4LSLB

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj476), a non-nucleoside inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
428
structure length
417
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 103
structure length 417
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lslB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslB03
3DLEB 5KT4A 3T5LA 3RAQA 1VRUA 1DLOA 4DL6A 2UUWA 5DQGA 5DG8A 2VG7B 4O4GB 5KFWA 5J2MB 4IQXA 3OHBA 2FJWA 5C5JA 3HVAA 3KHLA 1FKPA 3DLGB 1S9FA 1RYRA 1XR5A 1LWCA 1S1VA 2IC3B 3QIDA 5F8HA 5KFPA 4X2BA 3MEGA 5FDLB 1UWBB 4H4OA 3DLEA 4IG0B 4NCGA 5F8MA 5DQIA 4K4XA 4Y34A 3DLKB 4RUCA 4KE5A 2HNYB 4IRDA 4J9PA 2VG7A 4O4GA 1WNEA 5J2MA 2C22A 5KT2A 5KFVA 1JLAB 5KFUA 4ZPBA 3KMSA 4RUAA 3G6XA 2BANB 3KK2B 4ED7A 4YR3A 3D28A 2W9AA 3DLGA 5KFSA 3DOLB 4XPCA 4WFZA 2UVWA 3QLHB 2B43A 2XWYA 2IC3A 2FVRA 3PZPA 1S0OA 3KHRA 5FDLA 3CJ2A 2V4RA 4HYKA 1UWBA 3PVXA 4IG0A 1IKWB 1R0AB 5KFLA 4RNFA 2R8HA 3DLKA 2R2RA 3LAMA 5L1LA 2IM2A 2HNYA 1LW0A 4ZHRB 1S49A 4QWCA 4ED1A 1MU2B 1VRTB 4OL8A 3H2LA 1JLAA 1HPZB 3V6DB 5DGAA 2BANA 3KK2A 1RDRA 3QGHA 5J1EB 2GIRA 3JYTA 3UQSA 4K4TA 4F4WA 3FQKA 5L1JA 3DOLA 1KLMB 4KO0B 3VQSA 1RT5B 3QLHA 1JLGB 1S9GB 2D3UA 2J6UA 3ISNC 2CKWA 4NLDA 2AQ4A 2O5DA 1IKWA 2E9ZA 1R0AA 5KG2A 1RTJB 3H5UA 2BE2B 4I2QB 4ZHRA 5KG0A 4O3SA 2CJQA 4Q8EA 1MU2A 1VRTA 2VG5B 2OPPB 3KLHB 1S0NA 4RW8B 3Q8SB 4K4YA 3CJ4A 1HPZA 3V6DA 3KOAA 3KLFB 4F50A 5KFOA 5J2NB 2UVVA 5J1EA 5F9NA 3GV5B 4I2PB 4FS2A 3KMQA 1KLMA 4KO0A 1RT2B 1RT5A 4NLUA 5KG1A 5F8LA 1RYSA 1JLGA 1S9GA 2XC9A 1C0TB 3DRSB 1TP7A 3V6HA 1TL1B 2IM0A 3UR0A 3GV7B 1S6QB 1MMLA 5I42B 1Z4UA 5KFAA 3RBDA 5KFQA 5JUMA 1RTJA 4EO6A 2BE2A 4I2QA 3OLAA 1W25A 3KLEB 3DOKB 2VG5A 2OPPA 3KLHA 3NAHA 5KT3A 4RW8A 3UDLA 2W8KA 1IKXB 4LQ3A 4O44B 4ED6A 4LQ9A 4G1QB 3CIZA 3KLFA 4FBUA 2BRKA 5J2NA 4URSA 1JLFB 4EO8A 4RNHA 4DL7A 4I2PA 3FSIA 4MKAA 3NAIA 3LALA 3M8PB 3MF5A 1K1QA 3N6MA 1RT2A 4G3IA 3BQ2A 1QUVA 1C0TA 3DRSA 2V4QA 5KFZA 4I7FB 4Q45A 1TL1A 2IA6A 2IJFA 3CJ5A 4ZP8A 3OHAA 3PW2A 3M9NB 1S6QA 5I42A 3E51A 4RW4B 2BQRA 5KT7A 2BRLA 2W9BB 5KFEA 1I6JA 4QWEA 1N56A 3V81B 4KHRA 3EPGA 3H5YA 4EEYA 3IRXB 2WB4A 3KLEA 4KBIA 4JV2A 1IM4A 2XGPA 5HP1B 2R2TA 4PWDB 4TYBA 4O3QA 3PHEA 1IKXA 2EC0A 4KFBB 3LP0B 4O44A 4KHMA 2B5JB 1SH2A 1XR7A 2V9WA 4G1QA 4ZVHA 3IGVA 3NMAA 1JLFA 2IM3A 2RKIB 3GIIA 1JIHA 1CSJA 2BR0A 2FVPA 1SV5B 3M8PA 1IKVB 4B3OB 1RTDB 3I0RB 4TXSA 3PW5A 5DLFA 5L1KA 4TQRA 4I7FA 4H54A 3MR3A 4ED8A 4RW4A 4DEZA 1JKHB 2JC0A 2WCXA 4URGA 2W9BA 3KHGA 3V81A 1HARA 3IRXA 3M8QB 5HBMB 5HP1A 4PWDA 3KNAA 3BSOA 4J9SA 4ECTA 4KFBA 3LP0A 3T1AA 1ZTWA 2B5JA 3GYNA 4Q43A 2R8JA 3PW0A 2FLNA 3IS9B 2WRMA 4URQU 4FBTA 3MEDB 2RKIA 2HWHA 3IN5A 4K4WA 2WTFA 4ID5B 4J9MA 1SV5A 4XPEA 4NRTA 1IKVA 4B3OA 1RTDA 3I0RA 4TY9A 1S1UB 3GIMA 5KT5A 1LWFB 4FS1A 1RT4B 2ZD1B 5EUHA 3CDUA 3QGIA 3EZUA 1HQUB 1JLBB 1JKHA 2F8EX 2JEIA 4O3OA 4MH8A 3CVKA 3M8QA 5HBMA 1S97A 2FVCA 4JUZA 1HMVB 2AGOA 5KFNA 1RA7A 4EBDA 1DTQB 2R8GA 3I5CA 5KT6A 1N5YB 4EBCA 2ASJA 3IS9A 3SFGA 1TKZB 2YNFB 3MEDA 4O3RA 3I0SB 4NLXA 4ID5A 4MIAA 4NLOA 4QW9A 3ICLA 4ECUA 1S1UA 3BGRB 1LWFA 1N6QB 1RT4A 2QV6A 3M9OB 5F8NA 4ZP7A 2HNZB 4TYAA 2ZD1A 3HVTB 1HQUA 1JLBA 3TVKA 1HNIB 3LANA 1XR6A 1DTTB 3TQ1A 3PW4A 3CJ0A 3MFIA 5J2PB 1HMVA 5J2QB 5KFMA 2OH2A 3LP1B 1DTQA 5KG6A 4MK9A 3OSNA 2ZKUA 1N5YA 3DRRB 2ILYA 3Q8QB 3GIJA 1TKZA 1FKOB 2YNFA 2JEFA 3V6KA 4J9QA 3I0SA 4IDKB 3MEEB 4LSNB 1JLEB 3QYYA 2XI2A 4QWAA 3BGRA 4J9LA 4NLGA 1N6QA 2E9TA 3H4BA 4J9NA 2HNZA 4IRCA 2WONB 3CO9A 3HVTA 4ZMMA 2XI3A 4ECYA 3TAMB 5C24B 1TL3B 4PQUB 5DG7A 1HNIA 3OL8A 1DTTA 2VG6B 3BQ0A 3Q8PB 4ECQA 4O3PA 2UVRA 5J2PA 5J2QA 2JLEA 1ZTTA 3LP1A 3KK3B 2QE5A 1JLQB 4Y2CA 5I3UB 5KFXA 5F8GA 1T05B 3DRRA 2YKNB 2UUTA 1FKOA 4ZVFA 4ICLB 3UPFA 5KFBA 4IDKA 3MEEA 4IFVB 4LSNA 1JLEA 4YP3A 3MECB 5KFIA 4PUOB 2E9RX 3H98A 5D3GB 2WONA 3OLBA 5KG7A 2IBKA 4J9RA 5C24A 3TAMA 1RA6A 3E01B 2HWIA 4GC7A 1TL3A 1TKTB 4PQUA 3RBEA 1JXLA 2VG6A 3BR9A 3SFUA 4J9OA 1EETB 3KK3A 2RF2B 1JLQA 3PR5B 1RT6B 5CYMB 4R5PB 5I3UA 1T05A 2YKNA 3C6TB 4LSLB 5HLFB 3FDSA 3FRZA 2ATLA 4ICLA 2AX1A 4IFVA 4DL2A 4WXOA 5T14A 3MECA 2DPJA 2WK4A 4PUOA 2YNHB 4F4XA 3PR4A 3H5XA 5KFTA 1S48A 5D3GA 1QE1B 5CYQB 3GV8B 1RAJA 4KB7A 3MFHA 3OL6A 4R0EA 5EWGA 1T94A 3E01A 4NLTA 3T5JA 2ASLA 4EBEA 1TKTA 3MR2A 2UVUA 1EETA 1S4FA 2RF2A 1HYSB 3MR6A 4ECVA 1RT6A 5CYMA 4XO0A 4R5PA 1TKXB 3C6TA 3DOKA 4LSLA 5HLFA 4TN2A 5KFRA 2W9CB 4ECXA 2C2RA 2J6SA 3OL9A 5F8JA 1HQEB 3PJWA 4Q0BB 2HNDB 5EDWA 3OSPA 5KFCA 3FFIB 1NHVA 2YNHA 3RB6A 5L1IA 4DL4A 1QE1A 5CYQA 4RNOA 4IH5A 1LWEB 5DG9A 5DLGA 3BSCA 4RZRA 5F8IA 2YNIB 2BQUA 4IG3B 3DM2B 2R2UA 1N4LA 3DDKA 2W7OA 1TQLA 3LAKA 4J9KA 3G6YA 4ZP6A 1HYSA 3M9MB 4DL3A 5KFFA 2B6AB 4YMEA 3T5HA 4ECSA 3RB0A 1TKXA 2W9CA 2C2DA 3FQLA 4WZMA 1HQEA 4MIBA 4Q0BA 4RNMA 2HNDA 2OPQB 2XCPA 5KFJA 2R8IA 4U7CA 4ECZA 1S0MA 1N48A 4EYIB 1ZETA 3I5BA 2D3ZA 3KLGB 5KG3A 4DG1B 1SH3A 3G6VA 1LWEA 3CWJA 4MFBB 4Y3CA 2YNIA 3ITHB 4IG3A 5KFDA 1S1XB 3DM2A 3QGGA 4ZVGA 4Q44A 4JV0A 3CDWA 3GQCA 1KHVA 4ED3A 2I5JB 3OL7A 4NLSA 4ECRA 4KV8B 2B6AA 4ZVEA 4NYZA 4ZPAA 4KSEB 1T03B 1RTHB 3T19A 2OPQA 4ZPCA 3IG1B 4RW7B 1YVFA 4TQSA 1GX6A 4QWDA 1LW2B 5EWEA 3JSMB 4MK8A 4IR1A 2FLLA 1REVB 3KLGA 4DG1A 3PJXA 2GIQA 1JLCB 4NRUA 4MFBA 1GX5A 2YKMB 5C25B 3ITHA 3DI6B 1S1XA 1HNVB 1TVRB 3V4IB 2JC1A 4IH7A 4NLQA 2XGQA 2HMIB 5KG5A 3H4DA 2VA2A 2GC8A 1IKYB 2I5JA 3BREA 1QAJA 4NLRA 4KV8A 4RW6B 3QO9B 2OPSB 4RW9B 3KK1B 1S6PB 1T03A 2FJXA 1RTHA 3RB4A 1JX4A 4NLPA 3IG1A 4RW7A 5KG4A 2JEJA 3KLVA 3NBPB 3T5KA 1LW2A 1C1CB 2HAIA 4O4RA 3JSMA 4IOBA 3GILA 5F9LA 1REVA 5L9XA 1JLCA 3JYTB 1TV6B 2YKMA 1S1WB 3DMJB 4H4MB 3DI6A 5C25A 4IKAA 1TVRA 1HNVA 3V4IA 4MKBA 3PW7A 4YQWA 2IM1A 1BQMB 2HMIA 1RT1B 1S9EB 2WHOA 4NLWA 1IKYA 3BJYA 4RW6A 2JEGA 3QZ7A 2IAJB 2OPSA 3QO9A 4RW9A 3KK1A 1S6PA 3CDEA 4ZPDA 5JXSA 2I1RA 2BQ3A 1C1BB 2AU0A 1QAIA 3LP2B 4IRKA 2R8KA 3MTKA 2XCAA 3NBPA 4DL5A 1C1CA 4RU9A 2ILZA 2W8LA 1C2PA 2AGQA 5C42B 3NL0A 3HKWA 2ASDA 4K4ZA 3RAXA 4KKOB 1TV6A 1S1WA 3DMJA 3DYAB 4H4MA 5DGBA 2C28A 3C6UB 1OS5A 2VA3A 4NLVA 2DPIA 4HKQA 1BQMA 3SI8A 1RT1A 1S9EA 5K14B 2R2SA 1NHUA 1NNDA 4K4VA 3BSNA 3Q8RB 2IAJA 3CJ3A 1RT7B 4QPXA 3DRPB 1C1BA 5HROB 3HVWA 4R8UB 5KFGA 1BQNB 3LP2A 4YR2A 4WE1B 3IGNA 1RT3B 1RTIB 1D0EA 3H59A 2ALZA 4WYWA 4WFXA 5C42A 2IMWP 2OPRB 4KKOA 3DYAA 4ECWA 3MR5A 1KHWA 4WZQA 3RB3A 1EP4B 3C6UA 1SH0A 4K50A 4K4SA 1D1UA 4ED2A 3N6NA 5K14A 3D5MA 2D41A 4JV1A 1J5OB 1T3NA 4U6PA 1S1TB 3KJVB 1RT7A 3DRPA 5HROA 3H40A 4IH6A 3N6LA 1FK9B 4R8UA 1BQNA 3I5AA 2YNGB 4WYLA 2D7SA 4WE1A 4QWBA 3EPIA 3KLIB 1RT3A 2J6TA 2WOMB 3ISND 1RTIA 2RDIA 2AWZA 4KAIA 3V6JA 2FVSA 4IR9A 2ZE2B 4WXWA 4GC6A 2OPRA 2AX0A 3KHHA 4ED0A 1K1SA 3BQ1A 2FVQA 5KFHA 3QZ8A 1EP4A 1C0UB 4WFYA 5KFYA 3QIPB 4K4UA 3GIKA 4M94A 4MK7A 1J5OA 1S1TA 3KJVA 4EYHB 2IJNA 1SUQB 4TY8B 1FK9A 1LW0B 4NLYA 4IFYB 2YNGA 5KFKA 3H5SA 3KLIA 3BSAA 1VRUB 2WOMA 1U09A 1DLOB 2RDJA 4M95A 2ZE2A 3FFIA 2C2EA 5EWFA 4TLRA 2FLPA 4RNNA 4ZP9A 3HHKA 1S10A 3G86A 3NKYA 1C0UA 4NZ0A 2W7PA 4F4ZA 1FKPB 3QIPA 2FJVA 4Y2AA 2V0NA 4QW8A 1LWCB 1S1VB 4O3NA 2AGPA 4YR0A 4F4YA 1SUQA 5DQHA 4Q8FA 3NGDA 4TY8A 3MEGB 4IFYA 4H4OB 4NCGB
chains in the Genus database with same CATH superfamily
3T5LA 1VK3A 5C2GA 5ETQA 2UZAA 1I94F 3THVA 2UUWA 1H7XA 1VISA 3MUTP 1SCJB 5E33A 1XK8A 2LYVA 3KHLA 8ATCB 2XO6A 2F7VA 2HSEB 1UWBB 3DLEA 3UDCA 5FIIA 1MROB 2ZBPA 2DGOA 4P71A 4X4OA 4O4GA 2FZKB 2J7UA 4UOFA 1NPKA 3HFKA 1U0SA 1IN0A 3DRXA 3H8YA 2MKIA 2MKKA 4HYKA 4F4AA 3GJRB 4IG0A 3ZNJ1 3MWBA 2Z58B 3LAMA 4Z2XA 1J2VA 1FDAA 2B4UA 3TAPA 2P9EA 2J6UA 2AKWB 4UW2A 4GVLA 2W4DA 3KDNA 3OT9A 4LFCF 5J1EA 1KLMA 3OD2A 1RT2B 4F02A 2IRYA 3H7HB 3KLEB 3NAHA 4RW8A 4ZVOB 4OYIA 5A8RB 1TZ0A 3CIZA 1U6FA 3T6JA 2QSWA 5I42A 1HL6A 4RW4B 2W9BB 3V81B 1PG5B 1YWXA 1IM4A 5HP1B 2EC0A 3I9V9 1R6VA 4BLGA 3BGFA 1JXVA 3GIIA 2QGFB 3IA0A 2KHCA 3GU0A 4H54A 1D9FA 1K47A 4DX5A 3AOAA 2CJ9A 1V3ZA 2ZJPQ 2GHPA 1UPMB 2RKIA 4PXDA 1VQ4S 3GIMA 2B4VA 3CF5Q 3LUYA 2BUNA 3EZOA 1TUGB 5B0DA 4NX9A 1NO8A 3M8QA 2QMUB 4JUZA 2LMIA 4DLEA 2ZOGA 2EFNA 5J1NA 3IC1A 2F8MA 3G9CA 3TVKA 1K9MT 2LKZA 4F4KA 2Y0SD 3KG0A 5KG6A 2CQDA 1HR0J 3Q2SC 4ZMMA 2XI3A 2HHSA 5DG7A 4HHHA 3J80U 5J2PA 4OYBA 2V94A 4C8OA 1S0VA 2X1BA 4LSNA 1WC6A 2AT1B 1N5TA 2NPIA 4GC7A 4QU7A 2CQHA 2KFYA 3M30A 4J9UE 1GMWD 2YKNA 1NB7A 1Q7LB 2DXDA 4CYUA 1FJGF 3K59A 2DR5A 3CCRS 2E5JA 1AB8A 3C3LA 3MFHA 4G65A 1RACB 1HYSB 5CYMA 1TKXB 3HK2A 3EGVA 3R6GB 4WZMA 4LIRA 3EZ5A 1VBYA 4NXNJ 1Q1KA 1JQGA 5CH7B 4ZLNA 3KUEA 4M5LA 3IR6B 1BUXA 4PAAA 4USHA 2IVFB 2MZSA 4ECRA 4F3QA 1X5PA 1MWQA 2BKOA 4X65F 3KDOA 4IR1A 4DV5F 4DX7A 4DR6J 3AQPA 4WFAQ 1NKCA 1OJ4A 1ZAWA 3B4MA 3GE9A 2GIFA 2Q66A 4HHJA 3IM9A 1X4HA 1NK7A 1B4SA 3FZ2A 3N9UC 3OQ2A 2M5YA 1VQYA 2BJ8A 3MTKA 2XCAA 5A0YB 4NI2A 5D4OA 5HVFA 1RABB 3A4TA 2V8DA 2CYYA 2OLWA 1BC6A 3T1HJ 3H59A 2DY9A 2IMWP 4LFAF 2DGWA 3IXQA 2J8AA 5K8PA 1D1UA 4ED2A 4M63A 4PG8A 1FK9B 5AXKA 1BQNA 3I5AA 2D7SA 2V2VA 2DISA 4HEA9 4TU8A 2ZE2B 1TAQA 4OJ1A 5KFYA 2BM0A 2J0QD 5DDPC 1J5OA 1EB0A 3U27A 1XNRJ 2RQMA 4NLYA 3H5SA 5LMUJ 1DLOB 2CPJA 1B0PA 2C2EA 2ZBCA 2PN6A 3G86A 2FJVA 3HHEA 4N5SA 5DDRC 1HI8A 2F1FA 3DGVA 4H4OB 4QU6A 1XQIA 2PMWA 2WBRA 5DG8A 3FCHA 1VC6A 3HVAA 3RBXA 5B0FA 4HDHA 1WSVA 5FDLB 2J8SA 5DQIA 3NCQA 4RUCA 1NSAA 4KE5A 3TUPA 4LFBJ 5KFVA 2C1EB 3F44A 1FF2A 1UETA 4YR3A 2W9AA 2BJDA 1OO0B 4WP9A 1IKWB 1CG2A 2R8HA 3EJMA 1B99A 1WTBA 2E1RA 3VWSA 4OL8A 1X4DA 1P1LA 3P3DA 2CFXA 3FQKA 2JVRA 2K8GA 1JLGB 2D3UA 4FF3A 3GYGA 5BR8F 5KG2A 5CAAA 2RUGA 5A6WA 4RWXA 4AD6A 5KFOA 3HHLA 2C3MA 2Z2ZA 4C8ZA 5KFQA 4W92B 2VG5A 5KT3A 2FLOA 3QT7A 3L4BC 3KYLA 2ZBIA 3IAS9 4MKAA 4GKJF 3C16A 1SKUB 1DURA 2CJYB 4TYBA 2R2TA 4ES2A 3W3SA 2FJEB 3IGVA 4MYTA 1N36J 3I0RB 2RNEA 2DTJA 3IWXA 2A2DA 3S6EA 3I6PA 4ZN1A 1YIJS 3T1AA 2GA7A 4URQU 2ROEA 3IN5A 4ID5B 4NRTA 1AROP 1RT4B 4MH8A 2V50A 5KFNA 1RA7A 1QAYA 3IS9A 1GQEA 3I0SB 1FO1A 4DV2J 4NLOA 4ECUA 3P8BB 1LWFA 1NCLA 3AJDA 5M2PA 4O0IA 1T9VA 3KG4A 2OAUA 3POTB 3PYDA 3OFFA 2MZTA 5CXTA 2CADA 5J2QB 2ZKUA 2M9KA 3LPEA 4I68A 2DB1A 1AW0A 3DN9A 2MLYA 2LLZA 2ZH2A 3A3PB 1RHRB 1HNIA 4J90A 3R9LA 1KBRA 3M2RA 3CJQA 4ECQA 1NSQA 4AUKA 4OX9F 4E0DA 2GVZA 3VAGA 1JJHA 5D3GB 2GVDA 1UEUA 2HWIA 4QIWD 3ZNUA 4IOAQ 3M6WA 3I31A 3DRYA 1SL1A 2V69A 3ULHA 1RAHB 1HBUA 4OI0A 4R25A 4UQTA 4EWTA 3WC2A 2N7YA 1CJVA 3U7JA 3MMCB 3G8TA 3PO4A 2N3LA 4LR9A 1VQ7S 3CD0A 4J5OA 1KVKA 1ZM4A 3UN5A 2L08A 3MPVA 2Q43A 2L48A 1Z2LA 1N54B 3L95X 1FRJA 3PO5A 1APSA 4DL3A 5ETVA 2IVMA 2JZ5A 1ZETA 3K5LA 3T6BA 1D9DA 4JV0A 1LQ9A 3TARA 2YKOA 4B3TF 4PZVA 1DQ9A 4B9LA 4K0KJ 2Z2LA 2MHNA 4NEZA 2VL1A 3WHIA 4DS4A 1T95A 2DR6A 1YK9A 3BGLA 1SJQA 1YITS 3BGOP 5KG5A 3OUYB 4Q5VA 1U0HA 2B4OA 1I94J 4LR8A 3MOJB 3ETOA 3WIUA 1RGVA 2E7XA 1ITPA 4DR7F 3H20A 4JI4J 1IQZA 4PABA 3RBZA 4MKBA 4JI7F 2HRYA 2I2YA 1EZZB 1LFPA 4JI0F 2E29A 4DR3J 4ILLA 4M5KA 3DMJA 3GWCA 5LXYA 1JXEA 2FHJD 1WDDA 4CLUA 3IGNA 2UV8G 1VLOA 1D0EA 2DEJA 1IWGA 1D09B 4QCLA 3C6UA 4K50A 3QRQA 1EKSA 1S1TB 3JTOA 4IH6A 3QJPA 1ZAXA 2DNHA 3Q0AA 4WE1A 3QJJA 5GAHU 2F4VJ 3ZZTA 4AXJA 3AD8C 2A6MA 1X4BA 1C0UB 2E5GA 4MK7A 3N01A 3CMES 3OR2A 4RKUC 2YNGA 4ZIWA 1M5OC 4N7TA 2DGQA 4UF4A 2XSJA 4CT9A 4DDFA 1EQ0A 2OFGX 4YR0A 3KJNB 2KFNA 4M5NA 4IFYA 2IIHA 1N88A 2D69A 4RBTA 5DQGA 3HLUA 5KFWA 3CCLS 2CAJA 3DLGB 3JQKA 1V3RA 2XO7A 1VIXA 3BPSP 3K8WA 4ENOA 2VG7A 4C0OC 3R2DJ 3EDRB 3D28A 4M8LA 4QYZK 1GK8A 3ZTPA 2NZCA 2PA8D 1A6LA 1Y10A 2WVDA 4DL4A 2IM2A 2Z30B 3IWNC 5D0RA 4PXCA 4A8FA 3UNGC 3CW2C 5L1JA 4A8WA 1LEOA 1S9GB 3LWMA 1BE4A 2AQ4A 1U1LA 2E9ZA 3ZC4A 4ZS6A 1HPZA 4KO0A 4QR2A 1RYSA 4U7UD 3SCJE 1S6QB 1CBKA 4N8OA 3UVJB 4GKKJ 3KLHA 1UW9A 2HQ3A 3P4UB 2WSFC 3NAIA 2UP1A 3CJKA 4LF4F 2VF3A 4AQYF 3BQ2A 5B0AA 5KFZA 1TUWA 5FLXY 4JI2F 4EEYA 1FJGJ 3VAIA 4KFBB 2FY1A 3TUIC 3DU5A 4G1QA 3UNYA 5IT0A 1JLFA 2AF6A 2OTJS 2ZH7A 3BYRA 1F6TA 3RYLA 4JI5F 4IO1A 2NYIA 2R8JA 4NYOA 2A18A 2VQFF 4P2MA 2F63A 4TY9A 3C66A 1RWUA 4CLKA 2M70A 4EBCA 1RWOB 3MEDA 3D66A 3K5NA 1IJEB 2NXUA 2O67A 4W90B 1WDTA 1HQUA 1KOOA 2YBVA 2ZHAA 5KFMA 1N5YA 1VI7A 1TKZA 1FKOB 1VQMS 3QYYA 2BKPA 4XTTA 1RKIA 2A10A 4C11B 3DKDA 2RAQA 3BQ0A 5BYRA 4Y2CA 4NPOA 4PG5A 5CYJA 2WONA 4ER8A 3TAMA 3L7PA 3IAM9 2Z56B 3D6MB 3M2VA 1JLQA 3MHYA 2RRNA 1I1GA 2O66A 1IR2A 3H5XA 3HI9A 3GSDA 4R0EA 4USUA 4B02A 2MZ1A 1VJWA 2MZRA 1HWIA 2Y3YA 4ZCLA 1RT6A 2QEXS 4ECXA 5FJ4A 2KL8A 4I69A 2LXIA 2HQFA 5CCLA 1JNZB 3H90A 2GZOA 2PE8A 3VAJA 4ZP6A 3MM7B 2OPQB 3LOUA 3VZIA 2OJ3A 4KRWA 3WX8A 1OSCA 7FD1A 2JX2A 4NYZA 2KH9A 1SB6A 1BD6A 3HFZB 2M88A 5HSPA 3KLGA 1JLCB 3Q8YA 3DI6B 1X5OA 3V4IB 2QX0A 5JVGQ 3TRGA 4RW6B 2YKAA 1WORA 4NLPA 3NBPB 3GYXB 4QBUA 5ETLA 1HNVA 1G2EA 1W26A 4NEYA 2C3YA 3TI0A 4CDIA 2VBWA 1PJ6A 4PCQA 3C46A 3UDEA 2VQEJ 1NMEB 3LP2B 3ET6A 2R8KA 1FRHA 2FY8A 3HKWA 5LJ3Y 4DL0C 1U48A 4NLVA 2R2SA 3R7NB 5AJ3J 2IAJA 3VAFA 1U2CA 1HNXF 4ALZA 3DYAA 2IVYA 1SH0A 1SC6A 1RT7A 2ZVSA 1RBLA 4PPDA 3OPKA 3W2WB 3TP2A 2Y0BB 1VGYA 1N32F 5E41A 2K3KA 1J27A 5EGYA 5T7LB 2RE1A 1S10A 2AGPA 5G4DA 5M2RA 4F4YA 5U47A 4DL6A 1WELA 1U1NA 1TMMA 2FB0A 1WOOA 3P5BP 4ZLJA 3J7A1 4WF9Q 3DXSX 3OHBA 4CM2A 1WUUA 1HW9A 3Q86A 2YH0A 2L9NA 1FKPA 2X3DA 4UY85 2XMTA 2B8PA 3VAHA 2BJ1A 2DNLA 4ZPBA 2ROGA 1CULA 4ED7A 4QOTA 5HQLA 1NKBA 2EBGA 4XPCA 3MGJA 1VQLS 2V9KA 4ZHRB 4DMZA 2A6OA 1JLAA 3NS5A 1HLWA 3PYEA 2DRAA 1S6UA 3ZZOA 1ZAVA 3UR3C 2CJQA 3KOAA 4I4BA 1SJ3P 1L3KA 4UUXA 5F0UA 1FTCA 2J0WA 2XS5A 1M5PC 1T0TV 4EO6A 4I2QA 3W64A 2HHTA 2QIFA 4RNHA 2MTLA 2LEAA 3N79A 2PI5A 3QFHA 2CVEA 1XMQF 2HFSA 3FZBA 3LP0B 3N4WA 1TK8A 3NMAA 1SV5B 4ZPVR 4A8OA 1ACMB 1HWUA 1WJ9A 1N34J 1TTHB 1SJ4P 1BMQB 1KEKA 2ZNYA 1M5HA 3SSSA 4ETXA 3MAHA 4DXLA 4QIEA 2OUGA 1XJWB 2V8VA 4OX6A 8AT1B 2VOPA 1X8DA 2M7SA 2ATCB 1NHKL 2HVEA 4YB5A 5HBMA 4CNYA 1HMVB 2EC2A 1DTQB 3AH6A 2E5IA 4NLXA 1BY9A 4KY3A 1N6QB 3M1VA 3VR1A 4ZP7A 2FZCB 3GJSB 2Y1RI 1P27B 5HO4A 1RCXB 4RWWA 3V6KA 1U4BA 1JLEB 2DK2A 2HS4A 4IRCA 3GCWP 1H74A 4D3HA 3N5BA 1DTTA 2VG6B 1CJTB 1UMJA 3HD2A 4X4QA 3BN7A 4ZVFA 4ICLB 4IDKA 5D77A 4NXMF 4PUOB 3ZZUA 2BZ2A 3ZZRA 2QLJB 2CQ0A 2MB0B 1F5BA 4ZVPB 4YB6A 4R5PB 3MZIA 3CC2S 2VHGA 1QVFR 3GV8B 1E6YA 1T94A 1WEXA 4KIAA 4DV3J 5B7WA 4GVBB 3BBFA 3C6TA 3DOKA 3IP0A 4KH0B 4BBYA 2VJUA 5CYQA 1XWLA 2LQJA 4P9SA 5DLGA 2LXUA 1VOMA 2G13A 2K06A 2C2OB 3M9MB 5LMNJ 3TUZC 1UL3A 3T5HA 1NJZA 1RHKB 3I5BA 2MY7A 4KYZA 4IG3A 1QTMA 4ZVGA 3AT1B 3HM9A 2MXYA 3CDWA 4C97A 3O2IA 2V4JA 1KN6A 2CQ3A 4OX8A 1YVFA 1M1HA 1U1RA 3HMJG 1X9WA 2UXCF 3PJXA 4BWMA 5C25B 3EDQB 2OPSB 3ZXWA 2I6WA 4HVZA 1KDNA 4CM0A 1V3SA 1BXNA 3JSMA 2HHHF 4B17A 3TOQA 2R7TA 3W60A 2HMIA 2WHOA 2MZQA 3KK1A 3QAUA 2ZOMA 3UD5A 6FDRA 2MHEA 1NK6A 2J7WA 5AXMA 1S1WA 1Q5YA 1OS5A 2VA3A 4JV5J 1S9EA 5K14B 3BO2A 1VQPS 3CNQP 2HIYA 4LBIA 4KGVB 3ELHA 1GXUA 2NXJA 4Z7YA 2C42A 5E2QA 3H25A 2CIMA 2KRBA 3VVUA 4L73A 2QA4S 2FJBB 4B3RJ 3N6LA 1WKJA 3DGPA 2HK3A 2HQCA 4ED0A 3KHHA 2DHSA 5E3RA 3BQ1A 5K8NA 2C2NA 2V67A 2ZUAA 2AMCB 2ZFHA 3FBBA 4DV4F 1GFWB 1ZPWX 5D6GA 2MLXA 4OIXA 2RDJA 5EWFA 3R3TA 3HHKA 2Z0GA 4PQAA 2AJ0A 4ANDA 2GJ2A 3HJFA 2XYHB 2MJUA 2C2MB 5DQHA 4Q8FA 4TY8A 1LW0A 2H5JB 4FNHA 2ZH5A 2CJAA 3VALA 2VU5A 4C0HA 3CCTA 2G1DA 4DHVA 1S1VA 1Q5VA 4JI5J 1TKDA 1HWKA 2YXLA 3X3UA 4ZVTB 2B9WA 4RUAA 1HD1A 2BANB 3NGRA 1VBZA 3D67A 4WFZA 1Q8KA 1S0OA 2IC3A 4B9SA 3E8OA 4PYAA 2HFOA 4DJBA 1KQKA 4UOGA 1S49A 4ED1A 3ILLA 1WC1A 2OSQA 2M2BA 2IDLA 3Q89A 2GHVC 3D0IE 2ZDPA 5DRKA 2BE2B 4V19J 1VCTA 1HQ2A 2KM8B 4ZA1A 4F0MA 4FXVA 5F8LA 2DNPA 2CNLB 1FE4A 2DH7A 1F5CA 1KFSA 2OPPA 1VQ9S 4FF2A 3JTPA 3M6UA 4CLLA 2VKRA 3G8QA 2YWFA 3BYPA 4DPUA 2BQRA 4PWWA 4UOCA 4YN3B 1OPIA 2D74B 3CB4A 2DXFA 1YBUA 2CDRB 3GFZA 3O3LA 1SQFA 4B3OB 3EX7B 4I56A 4ID8A 5DLFA 4TQRA 4I7FA 3MR3A 5DDOC 2CPZA 3MCNA 4AYBD 1RHUB 1FRLA 2BMBA 4O0NA 4DPWA 2HK2A 1RTDA 1QY7A 4ZITA 3P5TL 1KRPA 2ZH9A 3NNCA 3OR1B 2F8EX 4S0MA 1WD6A 3ILOA 3SFGA 2B51A 2NCKL 2NS1B 3ICLA 3M9OB 5F8NA 2XNQA 4DN0A 2A0FB 3PX4A 1AT1B 3MM8B 1CS4A 3OSNA 3DRRB 2ILYA 2G2OA 3FMWA 1U2RA 2JEFA 3A3NB 5RUBA 3J81Y 2MGZA 2M8HA 4V19X 4PQUB 5A2QU 1PC4A 4CO4A 1VMBA 2QE5A 1RADB 2K1RB 3H2UB 4YDDB 1XBWA 1S72S 3QRRA 3E01B 1U47A 1TR0A 5I3UA 2RUSA 3SV4A 3OL6A 3MR2A 4WFBQ 1F9HA 2ACMA 2FDNA 2F9DA 1U49A 5F8JA 1HQEB 4HDGA 2CZVC 3BR8A 3OSPA 3SDEA 1QE1A 4HI2A 2HYIB 3ZO7A 1QJHA 3DM2B 4FVCA 5D4PA 3UCGA 5D8HB 5CZXA 1HBOA 1SH3A 3X1LB 4DUYF 4LMZA 3R1HA 3OL7A 2KT3A 1AFIA 3SSRA 2QN6B 5I4MA 4OHZA 2VONA 2FLLA 1T8EA 3ITHA 2QL5B 4ZKAA 1S1XA 1EX8A 1AUSL 2EXUA 2JEJA 3KLVA 4P6QA 3NNHA 4RO0A 3EMTA 1M5VC 2BQ3A 3C14B 3IBWA 3CGIA 2CQCA 2UXDF 3PKYA 4H4MA 4HI1A 2DPIA 4HLBA 1EAYC 2R7WA 3AOCA 2JH3A 2LU1A 5HROB 2OEMA 1VS3A 4YR2A 1R6YA 1GAOA 2CXEA 5C42A 2HS0A 4DZ6A 4BS2A 4KKOA 4USTA 2PA3A 2D41A 4OI1A 4R8UA 3UWTA 3AB2B 4RU2A 4QPTA 2GGPA 3MCSA 1FD2A 1L3UA 1RISA 3S01A 1K1SA 2BACA 4LF1A 2KFZA 1M5SA 2HG4A 4DCJB 2AD9A 3KLIA 3JS9A 2B9YA 3GIRA 3MDFA 3E3XA 3QIPA 4CH7A 4F25A 2O5DA 3BKTA 3DLEB 3RAQA 3CT9A 4O4GB 1TL7A 3AB4B 2JDJA 3AD9C 4LVNP 1IXKA 4NE9C 2G4BA 2QRRA 4IG0B 5BYQA 2C3OA 2NYHA 3KMSA 3MCMA 2NSBA 2JRSA 2UVWA 2ZVIA 1NK9A 3KHRA 3SMZA 4TNOA 2RT3A 2I9SA 3AD7C 4DWIA 2HW3A 4QIGA 1ZZNA 3AY0A 4FPRA 4FNIA 3QSYB 3QGHA 5J1EB 2GIRA 2AJQA 1KLMB 3TUJC 3K58A 3M32A 3MTJA 4ANEA 4Y2KA 1R0AA 1FWPA 4RW8B 3HT3A 2CNOB 2J7KA 1V9OA 1YRTA 3ZZ0A 2J0SD 3KNGA 5I42B 3RBDA 1DAXA 1W25A 2C2KB 4NXMJ 4FBUA 1FESA 4ZN3A 5KT7A 3T9ZA 1IUJA 3K7RA 3PRVA 1IKXA 2H48B 4PG7A 2RKIB 1VFJA 1VQSA 4IOCQ 2GW8A 4YY3J 2L9DA 1SJ1A 1B64A 2DY1A 4ED8A 5BJRA 3P45B 2X3GA 4OYAA 3SEOA 3M8QB 2C3UA 2R7XA 1JJ4A 2HBYB 2YWHA 3Q2TC 4CH1A 4K4WA 1IKVA 3BH6B 2RVJA 5H1SV 1WTFA 4DX6A 4ZJOA 3W9IA 2JEIA 1ULRA 2D9PA 1RXOB 1OSDA 3L7UA 2QFJA 3PIPQ 1HR0F 1S1UA 2QV6A 1A7GE 4TYAA 2JL9A 5E3PA 1VIOA 5J2PB 1U6ZA 1KNZA 2HLTA 2YNFA 4LF5J 4LSNB 2G0CA 1U1OA 4DI6A 4QWAA 2HNZA 4N56A 1MG7A 1FTRA 5H9FJ 4JI1F 4A8SA 3M30B 4GRSA 2F9JA 3MPUB 2YKNB 5CA5A 3UPFA 4CYUB 2HHHJ 5ETPA 5KFIA 2VASA 4ZVUB 4USMA 1WC4A 2VV5A 1JXLA 4A4JA 2VPWB 7AT1B 3PDNA 4DFJA 2EW9A 3A8EA 1QUPA 5CYMB 5LT5A 2W7AA 3PY8A 2OMOA 4X4SA 3DLLQ 3HJVA 2UU9J 1H72C 2UV8A 5KOWA 2U2FA 2QLFB 3OL9A 3RB6A 5L1IA 4NXNF 4N76A 3GJQB 1X4AA 1LXJA 2IBOA 2N4DA 2OO4A 2DVIA 3ZTOA 1RAAB 2B9XA 2HHVA 4Q0BA 1E6VA 2EFPA 4UZCA 2R8IA 3HF5A 1S0MA 1N48A 1V6HA 4LBPA 1XNQF 2ZH6A 4L75A 4DR6F 4DV4J 4RPFA 1VHFA 2P6SA 4ZPCA 4WP3A 3G4SS 1XN9A 3I56S 3G71S 4MFBA 1GX5A 3NG8A 1RTHA 2CUYA 3RB4A 1U1PA 4I0WA 1RJJA 4TLQA 1LW2A 2CNNB 4IUFA 1HKAA 4NI2B 5F9LA 4A8YA 1REVA 2G2YA 3JYTB 4IKAA 1TVRA 2IYGA 2EFOA 2IM1A 3BJYA 2AYMA 2DNQA 5J1PA 2AU0A 3GFYA 4OJGA 2JSXA 3P6YC 1C1CA 3R5CA 2LVWA 3T1HF 4QQBA 2XY7A 2C28A 1RU2A 5GADI 2MQPA 2KTQA 1H2TZ 1C1BA 1BQNB 2P5VA 2RQKA 4J37A 4USWA 1N0UA 4U9RA 2PI4A 4RUBA 4E98A 2XMJA 1Y5NB 1SKWA 3DXBA 1FEHA 1QAXA 1J5OB 1T3NA 2NSCA 3TVZA 1XNRF 2W2PP 3EPIA 1JJCB 4EU0A 3AA8A 1YJNS 4LRCA 5LMUF 4NA2A 1RWMB 2B4PA 2HGLA 2UUBJ 3QZ8A 1DQ8A 1URRA 3KJVA 2QMXA 4EI2A 3JSYA 1FDDA 2V0NA 3J7YI 1UFKA 3MMAA 3NGDA 2RDDA 5KT4A 3JQMA 5E5NA 2EKYA 2CNKB 3OV7A 2FJWA 4LFBF 5HI7A 2PIIA 3QIDA 5LXRA 3MEGA 3QJLA 4Y34A 2HWTA 5J2MA 3TA1A 3AFGA 1VK8A 1QTNB 3FJ2A 1WOPA 2V4RA 3ONQA 4X84A 2W1BA 3RRGA 3D3CJ 5DGAA 2IMOA 2PEHA 1AXQA 2CQ2A 3HHLB 3DOLA 4W98A 4ZCMA 3T3FA 2KM8C 4FXDA 1WI6A 2V8HA 2VG5B 3H2VE 4ZVSB 1ELOA 4PXEA 4DQIA 3C16B 4OJ3A 1LXNA 2J9DA 5LSRA 3OTBA 3MXHP 4PWUA 2R42A 1KOHA 3WDOA 3L9ZA 2W8KA 1VRQC 4DL7A 2AJ1A 5F41A 2VOOA 3DRSA 1N36F 2BRLA 2DCUB 3T9NA 1MWYA 1O5JA 1SH2A 4ZVHA 2B7CB 2W2NP 1WHXA 3PW5A 4OHYA 5E3CA 1O0PA 1RBAA 2V6AA 2WCXA 1X9MA 4WU2A 2LA6A 4ECTA 4DFPA 2B5JA 9RUBA 2CG8A 3IS9B 5IC6B 2YVSA 3RR7A 1LWFB 1RP5A 3EZUA 4FYXB 3LA0A 3W63A 2VJVA 4ED5A 2FVCA 3I5CA 2XY6A 3NGTA 2VB6A 4MIAA 1LNQA 2KXNB 2ZD1A 3PTWA 1RK8A 1JLBA 1S12A 1HNIB 3TQ1A 3M2RB 1SJFA 3MFIA 1IVZA 2AYBA 4AT1B 3V4MA 2OTLS 1M0SA 4FXWA 2HRTA 1FX2A 3BGRA 2GVZB 3ZFVA 3MAQA 1F5AA 3HVTA 3D0HE 2GVDB 2RS8A 4B3MF 1RAIB 3MEKA 1TFWA 2KDOA 3OL8A 1NDKA 2UVRA 3LP1A 1MMNA 3IO1A 3MEEA 1MWZA 1DHMA 3QT8A 5BXIA 1HBUB 3J7AN 1P6TA 1TMJA 1RZMA 1CJVB 2HHXA 2DNGA 4IFVA 1NU4A 2WK4A 3SBMA 4OQJA 5EWGA 3FEZA 2DNOA 1UFWA 1TAUA 3MPWA 1WF0A 2RF2A 4LSLA 5HLFA 2V2ZA 2QT7A 2C2ZB 1YJWS 4IH5A 5AE2A 2CJBA 4M5DA 1Q86T 3NGSA 1TL4A 3TZYA 2NPFA 3DDKA 1OY6A 4I6AA 3SZ2A 2W4CA 2W9CA 2XMKA 3K5MA 3IR7B 2XM3A 1A0OB 2PEBA 4ZVEA 1U0HB 4WIIA 1H2UX 3SCLE 5GAGI 4CT8A 4X4RA 1QVGR 3S7RA 1SVDA 2M4MA 5EWEA 2FHMA 2B8QA 3CD5A 4JI4F 1HBMA 1EIYB 4NLRA 5IZHA 3K57A 3THTA 1HI1A 2RIJA 1R8HA 1RUSA 1S76D 2LP4A 4IOBA 2XSFA 1VC5A 4B9NA 3ZZYA 4MJKA 4LJMA 4DR3F 4ILMA 4DZDA 3DMJB 1S7HA 2RU3A 2EI5A 2XMVA 2HFNA 4NA3A 5IWAJ 4K2XA 5FLXU 1FVSA 2I1RA 3C15A 4CI0B 4YHHJ 3K5OA 3BDPA 5ADZA 1IQTA 2IRXA 4D3GA 3C6UB 3SI8A 1BQMA 4WE1B 1IM6A 2F4VF 3D4JA 2E1AA 1M1KT 2BEFA 3RB3A 3N6NA 3DRPA 1NAQA 3OR2B 2YNGB 3I32A 4J9VA 1RTIA 3EXYA 3OW2R 4GC6A 2AYGA 3FVYA 2BKNA 2XSJB 4P73A 5HL7Q 1JWWA 2KHDA 2VKZG 4IFYB 1L3TA 5KFKA 1XMOF 1X4FA 2WOMA 3DOMA 4N41A 4I64A 4ZP9A 4ATNA 2DR8A 4A8KA 4E8UA 4ETZA 1KQFB 2XTJP 4I67A 3TW0A 4DOZA 4RJVA 1SUQA 2BA9A 2DT9A 2ZJRQ 2VG7B 2ADBA 1ROFA 3NNAA 1S9FA 3IM8A 1RWNB 2D9OA 3QMQA 3O5TB 2DGUA 2QSFA 1Q82T 2OD6A 3D3BJ 4P7VA 4RNFA 4DUZJ 4F0KA 3CCVS 1YRUA 2HHUA 1HPZB 4UY8T 2YPZA 4KO0B 1Q0NA 3FMBA 4F67A 2AYEA 4K8RA 4NLDA 2BDPA 3TNVA 2GJFA 4GKKF 3KLHB 2IPOB 3Q8SB 2XMAA 2Y9HA 2E1PA 1Q95G 3CJKB 3NS6A 4JI1J 5H9EK 3GPAA 1MMLA 1N8RT 4FN5A 3TZXA 4DR2J 2J0XA 4G1QB 2ZITA 4EO8A 5J2NA 1JLFB 4ELUA 2R7UA 5E0OA 3MF5A 3QRPA 5IQQA 4CRJA 2CZ4A 4U95A 4Q45A 2OGUA 2IA6A 4ZP8A 3CMAS 3M9NB 3MM6A 5KFEA 1I6JA 1FFGB 4KBIA 1WI8A 1RWWB 4C7QA 1MN7A 3BDEA 2PGCA 1CSJA 3IFEA 3I4HX 2F4FA 2UUCJ 4NCBA 1M5KC 2M0GB 3BKFA 2Y1IA 2CPDA 3NXZA 4ZPTR 3RAMA 2WRMA 3MEDB 2WTFA 3MD3A 1NSKL 5KT5A 2RH3A 2WAQD 1HQUB 1Y11A 3U1LA 3HSZA 1K73T 1T9YA 3DNCA 3P96A 1H2VZ 1F3VA 1N5YB 1RWVB 2ASJA 1HNZJ 1TKZB 2KVQE 3CJSA 4USVA 4Y00A 1XNQJ 1U6BA 2AZ1A 4Z37A 2DKOB 2B3TB 2O3DA 2RQCA 1X4CA 3CJ0A 3EE3A 5GMEA 4WFNQ 5IT9Y 1FJEB 4DV0J 1U8SA 4ZCKA 1W2BR 2O1PA 3OVBA 2WONB 3CO9A 5D0EA 4ZVRB 4C9DA 1K0VA 2QG9B 3TAMB 4QYRA 3M2VB 2AJ4A 2H3EB 2FPHX 3OFHA 1JLQB 5K9FA 2DITA 1EARA 2EK6A 1R3NA 3G8SA 3FEYB 3CO0P 2HFUA 3GFXA 2KO1A 3M2UA 1NB2A 2CPEA 4K4SA 1RT6B 4A48A 4WKRA 1U24A 4DSLA 3HULA 2AX1A 3A8KA 3MURP 1KLNA 5KFTA 2YWWA 1WG4A 3HSDA 3H42A 3PJ9A 3GB0A 1FFSB 1K8AT 3FFIB 2YNHA 1PYOB 3W9JA 1AZSA 3JQJA 3GG0A 4RZRA 1HWJA 2AP6A 4RLEA 4QIVA 3RB0A 3PRBA 2RS2A 2JFDA 4USKA 2HNDA 4OJHA 2XCPA 2NQPA 1YHQS 1CC7A 2DXEA 2D3ZA 3KLGB 2FJDB 2YNIA 1R89A 3GQCA 3TO8A 3FCWA 1WF1A 3HVRA 1FNMA 1HNVB 4IH7A 2K3IA 2N82B 1UJ5A 4L74A 1KR4A 2VA2A 4KV8A 2ERRA 2FJXA 4UOHA 5THWA 3CPWR 3W5ZA 3FKBA 2VQEF 4WJBA 2EKNA 2XS2A 2YKMA 4NLWA 1M90T 2IAJB 2WZ1A 5AJ3F 2YKQA 1UP1A 2NREA 3B8HA 1TV6A 3DYAB 3QNWB 5GMKa 1MN9A 2YTCA 1NHUA 3VHQA 2B9EA 1RT7B 1R27B 5KFGA 4YUDA 2H4WB 3GCXP 3D1HA 4M5HA 2VDHA 1HA1A 3WBZA 1KONA 4WYLA 2XBPA 3S1TA 3O6QA 1U2FA 2FVSA 1R31A 4XK8C 2R3VA 1P9QC 1VQ6S 4CH0S 1LWXA 3CDBA 2CVIA 3EGZA 2XHCA 4EGLA 2VBXA 3CCZA 2FIUA 4M94A 1ZOTA 4OZLA 3I96A 3W9HA 1U09A 4ITSA 3R97A 3SSQA 1UCNA 4RNNA 2U1AA 1FKPB 5D0HA 1V5VA 4ZLPA 4QW8A 4NYPA 5IV4A 1VRUA 2QL9B 3HFVA 4LF8J 1NDLA 4BC9A 2HVDA 5C5JA 5DDQC 1CULB 1YSJA 1XR5A 4NMXA 4WBFA 1P9YA 5I3PA 4NCGA 4K4XA 2DNKA 2ZWPA 3LH2S 7FDRA 3CUNA 3BKUA 1JLAB 4MYUA 4CLPA 1S6OA 4MMOA 2CG4A 4DQQA 4B9TA 2HNYA 2EK1A 3HHLC 4LUBA 3GTYX 2DRBA 3HZEA 3GJTB 3UQSA 3BZQA 2GHWA 5JMNA 3QATA 2F5GA 4I2QB 1WWHA 2OSRA 3V6DA 3CEDA 3BO4A 1NKEA 4AL7A 4F26A 1WC5A 4B3MJ 1RT5A 2XC9A 3DLBA 1HI0P 1AUDA 3OLAA 4X4UA 4P2FA 2EG1A 4WK3A 3KLFA 3PKMA 2PMZD 1T11A 4I2PA 4DSJA 5L38A 4DX8H 3VV2B 3W7BA 4KHRA 3B4DA 1N34F 3CE8A 4O44A 2V9WA 3MCOA 1X9SA 3EGNA 1KTQA 4DEZA 4URGA 4PG6A 5HBMB 4PWDA 4OHVA 3BSOA 4ZJLA 3PW0A 1GH8A 3C8YA 3VGUA 3M1VB 4P72A 5C2CA 3CDUA 3LGHA 2LA4A 4CO3A 4X4NA 1BHNA 1F1BB 5IT4A 1S97A 1F60B 4ZLLA 1UPPA 5H9FK 1CJKA 1R8BA 1RHQB 4P52A 3LANA 1XR6A 1DTTB 1FDBA 2P9CA 5HMYA 1CEZA 1VLYA 2WBMA 4X62J 5JVHQ 1NEEA 2VFVA 6AT1B 3ENAA 1SQGA 4IDKB 3D2WA 1EHWA 3K17A 3H4BA 4KHPJ 4ECYA 1H73A 3PYFA 3CJ8A 2ALYB 3OVAA 4QYZJ 2JLEA 2MQQA 3O1LA 5KFXA 5IXUA 4L72B 5DO2A 2Z2YB 2M52A 4FYWB 2MKYA 3BPDA 3M8ZA 1E6YB 2MQNA 3BN4A 2WVFA 3HCXA 3CDAA 1NJIT 4WPAA 1SJRA 3C6TB 3PYGA 4DV3F 1UZHA 5ETRA 2DPJA 4JI3J 3CJTA 2ZHBA 4L6V3 3PR4A 5HJYA 1IBKJ 5CYQB 4HL9A 3UD4P 3AJ1A 4LIWA 1S79A 2VFRA 3MR6A 2J9CA 1UVIA 5LMNF 2IFXA 4CLZA 2XYPB 1S59A 2WB1D 2HAFA 4YEAA 2GO9A 4WU3A 4LRFA 3TANA 4IG3B 1C4CA 2WVEA 2V4JB 2VICA 4ECSA 2WW4A 3J7ZT 1B70B 1KSPA 2MQ8A 1U45A 5KG3A 3G6VA 1LWEA 5GAEI 1ZBTA 2HLUA 1XMOJ 3CD7A 4ZPAA 3OTDA 3T19A 4FP9A 3JSMB 3OJUA 4DG1A 4OHXA 4NRUA 1F2HA 3VZHA 2HMIB 1FEEA 4EFAC 2ZJQQ 4OYZA 3KK1B 2BM1A 3UCZP 4Y0FA 2CWXA 3IG1A 2HAIA 4ZVQB 1S1WB 1S9EB 4JV5F 2F3JA 1Y3JA 2CPXA 3QZ7A 3QO9A 4RW9A 1S6PA 2R9LA 3PEJA 2KU7A 5DM6Q 2MSSA 1UVMA 2JLGA 2ILZA 4UT4A 1TK0A 4HKQA 2V2QA 3MUMP 2HQIA 3BSNA 3AXKA 4B3SJ 1VQKS 2BJ9A 3HVWA 4B3RF 1PCAA 3TZWA 4OYMA 3DGPB 3DLJA 3HX9A 3K89A 4RBVA 3D5MA 2FTRA 3LTOA 5DETA 4Y65A 2AV5A 3NS7B 3RU0A 3SQGA 3ISND 4QZVB 2VPYB 1DY3A 3U1MA 2OELA 3PIOQ 2ZEJA 3RG6A 4EYHB 4TY8B 1LW0B 2J76E 1YBAA 4FPIA 3PNIA 3E2EA 2W24A 2CPHA 3J81U 3NKYA 3M6VA 3RZAA 2HQDA 3M05A 2E1MC 1S1VB 5HMWA 1KQGB 2XLKA 1MSWD 4O23A 4K2JA 2JOQA 3L3CA 2IC3B 2R7QA 2DHAA 3OXLA 3VTIA 5F8MA 1JNRB 2PD1A 3JSBA 3NCRA 4FKXA 5KFUA 1JB0C 1NK0A 3DHWC 4OHWA 1YQHA 4USJC 2PMHA 4XDCA 2DD8S 2YQ0A 1P1TA 2ADCA 5KFLA 3DLKA 4LF2A 4WKYA 2R7RA 4QWCA 3OBIA 3FSYA 2DYAA 1X31C 4OZ2A 4U96A 3KK2A 1RDRA 4K4TA 5D4LA 3QLHA 5CD4A 4CCHA 2ROPA 1U25A 5D4NA 1J5EF 3B54A 1JK9B 2ZC3A 2YQ1A 4Q8EA 1VRTA 3C14A 2OPPB 2FQQB 1NK4A 3CJ4A 1ZM2A 3EWGA 4HHUA 5MAOA 1Z4UA 3TX0A 3MOZA 1RTJA 4OZ0A 2VFTA 1BWEA 4LQ3A 2LEPA 3FSIA 3KUHA 4ZPWR 3NGKA 2MLZA 1C0TA 2B0GA 4I7FB 3ENWA 3OHAA 1N56A 3QWPA 3EPGA 4Y2IA 4BWJA 2XGPA 2KXHA 3K5PA 2RD5C 2H51B 3M8PA 5IOLA 2RILA 1RTDB 4TXSA 1H38A 3PG9A 5FD1A 2BXJA 3D6HB 3WZ0A 1UVNA 3IRXA 5ETTA 1CC8A 1YRXA 3GYNA 1ZTWA 1QD1A 2HWHA 1WHVA 2F40A 3M8WA 1NH8A 5ETSA 3CCUS 2DH8A 3RGIA 3R8YA 3QGIA 4A46A 4FDFA 3QSIA 3MM9A 1CS4B 2DIVA 5E3AA 2VBYA 4QW9A 2MGZB 4L76A 3I4PA 2SXLA 1N5VA 3KUGA 2OH2A 4MK9A 4DPXA 3NMRA 3GIJA 2DH9A 3BH7B 2Z4PA 4P7TA 3D0GE 1HW8A 1TUVA 2XULA 1H6KX 4WWSA 4XIUA 5I3UB 1Q4RA 2ZBQA 4LF7F 5A6PA 4F2RA 5F3TA 3SXLA 2R7SA 1NDCA 5C24A 1RA6A 3CCES 2OEJA 3M8RA 3KK3A 1T05A 3W66A 2V8GA 3FDSA 4PG4A 4KH1B 3MECA 4BCAA 3SDEB 3CCMS 2OMLA 2BX6A 1QE1B 3UW1A 1WOSA 1Q81T 3ZZZA 2KT5A 2UVUA 3R27A 1EETA 1S4FA 4XO0A 3MR7A 2J6SA 5KFRA 1ZM3A 3L7OA 5EDWA 3PX6A 1QLNA 2H9ZA 3EUNA 3PHTA 1HBOB 5DG9A 2BQUA 3MM5A 1N4LA 5ETOA 2EFVA 2RJZA 3TX8A 2C2DA 1NXIA 4A8XA 1X0PA 4ECZA 3IBCB 3ITHB 2MMYA 1S1XB 4OYPA 2AEMA 4K5RA 2EFQA 2B6AA 2G1HA 4TQSA 4DUTA 4MK8A 1IBLF 4MKVA 3AQOA 5HQ8A 4DU7A 3VVTA 3H4DA 4CLFA 3BREA 3IMQJ 2X1GA 1T03A 2KYZA 4RW7A 5LSLA 3GILA 4W4MA 3QAEA 1RHJB 1NH7A 4H4MB 5D15A 1UVKA 4N77A 5B09A 1IKYA 2H5EA 2MY8A 2W2OP 3UDVA 1AA1B 4ZPDA 4FKYA 2E5LJ 2YKPA 4L3NA 2JLFA 3EYZA 5C42B 2EFGA 3RAXA 4KKOB 4K5SA 1WHWA 1RT1A 1F2GA 2NUUG 1R8PA 4G1PA 2RSQA 1GXTA 2QC3A 4R8UB 2P8IA 2CDQA 2D1CA 2GGPB 3G82A 4KGZB 2LXFA 2MEWA 4LF9J 3TJ9A 1W7WA 1SKSA 1ZA2B 4C48A 4JV1A 4F3MA 1X5SA 8RUCA 5HATA 1VQNS 3KLIB 1SXLA 4IR9A 1DJ0A 3M6XA 2OPRA 1PIEA 2Q1LA 3QIPB 1SL0A 1WG5A 2IJRA 3GG1A 3EM1A 1N52B 1N5QA 2K7JA 4U8YA 4DQSA 2XZDB 3B6BA 4Q7AA 1TL7B 2W7PA 1T3OA 1PJ5A 3DFEA 5IM0A 4Y2AA 4P74A 3F0NA 4Y28C 2X51A 3HDSA 1QSSA 1FWLA 4CZCA 4IQXA 3RR8A 4B9UA 3JAMY 4F2SA 1S77D 4WP8A 4WCEQ 4OLOA 3HP6A 3QWUA 5KFPA 2HRUA 1HHSA 3WX4A 2DBBA 3PFEA 3G6XA 2DR9A 2HEKA 2YWEA 2FVRA 3JXOA 3M32B 2EBEA 3NWGA 1CJUA 4DV6J 1PJ7A 3T1YF 1R0AB 3AJ2A 4F0HA 4A47A 1RAOA 1N33J 2ZH4A 5A8WA 3JYTA 3RJMB 3VQSA 4TVAB 3ISNC 4ERDA 2QZ8A 2QO3A 1MU2A 4FYVB 2CQ4A 3BBCA 1DBDA 3KMQA 2KVIA 5A8KA 2NZ4A 3L09A 3GV7B 3R5JB 5JUMA 4QR0A 2ZWOA 2GFFA 1IKXB 4ED6A 4LQ9A 3LALA 4YY3F 1NZAA 3TVYA 1TL1A 3JTNA 4JV2A 2P9GA 4HH1A 4JYAF 3GONA 4KHMA 1SC1B 2W01A 2IM3A 1QDUB 2BR0A 1IKVB 2DO0A 3DCAA 2V68A 5CQGA 2JC0A 4C0BA 4Y2MA 4HACA 3HZGA 1EKRA 4MAKA 4DPYA 1S1UB 3MPDA 2VFSA 1JKHA 2XMUA 5DJBA 1KD1T 2DCLA 2VPXB 2YNFB 4LF5F 2YWKA 2HNZB 4QR1A 1RAGB 4DS5A 2Y8WA 3U02A 4LSZB 4DV1J 2ZM6J 3W2VA 2XI2A 5G0RA 1AFJA 2VUGA 4NLGA 3PX0A 1VR6A 2W2MP 4QIFA 4YS2A 1N5SA 3Q8PB 2BJEA 3I82A 4OV1A 2ZKTA 3KJFB 4UZBA 5HANA 3R2CJ 2UU9F 1TL3A 2ABYA 2GMJA 4J9OA 4U7UK 3QFWA 1NSPA 3G96A 3IBFB 1BWVA 5LM7E 3DHXA 4F4XA 3IRWP 1UA0A 4EBEA 1TKTA 4J7CA 2WVBA 4ECVA 3THPA 4AE5A 1HHQA 4Q0BB 1E6VB 1Y9OA 2Z57B 1Y5LB 4B08A 1OMSA 3CD6S 4FYYB 1U26A 2RRAA 2HHWA 5GMDA 2ZZMA 5HVHA 2LECA 2L9WA 3BV8A 1YJVA 2D3OR 5KFFA 2HFZA 3TJAA 4M5IA 4EK2A 1IBMJ 1WSRA 4C4WA 1XEZA 1S4EA 4MFBB 5KFDA 1K44A 2XLJA 3R7SB 4M5MA 2AJFE 4NLSA 4X66J 1RTHB 1HHTP 1LW2B 2HS3A 2YQ3A 1REVB 4PPZA 2GIQA 1HBNA 2XLIA 3VAKA 3FBEA 1TVRB 4NLQA 2I5JA 5EX0A 2HHQA 3CULA 3CMQA 1JX4A 5KG4A 4OYWA 4JP8A 1C1CB 4O4RA 2CQPA 2I0XA 5ETKA 2LCWA 4B9MA 2Y1LB 3PW7A 2KZMA 2QYGA 4YQWA 1RQ0A 5AXNA 1X5TA 2DNMA 2YX7A 5JXSA 1FJCA 4C6AA 3AHPA 1C1BB 1QAIA 2IA0A 2PC6A 4IRKA 4I6YA 1Q53A 4DL5A 4HTJA 2NXNA 4K4ZA 5DGBA 3FC9A 2OFHX 2QA4G 3Q8RB 5LOQA 5D0GA 3MAAA 3SCIE 3MR5A 1FE0A 2UUBF 1J5EJ 1V5IB 2EPIA 4JOUA 3KJVB 3FRYA 1PKUA 4PEOA 4QWBA 1RT3A 3EICA 3V6JA 1U1QA 1WACA 4CTAA 2AX0A 2CPFA 3A3OB 2COLA 1EP4A 1UJ4A 2RQ4A 4NOHA 2QFIA 3GIKA 3MMBA 2X7IA 3MMAB 2LEBA 4FYDA 2FC9A 3TQEA 4M95A 3RW7A 4ELTA 4LRAA 3DLHA 1XMBA 4OI6A 2B56A 1REGX 4F4ZA 1R8CA 2AEFA 2K7KA 3MPYA 2KG1A 5SZTA 3MEGB 4X4TA 2MDAA 4C8LA 5J2MB 4DF8A 2GO8A 3W8PA 2O01C 1LWCA 4X2BA 2HVZA 4WIQA 1WHYA 1FHTA 1WNEA 3D54A 4DR1F 2FGCA 3DOLB 2XWYA 2N3OA 3PZPA 2EVZA 2GMLA 4YOEA 1UWBA 1MROA 1YZ7A 1KTVA 2LU2A 1H0HB 4F4WA 1Z1ZA 5BYSA 2A1BA 1FERA 3DDNA 1H3DA 4O3SA 3TWZA 4TU7A 1KP6A 2HZAA 5F9NA 5GADU 1G1XA 3DRSB 3V6HA 4LRDA 2DR7A 4U67Q 4LF7J 2PFDA 2WSEC 4LFCJ 2L3MA 2OEKA 2BRKA 1WG1A 3N6MA 4G3IA 2P6TA 1RT2A 1Q8LA 3J7Z5 2N7CA 2V34A 3PEHA 3H5YA 3KLEA 1UJ6A 1G3OA 4O3QA 5IFMA 3PHEA 5A8RA 2B5JB 1XR7A 2UUAF 2KT2A 1JIHA 4AFFA 5LL6d 3HD1A 2E7WA 4RW4A 4MT1A 2W9BA 3V81A 1B0TA 5HP1A 4NZ6A 3T5JA 2G9OA 1YJ9S 1XERA 3J7YU 1RWKB 2ZD1B 1M1GA 1VBKA 5EUHA 1JLBB 1D3WA 4OZJA 4BDPA 1SC3B 1B3TA 3BGRB 2WVCA 3A1YG 4P2SA 2X1FA 3HVTB 2H54B 3ENVA 3LP1B 4M5GA 1B7FA 3Q8QB 1IBLJ 4J9QA 3MEEB 2E9TA 1MNEA 5L8RC 4KQZA 2ZH3A 1OPZA 3OXFA 3ADAC 2CPYA 5F8GA 2VFUA 3NOGA 2BJ7A 3NCPA 4YP3A 4IFVB 1G6BA 5IV3A 3F73A 2DGVA 4OI4A 1OYEA 5KG7A 4DF4A 2JNJA 1KC8T 2NUHA 2RF2B 5AXLA 2XZTB 4LSLB 5HLFB 1XIQA 1FNXH 2GQCA 5T14A 2UXBF 2KN4A 1DQAA 1SQEA 2RRBA 4M5DB 4A8QA 3GP9A 2W9CB 3OJSA 1NM2A 3PJWA 1Y0HA 4L3KA 4OZ1A 5AT1B 9ATCB 2R2UA 2CJKA 1VJQA 3G6YA 1HYSA 1TKXA 3RTVA 4MIBA 4F36A 5KFJA 4C3LA 3V2UC 4EYIB 2BE7D 2YX1A 2RHSB 3M4XA 3QPIA 2ZNZA 1SBRA 1CPZA 1HBMB 2AIRB 4Q44A 1LK5A 1X7VA 4JI6F 2LDYA 1RU1A 1SI9A 3FNNA 4DR5F 2RB7A 3SYZA 2DO4A 4NL5A 2XGQA 3UN2A 3CJRA 2XEXA 3C15B 5IWAF 4X65J 3VCDA 2G0JA 4YHHF 3M8SA 2F8HA 2GS8A 4DV5J 3CXCR 2CPIA 4ZJQA 2OD4A 1BQMB 2MYFA 3ENQA 1IBCB 1S7IA 4H4KC 2W4PA 3BB5A 1L3SA 1SIZA 2CQIA 3NL0A 1YJRA 2MJNA 4C8MA 4DR4F 2W2QP 3OFEA 4MIWA 2MQLA 3T1YJ 4ZIVA 2I8EA 2JJ4D 3DRPB 2ZH8A 1RTIB 5B0GA 1VDHA 5A0YA 2LQ8A 2XB2D 1KHWA 4DFMA 5EN1A 1PBUA 2WOMB 1SC4B 1NLKL 3DOMB 4LFAJ 1NJXA 4OV6A 2LFVA 1LFWA 4NMLA 1PBAA 3LPYA 2G2ZA 1Q7YT 2KRRA 1SUQB 3J80Y 1FK9A 3PV8A 3ILIA 4ZK7M 2ZE2A 3FFIA 2DEIA 2QLBB 5M2UA 2FLPA 2DHXA 5IT9U 2YH1A 2HZVA 4JYAJ 1OYDA 1DLOA 4DSEA 1GXLA 3MMJA 3LGNA 1IJFB 1TFYA 2FC8A 2ZOFA 3FBCA 5CHCB 2DNNA 3KTQA 3GMGA 4NASA 5B0CA 5GAGU 4H4OA 2DHHA 3D1QA 4KC5A 4YB1P 4DUZF 4J9PA 3B78A 5KT2A 3NOCA 3A12A 1R0CB 5KFSA 4OLPA 1FCAA 1FWKA 1RWPB 4IO9Q 2IDEA 5FDLA 4LRBA 3DC2A 2OHDA 3EVOA 3UFCX 4N47A 1T02A 3IR5B 4KGMA 2CKWA 2CQGA 3J81j 1IKWA 4DR2F 2WSCC 4F50A 5J2NB 2ACYA 2AEJA 1JLGA 5BR8J 3KFWX 2Q3PA 3MM6B 3FEXB 1X4EA 2HBZB 2JWNA 2OIHA 4URSA 1PYSB 1YJ7A 2IJFA 2UUCF 3E51A 3CCJS 2WW8A 1VQ8S 4GKJJ 3NP5A 5L1KA 3R5AA 2C3PA 1ZS6A 3N5FA 2N4CA 3GR1A 4GMKA 4DFKA 4K7QA 4Q43A 4AL5A 4FBTA 2VC1A 1HNZF 1SKRA 5IQ6A 4FS1A 3I0RA 1R43A 3Q22A 2HBQB 1Y00A 4OZ3A 4TU9A 3TEHB 1URNA 5K5MA 4O3RA 4ID5A 2PDAA 4DSFA 1F3FA 4DV0F 1RT4A 5HJXA 1Y3KA 4ES1A 4G1IA 4J91A 5GVQA 1RB0A 1RLDA 3K0JA 3I0SA 2PSZA 2FJAB 5AE3A 4OMFG 4J9NA 4HT7A 3LQVA 1UZDA 3M2UB 3POTA 3KG1A 4O3PA 4CLWA 5J2QA 2F65A 3SIPB 2UUTA 1AYEA 3B82A 1CVJA 4XAKA 4ANCA 1FDNA 1RAFB 2Q6CA 2JHEA 2IBKA 1NPPA 3RBEA 2JVOA 3SFUA 1HNWF 4QJVA 4DL2A 4OX9J 3FRZA 3QBCA 4WXOA 3R6LB 4WTYA 2YNHB 5GAHI 4PKDB 1S48A 5D3GA 3MD1A 5CD4H 4ED4A 4NLTA 1AZSB 2ASLA 3GLJA 2HNDB 4NZ7A 1YG0A 5F8IA 2YNIB 1PYTA 2MKHA 3LAKA 1FRXA 4PR6A 1FX4A 2CJXB 3MMCA 2I38A 4RNMA 5KTQA 2KXFA 2PO4A 2BYCA 1PAUB 2ZHOA 4V1Ak 3Q24A 3QGGA 1FXDA 3TAQA 4KV8B 2E1CA 1D8ZA 1YTYA 4ILRA 2BABA 4KR0B 2YKMB 3TA0A 4B3TJ 3QT5A 1QSLA 4GO7X 4MKYA 3T5KA 2QJ3A 1TV6B 5HK4A 3CC4S 3OUYA 3JB9k 4KPYA 4DR7J 2DIUA 5E7OB 4DR1J 4RU9A 4HR2A 4JI7J 5MLCV 2R4FA 3G2XA 1SPBP 4QPXA 4JI0J 3Q83A 4M5JA 1GT8A 3N0VA 1TU0B 4WYWA 3UD3P 4ECWA 1FRIA 3HPOA 4LT6A 4U6PA 1PO6A 5LSOA 3HT0A 1RHMB 4KAIA 1RTZA 1BLUA 1YDLA 2FVQA 5KFHA 5SUHA 2H65B 1S1TA 2IJNA 2HVHA 2Y8YA 1K0TA 1VRUB 1I5OB 3ETMA 4LF8F 1FT8A 1C0UA 1GEHA 5I3QA 1F0XA 3W5YA 1O51A 1OY9A 1P8GA 4NCGB 3AA9A 4KPCA 4LREA 5K8MA 2AZ3A 2UUAJ 2DNRA 1ZYQA 3EVWA 2BVZA 1ZH5A 4G6VB 4OX7A 1ICEB 2XWXA 1Q8BA 2Q6BA 3KXDA 3VGTA 1OQ3A 2GAHC 3GSIA 2Z2MA 2HNYB 2XHWA 2AHOB 4DPOA 1RWXB 3PM9A 2BE9B 4LR7A 3HHDA 1OWXA 3DLGA 4GO5X 4DCOB 2BOPA 1LV5A 1U7LA 4UUWA 2VBZA 1PSDA 5L1LA 4X64F 5E3QA 3H2LA 3W5XA 3FCVA 1UEVA 3V6DB 1FD8A 3QQCD 3RRHA 1RLCL 1RT5B 1RE1B 1FXLA 4DPTA 4CIOA 1QSYA 1S99A 3OTEA 1S0NA 4K4YA 3KLFB 2KJWA 1G4CA 1WEZA 2MPUA 2CZ9A 4I2PB 4YFUA 3OFGA 4NLUA 3EVMA 1S9GA 4KT0C 1T9UA 3HSJA 5K8OA 2BW7A 1WC3A 4O44B 5ETNA 2V8PA 3CC7S 1RAEB 4OFZA 1K1QA 1UFLA 2AJ2A 3HKZD 2V4QA 2XY5A 3PW2A 1S6QA 3UVJA 5L39A 3PACA 3LW5C 4PWDB 2UXBJ 3WQPA 4LF4J 3LGMA 4JI8F 4AQYJ 1DARA 2YX4A 2XMMA 4JI2J 3H0PA 3UO0A 1FA0A 3KHGA 3M7VA 4J9SA 4KFBA 1KFDA 3W61A 1CJKB 3R1LA 4O3OA 3LF0A 2AGOA 2R8GA 4EZ6A 2MKJA 2VQFJ 2KJVA 2HHPA 4X62F 1T7PA 4AXIA 4DQRA 3CTRA 1CLFA 4DU8A 4CO1A 2ZBRA 4KHPF 4JI6J 2EWHA 4DN9A 2YY3A 1PAEX 1VQ5S 4DR5J 1DFDA 3VAMA 5B0EA 2GJIA 3WC0A 3RW6A 1WKKA 2FHOB 1OY8A 4BHQA 1I51B 2Y1JA 2POKA 1GMWA 1HD0A 2KYXA 1FKOA 3PCOB 5KFBA 3BF4A 4FZVA 2E9RX 3R5DA 4JI3F 4C11A 2GCFA 3HO1A 1CQNA 1IBKF 3SCKE 1FNOA 2GQ2A 3BR9A 3OTOF 2M3DA 1YGYA 2Q79A 4DR4J 2IRUA 2KB2A 4DQPA 3HHLD 4AL6A 4KB7A 5AE1A 1RKJA 2MKSA 5LJ5Y 3KWMA 2V2KA 5H9EJ 1X60A 3KKFA 2FGOA 4DV7F 2AW0A 1WC0A 1LWEB 2BBEA 2BW2A 3UN3A 3I55S 4J9KA 3KJQB 1TK5A 4U7CA 2X1AA 4CO2A 5HMZA 4DG1B 2NXEA 4BC7A 4CLYA 1C4AA 1LOUA 2MSTA 4KGXB 3MM7A 2E5HA 2OPQA 3IG1B 1R8AA 3ILJA 2GQQA 1YLXA 5EX3A 3NY0A 3QO9B 4RW9B 1S6PB 3QT6A 1FRKA 1Q8IA 3WIVA 3A13A 3BBBA 5L9XA 1JLCA 2HBRB 3DI6A 3V4IA 1XTZA 1FI4A 4RW6A 1TELA 4ELVA 4B3SF 2LDIA 5C7PA 3NBPA 1VC0A 1R0BG 2AGQA 4FF4A 4U8VA 2VPZB 5IC4B 1JJ2R 2H4YB 4IQMA 1NNDA 4P75A 3AODA 3SQGB 3LP2A 1G7CB 1ZM9A 5DS7A 3A8JA 1MLAA 4E2FB 4LF6F 1YZ6A 3PXGa 4RUHA 1IR1A 1T9WA 1JMTA 4CNZA 4WZQA 1KKHA 1YKWA 1Q16B 3O44A 1NBEB 2PFFB 1HNXJ 2ASYA 4I1TA 4ZOSA 5D78A 2FZGB 1NK5A 3A8IA 3CSKA 4CP5A 4K4UA 5IS2A 3OVSA 1UA1A 4ES3A 3W2WA 1KWMA 1RSCA 1N32J 4USIA 4TLRA 4K59A 1B0VA 5HMXA 4NZ0A 1BQXA 4UQGA 3F56A 1VHIA 3UE2A 5B08A 4CWBA 1KVJA 1F9FA 3SQOP 4X4PA 5T7LA 5GAEU 3O8WA 1RYRA 4DCPB 4C2MA 4HT5A 1Y7PA 1FJ7A 3F41A 5F8HA 1IR0A 1NPRA 5ETMA 3CCQS 3TJ8A 3DLKB 2HKEA 4IRDA 4CLSA 2V63A 1S5ZA 4R0JA 3KK2B 1NDPA 5CCMA 1H7WA 3QLHB 4OYXA 3HSGA 3PVXA 2E44A 3FSXA 2KZZA 2DGSA 4C3MA 1UKUA 1VRTB 2CQBA 3NEKA 1HIYA 2DGXA 1GNKA 4Q2MA 3TZZA 1GMVA 1U1KA 4RX6A 1FKAF 1TL5A 1RTJB 3H5UA 4ZHRA 4FVMA 4H4KA 3GV5B 5KG1A 2QA1A 1C0TB 1TP7A 2IM0A 3UR0A 1WEYA 1BGXT 1T9TA 3UDLA 2OKQA 3Q8VA 3UCUP 1D8YA 4PRFA 2BV3A 1B7YB 3M8PB 1N0VC 2YWGA 1HWLA 3LWLA 3GR0A 1HNWJ 3HXMA 3N28A 3IRXB 1WF2A 2ZZTA 2GAGC 3MM9B 1XMQJ 3I87A 2A3JA 5T41A 4C8YA 5DZ6A 3LP0A 2QL7B 2FLNA 1PILA 3FUYA 4DSKA 1SV5A 4XPEA 2FYXA 1GTEA 4P2XA 1OIAA 2HZCA 1PC5A 2RMLA 1HFEL 2DHGA 3FK4A 4EZ9A 3CVKA 1VQOS 3D68A 5KT6A 4NA1A 2VH7A 1UW4A 3W8GA 3CIMA 1A9NB 2XG8A 3T41A 5HAOA 2HURA 4CQ1A 5HQMA 2MQOA 1HMVA 1DTQA 3TA2A 3ET6B 2H5IB 4C8NA 2ZZNA 2DGTA 4J9LA 1N6QA 1SIWB 3DDIA 2GNKA 2GMHA 5C24B 4RBUA 3U1NA 2HVIA 3KK3B 1T05B 1FRMA 4F04B 2FUG9 1JLEA 3MECB 2GV1A 5KAKA 3OLBA 3GFHA 4YDXA 1L3VA 2HFVA 2VG6A 2RHQB 1CJTA 4NCAA 1EETB 1NRKA 1L5UA 3PR5B 1UVJA 2ATLA 4ICLA 1MW7A 1YI2S 3JAMU 2HIQA 4PUOA 1H98A 4ZDNA 3MM5B 1I3OB 5CABA 4OYOA 4R5PA 2C2RA 3VGVA 5KFCA 3NWRA 3D6TB 3IWLA 2LQBA 3BSCA 4XDDA 2W7OA 1TQLA 2FHKA 2HGNA 2B6AB 4GVBA 4YMEA 1S57A 4X4VA 5DM7Q 1ZA1B 3CWJA 4Y3CA 2ZDOA 4CO5A 1KHVA 2ZH1A 1NJYA 4KSEB 3EXCX 1T03B 1YJUA 1YJTA 1ZZFA 4RW7B 1DZ5A 1U8WA 2BJ3A 1DRZA 2GC8A 1IKYB 1QAJA 1KQSR 5F3ZA 2E5LF 1W2IA 2UXCJ 3K2YA 1RCOB 5C25A 2P2CB 1RT1B 1QM9A 2QA2A 2JEGA 2FHJA 1LKZA 2OPSA 4UTGA 4WTOB 3W65A 3MUVP 3G82B 1U02A 2XNRA 2W8LA 1Y4ZB 1RBOB 2NLWA 3C2PA 4LF9F 4P10A 1UAWA 3NGUA 1WKLA 4X64J 1OQ6A 2ZUGA 1NUEA 2ALZA 2OPRB 1O8BA 3LO3A 2L41A 5K14A 3RUBL 1GTHA 3QGPA 3VGSA 2D3O1 2J6TA 2AWZA 5DZ7A 3TYTA 2B7BB 4WFYA 5IM0B 3I9ZA 3PRDA 5KOXA 4EUVA 3BSAA 4OZNA 2R7OA 3GZ7A 2PT0A 1Q78A 3C19A 1NJWA 2ZC4A 1MMDA 2EG2A 2DNZA 3CCSS 2G0IA 2V5HG 3AXMA 4JI8J 4N8NA 2XYGB 2RU9A 1UEKA 1CJUB 4OI3A 4DV6F 4YB7A 4RR5A 2C22A 3OTCA 5A8WB 1N33F 5L9NA 2B43A 3ZTQA 3CJ2A 4LBHA 3US5A 3NRBA 2R2RA 4IYQA 1MU2B 3ZTSA 5CZVA 2BOAA 2BANA 3AAWB 3VF0B 2HPUA 1Q79A 5A8KB 3W62A 2LQ9A 3PFOA 5KG0A 3W1YC 2IHR1 3M8YA 1X0FA 3SV3A 4KTQA 3ISZA 2UVVA 3CCWA 1UWAA 4FS2A 3FGVA 3AOBA 2NR0A 1TL1B 1FXRA 5KFAA 2BE2A 3DOKB 3BO3A 2QLWA 3Q8UA 2Z8QA 4FF1A 1SL2A 3TR5A 1QUVA 5JJBA 3OTOJ 3CJ5A 2OP5A 4QWEA 2WB4A 2J9DE 4HACB 2VC0A 5B0BA 3BGUA 2FVPA 3ZTRA 2CA9A 1U1MA 2R7VA 1JKHB 3P49B 2CQ1A 3RRKA 1HARA 3BEGB 4C98A 3KNAA 4JBCA 1XC9A 4DV7J 3Q23A 1YBTA 4JB8B 4NWBA 4J9MA 4B3OA 4F7VA 1VYAA 1PGZA 2A2CA 4EBDA 2QYCA 3W2VB 1IWAA 4DV1F 2ZM6F 3UI3A 5HVGA 3BS9A 2GX8A 5G0RB 3OR1A 2VZ9A 3S8SA 2KI2A 3PW4A 1X4GA 2J5AA 1UVLA 3R7BB 1D9AA 4F3OA 4ZCIA 2LQ5A 2VODA 4Q2LA 2QMWA 1O6XA 1YX2A 1TL3B 2XS7A 3MM8A 1ZTTA 3ZZPA 3DRRA 2APOA 2MQMA 2VDIA 2KKHA 3H98A 4J9RA 1TKTB 4PQUA 2K1RA 4I6WA 5ITHA 1GMUA 2DNYA 2NXCA 3R5GA 4A8MP 4EMDA 1RAJA 2M8DB 3E01A 1T9XA 2W25A 4OZ5A 5L46A 2HGMA 2IY5B 4KGKA 1CQMA 1FVQA 4TN2A 4LF6J 4KJIA 2H1YA 2XQCA 1NHVA 4M1KA 6FD1A 2XZWA 1IBMF 4RNOA 2E66A 2E7VA 2HQGA 2JFKA 2DRDA 3FQLA 4B9VA 4X66F 1HQEA 1EJ7L 4RL1A 4Z7CA 3D6FB 4DV2F 1HBNB 3DM2A 4TKTA 4ED3A 2I5JB 2IYIA 1LK7A 3EGWB 1RI7A 1GX6A 4QWDA 2DJWA 4OI2A 5HN0A 3D7SB 3D9BA 4DUYJ 1EQMA 2JC1A 3TEGA 4CO0A 5EHHA 1NZ8A 3V5RA 3R5BA 1FFWB 4DBQA 3BM7A 1VBXA 2VIHA 4HTIA 3G6ES 4C3KA 1Z2ZA 1KVIA 3D1OA 2J9EA 3HHNB 4MTPA 3CDEA 1UTAA 3G87A 3MAAB 1C2PA 3VQTA 2ASDA 4LVOP 4PYDA 2EEYA 3NLCA 2YPYA 2MKCA 4K4VA 3CJ3A 2VD3A 2FD2A 1RT3B 1ZPVA 1NK8A 2QLXA 4Y6IA 2UXDJ 3JSRA 4WFXA 4CTAB 2CWKA 2XMWA 3K8VA 1EP4B 4PXBA 4WK1A 3MMBB 5HROA 3H40A 4F8RA 2OI2A 2RDIA 5A76A 4DLGA 4CLTA 4WXWA 3DU6A 3MI7X 4C8KA 2KG0A 2K2PA 5F0WA 5A2QY 1KS2A 1Y5IB 2MZJA 4K0KF 4HH0A 4DSIA 2CRLA 2QTWA 3OXGA 3FBFA 1LWCB 4O3NA 5K20B 1F9EB 1R7IA
chains in the Genus database with same CATH topology
3T5LA 1VK3A 2UZAA 1VRUA 4FNHA 1DLOA 2ZH5A 1I94F 3THVA 2UUWA 1H7XA 3MUTP 2CJAA 3VALA 4BC9A 1GXLA 4DSEA 3MMJA 3LGNA 1IJFB 1TFYA 5E33A 4C0HA 2FC8A 3CCTA 5DDQC 2G1DA 5C5JA 1YSJA 2ZOFA 1XK8A 2LYVA 5CHCB 3KHLA 2DNNA 4DHVA 1XR5A 3KTQA 1S1VA 2F7VA 3GMGA 4G3IA 1TKDA 5B0CA 5I3PA 5GAGU 1UWBB 4H4OA 3DLEA 4NCGA 3UDCA 3D1QA 4K4XA 5FIIA 1MROB 2DNKA 1HWKA 2DGOA 4KC5A 4YB1P 4J9PA 4X4OA 3X3UA 4O4GA 3B78A 3LH2S 4DUZF 7FDRA 3CUNA 2J7UA 5KT2A 1JLAB 2B9WA 4RUAA 4MYUA 3HFKA 1HD1A 2BANB 1S6OA 4MMOA 1VBZA 1IN0A 3DRXA 5KFSA 4OLPA 4WFZA 1FCAA 2CG4A 3H8YA 2MKIA 1S0OA 2IC3A 4B9SA 4DQQA 3E8OA 2MKKA 4IO9Q 4B9TA 5FDLA 4HYKA 4IG0A 2HFOA 4DJBA 1KQKA 3MWBA 3LAMA 2HNYA 1S49A 2EK1A 3DC2A 3HHLC 4ED1A 4LUBA 4Z2XA 1J2VA 2DRBA 2OSQA 1FDAA 3HZEA 3UFCX 2M2BA 4N47A 3UQSA 2B4UA 3TAPA 1T02A 3BZQA 2GHWA 3IR5B 4KGMA 2P9EA 2J6UA 2CKWA 2CQGA 2GHVC 3D0IE 1IKWA 2ZDPA 5DRKA 2BE2B 4I2QB 4UW2A 4V19J 4DR2F 1WWHA 2OSRA 2W4DA 2KM8B 2WSCC 3V6DA 3CEDA 3BO4A 4F50A 1NKEA 5J2NB 4AL7A 4F26A 5J1EA 4LFCF 4ZA1A 2ACYA 4FXVA 1KLMA 1RT2B 1RT5A 5F8LA 1JLGA 2DNPA 2XC9A 3KFWX 4F02A 2Q3PA 1FE4A 3MM6B 2IRYA 3DLBA 1HI0P 3FEXB 2DH7A 1AUDA 3OLAA 1X4EA 3KLEB 4X4UA 1F5CA 3NAHA 1KFSA 2OPPA 4RW8A 5A8RB 1VQ9S 2JWNA 2OIHA 2EG1A 1TZ0A 3CIZA 4WK3A 3KLFA 3PKMA 4FF2A 4URSA 2PMZD 3JTPA 1U6FA 3M6UA 4I2PA 4DSJA 5L38A 2VKRA 3G8QA 4DX8H 2YWFA 3T6JA 2QSWA 2IJFA 5I42A 1HL6A 4RW4B 3E51A 3W7BA 2W9BB 3CCJS 2BQRA 2UUCF 4UOCA 3V81B 4KHRA 2WW8A 3B4DA 1N34F 1OPIA 1YWXA 1IM4A 5HP1B 2EC0A 1VQ8S 3CE8A 3I9V9 4O44A 2V9WA 2D74B 3CB4A 3BGFA 3NP5A 3GIIA 3GFZA 3O3LA 4B3OB 3EX7B 3IA0A 4I56A 4ID8A 5L1KA 3R5AA 2KHCA 4TQRA 5DLFA 3EGNA 4I7FA 1X9SA 2C3PA 3N5FA 4H54A 5DDOC 1KTQA 2N4CA 3MR3A 1D9FA 4DEZA 3GR1A 4PG6A 2CPZA 4URGA 4GMKA 2CJ9A 5HBMB 1V3ZA 4DFKA 4PWDA 4AYBD 4OHVA 3BSOA 4Q43A 2ZJPQ 3PW0A 4AL5A 2GHPA 4FBTA 2RKIA 1FRLA 1GH8A 2VC1A 1HNZF 1SKRA 5IQ6A