 4QWBA 1VQ4S 3TO8A 4ZS6A 4XIUA 1KOOA 1U02A 2WCXA 3HZEA 2DGTA 2GJ2A 4J9PA 2AZ1A 4DV4J 1SKSA 1UJ4A 2HLTA 4TU7A 1HHQA 2H1YA 3H5XA 4IH7A 5BR8J 3UR3C 1RDRA 2H9ZA 2KI2A 4KTQA 1QSYA 3D1OA 3T41A 3D1HA 1RHKB 3ETOA 3GIKA 1WKJA 4UW2A 4AFFA 1D09B 1Q81T 1T9UA 2HS0A 3PEHA 3QAUA 4RWXA 1NDKA 3OLBA 1YJVA 1S12A 1TUVA 3AFGA 1U0SA 4ZPCA 3TX8A 3WC0A 4QW9A 2EKYA 4DCOB 1CJTB 4AUKA 1UVNA 3HI9A 1RT5A 5J2PA 1B0VA 2DNNA 3UCUP 2VBYA 4WFXA 4F4XA 4PCQA 1HBOB 4WFYA 3CE8A 3CDEA 1T7PA 1URNA 3M2UA 3PIOQ 3KLGB 1DURA 2OUGA 3NY0A 4RBTA 2OI2A 4MIBA 2RDJA 4NLRA 3MM8B 5LL6d 1FKOB 3CMQA 3KTQA 1TFWA 3BKTA 1SI9A 3FCWA 4ID5B 3AXMA 2GZOA 2FVCA 3ET6B 4JI7J 3IP0A 2OD6A 4LF7F 1X5TA 3PEJA 5JVHQ 4GKKJ 1KOHA 1VC0A 2JEGA 2FD2A 3P8BB 3TUIC 2XSJB 5KFNA 2BQUA 2XI2A 2MKKA 4I2PB 2HMIA 3EJMA 3I5BA 1HMVB 5ETVA 1SV5A 2KHDA 3K5LA 1TKTB 1VQYA 5I3QA 1SJRA 2NPIA 4KB7A 1S4EA 2MY7A 4F4WA 1SH3A 3C15A 3BYPA 4FYXB 3RB4A 4BDPA 1VMBA 2BE9B 4X65J 1VIOA 2UV8A 1TL1B 4DUZJ 1X4DA 2F8HA 3GSDA 2JVRA 3PYDA 2BJEA 5HP1B 1F5AA 3CD5A 3CJSA 2YXLA 3PACA 3CD0A 2RHQB 4NLXA 3VAMA 4LF5J 1UETA 3N6MA 1XMQF 5RUBA 2CPJA 5J2PB 4HDHA 1Y9OA 2I8EA 4JI4F 2ZZTA 3M32B 2JSXA 1IM4A 3ELHA 2OMOA 4PG5A 3PHTA 2F7VA 1SJQA 2BKOA 3A3NB 3THVA 4YB7A 1GX5A 2XO7A 4PPDA 3MM9B 4Z7CA 3ZZOA 1RWVB 5L1JA 1SUQB 1O6XA 2FDNA 2HLUA 3VZIA 2LYVA 3KXDA 3JTOA 5B0BA 3MR5A 3AXKA 2ZH3A 3KK3B 2E29A 2B6AB 1KS2A 4I68A 4OI6A 5AXLA 2CZ9A 4AE5A 1U0HB 2OAUA 2BMBA 2RDDA 3H4BA 3UD3P 2UXDJ 2BA9A 5C2GA 3TQ1A 4ED5A 1PC5A 1F0XA 1HWIA 2IMOA 2ZBQA 4OYMA 2FIUA 2WZ1A 1HFEL 3BO4A 2UU9J 3SBMA 4RW9B 1E6VB 2P9GA 4OYXA 2N3LA 3MMJA 5G0RA 4DV6J 5DM6Q 1XC9A 3HHEA 2HIQA 1WHWA 3BR8A 3QWPA 3EZ5A 3PCOB 1XMQJ 3DU5A 1HNZJ 2AJQA 2NXJA 2RU3A 4Y2MA 1U24A 2FQQB 5IC6B 4X4NA 4IG3B 3MEEA 2DB1A 4DUYJ 2B4OA 2CDRB 2GIFA 2AJ0A 4P2FA 5F3TA 4AT1B 8ATCB 1MU2A 3KLVA 4DUZF 4YHHF 1GH8A 4E0DA 4KJIA 4O4GB 1RAAB 3MM8A 2J0SD 3HHLB 4YEAA 2XYHB 4DOZA 5BR8F 4ELUA 2HHPA 1B0PA 1KONA 2WVCA 2RQKA 4OZ5A 3KLGA 3M2UB 4C8OA 2ZH2A 2DRDA 1NPPA 2QT7A 4DX8H 1QD1A 2AGPA 2BOAA 2AJ2A 3CCZA 1VRTA 2W24A 3CJKB 3ZFVA 3W5XA 3OL6A 4EYIB 3L09A 2UUAJ 3J80Y 3ILLA 1HNZF 2I9SA 2KN4A 3NS5A 1HWLA 1J5EJ 4J91A 1F5CA 2CNOB 2AYBA 1FFSB 2BJ7A 4WE1B 3UFCX 5KFBA 2CZ4A 3GTYX 3DDNA 3N5BA 2HZCA 4ATNA 3OL8A 3PO4A 2LQ5A 4ZVGA 4DV0F 3TJ8A 3V81A 4Y2AA 1KWMA 5DQGA 3T1YF 4Q43A 3MDFA 3MCMA 4ZVRB 3QQCD 2RQ4A 2P6SA 5EWFA 3DOLA 1RTDA 1QAJA 4CWBA 1HNXJ 2GVDA 5J2MB 2IDEA 1Z4UA 3US5A 1XNQJ 2G0JA 4ZN1A 4IO1A 4JI6J 3M8QA 3M2RA 5KFXA 1N34F 2E5IA 2R8IA 1XR6A 5K20B 4DSIA 1P1TA 2A2CA 2EG2A 1VQ7S 1KDNA 2MKYA 4C3MA 1HNVA 2YQ0A 3MMCA 1RWXB 4ELVA 5KG3A 2K06A 2MMYA 3NGUA 4L73A 3QRRA 1WJ9A 3K5OA 2QSWA 1RWKB 2BE7D 2FHJD 1SC3B 4QU7A 4B3SJ 2J9DE 1LKZA 1RHMB 2MPUA 2CQ1A 1UWBB 3HVTA 2D74B 2DGOA 2HQGA 3H2UB 5HAOA 2CQ2A 1WKKA 3KHGA 2R7WA 3TRGA 4ZJOA 4DR1J 1NKEA 1JLQA 4FKXA 4N7TA 2COLA 1OQ6A 2BJ9A 3LP2A 2D1CA 4QQBA 2HS3A 1R0AA 1JLAB 3QFWA 3R6LB 2W2OP 1S9GB 3HD1A 4L72B 3UCGA 2KU7A 4CYUB 2WONB 3LP0B 1CJUA 1U26A 3T1AA 1HQ2A 2HRUA 4C8NA 2YKNA 4PYAA 1R43A 5KG4A 4DPWA 4AL6A 4NZ6A 4OFZA 3F44A 2YWWA 2A10A 2W2PP 3JTPA 5KAKA 3OV7A 4TQSA 1RT2B 4A8WA 2V9WA 3UN3A 1DTQB 1CEZA 2CWKA 3IXQA 5IT9U 3MCOA 5IQQA 3V6DA 2O67A 2HHSA 1IXKA 3BBFA 2PMZD 1NSAA 4ZN3A 3D54A 2Z58B 3THPA 2E7XA 1KHVA 4Q5VA 2H4WB 1RTJB 3M9NB 3DLGA 2B5JA 5HLFA 1HL6A 1RAEB 3BKFA 2N7YA 4K4ZA 5H9FK 2RRAA 3KUEA 2JVOA 2O01C 3WX4A 5A2QU 4H54A 1R7IA 2E7WA 4AXJA 1P6TA 4PZVA 3K17A 5KFVA 3LQVA 5DJBA 5KG1A 3M1VB 3M8WA 4M5DB 4N5SA 4OQJA 2XLKA 4AXIA 3ISND 4MH8A 1FDBA 2E5LF 3E2EA 2DHXA 2DNZA 2HVIA 1HBMB 3BB5A 3PG9A 3B8HA 4ZP9A 3TZYA 3LA0A 3U02A 4F4KA 2ERRA 1PJ5A 4ZVPB 2JLGA 3QJJA 2VPYB 5L8RC 2K7KA 1R8CA 2C2MB 5LSLA 1YHQS 1X60A 5DRKA 1N6QB 1JLEA 1J5OB 3H2LA 3JSBA 3QYYA 2ZH7A 1FX2A 1N32F 3NCPA 1RWPB 3G2XA 2EK6A 2GNKA 2GO8A 2GV1A 1S72S 1NJXA 4C8ZA 3ICLA 2G1HA 4EGLA 2AEFA 4J5OA 5DQIA 1HNIB 4F36A 1FFGB 4Q2MA 2RNEA 3UI3A 4MTPA 1R0AB 5A8RA 4A8XA 1OPIA 2HAIA 3IBFB 3PR4A 1REGX 4XO0A 4K2XA 1R8AA 2LQ8A 2DR5A 2YNFA 2NUHA 4CLFA 4CCHA 1X8DA 3MR6A 1RWNB 3JS9A 4QW8A 5HL7Q 2MTLA 2XZWA 1UJ5A 2P6TA 2V68A 2DR9A 3CJQA 4DFPA 5GVQA 2DIVA 4ZVUB 3NL0A 3U7JA 4DSFA 2BJ8A 2JJ4D 3Q89A 3W66A 1HBUB 4IOCQ 1S6QB 1HLWA 1KP6A 3R5BA 5B0DA 2HAFA 1KVKA 2CPDA 4RWWA 3IBCB 1DQ9A 3MM5A 4I56A 2FVPA 2QSFA 4ZVEA 3TAQA 1I94F 1V9OA 3MAHA 5J2MA 3J7Z5 5B0AA 4A8KA 3NNHA 2B9XA 2XB2D 4ALZA 2GAHC 5F8JA 2D69A 2FJDB 3OTEA 2R7QA 4DX7A 4WZMA 3D7SB 2ZD1A 4OJHA 2IMWP 3LW5C 4QU6A 2MHEA 1O8BA 1RWUA 3Q8VA 4RU9A 3R3TA 2IVFB 1IWAA 4KT0C 3BN4A 4WE1A 3AB2B 4ZHRB 1WTFA 3GILA 1U8SA 3PRDA 2GVZA 2KYZA 4QIFA 1YJNS 4N76A 2QLBB 4IDKB 3BBBA 4W92B 1RWWB 2CJYB 4RW6A 4FNIA 2QYGA 3PW2A 4CLYA 2B0GA 5G0RB 2R4FA 2R7OA 3EDRB 1TELA 1KLMB 3KLFB 1NDCA 4RW9A 5I4MA 2VHGA 3KHRA 2C22A 2V8HA 2QV6A 3BGFA 3CCQS 4DL7A 1S1XA 3PX6A 5KFLA 1NSPA 2CNLB 3FMBA 3KLIA 3CD6S 4FYYB 4OLOA 4E8UA 2R7RA 2ZOGA 3JQMA 2KRRA 2UUCJ 3IAM9 4M94A 1WF2A 1N5QA 3EXYA 3FGVA 3CW2C 2H3EB 2ADCA 1PG5B 1L3UA 1VYAA 1RWOB 2MJNA 3RYLA 4C0HA 1DLOA 1S4FA 1XIQA 2C2KB 3VGTA 4IOAQ 3SEOA 1I6JA 2DXDA 4GKJJ 2ILYA 3IWXA 3TEGA 2O3DA 3D6FB 2LEAA 1U6BA 2EVZA 5ETSA 2P9EA 1RB0A 2A6MA 2Z30B 3M6XA 4GO5X 3JAMY 3TNVA 5CCMA 1FDDA 5LT5A 1EKRA 1O51A 4UZCA 5J1PA 3QRPA 4B3OB 1X0PA 3VGSA 1Y5LB 4CP5A 5I42A 4RBVA 3UR0A 1S6UA 4GC7A 1TKZA 4OHWA 4UT4A 4DR3J 3LP1B 2U2FA 2CA9A 1QAIA 4C2MA 3KK2A 1MROA 2MKCA 1JLCB 2Q6CA 5KFJA 2W9CB 3OR2B 2HFSA 1VLOA 2BX6A 3ILJA 3IR6B 4KFBA 4KGZB 2HHHJ 5KFYA 2RKIA 3H20A 4J90A 1V3ZA 3OTDA 2LXIA 4H4KA 4KGKA 2A6OA 4LFCF 1EARA 3OSNA 2ZE2B 2F8EX 3FKBA 2HK2A 4O44B 4PUOB 2QYCA 3D3CJ 3HHDA 3G87A 4E98A 2V8VA 2X51A 1P9YA 3TA1A 4Z37A 3BO3A 2VONA 1VQ9S 4DV6F 2H54B 1TK8A 3OUYA 1NK8A 3HULA 1T8EA 3WZ0A 2HK3A 3KJFB 4O23A 3FCVA 1TL1A 2YWFA 4F04B 4DQPA 2EC0A 2EI5A 2POKA 2J0XA 2ZKTA 4BCAA 4USMA 3JB9k 4ID5A 4UY8T 2IAJA 2E66A 2H51B 2MLZA 5DG7A 1AT1B 1IBCB 3HHKA 5A8KA 3D2WA 5F8GA 2YWEA 4HHHA 1ZETA 2CZVC 3AJDA 1U1PA 1KQGB 4G65A 4RJVA 4C11A 5DLGA 5ETNA 1LOUA 1A0OB 2DHAA 2RRNA 4GKJF 3PJXA 5BJRA 3EZUA 3EMTA 5C25A 1PIEA 1X5SA 3FBCA 3Q2SC 3LALA 4MK7A 4F3MA 3NLCA 3VQTA 4WXWA 3ZZRA 5LMNJ 1SJFA 3BGLA 1FJGF 3TVYA 4NRUA 3H0PA 2FHJA 3EVMA 4KFBB 1WEYA 4KKOA 1NO8A 2KXHA 3MMAA 4WFNQ 3SYZA 4NLUA 4I67A 4IR1A 2XY7A 3OXFA 1BE4A 2OJ3A 1S0VA 3HX9A 4CO1A 4JI3J 3HXMA 5EHHA 1D0EA 3GIMA 4KGXB 4DUYF 3IM9A 4JYAJ 1CJKB 3F41A 2FJBB 4B3OA 1VDHA 3CWJA 3I82A 4KQZA 3G82B 2XLIA 4XDDA 3UDVA 4Y65A 2KL8A 2XMMA 3CJ2A 1VS3A 2BXJA 1YBAA 3I32A 4M8LA 4YB1P 2CPYA 2V4QA 2O1PA 3HT0A 4ETXA 3WBZA 2BDPA 2VFUA 4DS4A 1HBUA 2FC8A 2Z4PA 4Q7AA 1XNRF 4MIWA 4DHVA 2VOOA 4FBUA 4L74A 4KIAA 3DHWC 2B8PA 3DYAB 1MLAA 3DRSB 2AHOB 2IA6A 1GAOA 2BJDA 1ULRA 5KG0A 2VFRA 5KFEA 3KLIB 2NXEA 4TVAB 1VQPS 3T5KA 2R7VA 4LFBJ 1YWXA 2LU1A 1Y10A 4OYAA 1NDPA 1JLBA 3BS9A 2LFVA 4QWAA 4V19J 3NEKA 5ETOA 1CPZA 1GMUA 2PGCA 1RT1B 2HWHA 2N3OA 5B7WA 2V8GA 4I7FA 2XBPA 4IFYA 2Y0BB 2FB0A 1FXDA 2XG8A 2JFDA 1JLFB 3MHYA 3ISNC 1P27B 2VU5A 5D0EA 4FBTA 4CLUA 2CXEA 2HPUA 1L3KA 1HBMA 1WHXA 2EG1A 2PSZA 4WTYA 1WOSA 2JRSA 4ZCLA 2XO6A 1JB0C 2PEBA 2WW8A 1YBTA 3VHQA 2ZWPA 2FY1A 2WVDA 2ZKUA 4ILMA 3IS9B 3VVTA 3T1HJ 3F73A 1TVRA 3EZOA 3LH2S 1NKBA 5AXNA 3OW2R 1JQGA 2GQCA 3L7PA 3J7YU 1Q5VA 2XS5A 1S6QA 3G6ES 1XBWA 1YGYA 1F6TA 2Y1IA 1TAUA 2QL5B 1KN6A 3FBBA 3H2VE 3MPDA 2AKWB 3DOKB 4M5JA 4PXDA 4NCBA 1U2CA 1B7YB 3GJQB 4QIVA 1YTYA 4PPZA 2VPZB 4J9VA 4WWSA 7FD1A 2R8GA 2QA1A 1Q86T 3HMJG 4OZLA 4X66J 5CZXA 4N8OA 1SVDA 5KG2A 1PBUA 4PABA 1KFSA 2YNFB 1Q53A 3EM1A 2FLLA 2B4PA 1RKJA 4DU8A 3K8WA 1K8AT 2ZJRQ 4NLPA 1T03B 3NOCA 1BC6A 3PX0A 2ILZA 3ILIA 1NK6A 3D3BJ 4ICLB 3AODA 4BS2A 4WP8A 5ITHA 4GVLA 2J9EA 2QLJB 4ECRA 3R2CJ 3CMES 2R42A 1CG2A 3D0IE 2GX8A 3ISZA 2HRYA 1CULB 4I64A 2G2YA 1R8HA 3PO5A 2FGCA 2HFVA 1AUSL 1YI2S 2VFTA 4M5GA 2IIHA 4ANDA 5HK4A 1PYTA 3IAS9 4DV7J 1BY9A 3TYTA 4JP8A 5I3UA 4C8YA 3MEDA 3DXSX 1KC8T 4KYZA 3TW0A 3CC4S 2PA3A 2VPXB 3CDWA 1S1UA 1QY7A 2NUUG 2YWGA 3GLJA 1AB8A 4DR5F 4DR7F 4OHVA 5KFHA 2WVEA 5KFKA 4DG1A 4YDXA 4A8OA 4DQIA 4DJBA 1RSCA 1VBKA 3D68A 3LOUA 5J1EB 4LF2A 1YRUA 1BWVA 2YX4A 3TUPA 4JI0F 3K57A 3M8SA 1RUSA 2FY8A 1FJ7A 4NZ7A 3DI6A 2VQEF 3ONQA 1LQ9A 3DGPA 3FEZA 1RABB 4I69A 4JI5J 4UOFA 5JXSA 1FVSA 1NHUA 3D1QA 2JNJA 3DLEA 3V81B 3U27A 1ZBTA 2MSTA 3DRPA 2M9KA 4JI2F 4RNNA 4G1QB 3V4IB 1YITS 4ED8A 4TY8B 3V6DB 2D3ZA 4YS2A 3KLHB 5T7LB 3J7YI 4LFBF 3LWLA 1K47A 2HZAA 4OMFG 4IYQA 3OT9A 5K9FA 1C0UB 2LU2A 3DM2B 4WIIA 1S1XB 4I6WA 4ECXA 1QSSA 4C0BA 3GV8B 3D4JA 1KBRA 4JI7F 1VJQA 1HW9A 1EETA 4IRKA 4F8RA 2HFOA 4U8VA 5CYQB 4FXDA 2VKRA 3VZHA 3I0RB 2HBRB 4ANCA 5KT3A 1U1RA 1B3TA 1L3TA 3CT9A 1FRIA 2FZCB 3H25A 2LECA 2D9PA 2FLNA 1S9EA 1T11A 4ZVTB 5AXKA 2PIIA 3HVTB 2QE5A 5DO2A 2BJ1A 1V3RA 2GFFA 5KFWA 5GAHU 3OVSA 2HNDA 5AJ3F 1UFKA 2XMJA 5HATA 4NZ0A 4M95A 5KT5A 5IV3A 4KO0B 2VB6A 4ZVOB 3W2VB 3PKYA 1HNVB 2V8PA 3MMCB 2ASDA 3W63A 1LW0A 4C9DA 1UA0A 2HWTA 2ZOFA 1F9EB 1MMNA 1VHFA 2RH3A 3DGPB 3I5CA 2LQ9A 2UUTA 4C98A 4F0KA 1LWEA 1M5HA 3MGJA 1U4BA 3MM5B 2XSFA 4RW8A 1V5IB 2CPEA 3NAHA 1HQUB 1YZ6A 4PXBA 2DR8A 4NL5A 4LFAJ 4O3QA 1FJGJ 1C1CA 3QIPB 5J1EA 1F9HA 4RNHA 1LW2A 2M5YA 1F2GA 3FSXA 2VBZA 1FD2A 3OFGA 2WOMA 4LRAA 1GNKA 3W2VA 5LOQA 1LXJA 2E5GA 1H2UX 3Q23A 3EGNA 2B43A 5JVGQ 4WIQA 4YB5A 4ZIVA 3IM8A 1HNWF 1LXNA 4LVOP 2ZHOA 5A8WB 1IM6A 4B17A 1B99A 1V3SA 1VI7A 3G8SA 4G6VB 4XTTA 2IYIA 5CCLA 3Q8PB 3DLKB 2J76E 1FKPB 1GTEA 4OJ1A 2UXDF 3TZXA 5E2QA 2AX0A 2OPSB 1PCAA 4OZ1A 3GYGA 3QT8A 1HR0J 2Q43A 2KH9A 2ZBCA 4OV1A 3IRWP 3BQ1A 3H40A 3T5JA 3OL9A 1K0TA 2QFIA 4A8SA 1RADB 3A4TA 4F3OA 2QMXA 3I96A 4CLWA 4GVBB 4Y2IA 5E3PA 3KMSA 2HHVA 4DL2A 5EWEA 2PFDA 2LDYA 1FFWB 1NUEA 2UZAA 1H38A 4M5NA 4TXSA 2J0QD 1JJ4A 4P2MA 4ZLJA 3CCJS 4NYZA 2IJNA 5CH7B 1RT6B 4IG0A 2DY9A 2EBEA 2MB0B 2XGPA 4UQGA 4DV1F 3DLEB 6FD1A 1UAWA 4Y2CA 2V2VA 2OPRA 2WRMA 3RBZA 5HSPA 2RT3A 3CEDA 4ANEA 5LSOA 3M1VA 2YWKA 5MLCV 1CC8A 9RUBA 5LXYA 2FHKA 3IRXA 2VA3A 4USWA 3KUHA 3M4XA 3CCWA 3HT3A 2YKMA 2AJ1A 2YKQA 4A48A 1JNRB 3CNQP 1ZYQA 2D9OA 1VQ8S 3E3XA 2VQFF 3IS9A 3KK3A 1UP1A 1DZ5A 5HI7A 5FLXY 2JLEA 3FMWA 4ETZA 1SC4B 2NXUA 4F4YA 3M6UA 3MM6A 1FA0A 1PYSB 4DN0A 5GADU 3T1HF 2Y1JA 1EIYB 1OSCA 1KSPA 1WD6A 3JSYA 1IKVA 4HR2A 5I42B 4X4UA 2AYGA 4NA1A 1EQMA 5KFZA 3HP6A 5H9EK 2J5AA 4WYLA 4DPXA 3TEHB 2XMKA 2GHPA 2DNPA 3THTA 3CCMS 4X64J 4WZQA 3BGOP 1FNOA 3JYTA 2IC3B 3DXBA 4RLEA 4AYBD 4ES2A 2GJIA 1X9SA 5IS2A 1TUWA 2GHWA 5A6WA 1KQFB 3P6YC 2YH1A 2M70A 5KG5A 1CS4A 4N41A 2IFXA 4DCPB 2W9BB 4DV1J 4LIRA 4ICLA 3CD7A 5F8IA 5D0HA 1UFLA 5DG8A 2WBRA 3W3SA 4V1Ak 5GMEA 1UVJA 1QJHA 4PYDA 1C1BA 4XDCA 3VAJA 2UU9F 3HKZD 1I51B 2FZKB 4DR4J 2XQCA 4D3GA 4DV3J 2YQ1A 3MAAA 1U1NA 1HI8A 2Q66A 5C42A 1TAQA 2N4CA 4KR0B 5LSRA 3KDNA 4DU7A 1TTHB 4WK3A 2BKPA 2MZJA 3D66A 2CJXB 4HLBA 4K4WA 3B4MA 1RK8A 2FLOA 3Q8YA 4ELTA 2HHTA 3WDOA 1YJTA 4LF4F 2HFUA 4ECQA 3ET6A 2CYYA 3I0SB 2W8KA 2HHHF 1WNEA 4IFVA 3H4DA 2R9LA 2RSQA 3J81U 1D3WA 2IRYA 4FPRA 3OTBA 2DO4A 3C66A 1CQNA 1NBEB 5T14A 3K5MA 4M1KA 3CULA 4MFBA 3UPFA 1JX4A 5KFRA 4Y0FA 1FD8A 2DYAA 5A76A 1QAYA 3R97A 2R7XA 5F8NA 2NSBA 4OYIA 1ZZNA 5HROA 2NYHA 4K59A 4WF9Q 2U1AA 2OSQA 3I0SA 5CYMA 2VD3A 1X4GA 4DR2J 1SCJB 1D8ZA 3SXLA 4ZKAA 4DFJA 2YBVA 3O44A 3K59A 1FNXH 3PIPQ 2F4VJ 1I3OB 3O8WA 3D0HE 4DBQA 1JLGA 4ZJQA 2BQ3A 1RT4B 2Y0SD 4DR6J 2AX1A 2IRXA 1AA1B 1RBLA 1ZM2A 5EUHA 1Q8LA 1SQEA 5HMXA 5C42B 3EVOA 1GT8A 1T02A 3M6WA 3D5MA 4N77A 2QMUB 4NLTA 5A8KB 3HJVA 4IFVB 3D28A 3OR1A 4J7CA 4X4RA 1YJ9S 3A8KA 3BV8A 3UD4P 1TFYA 2NXCA 4IG3A 1NPRA 2DNOA 3LTOA 4K50A 1UW9A 4JV1A 3A8EA 3BEGB 3AA8A 4ZCIA 1QUPA 2XWXA 3GCXP 4F7VA 2FVSA 4CIOA 5F8MA 2BANB 3O2IA 3TI0A 4ED2A 1F3FA 5D3GB 1MW7A 3N4WA 4OI3A 3Q8UA 4PAAA 4FYDA 3OTOJ 1S79A 2PEHA 2EW9A 4G1IA 1BXNA 3M8ZA 4DPYA 1WTBA 1BQXA 2ATCB 3OTCA 5L46A 2CPZA 5H9FJ 4J37A 4YN3B 3WHIA 1UPMB 1WOOA 3K7RA 3N01A 4WCEQ 4AQYJ 2Q1LA 1NK4A 1SC1B 1JLCA 2EKNA 3R5GA 5KFTA 2N7CA 3MWBA 1CJKA 3HDSA 4NE9C 2C2RA 2XEXA 3BR9A 1SB6A 2UXBF 3KJVB 4FXVA 1NPKA 3R5DA 2CJBA 3MCNA 2QX0A 3SDEA 4DR3F 2AGQA 3GJRB 5E33A 2M88A 3TX0A 3BGUA 5E3AA 1KVJA 2ZM6F 2XI3A 2XM3A 4QPXA 1NLKL 2LLZA 4NLSA 3CPWR 2L9WA 1U1KA 3AOAA 2FJAB 2C3MA 4J9SA 2VG6A 1RT3A 4X4SA 3DFEA 3GONA 3BKUA 4PR6A 1Q16B 1NJIT 5ETQA 1PKUA 2MKIA 2RILA 3GG1A 2B4UA 3SFGA 1HKAA 1PSDA 1KEKA 4B3MF 1ZAXA 1N48A 2HGLA 5ETRA 2GHVC 4ZVSB 1U1OA 1D9DA 3Q83A 2HQFA 3TANA 4RR5A 2GGPA 3C15B 5K8PA 2KFYA 4NASA 3NGKA 3CCES 4GVBA 1B7FA 3GMGA 5FDLA 5D78A 3OVBA 2V69A 2DPIA 4ZLPA 2OPPB 3H5UA 5L38A 1U48A 5IWAJ 3SSQA 3U1MA 3DRRB 3W1YC 2HGMA 4HI2A 3W2WB 4QPTA 1SQGA 3VWSA 3ENAA 4PXCA 5F0WA 4CLTA 5ETKA 4CYUA 3H8YA 2ZHAA 1DY3A 2M52A 2DHGA 3TA2A 2AGOA 1IBMJ 1RT7A 2D3UA 1BQMA 1FKPA 4ZITA 2EFVA 3RBDA 1HD1A 2MZTA 1VQLS 4EWTA 3TZZA 3IGVA 3QRQA 2HEKA 1WI6A 2VDHA 3BPSP 5B0EA 2HVZA 4QR0A 4CO3A 1ZA2B 1WDDA 1URRA 1FE4A 2IVYA 2DNLA 4DV4F 1DHMA 1Q7YT 1MNEA 3R5AA 5HN0A 4LSZB 2X1AA 1HD0A 1R3NA 3MEGA 1WWHA 2Y1LB 2B51A 3NGSA 4LR8A 5E3QA 3QJLA 2OKQA 2IDLA 5HANA 3RAQA 2P9CA 3SMZA 4RW4A 1S5ZA 4LF1A 2PA8D 1MSWD 1HQUA 2J7KA 2NLWA 4QYZJ 1FRLA 2ASYA 3OPKA 1OYDA 1JKHA 1LWEB 2ACYA 4ZOSA 3PR5B 2ZBPA 1NJWA 1QVGR 3DOLB 1RTDB 4WXOA 1I94J 4C3LA 1IKWB 3ZZUA 5BYSA 1WC6A 1X4FA 5CHCB 4C8MA 4DDFA 3UCZP 3DHXA 3ADAC 2DIUA 4HACA 2H5IB 4PKDB 1EP4B 3LF0A 5HMZA 4NA3A 1VJWA 2MQNA 1IKXB 1CJVB 1H7WA 3GWCA 1M5KC 5IOLA 2ABYA 2OD4A 3MMBB 3P4UB 4HI1A 2BM1A 4B02A 2RQCA 3BJYA 2Z2LA 4WFAQ 2BZ2A 1RLCL 1X4BA 2HFNA 4TY9A 3CC7S 1H2VZ 2OEKA 2PMHA 3D6HB 4ECVA 2CQCA 4K0KF 4DL5A 3CCTA 1WOPA 1A9NB 2E44A 3QWUA 3I0RA 2Y1RI 3L7UA 3MEGB 3VR1A 4QWCA 2HNZB 4P10A 2QEXS 4L6V3 5IXUA 2V4JB 4RZRA 2J7WA 4L3NA 4MYTA 1UPPA 1TV6B 1X5PA 2HG4A 3IWLA 4CH7A 5HJYA 4Q0BB 3BSCA 1FJEB 4NMLA 4CLKA 3BYRA 4RUAA 1FESA 1S9EB 1WI8A 2VG7A 2QJ3A 4FZVA 4D3HA 1A6LA 1IUJA 2HNZA 3JXOA 4B3TF 1BWEA 4UY85 1T0TV 4WP3A 3GU0A 2J8SA 1RXOB 4LSNB 1EKSA 1S99A 4U8YA 3QPIA 1EETB 4O4RA 3ENQA 4CLSA 5B09A 3NAIA 5EX3A 1BQNB 1JMTA 1RHRB 4DR4F 3CDUA 3QBCA 2Y3YA 2GGPB 2W1BA 3FSYA 3UDLA 3W5YA 3KNGA 5F9NA 5ETMA 1N54B 1FEHA 4WKYA 1J2VA 4AL5A 3JQKA 5A0YA 4C7QA 1VQSA 2ZZMA 3KDOA 2DR6A 2LEBA 3DLGB 4B9NA 3VQSA 1X31C 1N5YB 2GO9A 3ENVA 3QO9A 1M0SA 4OX8A 4P2SA 2ZH1A 3PY8A 5KG7A 2HYIB 1IKWA 3W7BA 4F0MA 2HW3A 3ZZ0A 4IRDA 4ZK7M 4NLVA 4OJ3A 4O3RA 1SQFA 2UXCF 2RMLA 4NCGA 1KLNA 4ZP6A 5I3PA 3P45B 4RUBA 3EE3A 3FBEA 4UUXA 1KFDA 1MWZA 2A2DA 5K8OA 3U1NA 1S77D 3N28A 2GAGC 3FZ2A 2MQPA 4CO4A 5GAEI 4PEOA 1B64A 1YVFA 2WONA 1CJUB 2DH7A 1HQEB 1VHIA 2MLYA 5CZVA 4N8NA 3TVZA 1FDNA 1JLAA 4B3SF 4YP3A 5I3UB 2DY1A 1AFJA 2JFKA 4P73A 4FF3A 1U09A 4HTIA 4JI8J 1OSDA 2QIFA 3VCDA 1UWBA 1M1GA 1U6FA 3AQOA 2B9YA 3RUBL 5D0RA 3VAGA 1SL2A 1IBKJ 1FT8A 2E9ZA 4KBIA 1CULA 3N79A 1YG0A 2MZRA 2CPIA 2K2PA 3UWTA 4RNMA 2OIHA 4OX9J 1IWGA 2UVRA 1S7IA 2VBXA 2ZH4A 1FK9A 3FNNA 2VA2A 1ZZFA 2OPPA 3B6BA 3T6BA 2Z2ZA 5FDLB 4XPEA 2AYEA 5CA5A 3RB0A 2RRBA 3QFHA 1FXLA 3PJ9A 2KFZA 2C2EA 3M8QB 1NK0A 1XR5A 2BABA 1X0FA 5EX0A 2W8LA 3HFVA 4EI2A 1C4AA 4KRWA 5DDRC 5GADI 2VPWB 4PG7A 2UUBJ 3FDSA 2NXNA 1OIAA 3W64A 1OWXA 3L7OA 1RAFB 3LGMA 1N8RT 4JI5F 3PKMA 2O5DA 2V63A 2GJFA 2DJWA 1HBOA 4WBFA 3DU6A 3VAKA 3ZZTA 3PV8A 5H9EJ 2VG6B 1UVKA 2ATLA 4X62F 3E8OA 5M2PA 2DNRA 5E41A 4LF6F 3EGVA 4TKTA 2BR0A 3OD2A 1FJCA 3WX8A 2XS2A 2DHHA 5M2RA 2ZNYA 3MUMP 3FQKA 1B70B 2G0CA 3SDEB 3T19A 3V4MA 1BQNA 3DLHA 3PXGa 2EXUA 4ENOA 3VTIA 4C97A 1C4CA 4OHZA 1I5OB 2WSEC 4NPOA 4X4TA 4TN2A 2CG4A 3K0JA 1OPZA 2HNYA 4USHA 3P3DA 2A1BA 4CT9A 1S9GA 2PC6A 5HMWA 1QTMA 2WTFA 1PJ6A 1RCXB 1WKLA 3AHPA 2UUCF 2PMWA 4DLEA 3U1LA 4O4GA 1G6BA 5LM7E 4F4ZA 3SZ2A 5LJ5Y 4ECSA 2W4DA 4ECYA 3C6UA 1ZM3A 1VRUA 3MD1A 4HL9A 3ZO7A 4B9TA 5L1LA 1LK5A 2WK4A 2EFPA 2G4BA 2V4JA 2E7VA 4DLGA 1RYSA 4F2RA 3ITHA 3BPDA 3I31A 1RHQB 3I4HX 4KGMA 1LWCB 5D77A 2KZZA 1XQIA 4O3OA 5A2QY 3CXCR 4LR9A 4LF5F 3ZZPA 2CQBA 1TL3A 4CNYA 4X4PA 3P5TL 8AT1B 4ED7A 2V2KA 1JWWA 3M2RB 4PWUA 3C6UB 2CPHA 4EMDA 1U7LA 2YPZA 3OFHA 1C1BB 2LA4A 2GC8A 3NBPB 2H5EA 5KT6A 1D9AA 3HSGA 2BV3A 1K73T 3AD7C 2GIQA 2R8KA 5F0UA 5KG6A 4IUFA 4A8QA 3VALA 1HIYA 3IR7B 3QT7A 3VGUA 4LQ3A 2OPQB 3GCWP 2ZBIA 3S7RA 3H5YA 2MDAA 3DMJB 2M2BA 4FP9A 2MYFA 2Y8YA 3MFIA 2O66A 2IC3A 3UDEA 4J9OA 1XMOJ 4DWIA 2OSRA 4CH1A 2VG5A 2BKNA 3R5CA 2RIJA 3UN2A 3JSMA 5C2CA 2CQDA 1BUXA 1VK8A 4EFAC 1UTAA 2XNQA 1K44A 1R89A 1WG1A 4OZ2A 5IT0A 3I6PA 5C25B 3MEKA 4FVCA 3A8JA 3HCXA 4EZ6A 1NU4A 1W26A 5HVGA 1QTNB 3S01A 1R31A 1NNDA 3FUYA 3IGNA 4ZCKA 1TQLA 1IKYA 3EYZA 1FDAA 1H7XA 1QDUB 1WC1A 3KLEB 2ROEA 3HHLA 3LO3A 4IQMA 2WVBA 3SFUA 2DPJA 3P96A 5L9NA 2KT5A 4UQTA 4KKOB 3MMAB 3OFFA 2CQPA 1DTTB 3MEEB 2P5VA 1M1HA 2DT9A 2LMIA 2QN6B 1G1XA 1CVJA 4DCJB 4EEYA 2D7SA 3GIRA 3MR3A 1ACMB 3RZAA 3Q86A 1TL7A 2DCUB 2HMIB 2FYXA 4I2PA 4OJGA 4ZPAA 1GXLA 2CWXA 1K1SA 3R1LA 3K5NA 1VC5A 5B08A 4O44A 1PO6A 3O3LA 4ECTA 1RTHB 4DMZA 6AT1B 3FK4A 4LF9J 2OMLA 3C14B 3KMQA 3MTJA 4QYRA 3EGWB 3N6NA 3GQCA 4UTGA 2JHEA 4WTOB 3J80U 4JV5J 3EICA 2WAQD 2GQ2A 4ZIWA 2JZ5A 2ZH6A 1FKOA 4GMKA 2H65B 2IJFA 4P75A 3MOJB 1HQEA 3OUYB 4QYZK 3D9BA 2CPXA 3ZTSA 2K3IA 4IO9Q 3PW0A 2W2QP 2RF2A 1S0OA 3MXHP 2QA4S 3R2DJ 2FTRA 4MKAA 3FFIB 4DR2F 5J2QB 2HVHA 3M32A 1M90T 4K7QA 1SKRA 4LF9F 3J7ZT 1TL4A 1EZZB 4UUWA 5HJXA 2CIMA 1GXTA 2KVIA 4P6QA 2KRBA 5D4LA 2RF2B 4B9VA 4LMZA 4LSLB 4WFBQ 2R8HA 1DLOB 1FWPA 4OYWA 2OPQA 3DOMB 1AW0A 2BQRA 4A4JA 3MM6B 1HARA 2EWHA 3TAMA 4X64F 1NK5A 4F3QA 4EBDA 1FF2A 3CIZA 2AEMA 1OO0B 4DR5J 4X4VA 1MMDA 3PJWA 2Z8QA 4MYUA 3TOQA 4YFUA 3QNWB 2W7AA 3DGVA 3IRXB 3DCAA 5U47A 2E9TA 3OJUA 2VBWA 2GMLA 3LPEA 1XR7A 1AROP 2YKAA 3Q8QB 4TYAA 3I55S 2FJEB 3HVAA 2HURA 4DV2F 1XEZA 2XMTA 2R2SA 2LEPA 4ITSA 4P71A 4QWDA 1U49A 4QOTA 1S97A 4RW6B 3SSRA 4IG0B 3ITHB 1RE1B 3HZGA 3ULHA 4C8KA 4W90B 1GEHA 2M8HA 1SJ4P 2PN6A 1FTCA 4DV3F 1YZ7A 2AJ4A 3AAWB 2MZSA 3AQPA 1F2HA 2XMUA 3KLEA 2F1FA 4RKUC 2V2QA 2X3GA 4OI1A 3UVJB 1KD1T 2LQBA 2CG8A 3GB0A 2MKSA 1U6ZA 4OYZA 4CO0A 3NRBA 3PVXA 1Z2LA 2UVWA 5CYQA 4X66F 2XZDB 4ZCMA 2MZ1A 1IJFB 5JUMA 4ZDNA 2R2TA 1UCNA 4L75A 2Q6BA 4KPCA 4IDKA 2J8AA 5GAHI 2OH2A 4K5SA 5HMYA 2ADBA 4PG4A 1HWJA 1CC7A 1XK8A 5AT1B 4B3TJ 4DI6A 1RYRA 1OS5A 5T7LA 2LDIA 2SXLA 3ZTOA 4JB8B 5KT2A 2D41A 4ZA1A 2VH7A 3DLJA 1S10A 2MXYA 1ZS6A 2LKZA 4KY3A 1SKWA 1Y3JA 3HFZB 4GC6A 2XYPB 4M5KA 3QLHA 1LW2B 1HA1A 1H72C 3V6KA 1X4HA 2PT0A 3R9LA 4PQUA 2R7SA 1M5VC 2CQIA 1E6YB 2DBBA 3MECA 4J9LA 2C3OA 2XY5A 2EFOA 2UV8G 5A8RB 1AYEA 1Q79A 1YSJA 4LFAF 2HHUA 4A8MP 5J2NA 4JOUA 3EPIA 3UN5A 4OZJA 2D3OR 2DNQA 3M9OB 1S1WA 4HHUA 3QGPA 1MN9A 4PG6A 5SUHA 5D4OA 2XGQA 1WEZA 3ETMA 2V6AA 1NEEA 4FS1A 3KK1B 4YHHJ 1FCAA 2KM8B 2HQ3A 2ZUGA 1HPZA 1RAGB 3AJ2A 3M05A 4OZNA 1T9WA 1ZM4A 3AOBA 3ZNUA 5LMNF 1G4CA 1KVIA 2DH8A 1NHKL 1X5OA 2J9DA 1Q1KA 1Q8IA 2Z2YB 3UW1A 2VASA 1U25A 1H74A 1TKXB 4NYPA 3RW7A 2JEFA 2HSEB 3BSOA 4QIWD 3OQ2A 9ATCB 4JV5F 3N6LA 2ZEJA 1CSJA 3PFEA 4NRTA 3AY0A 3PW7A 3HF5A 3MM7B 4A47A 1QM9A 1HR0F 2IRUA 1HWUA 5KT7A 1T03A 4EYHB 4NCGB 1GTHA 3CO0P 1FWLA 1SKUB 3CO9A 3RBXA 5KFPA 2KHCA 2HHQA 2YNIB 5E5NA 3HVWA 1W2BR 3M8PA 2XNRA 5C24B 3KG4A 5HBMB 3MZIA 4URGA 5E0OA 5HLFB 3EXCX 4U67Q 1KQSR 4MKVA 4NLOA 3QO9B 1N88A 3WQPA 1MN7A 2KG0A 3QSYB 2Q3PA 3N9UC 3LAMA 1RU2A 2IYGA 1VGYA 4QZVB 3W9JA 3QMQA 1NSQA 4U6PA 2E5JA 2GA7A 2W4PA 3DDIA 2BVZA 3PM9A 4JYAF 3D6TB 3UQSA 5C24A 1YLXA 5CABA 1DQ8A 2B7CB 1FKAF 2VV5A 4RW7A 4L3KA 5G4DA 1NJZA 2KTQA 3WIUA 1OYEA 1Q8KA 4DQRA 1BHNA 1RT2A 2YWHA 1FWKA 4YR2A 2DRAA 2BE2A 4B3RJ 4B08A 3G6YA 3JTNA 4DL4A 3IBWA 1FK9B 1Q7LB 3OFEA 2JOQA 1NRKA 1FXRA 4OYOA 4QR2A 4X62J 1FHTA 1Q0NA 4DV7F 3HKWA 3R5JB 2AU0A 1VK3A 2LP4A 3POTB 1R6YA 4DPOA 3MD3A 2L9DA 1H73A 1V5VA 2GMHA 3BDPA 4C3KA 4Q8FA 2VG7B 4R0JA 2CQ3A 2NZCA 4NLWA 3RBEA 3RW6A 4MIAA 3V5RA 1T94A 1RAHB 3A1YG 4DX6A 2YNHB 2KYXA 3PYEA 4I7FB 3SCIE 4DR7J 2B4VA 3AD8C 2D3O1 1ICEB 3NP5A 5D3GA 1NZ8A 2MQLA 1XWLA 4I6YA 3D6MB 5KFAA 2CNKB 3LWMA 1VQOS 3SIPB 1SJ1A 2EPIA 2C3YA 3W9HA 3TZWA 2GQQA 2GIRA 5HQLA 4K4YA 2LCWA 1Z2ZA 2VF3A 3BQ2A 2KG1A 2QA4G 4EBEA 2RD5C 1NDLA 1IBLF 3QSIA 1RTIB 3FC9A 4ECWA 2BOPA 3OVAA 4URSA 3MECB 3RRHA 3DLKA 2HQDA 5DLFA 2RVJA 1YIJS 1TUGB 2FVQA 2BACA 2GVDB 2MKJA 1BMQB 3NKYA 2PI4A 5A8WA 1SL1A 3CB4A 3BBCA 4JI2J 3ZTRA 4RUCA 4HVZA 4IQXA 1RT4A 2E1MC 2ZOMA 1KQKA 1N36J 5DGBA 4J9UE 4OLPA 5H1SV 2ZFHA 4RO0A 2E1PA 1S7HA 2YTCA 1ZTTA 1JJ2R 1HI1A 4R5PB 2IHR1 3IFEA 2DXEA 3QGHA 3QT5A 3T5LA 2C42A 1W25A 5KFDA 3T6JA 1TVRB 4J9KA 4UOHA 1Q5YA 1Y00A 4CM2A 5DM7Q 1FX4A 2HQIA 4PQUB 1WC5A 2QC3A 2I5JA 3AT1B 3EVWA 3EWGA 4JI8F 3UD5A 3KYLA 5CYJA 1LW0B 4MFBB 1YJ7A 3AOCA 2DGWA 4HHJA 1FNMA 3OLAA 4ED6A 5KFUA 1VBXA 1GK8A 5KOXA 3FJ2A 2EK1A 2G1DA 1N5SA 4CTAA 1BGXT 4NLGA 3Q8SB 5A6PA 2Z0GA 5DG9A 1LWFA 4H4MB 3FVYA 4IFYB 4WK1A 4C4WA 5EN1A 1NHVA 2QGFB 3A8IA 4ER8A 2GW8A 1RT7B 1WDTA 2FHMA 5D8HB 2WBMA 3DKDA 2IY5B 4OX6A 4OZ3A 1WG5A 3D67A 2L08A 2YVSA 2VL1A 5IV4A 5IT9Y 3V6HA 1JLBB 3W2WA 4K8RA 3KJNB 4LT6A 2NZ4A 2N82B 1PAUB 3OHBA 2C2OB 4KHRA 4NI2B 3W65A 2V94A 4LVNP 2ZH9A 2IVMA 2NPFA 3DM2A 2IAJB 4C6AA 2OEJA 4OI0A 1WEXA 1RBAA 2MZQA 2B6AA 3MMBA 4TNOA 2MQOA 4TQRA 2W2MP 2XCPA 2W7PA 1IKXA 1CJVA 1SH2A 4E2FB 1GMVA 2MGZB 3TAMB 1YX2A 2FPHX 2W9BA 3Q24A 2VOPA 4MKYA 1CS4B 1HW8A 3GV5B 1QAXA 1RKIA 4ZPTR 2IM2A 3MM9A 4ZP8A 2JEJA 1WF1A 2C2DA 4K4SA 4LF8J 4PUOA 4ZPDA 1RT3B 2HVEA 5AE3A 3DDKA 1GMWA 4QJVA 1D9FA 1JJCB 4OI2A 4DSEA 1N0VC 2AIRB 2CADA 2HFZA 2E1RA 2RKIB 5DS7A 2BJ3A 3FFIA 1WACA 5EDWA 1YJWS 2KM8C 4NXNJ 4OL8A 1V6HA 2F40A 1R0CB 3KK2B 1MROB 2W9CA 2R8JA 1IKVB 2H5JB 1LEOA 2AWZA 2XMVA 4RX6A 1IN0A 3BN7A 5BXIA 3LP1A 4DSLA 1QLNA 3QT6A 2HHXA 2UXCJ 4FDFA 3ZTQA 1YJRA 2B7BB 3DC2A 4KGVB 4DZDA 2VJUA 1FRJA 4H4KC 3GE9A 3VF0B 3M7VA 4LR7A 5GAGI 3T5HA 2NREA 4LJMA 4K0KJ 4FYWB 1LNQA 3VV2B 4EBCA 1XMOF 4GO7X 4WYWA 3PRBA 3S6EA 2WB4A 3CIMA 1SV5B 3F0NA 3W5ZA 1J27A 3BF4A 2FJWA 4NCAA 1TL7B 4O0NA 1ZTWA 4DV2J 2B3TB 4UZBA 1YJUA 4BBYA 3M6VA 4CLLA 2WW4A 1RT6A 2HBZB 1HI0P 2JH3A 4USUA 1TKDA 1QVFR 5KFOA 2L48A 4ZVFA 1G3OA 4B9LA 4I2QA 1NMEB 3NGTA 3ZXWA 5CXTA 3RB6A 3W8GA 2MHNA 3O5TB 2DRBA 4NXNF 2RDIA 2PI5A 1IJEB 4I0WA 4DL6A 1TKTA 1IKYB 2QZ8A 4Y2KA 2IBKA 3OBIA 2C1EB 2CNNB 4LF8F 2MKHA 1GMWD 1UEUA 2CJAA 1XNRJ 1OMSA 2Z57B 3M2VB 3GV7B 4HKQA 2NYIA 3KUGA 4RNOA 4ES1A 2J6TA 2QO3A 3AD9C 1B4SA 3QAEA 4J9RA 2K1RA 3GP9A 4ED1A 2C28A 3LGNA 5K14A 3VAFA 5HROB 3TJ9A 1L3VA 2ACMA 3DMJA 1DJ0A 2J9CA 1UW4A 3P5BP 1IBMF 3MPVA 3CCRS 1L3SA 4ZLNA 4LRFA 2OELA 3C46A 2WOMB 2RHSB 1NB7A 4DV0J 5AXMA 3M30A 1T9XA 3OXGA 1RT5B 4USJC 3HLUA 2VJVA 4J9NA 1JLFA 1YQHA 3WC2A 2LVWA 3C19A 3KKFA 3PFOA 4F26A 2XMWA 1T3OA 1VRQC 4I6AA 3FZBA 1MWQA 2VG5B 5DDQC 4L76A 5EGYA 1DARA 1TL3B 3MR2A 2V8DA 5D4NA 3ZZZA 4HYKA 1U45A 4O3NA 4MK8A 4U95A 1UJ6A 1B0TA 5GAGU 2QMWA 1VOMA 2W25A 4OZ0A 4OYPA 4WU2A 3TWZA 3UE2A 2HNDB 2KJWA 1REVA 3CJRA 3UNGC 2V4RA 3P49B 2UUAF 3R27A 5IM0B 3F56A 1UVIA 1R6VA 3MR7A 3L4BC 1UZDA 2MSSA 2A3JA 3PDNA 2ZM6J 1S76D 5ETLA 1RACB 2M4MA 2ROPA 2MJUA 2I38A 4BC7A 3G6VA 2DGXA 1UZHA 1U1MA 4ED0A 3C6TB 3KWMA 4H4OB 4PXEA 4DUTA 2XS7A 4NLQA 4BHQA 1ZH5A 1N6QA 4M63A 4Y28C 2DNYA 2CQ4A 2GVZB 3R7SB 2V5HG 3UNYA 4AD6A 1NCLA 2AD9A 1N32J 1Y5IB 2KT2A 1BLUA 1F9FA 4ZHRA 4NEYA 1N33F 4HH0A 4G1QA 2KJVA 4Q45A 1TK5A 1X7VA 4WJBA 2FJVA 4U96A 3OXLA 5KFSA 1WELA 3ZTPA 4CO5A 1Q78A 3GIJA 2DTJA 3CCUS 2G9OA 3CDBA 3H98A 1PC4A 2AW0A 4M5DA 2BW2A 3GZ7A 2JC0A 1RHJB 1MG7A 3GPAA 1S0NA 3IG1A 1EHWA 1UVLA 4DFMA 2K1RB 1RTZA 3NOGA 4ED3A 3WIVA 3IO1A 1PYOB 4K5RA 4ZPBA 3SCJE 2MY8A 4R5PA 1T05A 3CJTA 4YR3A 1HNWJ 3M2VA 1R27B 3TARA 3DLLQ 3HK2A 2RB7A 2HGNA 3J7A1 2IJRA 2RAQA 3W60A 3TQEA 5GMDA 2ZBRA 1UKUA 4URQU 1X4EA 3MEDB 4C11B 2OEMA 3CTRA 4R8UA 3DRYA 4DV5F 5HBMA 4X65F 4XK8C 3HSZA 2EFGA 5IQ6A 2P8IA 3SQOP 2YNIA 3SV3A 1RAIB 2XCAA 4JI4J 4O3SA 5KFFA 2Y9HA 1TMJA 2VDIA 2IM3A 7FDRA 1PGZA 2ZC3A 3IMQJ 5GAEU 2VKZG 3M9MB 2M7SA 4K4VA 2V0NA 2AP6A 2AMCB 4JI0J 1OQ3A 1VFJA 1FRMA 2CKWA 3NNAA 4YMEA 4OHXA 2CUYA 3CSKA 5CD4H 3GFHA 3GYNA 3JYTB 4OV6A 3MTKA 3I9ZA 3NMAA 3I9V9 1MWYA 1JK9B 1F1BB 1N0UA 2BUNA 5K5MA 1SPBP 1VISA 2ZHBA 3LANA 2DGQA 3OR2A 1UA1A 4NEZA 4KH1B 1NZAA 1S1WB 1P1LA 4LF4J 2W01A 2DEIA 2B56A 3TVKA 2L9NA 2YKPA 3VGVA 2J0WA 2XZTB 2Z2MA 2FLPA 2CPFA 4UOCA 4PRFA 3BH7B 1S1TB 2X7IA 1LFWA 3MURP 2V50A 2FUG9 5HVFA 4Y00A 4RW8B 4RW7B 2K7JA 2PD1A 3H59A 3IN5A 1IVZA 1IR1A 2DKOB 3NS7B 2CJQA 1D1UA 2N4DA 3Q22A 3IC1A 3OL7A 3ILOA 2ZH8A 2MQ8A 2B5JB 2LXUA 3QLHB 1FVQA 1R8BA 3JSRA 4LSNA 3HHLC 3L9ZA 1N5YA 4AL7A 1S6PB 2PO4A 2R2RA 1Q95G 1JJHA 3BM7A 3BGRB 4ES3A 1FE0A 4HT7A 1YDLA 1TZ0A 4ILLA 3KG0A 2YY3A 1H2TZ 3A3OB 3IWNC 4F50A 4KHPF 3A13A 2XHWA 1QSLA 2VZ9A 1KR4A
chains in the Genus database with same CATH topology
3K58A 2IBOA 1S9FA 2EFNA 1RJJA 1S49A 4DSKA 1KNZA 1I1GA 1S0MA 4CI0B 1VQNS 3PW4A 5MAOA 5LJ3Y 4R25A 4C0OC 4HT5A 4NWBA 5KT4A 3LP0A 4KV8A 1UVMA 3CJ5A 3RB3A 2NSCA 3LP2B 3GFZA 4JI1F 1HBNB 2CQ0A 2OPSA 2YH0A 3IR5B 3MOZA 3LUYA 1RI7A 1CLFA 4GKKF 2YX7A 2ASLA 3KK1A 4HEA9 2DNHA 4Q44A 1REVB 3GYXB 1TV6A 3G8QA 3MPYA 4Q2LA 4TY8A 4X4OA 1AUDA 1SIZA 2UVUA 3G86A 1EP4A 3FEXB 4FF4A 5FIIA 1DBDA 4YOEA 4ZMMA 1NK9A 3RAMA 1VC6A 1DAXA 1UEVA 1WHVA 2JWNA 1Q4RA 1C1CB 3QIPA 1K1QA 2VC1A 2I5JB 3CMAS 3PZPA 4X84A 4O0IA 4WKRA 1T95A 5E7OB 3NWGA 4DL0C 2QFJA 1G7CB 4X4QA 1RQ0A 1N4LA 3B78A 3QGIA 4DQQA 4TU8A 3PX4A 1S1TA 1IBKF 3NCQA 2HHWA 4PWDB 1U2FA 2OTLS 3SSSA 3T9NA 3DOMA 1S1UB 4YDDB 5THWA 2E9RX 5B0FA 1F5BA 2UUWA 4O3PA 3ZZYA 5GMKa 4XAKA 1HNXF 4CT8A 2BM0A 4MK9A 4QBUA 4X2BA 3FEYB 5CQGA 1BQMB 1RGVA 4DR6F 2QA2A 1IR0A 3GFYA 1HBNA 2PDAA 4EU0A 3CUNA 1K0VA 3ENWA 4FN5A 4ZVHA 2XY6A 3DRRA 4OIXA 5L39A 4BWMA 5LMUF 5FJ4A 1JLEB 2I1RA 1C0UA 3MUTP 1UFWA 3K2YA 5F3ZA 5DDPC 4K4XA 3KLHA 3O6QA 3CJ3A 3OTOF 4CZCA 1O0PA 3V4IA 2NS1B 4BWJA 5KFIA 4R8UB 5HQ8A 1S6PA 1NH8A 3R1HA 3LPYA 3C8YA 3AH6A 4YY3F 4K4TA 3DOKA 3CCVS 3NG8A 5KFMA 1ZPWX 1X9MA 3G9CA 2HWIA 1SBRA 2J7UA 3GR1A 3VAIA 1LK7A 2E1AA 3OSPA 1WG4A 1GX6A 3RRGA 6FDRA 2R7UA 3TA0A 1TK0A 1M1KT 4EUVA 3B4DA 4JBCA 3BQ0A 3MI7X 4Y3CA 1MMLA 4XPCA 4RNFA 1VIXA 2RJZA 4YQWA 1PILA 2W7OA 3KFWX 4I4BA 2FGOA 3MPWA 1VLYA 3B82A 2PE8A 1RA7A 3JSMB 1Z1ZA 5J2QA 4OX9F 2YKOA 4RUHA 5DDOC 2J6UA 3O1LA 1Q8BA 2ZJQQ 2A18A 5KFQA 2F9DA 2W4CA 4WFZA 1APSA 3RU0A 4H4OA 1H6KX 3C6TA 2JLFA 3X3UA 5B0CA 2DK2A 3FQLA 2YKNB 5KFCA 1JXEA 2ZNZA 2BDPA 4B3MF 1NK7A 4OX7A 2OFHX 4PG8A 1TKXA 4ZP7A 2UP1A 3SCLE 4NXMF 2CRLA 3GFXA 3G71S 1HPZB 2L3MA 2Q79A 4F25A 5SZTA 1RTHA 3GG0A 3NGDA 3X1LB 1HYSA 4TLQA 4BC9A 5DETA 1KLMA 3KLFA 2FC9A 3I5AA 1NJYA 3DYAA 2CJKA 4IKAA 2BANA 2VFSA 3CF5Q 4Y6IA 2WHOA 4NOHA 3UDCA 4KE5A 1DQAA 4A46A