4LSTH

Crystal structure of broadly and potently neutralizing antibody vrc01 in complex with hiv-1 clade c strain zm176.66 gp120
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
224
structure length
222
Chain Sequence
b'QVQLVQSGGQMKKPGESMRISCRASGYEFIDCTLNWIRLAPGKRPEWMGWLKPRGGAVNYARPLQGRVTMTRDVYSDTAFLELRSLTVDDTAVYFCTRGKNCDYNWDFEHWGRGTPVIVSSPSTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN GP120 of HIV-1 clade C
publication title Multidonor Analysis Reveals Structural Elements, Genetic Determinants, and Maturation Pathway for HIV-1 Neutralization by VRC01-Class Antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 36
structure length 222
sequence length 224
ec nomenclature
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lstH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lstH01
3IYLW 1NAMH 1J87A 1EZVY 3T0WA 4Z8FL 5AD0A 1EHNA 2XTJD 3QA3A 2H26A 1MFEL 3W0WD 2HVJB 1BZ7B 3NIFF 3R4DA 3G5ZB 1MHPH 3LH2L 3VFVB 3TT3L 2ITCA 5TQ0L 1MNUL 3F7YA 3MGOB 4XPHL 4X4ME 3ILQC 4JDVB 3FO1A 3QNXA 5C9KA 4YWGH 3RVVC 5B3JF 1SJEB 1A7RH 1UG9A 2GT9A 2J5LB 2ESVD 4U1SA 3VFGH 4D9RE 5EBLA 3ZKSD 3BGFB 4L3CB 1Q9OA 1NSNH 4HCRL 3VD7A 4OQ1A 4KPHL 1T0PB 4K8RD 3SBWC 3PWPA 4DKEL 4ZO8A 5LBSH 1X7QA 3DX7B 4TQEH 5MENE 2FR4A 5I8EB 3FO2B 4XWGH 2FO4B 5DMYA 1TJHL 3FB8B 4YHLL 4PS4H 1Z6JT 3NFSH 2VLME 1OGTA 5EWIH 5JXAL 4V1DD 4YAQB 1FDLH 5D1XB 5EG6C 3LQZB 2JELH 3QDJA 5GJTL 1KCRH 4O2CA 4ZUTA 1YY8B 3BO8B 1YEHL 5EOQH 3LKSA 3BH8B 3QCUH 5E8PA 4M4RA 3ARUA 4RBPH 4HUNB 4HKZA 4OD3L 4XBPA 3PJSB 1L7IH 3VW3L 3VFNA 3ARXA 3H9YA 4KROB 2OM5A 4KHTH 2YUZA 1G7LA 3BWUC 1CCZA 3QZWG 4LU5L 1G9EA 3RIFF 3BT2H 2JJSA 1HILA 2I60L 4A6YH 2RAMA 2JCCA 2VIRB 1AQKL 5J3HC 2PXYD 4NO2A 1HYSD 4NZUL 3OR6B 1HHIA 5BOPA 3QDMA 1A1MB 2VAJA 4MD0B 3G04A 5DHVH 5E2JA 3S3JA 2Q1EA 2V5TA 3UTQA 3ZKNC 4EDXB 3HPLB 3MRKB 1EAPA 1RUMH 3DMMD 3PQYD 5BW7C 5BRZD 4BFIB 3OTTA 5SWQB 4UV4L 3TGXA 1S9VA 3QDGB 5D6DA 5EC2A 3VH8B 5MEOB 4TPRL 3RUGB 4NZJA 4HWNA 2DBJA 4JREB 3HI1A 4HG4K 5CJXA 4RFOL 3MRBB 1GVIA 4G3YH 4HAFA 1YECL 4CAGA 4MNGB 4NRZA 4GAGL 2YC1A 3FAXA 5ALBL 5F1OB 2WQ8A 2FH6A 2Z31A 5J6HA 3QUXA 4G6AD 3C6SA 1WC7B 4F57H 2AV1B 2NMSA 4QHKJ 4WWKA 1QFWM 5SX4H 1FNAA 1U58A 3QNZB 1Q8MA 5C0CA 2WWKO 4UQ3B 4K71B 5HI5C 4WJ5B 5EZIH 3BWAA 1KULA 4CMHC 4PB0L 4X6CA 3IDUA 4Z76B 1KEGH 1A3QA 1D5IL 1KCUH 2CLRB 3CH1A 1NMBH 2L4OA 1VGKA 3QJFB 2W9DL 1H15B 5HGAA 1RZ8A 2V2TB 3EYOA 3DURA 2AK1L 3OHXB 4JN2A 4CJ1A 3SKOB 5I18L 2GTWB 5DC9B 1IM3A 4JN1H 4P23A 1U91A 3FB5B 4G8IA 2LU7A 4G6ML 3LPGA 1BQHA 4Q6IB 5CS7A 1EFXB 4Y16C 4PJ5E 2F54D 5ERWA 2BSED 3TBVB 5HHQB 1FL3B 3KPNB 4XXDB 3BP7B 2J8UB 5ISZB 3MLWH 4GRLC 2D3VA 5I16B 3C5ZA 3QUZD 4HMDA 4FQLL 1NUFA 4Y4FB 4N0UA 3TPUB 3OKKA 2GJ6E 1F4WL 4LGRB 4TOYL 3TBTA 5D72H 1JV5A 3GI8H 1TENA 3DO7B 4DW2H 4RA0C 1FZOA 3UJJL 3SO3B 1MLBB 4QCIB 3RBGA 4AEHH 3GSRB 5IB5A 1AR1C 2EDNA 3O4LD 4XMKL 2D7PA 1JFQL 3IRZA 5KVGL 5CILH 5LJYH 1DEEB 3BH9A 3L6FA 3EO1B 3CFKA 4WUUB 2VERN 5F96H 2I9TA 1AGFB 1SMAA 4UINL 5ABDE 1ZMYA 2NX5D 4JFYB 3JSSA 2VDLL 3ZE1E 3LV3B 5F89A 1R3KA 2G9HA 2K1MA 1U92B 5C92A 1KCVL 2X9XA 1UQSB 2BFVH 3MUGB 4A2MA 4RFEA 5FHBH 1PFCA 1ORSB 4OD2B 5D1QC 4JHWL 1MAKA 5IWLC 3HI6H 3LEXB 4D8PB 1NUDA 4KKAD 3KGRA 4HC1L 4LCCB 4RWYH 3VXMB 2DI9A 2D4FA 3MRNA 1CFTB 2IANA 1Z0MA 4JY6B 1IGTB 5T3ZE 4ENED 3CFEB 5D1XC 4BELD 4LGSB 5B38G 3KPMB 5C07D 1FIGL 4ALAL 3G6JF 4JFEA 2DTMH 1XH3A 3H9SA 3O2VH 4E0RB 1YYLL 5HVHC 2CIIB 5DMGC 1QKZH 4OCLC 4QLRA 1RHHB 3QPQD 4LP4A 2AABL 1D6VH 3HE7D 1J1XL 4RGMC 5IVXE 1LO0L 3ARVA 3SOBL 3RKPA 4G7YL 3ARDA 5FB8A 3OF6D 5L88L 1GGBH 3DARA 1FZKB 2P5EE 2UVEA 2B0SH 4P4KC 5DEFA 1AGDA 4YZFE 1P4BL 4OM1H 4PJGB 3SDAA 5DUBA 3OXRA 2Y36L 3UCRA 35C8H 3NFNB 2X2YA 4XC1H 1HK6A 2XQYG 3U7WL 4OGZA 1J8HA 2GY5A 2H3NA 3IDJA 1KJ3H 4D0DA 4ZPVA 2PTVA 4DAGH 3KDMA 4RMSA 4I1NB 3SGDI 2Q8BH 4YIQB 1JNHB 1S3KL 1WZMA 1RU9H 2H32H 3EO9L 3H3KA 3QIUB 4IS6A 4NYLA 5I1EH 4L29B 1IQWH 1YZZA 4YE4H 3T0VA 1QLFB 5F9DC 2P8PB 4FQHB 4PY7B 4YNYA 4NQSB 1T03H 2RJMA 5DJAB 3QP3A 5GXBB 3VMOA 4HJJL 2YPLB 2HLFD 4EN3B 1F97A 5TQ2L 3IAQA 4I3RL 4K71C 4XX1E 1GZPA 3T4AB 5IB2A 1UC6A 4EOWH 1V7NH 3F7VB 2G75A 1JZ3A 4XBGA 1JPSL 5SX5K 5DK2A 2X1WL 1IKNC 2LE9A 3LD8B 1GAFL 1VFAB 5GGSB 3WCYA 3QCVH 4LLDA 1IGJA 3EYSH 4MB5A 4BUGA 2A6JA 3IU3B 1CICB 5BZWA 5I8KL 2OL3L 2Y25A 5D7JA 1Y18B 4PJXA 3DLQR 4MJ6B 4PJBA 4U6VH 2GJZB 1KB5H 3O2WH 5DTFB 1U2CA 4HIIB 3IB4A 5C6TL 3OZ9H 4KV5E 5JIPA 4N90E 4NC0B 3ROLB 4YEFA 1OSPH 5L8KB 3UAJC 4Q6IC 3TCXA 4NRXB 2JB5H 2VDRL 4CBPA 3KPSD 1A14L 3ARYA 3WSQH 5AWNH 2MTPA 4LVHC 4LARH 3ZYIA 5M7QA 2QQNH 5LWYL 2GHWB 4LCIL 1BFTA 1RI8A 2P5WE 5D2NC 5B8CB 2BSRB 1BP3B 2CJUH 4PJ8C 1T3FA 1RZIA 1JUFB 4K9EC 4WU7B 4YX2L 4OCNC 2ZCHH 4X99A 1OTUD 4HGMA 4R97B 2RFXA 3WFDL 4ZFOB 3VGAB 2BSSB 4GKZA 5E24E 4YHML 2VTFA 2BNRB 5EBMB 2CRMA 1X6LA 4YO0A 4XNXL 3V6FA 4KKCC 4RGOH 2AW2A 2IGFL 4LLVB 4LLWB 3RBSA 2GAZB 4F7EB 5DQDL 5T1LD 5C2BL 4UT6H 1S78C 3VMPA 1XF3A 1HNGA 1MCEA 1OLZA 3RVUC 1E4KA 2H2PD 2VITB 4OZIE 2NTFB 2P8MA 3GKWL 4HAGA 1A6TA 3P0VL 1UYWL 3IRPX 1G7HB 1Z3GL 2ZJSL 5KSUA 4J3UA 1WCBB 1I9JL 3WKMH 3T0DA 2LAGB 1EMTH 4R0LA 3ULVC 4NP4L 3SQOL 3O6FD 3P9WB 4NUGH 4YH6A 5EUOA 1JK8B 1D5MB 4I0PB 1ES0A 3UO1H 3WNNA 4NNYB 5FUZL 4UILL 5CJ5A 4KTYA 1G7MB 43CAA 5HYSG 1INQB 5L0QB 4Y1AD 1JGUL 1A1NB 1ZEAH 4XPBH 4MWFB 1UA6L 1FV1B 4J3XA 5I75B 1BBJB 3N50A 5GSRA 3ARGA 3MQIA 5AD0B 2H26B 4XP4L 2D03L 4KK8D 1U8JB 1VERA 4AH2A 1RZGB 4L8SA 3QNYA 3BMVA 2DQGL 2X4NB 3MACH 1LO3H 1P4LA 2ITCB 2VKXA 4GO6B 4X4MA 3FT4A 3JXAA 4X0KA 3BX7C 5HDLA 2CQVA 1I9IH 3QUML 5E2TH 2D7TH 4Z7WB 3VWKA 4ELKA 5EBLB 5EUKA 2YD7A 5L2JA 3S37L 1Q9OB 1T4KA 3PWVB 1H3UA 2LAAA 5JLZA 4UZGA 1NFDE 4ZMAT 3EHBD 3SKNA 3PWPB 1D9KB 2VXVL 1BQSA 2X89A 1X7QB 5ICYA 3IAGC 3PGFL 2BK8A 3LKQA 2FR4B 3HE6C 5MENA 4DN3H 4I0KA 1IBGH 5KSAD 4WGVB 3CFIC 1FC1A 3C8KB 5HHNA 3EOTL 3BIKA 1JMXA 5DD5L 3RWFA 4ZAKC 3ARBA 1GGYA 1DBAH 4M43L 1MLCA 3W9DB 2DIBA 4BA8A 2UUDH 2NY1D 4ZUSA 2HRPH 1PZ5A 3QDJB 1QSZA 4WO4B 1FFNB 1EGJH 1UWXK 4JG0L 4MNHB 4ZUTB 2AI0L 4FZ8L 3BDYH 3PUCA 1P2CA 5GS1C 2YEZA 5JR1L 5E8PB 1FVCA 5D8JH 2JIXD 2NY6B 1F4HA 5FO7B 2BC4A 4U4BA 1PSKL 2YD5A 3VFNB 4OGYL 5TFSL 2XYCA 5D7KE 1HOCA 1KIRB 3RWHA 4YC2B 1WIUA 4UB0L 3VG9B 3MV8B 3IDNB 1LEIA 1HILB 4P2OC 2YMXL 2JCCB 1IGIH 2X09A 5GZND 1INDH 3VI4F 1VFOA 3QIWC 4Z0XA 4NO2B 3JWOH 2V7NA 4G9DA 1OARL 1VFBA 4OLEA 4G9FD 4DUXA 4FNLL 3D0LB 1HHIB 5CGTA 5IEKA 1O7SA 1UB6A 4GRWF 4Z0BL 4Y2DC 3NGBC 1JTTA 4S1DC 3R1GH 4Y89A 1CE1H 5C86A 3ESUF 4TVPD 2V2XB 3UTQB 5BOZG 1LDSA 1EAPB 4TNVF 3B2UC 5EIVA 2X4QA 1FYHB 1GOHA 3M8OH 4MD4A 5EC2B 4Z7VF 1KELH 3U9PH 5KVDH 3BVNA 2XTJE 3W0WE 1FAIL 4LNVA 1K6QH 4OGXH 3HI1B 4CDHA 1RAMA 1BEYL 3RDTC 2ILLA 2DMCA 1DQML 2I07B 2R29H 2R56L 3MV9D 4NRZB 4G42B 2YC1B 4FXKB 1A3LH 4ONGH 1DANU 3NOIA 5C2UB 1GOGA 4WWKB 2Q87A 5D6CA 4W68A 4D0BB 3ARZA 4OIBA 4OD1H 4WNQB 1U58B 2ESVE 3O6LL 3UDWC 1A2YB 3QEGH 4R97C 1VPOL 4NQXA 2W9EH 4QRTA 5HYIA 3BWAB 1RFDL 1UXWA 3L5WA 1R0AL 4X6CB 4HQQH 3IF1A 2R4RH 1HSAB 1OD9A 4ODHH 2FX7L 1CXLA 3D18B 2P47B 1KBGH 3HNSL 3CMOL 3QQ4A 3BE1H 5DRNA 4KUZH 3SE3C 5JW4R 1RHFA 1ACYL 3L7EA 5C0RH 4M8VA 5GGQL 4JN2B 4V1DE 4ZFGH 4D94A 1IM3B 3G5VA 1DZBA 4K3JH 1EEQA 1I1CA 1U91B 4S11A 4WUKH 3MJ9A 4G8IB 1R6VA 4JVUA 2Q20A 1CFBA 3RY5A 1T21A 1FFOA 3STZA 4I0PC 4NNXA 4OQTH 2M8XA 5ID0A 2XZAL 1NCAL 2O93L 3Q6FB 4X5WA 4FP8L 3G08A 1EJOL 3PHOA 4M48L 1CTNA 1MFDL 4JGMA 2CDFA 5FF6A 3WN5B 3P4OA 2FH8A 1J1PH 2WBJD 3AREA 3CDGB 2GJ6A 2UZIL 4KUCF 1QR1B 5E2VH 4W4OA 4MNQD 3BPLC 5BMFH 3MTRA 4G80B 1ZAGA 4OFYA 1F45A 4OAWB 3GRWL 4KRPD 5IB5B 5L2KA 4NM4L 2EDOA 3P73B 2HN7B 1A7PL 5C08D 2BNUA 5HHOD 5C6WH 3BH9B 4FQQA 5KN5A 1IC1A 3BZ4B 3PQYE 3CFKB 1D6EA 5BRZE 2QLVB 4FFVD 3NABH 1ZLVK 2XFXA 1U8HB 2C1PA 5CGYC 1G9MH 1FG2A 1JWUA 3SHSA 3UYRL 1DN0A 5F89B 1GPOL 2G9HB 3LHPH 3X3GL 2HFGH 3IGAA 2AEWA 2A74A 4J2XA 4MJIB 1NGQH 4OZGF 5C0ND 2D9QB 1JRHL 2QADB 2D31A 1EDQA 1IAKA 5DFVC 4HEME 3ZE0E 1HWGB 3MCG1 4J6RH 1KIPB 1SY6H 5J9PB 2X4OA 1F6FB 3ZL4H 3HLAA 2FHBA 3QRGL 3CIQA 5DJ2B 5GS2D 5I73B 1A7NL 1SEQL 3TA3A 3NIDF 1HI6A 2W0FB 3KPQA 2APXA 5D96B 4HIXL 1JI2A 4XP1L 4X80L 3ULUF 1IZJA 4K94H 5EPMB 1VDGA 4FQXB 1GOFA 1TJGH 1MJ8L 2LU3A 4Z95H 5I19L 2CKBA 4JPVH 1ZE3C 2ZNXA 3LS5H 1XH3B 2EO1A 3AAZA 3H9SB 1P84J 2NY6C 3L9RA 4DUWA 1MF2H 5GRVL 1QFWI 1UM4H 3K8LA 4QRRD 4PRPD 4QY8A 5IVXA 4NSKB 4WI7A 3TH2T 2JJSC 4I2XE 3E8UH 4EI5B 4JM2B 5H37G 2P5EA 2F54E 2VZ1A 5DEFB 1AGDB 5HD8C 3FJTA 5EORL 3T77A 3VH8G 3SDDA 4JZOB 4NZTL 3SDAB 3X3FL 1WZKA 3Q5OA 5DA0B 3U0WL 5IFAL 2C7UA 2DB8A 4ZG1A 2J12B 5HHME 4OTXL 1U8PA 1YYML 2O5XL 3V5HA 3WHXB 2H3NB 1F5WA 4D0DB 4I18A 1S7UB 5KTEH 3AS2A 5L9DL 1KTLA 3T04D 1DSFH 3KDMB 4RA3A 2X5PA 2IAMB 3O4LE 5CJXC 3L95A 3MJ7B 4RISL 1NLDH 3JTSB 5GHWH 4U0RB 4NYLB 1R24A 4IS6B 4KVCL 5D2LB 2O5YH 4O51A 4Y4HB 4RGNB 4X9BA 1I1RA 5HBBA 3B3IA 1R5WA 4FQIH 1QBBA 2NX5E 2Z31C 3MLXH 1D5BA 3QUXC 2XQYK 5KVMC 3FRPG 4WWKC 3PWJA 5F1IB 3D9AH 4HWBL 5KS9E 2D7MA 2FEEI 1S5IL 1YNLL 1GZPB 4UV7L 5JW5A 1PEZA 1HYRC 4V2CB 4XT1C 4NQTA 5F9AC 5IB2B 5L6YH 1NH6A 3I50H 2R1XA 2ZUVA 3MR9A 1PQZA 2IBGA 2B5IC 2GUOA 2VXUH 5ACLA 5DK2B 4KK5D 3FRUA 3JV0A 2E6JA 3JWDH 3BEWA 2A6JB 3JUZA 3UJTH 1ZGLB 3S9DB 3NTCH 2YZ8A 1OGAD 3FQUA 1OQXA 3FQNA 3MO1B 5C07E 2OK0L 2XICA 4P23C 1Y6MR 2HFFA 4XVTH 1GZQA 1FBIH 1XAUA 2F5AL 2A0LD 1IAMA 3UZVB 4PJHF 4KXZH 3D0VA 2GSGA 4LVEA 3QG7H 5IB4A 1FAKT 3ULUL 1T66D 1HKLH 1NCBL 3D69A 3RTQA 1LK3H 1WLHA 1J5OH 1EVTC 5FGBC 3BP6A 4QF1B 4GUPB 3C5ZC 5AZEL 1C5CL 4IRJB 4C56B 1UKQA 5IKCA 1IGFH 3GBNH 5A2KH 2F58H 2Q7YB 3LS4L 1DFBH 2VL5B 2R0KH 1T3FB 3B9KA 1QSED 1DR9A 1S8DA 4OIIH 1AXTH 3NZ8B 4Y8AA 5GRZA 2EH8H 4PLJD 1BBDL 2HVKA 2FECL 1C1EH 5DJCA 4GKZB 3WFCH 4PGZA 2R2EB 5T33L 4RSVA 4JPWH 4H88L 1BF8A 5HDQH 1U36A 5LGJB 4HK3N 4NN6B 3S3SA 2DBLH 2Y7QA 1IGML 3MRMA 1RUPL 1LD9A 4G6JL 1Q9LA 5IUSA 3F8UB 3SCMD 1FFPB 2E9WA 3EJJX 4CNIA 4OZIA 3AXLB 2QADC 3MLVH 3V7MA 2V5RA 4TTDD 4OT1L 2VLKD 4JFPA 3RWDA 5CD5C 4CDGC 1Q0YH 3DROA 2DAVA 4L5FL 4JO1L 4NUJB 2K7QA 1JPFB 3RIAK 4P4RA 2QHLA 2XWTB 4OGAD 4DK6A 4P9HH 4NWUL 1MFBL 5CZXD 3W39B 5GS0C 4ZUVA 2IG2L 1ZTXL 2ZOLA 1B0RA 2WW8A 5C0BD 4AENA 3C8DA 1OAYH 5GSRB 5FM5O 4HHAA 4K3DH 3ARGB 5DD0H 1FYTD 4XI5C 4HS3A 2XZCH 3NCFB 4IIQB 4IRZH 1BOYA 2YRZA 3BPNB 4AH2B 4Q9BA 4L8SB 3MV7A 3QNYB 3KPRA 2ID5A 3ARDC 4MGXA 1X4ZA 2G5RA 4QHLA 4KJQC 3L1OH 3OKNB 4GRMA 3KPSE 2E9IA 5D1ZA 3QAZC 3RGVD 4OZHF 5C3TA 3WLWC 1ZLWK 1HKFA 2J88H 4DFHA 4XCYA 1AGBA 1BLNA 3PIQB 3OAUL 3VWKB 5IB3B 3SKMA 1A22B 5L2JB 1F6AB 2KPNA 2V9RA 1PDKA 5JLZB 1MJ7H 2CK0H 4U1IB 1CWVA 1NFDA 1B4JL 3K8MA 2Z0BA 3QUYB 4WHTA 3SKNB 2EIZA 3MRDA 4I48A 1DBML 5BV7L 4UTAH 3LKQB 3UBXB 1FQ9C 5MENB 4AL8L 2VDOL 2PTUA 4QWWD 4XCFL 5HHNB 4BZ1H 1EO8H 2X05A 3RWFB 5FCUH 4MJ5A 5I1KH 3F58H 3ARBB 4ZOAA 4U0RC 1S5HB 1F00I 4HUWB 1G7JA 4DGYH 5I9QB 4ZUSB 1RK1A 1LMKA 3VRJA 5GRJL 3V4UH 2AK4B 4I77H 2YEZB 3EFDL 4R4BB 1A6PA 2JF1A 1FVCB 3U4EB 5F7YC 2BC4B 1FSKB 4XAKE 1IM9D 3FOLA 1JF1B 2R1WA 4LHUB 2YUWA 1LEIB 4U3CA 1RIHH 1YEGH 4PJDE 1J7VR 4NJ9H 3OV6A 3RPIA 4YQXH 3AS1A 4U7SA 3TBWB 5SV3A 5T5FL 4G9DB 1VFBB 4OKVB 2VXTL 4KTEH 4YGAB 1UB6B 1V3KA 5D7JC 1YPZF 1NBQA 2YSSA 5DUPL 4JFHD 2IPTH 3HFML 5L7XL 4Y1AE 1CXFA 1U8LA 2Z9TA 5TDPA 1KFAH 3REWB 3SDXE 5F6IB 5E4EB 4Z8FH 4RX4D 4XHQA 5IT2L 1MFEH 1OTTD 2Q6WB 5DD3L 3QQ3A 4NC2B 5D7IE 4Y5VC 5F7DA 3KPPB 4YFDB 1KJ2H 3GMPB 3INUH 1DJSA 5I1LA 25C8H 4YDIL 2IPKB 1JGVL 4PRBA 2EKSA 5F3BA 3F6IA 3AMKA 4X9GA 5DJDB 2R39A 1UFUA 2P49B 3KLHC 1TJIL 3AGVA 2MQ0A 1N5YL 4HCRH 2ESVA 5C0JB 4I0CC 3RZCD 3SDCD 3NBNA 1TPXC 1FN4B 4KPHH 1MCPL 4NQXB 3RVXC 1S7VB 5J7CC 1JI1A 3H6JA 3VXSD 4RAVB 4DKEH 3IF1B 5B39A 2NZIA 3WS6A 2QSCL 2E7CA 4ETQA 5FM5M 3QEHA 4CU6A 1BX2B 1TJHH 4HK3J 3UPCA 3ZKXB 4XCEA 2ICWI 4GQPH 1U9KA 2VQTA 5DHXB 1NCDL 4LFHG 3NA9H 4G8GD 1ZVSB 1WBYA 4IDJH 5GJTH 2XQBH 1MH5B 4V1DA 5D70L 3SGDH 2ORBL 3G5VB 4YXKL 3IDYC 3VFWA 3LEVL 4R0LC 4X9HA 3D3VE 2EE9A 2J4WL 2NY4B 4OD3H 2R4SH 2PYED 3VW3H 1V7ML 5KJRL 5F71A 3FQTB 3KPOB 4PJ5B 4NNXB 2VAAA 3STZB 1DQDL 1FNFA 4X5WB 2I60H 3G08B 4OFPA 3ZE2F 1NAMB 3HG1A 4NFBA 1HIML 2VUOA 4FFZL 4JHZA 1XR8A 4NWTH 5FF6B 3P4OB 3AREB 3TC9A 2GJ6B 4NZUH 2PXYA 4ODSL 1EXUB 1VFMA 1X5FA 2EICA 1FZMA 3KNBA 4G9FE 5JUEL 5E00A 1OP5K 1JN6A 3ARGC 4RMRA 5LVEA 5TGBA 4TVPE 1PX4A 4YGVA 4LEXL 3BPNC 3FONB 4FQQB 5KN5B 1SJHA 3PQYA 1E6OL 3DMMA 4LDLB 5EIQA 5BRZA 5JHLL 4JQVC 2NXZC 4TPRH 4WHDA 3RKDD 4M1CD 4U2YA 4U6YB 3BP4A 3Q6GL 4AG4L 3NCBB 4QXTB 1DN0B 4ZODA 5M94B 1SYSB 3TJEL 3OAZK 1YECH 4ODBD 1AP2A 5FK9A 3H9HA 5TH2A 5EH1A 3IGAB 5F72S 2OQJA 2X9WA 2IC2A 4GAGH 3MV9E 5F7FA 2D31B 3VGBA 1NDGA 4YHZH 1SQ2N 1UH3A 4YLQT 2L7UA 3JWNC 5F7LB 2Y6SC 3SN6N 3VI3F 1IAOA 2QHRL 4PB0H 1FZJA 1HI6B 3C87A 2BDNL 4YXLL 5J57B 5HDBE 5FGSA 5I9QC 4HMCA 1CK0L 4PY8I 3B8SA 4S1RL 5L8JB 3FHAA 3TBSA 2CKBB 1HH6B 4XNYL 4OLWL 3AAZB 2DQCL 5GGTL 4K55A 4A6YB 3L9RB 1M4KA 1R3IL 5I1CL 3OKOB 1FSKC 4PJIE 2ATKB 4GKNA 4WI4A 1T7ZA 4WCYL 4LVOC 1EIBA 4QY8B 5IVXB 2XKNA 5E8OA 4I2XA 1FH5L 1B6UA 4ODVL 2P5EB 5CFHA 3JZ7A 2F54A 1UADC 2DLEA 3T77B 3L5JA 1CG9A 3SDDB 5DURB 1JTPA 2HA1A 2A73A 2C7UB 3QUZA 5F1KC 3BRFA 3CSYB 1U8PB 5FYKH 3V5HB 2HKFH 4MSWA 2IBZX 4MNQE 1QSVA 4P5KA 4GG8A 3EW3B 4I18B 3RZWA 1MHHA 1KTLB 1LP9F 1G6RA 4Z7NF 5KVGH 4RRPA 1I8KA 3O4LA 3L95B 1WT5A 2CO7B 5E4IA 5HHOE 5IVZB 1W72A 4UINH 1R24B 4QXUL 3GSUB 3VG0L 2L0DA 2VDLH 1R5WB 3EYQC 1I3RA 1H8NA 1AE6L 1BVKA 2NR6C 2NX5A 2VE6A 5FO8A 1KCVH 1XGTA 3DHJA 3HAEH 5F6HJ 2EC9U 5ALCL 5JW5B 5K59E 5CZKA 2YXMA 3CDCA 3TO4D 3NFPB 1OAXL 3ARTA 5IW1A 3ME0A 2R1XB 4BSWA 2IPUG 3MR9B 1MCDA 4ZDHA 3TNNA 3BQUD 2MQ3A 1D5XB 4OCRL 1AXIB 3QDGD 2AJZA 2EDBA 4PG2A 3STBA 3UTPD 1XF5B 3ZKXC 2BJML 1QRND 3ECBA 5LGHH 3E6FB 1MVFA 2YZ1A 2VZUA 5BVPH 1A6AB 1JPTL 2DQTL 1FIGH 4OQTA 1WAAE 1CF8L 5DQJA 2VXQL 4X6EA 5C07A 2EXWD 3BGAA 1T2QL 4DTGH 4LEOA 4HDIB 2HFFB 1YYLH 4FG6D 3O0RL 1H0DA 4N1EA 2AABH 5DJYA 2VRAA 2GSGB 1Q94A 3KYKL 4G6FB 3EJZD 1LO0H 5FGRA 2XWBB 3D69B 1NFIB 4QRRE 3HE7A 4PRPE 3RNQA 3Q48A 4QHKI 1CI5A 2OP4H 2HH0L 2Q7NA 2P5WB 2FL5A 2VXSH 4PJFF 4MHHG 3MREA 4ETYA 3MRRA 2Z93A 3B9KB 4W4OC 4FS0A 1NAKL 1S8DB 4M6ML 5CINH 1SHMA 2Y36H 4GXUN 3UC0H 4BSVB 4CGTA 5DJXA 3OKYA 4P57B 3WYRA 4X98A 1N7ML 1NJ9A 5EU5B 4D2NA 2DQJL 2ED7A 4U1KB 3MRIA 3RI5K 4F8QA 4LBEA 3P4MA 1ORQA 3VXTB 4EQ2A 5FFLA 1T2JA 4HFUL 1UGNA 4S0SD 1YUHB 4Z78A 1S3KH 2Y7QB 5E0QA 5HVFB 3MRMB 3V95A 1ZXQA 1SY6A 1LD9B 5C0FA 1Q9LB 4O9HL 1KLUB 4KRNA 2VDNH 5FYLL 4R2GD 2ARJA 4OZIB 3TP4A 1RURH 1BM3L 4NQCD 2BVTA 4JFPB 3VD3A 3DROB 3GMMA 4Y4FD 3T8XA 4KVNL 3WEXB 5TQ2H 5B3JE 2AXJA 1BD2D 4I3RH 3VXOB 1U95A 3WNPA 1ADQA 4P4RB 4WW2A 4UOJA 4L8CA 3VWJB 3TA3C 4DKFL 1QHPA 3FKUS 4LPVA 2B1HH 3FAWA 4AT6B 3VXRD 2D0FA 4L9DA 1GAFH 1FL6A 1JHLL 1D7FA 2RHEA 2ZOLB 4F3FB 1B0RB 1WFTA 3S88L 1JF5A 4LCYB 4AENB 3DJ9A 5I8KH 1ZA6A 2ED9A 4CKVX 1KN4L 5KSBF 4HHAB 4JRXA 4AK1A 4HS3B 1DUYA 2J6EA 5C6TH 5I17A 1R5IB 1WTGT 3AY4A 3RL1A 3BN9D 1CFVH 5BS0E 1NCNA 3NZHH 2A38A 3MROA 4MA8H 4CU8A 2VDRH 1E28A 4KDTA 4PJEB 4LNRB 4MA3A 4F15C 5D1ZB 3KPSA 4EXPX 5LWYH 1T89A 4FQ2L 4JHBA 5AEAA 2DQHH 3SKMB 5HGBB 4HLZH 3NN8A 2XN9D 4HF5H 5F3HA 4R8WL 4XMPL 3X13B 1NFDB 4YX2H 4PBVC 4WHTB 5JW4N 1P9MA 1QSEE 4LVNB 5J56B 1UB5B 4LHJB 3WFDH 2XA3A 3EDFA 1AIFA 1D5ZA 2VZ3A 4YHMH 4MJ5B 3VFTB 4M6OH 1EZVX 2E7MA 1O5DT 1QLEH 4LP5A 2XG5A 3DGGB 4JPIB 3VRJB 5DGQA 4O00A 4JJ5A 5T1LA 3L5XL 5J6GA 2CMRH 2X1PA 3GKWH 3P0VH 1LK2A 2ICWA 1TZIA 1Z3GH 4P5TA 1ACZA 1RZJC 2DWDA 2VLKE 3D1MC 1CD0A 2VLJE 1EAJA 4NP4H 3SQOH 2DQUL 3PL6A 2BMKA 3VXQA 3WDJA 4NN5C 3O6FA 2V2WA 4PJDA 2AEIT 5FUZH 3NPZB 3UJIL 3RPIB 3KJ6L 4UILH 5IMKA 2W60A 1S7RA 2P8LB 1HSBA 5KSVA 5BO1H 1MWAA 3VGDA 5C09D 3BUTA 2WP3T 3ULUD 2ZG2A 4JR9L 4UQ2B 3MBXL 2D7QA 3QIUD 3THML 1JGUH 1RPQA 1YQ2A 5JDJA 2YKLL 4YBQD 2JTDA 1OY3B 4Y1AA 1U8LB 3OBAA 5TDPB 3SDXA 1XZ0B 1QUNA 4OUUA 5HI3C 2YPLD 2D03H 2HRLA 3QQ3B 1FYTE 5HPOA 5IEHA 2HWZH 3W0WB 1W0VA 4DKDC 1A8JH 5D7IA 5DWUH 3RTQC 1CLZL 5I1LB 3V8CA 2R69L 4JFOB 4PRBB 1J0ZA 2EKSB 4YHNA 5F3BB 3MRPA 4MXQD 4NHUB 2EEAA 3QUMH 4AQOA 2EYRA 3B9KC 4P48A 3KYNA 5C70A 3S37H 3GBLA 1T1YA 5DJ6B 2BVOA 5IMMB 4OSUL 3MRLA 2VXVH 4X8JA 3PGFH 5B39B 1EO5A 4Y7MA 5BZDA 5F88A 3QEHB 1TVHB 3EOTH 5EU4A 2VDKL 5DD5H 3TT1H 5KSAA 5JW3H 3U0TA 4XCEB 1LHZA 3DVNB 2Q76A 4GOSA 4P46B 4FFWC 1ONQA 3MXVH 3GO1H 1WBYB 5J1SC 4I9WD 2D9CA 4V1DB 4JG0H 4H1LA 4ONOA 3CVHL 4FZ8H 1U2HA 3VFWB 5GQBA 1YMME 2VDPL 2R0ZH 1NCCH 1CGYA 3KLAA 1Q38A 2JIXA 1FNLA 5ILTL 5JQ6H 2VAAB 4APQB 3G5YB 4GW5A 1ITBB 3VD4A 3H42H 2YD1A 4M7LT 5F7NC 1KV3A 1JHTB 2QTEA 3MRQB 2X1OA 3I75B 3ROOA 5C0DB 3F65A 3SGJA 2HLAA 1FZMB 3KNBB 2EEDA 3IFNL 4G9FA 5FUOH 3X12A 2C1OB 2N56A 2XXMB 4JFHE 4PREA 4YGVB 1SJHB 4O4YL 1ZWIA 4X7TA 3G6JE 1CFQA 5BRZB 2OR7A 4KK9C 3ULSA 2ADGA 3BP4B 3FZUC 3RVWD 5CP3H 5D1ZC 4J3SA 1BEYH 4IHOA 2FWOB 4LFHD 1CD1B 5TH2B 3DV4B 2R56H 3UBXG 4ODWA 4OBRA 1QLRB 2Q8AL 4XPTL 43C9A 3MV9A 5IB1A 3SDYH 1SBSL 2DQDL 3MLZL 4IEFB 3C2SA 3CX5K 2I9LA 1F02I 4LVNC 5TE7L 5I15L 5I71B 2A9NH 1RFDH 5LCVL 1IAOB 1R0AH 3L3HB 1NAML 4P3WA 5TE4H 3B43A 3VXSE 1LWRA 2FX7H 4ZTPH 4JCMA 3HZMB 3O4OB 1IKFL 4N0FA 3HNSH 1QRKA 3CMOH 1JHKH 3SQBA 3ZMRA 1MFCH 2IALA 4FQCL 4PRNB 1I7TA 4LCWA 1ACYH 2ZOKB 4PFEA 4LHUG 1BMGA 3DXAD 2GY7B 4BH7A 1CBVL 2PO6D 2D7OA 4POZC 5CAYB 1EUUA 3WFZA 3VFUB 5I8CA 4PJIA 4YFLI 4YWGL 1TXKA 1A7RL 5I1GH 1PEWA 2XKNB 3ISWA 4U1HB 2MCG1 1NSNL 4I2XB 4XZUA 3MLRH 1D9KD 2F54B 1NCAH 4FP8H 2FATL 1G7QA 1OP9A 5LBSL 2GITB 4XGZB 2ZCLH 4TQEL 4M48H 1VHPA 1CG9B 4XWGL 3HZKB 4KJWD 2UZIH 1RUQL 4PJAF 5J1AB 4PRID 5HHMB 5EWIL 3ULVF 3EGSB 4WO4D 2ENYA 4Y19D 4OV6F 1MRFL 4MNQA 4P5KB 2JELL 1MHHB 5EZOL 3K3QA 2XTJC 1A7PH 5EOQL 4GBXD 4MB4A 3PWLA 3QCUL 1CYGA 5C08A 1OSZB 2DN7A 5HHOA 4FQJH 3ZO0A 1W72B 1WJ3A 4K7PX 4AIOA 4HCRA 4KHTL 4GRWH 1KTDB 2JJWA 4FRWA 5E70A 5DMKA 4GLRI 2E9JA 3S3PA 4A6YL 1FL5A 1OD7A 1XGTB 2HAZA 2ARJQ 5KS9B 3TYFA 1JRHH 4NZDA 4XRCA 2LTQB 3CDFA 1CTOA 4G8FA 1DBJL 2EZ0D 3QFJB 1CL7I 3QRGH 4X5LA 4Z7UF 5FHAL 1L7TH 3ALPA 1U8QB 1HE7A 1R3JA 1RUML 3MRFB 3R8QA 3FT2A 5IHZA 3JV5A 4TSBL 5HGGS 3IFOA 3U1SL 1YNTA 3ECBB 5CEYA 5K9KB 3GSWB 4GFTB 1MJ8H 5I19H 3VA6A 5JZ7D 2AKRA 1S7XA 4LPTA 4XP6L 1EEZA 3AUVA 5C07B 2HP4A 4LEOB 4YDVB 1Q1JL 2IPUK 3RHWF 4POYA 5JHDD 3IFLH 2YWZA 3B9AA 5DJYB 4PP1D 4ODXA 1Q94B 1MJUL 4WTWA 1X44A 2ZUQC 4S1QH 4QRRA 4J4PC 3RNQB 1TVBA 2HTKD 4K9EL 4PRPA 5EZIL 2NY3B 4ZFFA 5IFJB 1KTRL 5ANME 1JWMB 3E0GA 2BOCA 3MRRB 1KEGL 1KCUL 2PXYC 1X5YA 1RVFH 1HYSC 3GMNB 2NY5C 5IFAH 3U0WH 2CXGA 5DJXB 4X98B 1NJ9B 2FIKA 5IHLB 1WUNT 3DMMC 3MRIB 3PHQA 5L9DH 4JN1L 1LE5B 5CJOH 4RISH 1KACB 1RJZA 2AJSH 4KVCH 1UEYA 2SEBB 1NLBL 3C2AL 5B38A 2WBWB 2YA2A 3RJDA 1RD6A 3OQ3B 4EDWL 3O41A 4H8WH 3GMMB 3T8XB 4G6AC 4PGCA 1S5IH 3PV6A 3UZQA 1HCVA 5C6PB 4UV7H 4P99A 1CQYA 4HK0A 5HYJD 4L8CB 4QHUA 4I5BA 3GI8L 3PNWA 4JDTL 5HHPB 2HJFB 5EU7C 2E6QA 1V3JA 2WM0A 3O4OC 3Q1SL 3QXTA 5FYJU 5K9JH 5CILL 5GS3A 2NQCA 3DETD 4R26L 1JNJA 2W0KA 3UTPE 4NQED 1ZA6B 4ZO7A 3MNVB 1NCWH 5GISL 1QRNE 2ADIA 3GHEH 3LPFA 5ICXA 4MJID 3TM6A 4YDJB 3TESA 2ZCKL 4Y5YB 1OGAA 3VU2A 5I17B 5EOTA 3A6CH 3RL1B 1Z9OA 1PG7H 1VACA 2X70A 3MROB 5FHBL 1NDMA 3NACH 3NCJH 4HFWA 4MA3B 3ULUH 3BAEH 1HQRA 1NCBH 4QOKA 2R1YA 1G6VK 1XR9A 3K74B 1FCCA 2H2SD 5EU6D 4WHYH 5EO1A 1RY7B 2AQ1A 3IFPA 3QUZC 5F3HB 3VI4E 3VXNA 3LKRA 1VGEL 2D4DA 5DJZB 3I6LD 3MV11 3GSNA 4IRSB 1QSEA 4GRWE 2VLRD 2W65B 2QKIA 1D5ZB 4F33A 1XCQA 3I3EA 4I4WB 5DFWH 2DTML 5T33H 3W82A 4HBQA 4TUOB 3K4DA 1WT5C 4H88H 2WINA 1XF2B 2EIEA 4PLKD 2A83A 1QKZL 4XX1G 4EKXA 2K3TA 3RAJH 2FJHA 3FO0H 2CIKB 2VISA 4EI5D 3GHBH 1IGMH 4JM2D 1RUPH 1A7QH 4JJ5B 3KXFA 4G6JH 4OCWL 1HXYB 1NBZB 2YOCA 5DO2D 4M1GH 1XIWD 2CRYA 4O2EA 1TETL 4HC1A 2J8UE 3SCMA 4OT1H 1TZIB 2B0SL 2LTQC 2YD4A 3EZ8A 3UX9B 4ESKA 2DWDB 4OM1L 4L5FH 1DN2A 4NQCE 1A3RL 2VLKA 1E4XI 4JO1H 1UKSA 5E5RB 1QO3B 1EVUA 35C8L 3N1PC 4XC1L 4NJAH 4ZOEA 2BVYA 1BD2E 4XTRD 4NWUH 4PG2C 1MFBH 2W60B 4F37F 4MB3A 2IAMD 5KSVB 4XC3H 3U83A 2YHGA 1ZTXH 3HCVA 3VXRE 2APTA 5DVOA 4LIQL 3S34L 4EIGB 1L0YA 4ENEC 4RGND 5I1EL 3SDXB 5C0BA 3U4BL 3QJHB 2IJ0C 4RDQG 4D9LL 3GK8H 1T03L 4UIMA 4XXCA 4Q9CA 1FYTA 2OXGA 1W0VB 4WV1A 2DL9A 5HI4D 4OLYL 3HE7C 3D39D 5D93B 3P4NB 5FUCE 4YDKH 2WWMD 5I0DA 3WXWH 4YHNB 3LOWA 1N3NA 3D85D 1S9XA 3MRPB 3RGVA 2EYRB 1OP3K 1WWBX 5H2BB 4HWEH 2LU4A 3EYSL 2XN9E 3CDYA 4JHAH 3QCTL 5F8QC 2BVOB 1B4JH 5FYLD 3RP1A 3MRLB 5BV7H 1DBMH 4X8JB 4U6VL 3UZEA 5C0EA 3QULB 5FOBA 4IM8A 3U79A 1KB5L 3O2WL 3GMRA 4AL8H 2XZZA 1K4CA 3W11D 5F88B 1J10A 3OZ9L 4C54A 5EU4B 1RSFA 4M62H 3U0TB 2X6MA 4HKXA 1OSPL 4HXBH 5HYSA 1PKQE 2Q76B 5IFHH 2YN5A 3U30C 5AWNL 4LARL 2QQNL 2NY1B 4IRJD 3DYPA 5GRJH 1M6OA 1MCJA 2A9MH 3DTXA 1ZSDA 3P77A 3D3VB 1AO7D 3EZJB 4NKMB 4OZGE 4WW2C 5E08L 1KOAA 2JIXB 32C2A 5MI0B 2CJUL 4ZXBC 4BK4A 2Z8SA 1IM9A 12E8H 2OL3A 2F8VA 3IVKA 4QXWA 1MREL 1KGCD 4GKOA 2F9BT 4M93C 1ZGLM 3Q0HA 4O5LL 4Y4KB 4HMEA 1HDMA 1JPGA 5T5FH 3NIDE 3QQ9D 2VXTH 2P46B 2X4SB 4RGOL 3GMOB 2HLAB 1IMHC 2WLYA 2J1KA 5C09E 3QEQB 3VFPA 1IAIH 5DUPH 4F7CB 3ULUE 3X12B 4X6CF 1MFAH 3AY4C 2F74A 4Y2OA 5BXFA 1N6VA 2ZG1A 4WIQA 2VC2L 5HSFA 5DD3H 4CVXA 3BJLA 3ULSB 3T0XA 3FFCD 4KDTC 2Y5TA 4RX4A 2YPLE 4QRQB 1B88A 4LLYB 5HHXH 3LN4A 1R5VA 5CZVL 1RV6X 1T89C 4NUGL 1RUKH 2OR9L 3L3DA 4ODWB 1MRDL 4YDIH 1JGVH 5H35B 5FECB 1H5BB 3MV9B 4H8WC 4X9FA 4PB9H 5IB1B 1C12A 2DIAA 2XOTA 2CRZA 4ELME 5DVLA 1TJIH 2J8HA 2UWEA 3EOAA 3C5SB 1N5YH 1P9MC 1MCPH 4P2QD 1ZEAL 3OJVC 1OTUC 3HS0A 3RZCA 3SDCA 1JGLL 1S7QA 4GW1A 2GI7A 2YK1H 2ADJA 3VXSA 2YBRA 2VR9A 5GRUL 1X5GA 4ODUA 4CVZA 2XT1B 4PUBH 4WW1A 5IV2A 2JB6A 4GXUM 4GG6F 3GJEA 2H8PA 5IQ9A 2UYLA 2NXYB 1RZKH 2H2PC 5IW6A 5D70H 2ORBH 4P5TC 5I8CB 4G8GA 1ZHNB 1I9IL 4I9WE 5E2TL 2D7TL 3LEVH 4AQ1B 1XGUB 2J4WH 2ICCA 1B90A 2OI9B 1AD9A 1Y0LA 3PL6C 4BFBD 4KHXL 3QUYD 1BJ1H 3O6FC 2IFGA 5DD1H 1I1FB 3WIFA 5J8OA 2PYEA 1WSST 1C16A 4X6FA 3JVGA 3X14A 3P4LA 1HIMH 1FVEB 5DK3A 3K0WA 4DN3L 1HNFA 2ZUTA 1IBGL 4M02A 1WFNA 3G9AB 1ZLVH 4WI6A 4LDEB 3RY4A 3FT3A 2WBJB 1KJ2B 5JUEH 1DBAL 4ODTH 4M9OA 5HI5D 3FB6A 4MNQB 5B22A 3OWEA 2AK4D 2FLRT 4J3TA 4KRMB 1EGJL 4KAQH 3U0PB 3WFBL 4GXVL 4PRDA 1LVEA 1YDPA 4PGBB 4NO3A 5FYJL 4KRPB 3TVMA 3PWLB 4L4TB 2H9GA 4U1LB 4WFHE 5JHLH 1NMCB 4ZO9A 5HHOB 4KK6D 2DD8L 4MMZC 1F4AA 4N9GA 4LHUD 5DHYA 4AG4H 4C4KT 4PJHE 3CAFA 3D6GA 1BWWA 1PW3A 5DMKB 3TJEH 2IMNA 3OGCB 1KXQE 1NGWA 4XPFH 2QQQA 5B39G 4W6YB 3D48R 4XVSL 3TYFB 5EO0A 3CGTA 3BKJH 2EXYD 4G6KL 4XRCB 4UUJB 4MA7H 3I3BA 3SPVA 3R1GL 1X6NA 3SJVD 2DQFA 4ZPTB 3CCHA 3T2NL 1XGPB 2VUYA 3U4AA 5F1NB 5IHZB 1RIUL 5TDOA 5KSAC 4BQ6A 1FHGA 3IFOB 3BP5B 4MLSA 2BDNH 3ORJA 3CZFA 2HVJA 5KVDL 4P9MH 5JORA 3G5ZA 1MOEA 3FB7A 4MMXC 3IETA 5D4QA 5CEYB 3WO3B 5I30H 1K6QL 2GK0A 4OGXL 4S1RH 4PGDB 4XNYH 3UPAA 1MRCL 2LQRA 1EEZB 2DQCH 2R29L 5GGTH 3JTTA 4JDVA 3QDHA 3DXAE 3B2VL 5KAQF 4HH9A 2AERT 5MI0C 4Z7WE 2ZUUA 4WCYH 2XRAH 4OD1L 1I75A 3GIZH 4L3CA 4QRRB 1FH5H 1TVBB 4PRPB 3QEGL 4ODVH 3CPLB 4KKLD 1FLRH 1I7ZA 5ANMA 2B4CC 5GZNC 2R4RL 1FNEB 3DX7A 3HMWL 3FTGA 1NC2D 4WDIA 2E9BA 3BE1L 4KUZL 4MAUH 5D1QD 4IOFD 5CCKH 5HPMA 3CU7A 4HWUA 2F15A 4Y8DC 2FIKB 4PRIE 4BQ9A 4YAQA 3OKMB 4LQFL 3LQZA 4FMFA 2P45B 2EE3A 5FA4A 4ZFGL 4Y19E 4M6AA 3ZT6A 3BO8A 4K3JL 3MBED 3WUWG 3N1FC 2NY4D 4M7LH 4WUKL 1JNNL 1I1AC 3IDXH 4PJXF 4QXUH 4PJBF 2NLJB 5AYUL 5CMAA 4OZHE 2OX5A 1N0LA 3PV6B 2VWEE 5DMGD 5GS0L 3ALWA 1OQOA 4HK0B 4QHUB 3OR6A 3JBG7 1OAXH 4MDJB 1A1MA 5BMFL 3TO4A 1JCKA 1GC1H 3GDBA 4OCRH 3HPLA 1MCOH 3MRKA 1HZHL 3K2MC 4F2MB 4BFIA 4P4KD 3L3GB 3TEUA 4K07A 2NY7L 2RB8A 5CD3B 3QDGA 2BJMH 2Y07L 3VH8A 1S7TB 3NABL 2CDGA 5AG8A 3QI9D 4UU9B 2DRUA 1G9ML 2ADIB 1QRNA 1JPTH 3MRBA 2LVCA 3O9WB 4FTVD 2VXQH 3LHPL 1T2QH 3U9UB 4LSSH 4WFED 4MNGA 3P30L 2X70B 2G60L 5TF1H 1HEZB 1M1SA 5BS0B 3O0RH 4FXLA 3ARQA 4HFWB 4HKJB 5JHDE 1HQRB 1HH9B 2R1YB 4HV8A 3ZL4L 4X7FC 4LPXA 1MCKA 4WJ5A 4Z7QF 3MYZA 3GRWA 2AJXL 5EO1B 4Z76A 3IFPB 4YK4B 2ERJB 5DRZA 4CJ0A 3LKRB 1NAKH 1QA9B 1A1OB 5DD6B 5EUOF 4K94L 4XNUL 1H15A 1YPZE 4Z95L 1N7MH 1K8IA 4CN4A 2QKIB 4H25A 1XCQB 4JPVL 4KRPC 3LB6D 3OHXA 2C3GA 1NMCC 2WINB 4LKCB 4K3EH 5GSVA 2GTWA 2A83B 1UM4L 5F9WC 1IEBB 3NCCB 1EBPA 1XMWA 2FJHB 4IOSD 2VISB 4M1DL 4HIJA 1JTOA 4B53A 1FIEA 4X6DF 3E8UL 4HIEB 1FL3A 4O2EB 1ERNA 2O26U 2R0LH 4XXDA 2O5ZL 3SCMB 2J8UA 1B9ZA 2W91A 4X7CC 5C0NC 1MELA 4XAWL 5DURD 2C3HA 3CZJA 3HA0A 4KVNH 1BOGB 2VLKB 4NQCA 3PDGA 5EFIA 2VLJB 4Y4FA 4YXHL 1IC7L 5GZOD 1BD2A 5E6IB 3QEUB 4DKFH 5TF0A 2KUTA 5HYJE 3K8KA 3G6DL 4AZ8A 1MLBA 4QCIA 3GSRA 1Z9LA 4OF8A 1FO0H 4LMQE 2IWGA 1YEFH 3OJDB 1UWEH 3X11B 1JHLH 3VXRA 1OAQH 2AQ2A 4LPWA 5T5NG 5GHWL 3C6LB 4NDMA 1FJ1B 1ZLWH 2O5YL 4Z6AT 4NQEE 2FJFA 4YPJA 3MOQA 3LV3A 4FQIL 3WS3B 5CSZB 4UIMB 1VESA 2CH8A 4C58B 1FYTB 2C3VB 3HB3D 4MJIE 1H3TA 4KDVA 4WV1B 5CIPH 3ARWA 2NW2A 4RMVA 1B3JA 4OD2A 1K85A 2IF7A 2R8SL 1S78D 5L6YL 5EB9A 4D8PA 1S9XB 4UIKH 4E41D 1MCFA 3RVUD 4LCCA 4HPYL 3ZE2E 3OB8A 5DYOA 3TN0D 2QSVA 4R8WH 3N85L 5EU6E 2XN9A 1FFRA 1AD0B 2AJUL 4HXAH 1SEBA 4TULL 2OZ4A 1U0QA 3CFEA 2HFTA 3TH3T 2F53D 4B0MM 3KPMA 3OB0H 2DTSA 3GMRB 3I6LE 1K4CB 4DEPB 2VLRE 4XVTL 4E0RA 2YN3A 4HWBA 1FBIL 1M05A 5DVKA 2CIIA 3P9MB 2H1PL 1RHHA 1PKQA 3WNMA 1XEDA 1HKLL 1MJJB 4JE4B 4V2BA 3ZDXE 2P5WD 1LK3L 5DT1H 3VFSA 1J5OL 1M6OB 1WWCA 4QKXB 1YMMB 3U6RA 3DTXB 1ZSDB 4EVNA 1IGFL 3GBNL 3BYYA 1T0MB 3FQRB 3ZSSA 32C2B 3WIIL 4XP5H 4P59H 4MHHI 1AXTL 3MJ8A 3WFEL 3K4AA 2ZNWA 4MA1B 3W5NA 2MOVA 1W0YT 2ZWLT 1NANI 4KK5C 5I74B 3WFCL 3VI3E 1JPGB 4JPWL 1ZHBB 2C3XA 2BSTB 4UT9H 1OVZA 4N5ED 4JR9H 2JJVA 3GMLA 4Z9KB 1JNHA 2DBLL 4O58L 4KKBD 3QIUA 3H8NA 2HT4D 3WHE1 3C09C 4L29A 3HC4L 4RGNE 1QLFA 1NFKA 1UEMA 5GPRA 3G6JB 3MLVL 2E5EA 4NQSA 3TLRA 4CVXB 5A2IH 5DJAA 4JM4L 2YPLA 1Q0YL 3WDHA 1D3CA 1SVCP 3RL2A 1R5VB 2WBKA 1F3DH 4ONHA 3VWJD 3T4AA 3OKDA 2GK2A 3D39E 3FQWA 3F7VA 3ZLQC 1UJ3B 1YJDC 4KI5D 3I84A 4ZNCD 4HX1B 3BYTA 3REVB 4PLNC 3O3EA 4ELMA 5KG9A 1ED3B 5GGSA 2MHAB 3MFGB 2DI7A 3IU3A 5CLTA 1GHFL 3MUHL 4PLJC 3E2HC 3RZCB 1S7QB 3T3PE 3WIHH 4GW1B 1IEHA 1OAYL 1GGIH 1LDPL 5FYLE 4K3DL 3IKKA 3VXSB 2YBRB 4HIIA 5BVJA 4LSQL 4CVZB 4IRZL 4WW1B 2JB6B 1QBLH 1LP9E 4Z7NE 4UNTA 1QSFD 2H8PB 2A6IB 4MS8D 2UYLB 4Y2DD 4W6WB 1TQCB 5DZLA 5IW6B 5ENWA 3RQ3A 1ZHKA 5E94B 3B2UD 1XF1A 2J88L 1UENA 2ATPB 1KC5H 4EUPH 3FN0H 3HRZA 4HJGA 5B8CA 1AD9B 1Y0LB 3K46A 4XBEH 5ILTH 4MCYA 5IJVB 1AO7E 2CK0L 4R4FH 4X8XA 4J3VA 3RDTD 1JUFA 3WD5L 4HBCL 4WU7A 1C16B 3MV01 5CWSA 3DYMA 4ZFOA 4FFYH 2BSSA 1PBYA 5ESQB 1KCKA 5CZXC 1KGCE 4BZ1L 1EO8L 2X7LB 5FCUL 1QYGL 5I1KL 1ZV5A 1EHLL 3F58L 4LLVA 4DGYL 5C9JB 3OAZH 4TNWF 4F7EA 3FB6B 4XPAL 3BEVA 4I13B 3WJLA 4XXCC 4DJMA 1JL8A 5JDSA 1CU4L 1YDPB 5DI8A 3V4UL 3QUMB 2VITA 4O4YH 1WCQA 4Q9QH 1G7HA 3L7FA 2IADB 4HS8L 5GGUB 4N9GB 3FFCE 4PJHA 1KXVC 1TVDA 2KDGA 1NGWB 3RGVC 2EDYA 3S96A 1JK8A 4MD5B 1D5MA 4XPTH 4JLRA 2ZSWB 4HWZA 5F70A 2FEDC 2X44D 2UZXB 1C5DA 1KXTB 2DQDH 4PJFE 1G7MA 3O8XD 4KTEL 5IVXF 3T2OA 1IARB 5EZLA 5HHVL 5TE7H 3VGGA 2DQFB 4IOIB 4ZUWB 1A1NA 2OTPA 3KHQA 1UACH 5LCVH 1FV1A 1BBJA 4P2QE 1U8IB 1KFAL 1MY5A 1T22A 4QWWC 2BHZA 5TDOB 1JE6A 4KJPC 2AQ3A 4GJTB 2XI9A 3CZFB 1IKFH 5JTWA 4YPGA 5F93C 3KWWA 3S97C 5JORB 3FB7B 5E5UB 3IETB 1U8JA 1MI5D 4PYGA 1RZGA 2DDQL 2GK0B 4FQCH 2X4NA 4QEGA 1KJ2L 3INUL 5A2FA 1CBVH 3R0MA 25C8L 3JTTB 4X83A 3DXAA 1G84A 2PO6A 5SWSB 4HH9B 4KGJA 3HMXL 4Z7WA 1U6AH 2RCSL 2AJ3B 1WBZA 2P7TA 3PWVA 4L1HA 2DJUA 3K7UA 4NKQB 1I7ZB 5ANMB 5H37H 1D9KA 2FATH 1TQBC 4K2UH 3FTGB 4WDIB 5GJSH 3C8KA 1UT9A 1RUQH 3N9GL 4P46D 5KZCD 4F58H 3GI9L 5HPMB 4PRIA 3NA9L 3W9DA 1DUZA 1MRFH 4IDJL 1OHQA 4WO4A 5FA4B 1FFNA 2CPCA 2XQBL 4MNHA 5EZOH 5GGRB 4Y19A 4LASL 5KSBE 3BESR 2W07A 4ZSOB 4B7IA 2AK4E 3BOVA 4I8DA 1INEL 3GM8A 4WTZG 2OMNA 1UZ6E 5FO7A 4GBXA 4APQD 2R4SL 1X5JA 2PUQT 1KIRA 4LPYA 4HUKB 5DRWA 5GRWA 4N1CA 5CMAB 5C7XH 3MV8A 1U93A 3IDNA 7FABH 4JG1H 3NCMA 5GRXG 1MIMH 2R2BA 3TFKC 5AZ2L 2ITDB 4NWTL 4Z5RA 1RJLA 4GMTL 4M00A 1U3ZA 1VKXA 1B2WH 1RZFL 3D0LA 3QISA 5GRYA 1DBJH 3SDCC 3F7QA 3G6AA 3TO4B 4OF0A 1A9EA 5INDB 4YHIB 3LEYL 4TUKH 5FHAH 2V2XA 3SJVE 3MLUH 3BQUB 4TSBH 4IMKC 3S35X 5HD8D 3P0GB 3U1SH 3VXUE 3MODL 2CDGB 4RMWA 5DVMA 1FC2D 3HN3A 1TQCC 1QRNB 3A67L 4XP6H 3QHTC 2I07A 1Q1JH 3WV0A 4G42A 4FXKA 1P6AB 2B1AL 5IIEB 4B41A 3UBXI 5JXED 5FGCE 2OXHA 1HINL 5JHDA 1MJUH 4D0BA 1WQVT 4YHZL 3RWJB 4WNQA 3GGWA 4LGPB 2BHUA 4HV8B 3JVGC 4YDLC 1J11A 4OZIF 4K9EH 1A2YA 3OXSB 1L4IA 1WITA 1I4FB 4LCUB 2X40A 1QOKA 1VEMA 1HSAA 1K8DB 4MLIA 5DRZB 3D18A 1OCWH 1W8OA 3VXPB 3M17B 4GRWB 3H9ZA 4UAOC 4OZFA 1K8IB 4PD4J 4H25B 3TVMC 1RK0A 4P5MA 4X7DC 4LSUL 2RIKA 3MJGX 4AEIH 5GSVB 4LRNH 1F4YH 1M7DA 3L5HA 3RKDC 4M1CC 4Z7VB 3QHZH 3DUHA 4HIJB 1RZJL 5I1HH 4YEEA 2CR3A 2EC8A 4U1JB 1U3JA 1NLBH 1QR4A 3ULVH 2D0HA 3C2AH 3NPSB 1OT2A 2PW1B 2CR6A 3Q6FA 4R2GB 1U8OB 5F9JA 4EDWH 5E9DB 3T4YA 4J3WA 3O3BB 3MYJA 1TNNA 4NQCB 3BKCL 5EFIB 1AKJB 3WN5A 5HHMD 3CDGA 1QR1A 1MAJA 1BD2B 3GNMH 4JDTH 2OYPA 1YEDB 1BFVL 5HYJA 1VENA 5FYKL 4C55A 3AROA 4G80A 2HKFL 4OFKA 1WF5A 5GGTA 4OAWA 3Q1SH 3P73A 2HN7A 3QWOB 1DLFL 1VADA 2PR4H 3VXRB 3BZ4A 3STLA 2DQIH 3L3KA 4R26H 5T1KD 1U8HA 4NDMB 4LF3B 2DYPD 5GISH 3HC0B 1BZ9A 2FJFB 4LOUC 4BZ2H 4RZCB 2ZCKH 4H20H 2HTLD 2BOBA 4MJIA 2GCYA 2J5LC 4FTVE 2AXFB 4DKAA 4LSPH 2NW2B 2QSQA 3BGFC 4WFEE 3QWRD 2R2CA 3QXUA 3QFJD 3ARSA 1KIPA 5ICZA 5J9PA 3CFCH 5KW9H 3MZGB 4NQVA 3FO9A 1JGDA 4MZ3A 3EFFA 1RZ7H 5I1IL 5DJ2A 3RVTD 5J11B 1OB1A 4TTGA 3AM8A 4QTHA 1RULH 3MCLL 5DYOB 2W0FA 4HUXA 1P7QD 5EU6A 1UXSA 2XN9B 1KYOJ 2VKWA 2EE2A 1VGEH 3TO2B 1SEBB 5LGHL 5EPMA 3QXVA 4FQXA 5BVPL 2I5YL 3LRSB 4LSRH 5EZJB 3PDDA 4DTGL 4GQ9H 2VLRA 2QQKH 2YD8A 2IMMA 3G5XA 1H3GA 2EDWA 1M05B 3QXAB 5GS0D 3CFJA 5ID1B 3ARFD 4KROC 1PKQB 3SGEH 3GKZA 2FD6H 2NY3D 4NSKA 4OCWH 1EEUA 2BNQD 3VFSB 4EI5A 4JM2A 2OP4L 2RGSA 4M4PA 1TETH 3BGMB 1NKOA 4GH7B 3V5DA 3U6RB 2VXSL 4OLUH 4EVNB 5E5MA 5KOVC 1XIWA 4OZGB 4Q9RH 2DICA 1UM6L 1A3RH 1FNSL 4JZOA 1KNOB 2KZ1B 3TO4C 5CINL 3MJ8B 4H5SB 3UC0L 4KJQD 2XWJA 1IQDA 3V52H 1TITA 2GTZA 3WHXA 3DNKA 2WNGA 1YA5A 3L3OB 1S7UA 3EDEA 4YBHA 5EU3B 1EUTA 2IAMA 2HT3C 4LIQH 4EJ1C 3GMLB 5D2NE 3S34H 4JREC 5C09B 2FYYB 2G2RA 1XFPA 3MJ7A 5CSBA 3JTSA 1I8MB 1G9NC 5D2LA 3WJJA 3ZKQD 2VDNL 4Y4HA 3U4BH 2Z8VC 2EXWC 3CXHJ 5EBWA 4D9LH 2NPLX 3PGDA 1P4IH 1RURL 4FG6C 3M07A 5F1IA 3RL2B 4OLYH 1ZLUK 5K9OA 1FE8H 3S4SA 2Q3AA 3EJZC 4ONHB 4F7TB 1KB9K 4OF3A 4FOMA 5C1MB 3OKDB 5LAXA 4MXVE 5F1SA 3FQWB 3D39A 1CVRA 3MRJA 1NBVH 3DUSB 3O3EB 4ELMB 2B1HL 5KG9B 4E41E 1DEDA 3BKYL 3ZHLA 4JY4B 3PP4L 4LAQH 3QHFH 4XVUD 3QCTH 1DQQB 1ZGLA 2HYMA 2X4UB 2BCKA 4FABL 1K9TA 1TCRA 3L3JA 1HHHB 4WI8A 1BGXL 1Q9KA 2F53E 3MO1A 1A6ZA 5BVJB 3RU8H 5FM4A 2HMID 1CFVL 4UI2A 5J12B 3NZHL 4GSDH 4MA8L 1A4KB 3GJFA 5D7JD 1H9VA 3UTSE 3BZFA 1XGYL 3UYOD 2OSLB 1WGOA 3ZYJA 5ENWB 1ZHKB 4QF1A 4GUPA 4MQXD 2DQHL 3HRZB 1R3LA 4C56A 4IRJA 4HJGB 1RUAH 4Y4FC 4HF5L 5E08H 3MLYL 4MCYB 2Q7YA 2VL5A 1C08A 1AO7A 4IRSD 4TVSa 4XNMA 2CSPA 3UROR 3SO3C 1T5WB 3NZ8A 5SX4I 4CADA 1MREH 5CWSB 2AEPH 1X5HA 4JVPA 3N1QC 4O5LH 2R2EA 5KVFH 3BUYA 3ZE0F 4ZFZB 4M6OL 4YR6B 5LGJA 1QLEL 3BN3B 3BEVB 3RVXD 1QQDB 4PJ7F 5JDSB 5DI8B 1FFPA 3QH3A 2CMRL 3AXLA 4XAKD 2VC2H 4EZMA 1ZT1A 5E1AB 3SE9L 5HY9B 3L7FB 3LN9A 4TUJB 4NPYA 3VE0B 4HGKC 5FUCC 3WL9B 3FFCA 2Y5EA 4PJHB 1KIQB 3F7RA 3QB7C 4NUJA 2CUIA 1PG7W 1JPFA 2MKLC 5CZVH 2OR9H 3S96B 3VD5A 3SY0A 4LCCC 1MRDH 5BV7B 2XWTA 4NKDB 4JLRB 1AHWB 1F42A 4HWZB 3MRGA 3FCTA 4KI5E 1A7BA 5I76B 1C5DB 1KSRA 3W39A 5BO1L 4PJFA 4KJYB 4KY1H 5EZLB 4KQ3L 4MZ2A 4Y5XB 4MVBD 4NC1C 4JRYB 1JGLH 2YD2A 1SMOA 4P2QA 1JGEA 1T22B 2DLHA 5IESH 4P2RD 5GRUH 3WFHB 3V6OE 4YPGB 3KWWB 4IIQA 4HGWA 2HWZL 4IJ3B 5DWUL 1GYAA 2PW2B 4PJEE 1QSFE 5CHNA 2F19H 3U7YH 3OKNA 4DGVH 1F4XH 3RJQB 1A5FL 1C7SA 3DXAB 2YXFA 1P5UA 3UMTA 2PO6B 3D2UD 3ES6A 2VMFA 3PIQA 2OLDA 5IB3A 5BW7A 1F6AA 3SO5A 4KHXH 3J8F7 4LIQE 1WBZB 2P7TB 5C0IA 2NY5L 4U1IA 4IDLA 4U7KA 1IFHH 2QV2A 2YUXA 3BZDA 3QUYA 3GBMH 1EEYB 2JJTA 4U49A 3UBXA 1GGCL 4HLZG 5J13B 3R0NA 5DJ8B 4YHYB 1K2DB 1WWWX 2ICEA 3E1F1 2GEEA 3TT1L 5JW3L 5HDOA 5DLMH 3QIUC 4WRLA 1S5HA 4HUWA 1L9NA 4PRIB 3SKJH 4UNUA 2OTWA 1DUZB 3MXVL 4LHQB 3GO1L 4QYOA 2EE6A 2Y6SD 3WFBH 1P6FA 4GXVH 1FORH 4Y19B 5FYJH 4EN3C 2AK4A 3D3VD 4WENB 3WMSA 3PXHA 3K1KC 4R4BA 3U4EA 1MQKH 3TF7C 2DWEB 4GBXB 2R0ZL 3L3IA 1NCCL 2DD8H 5LKNA 5JQ6L 4RMQA 5TDNB 1JF1A 4U1GB 5DRWB 3FFDA 4LHUA 4JZJB 1U93B 3MZTA 1DL7H 2FEEL 3H42L 5IK3A 4MXQC 5MEQA 4OZHB 4Y4KD 4ERSH 3LD8C 4DOHB 4XVSH 2R2BB 2XTLA 1MCCA 3TBWA 4HZLA 4G6KH 4Z5RB 1RJLB 4P3DB 1X4XA 1KPUA 1GH7A 1VKXB 2C4FU 1CICC 3I6KA 4OKVA 2NY2B 4M7ZB 3QEQD 4XNQA 1CGXA 3G6AB 2PCPA 5FUOL 1A9EB 2CKNA 3T2NH 1YEEH 1T7VA 5IJKA 3SJVA 3MOAL 3REWA 1RIUH 3CVHA 4NNPL 3QO1B 1CIDA 3Q3GA 1J05B 1DLHB 2Q6WA 3S36L 1N0XH 3TV3L 1NGXB 1Z5LA 2KKQA 2VR4A 3KPPA 1MI5E 3GMPA 1MRCH 1ZA3A 5EOCL 2G5BB 1X9QA 2IPKA 3B2VH 1A6WL 5B8CC 1H8SA 4PJ9B 1TCMA 5F44A 4OI7A 4U6XA 3SDYL 3ZTJG 5DJDA 3DHMA 5JHDB 3WKNA 3GGWB 1OAZL 1H8OA 3T08A 2DKSA 5C0JA 5EA0H 2EIDA 1FN4A 4QGYA 3V8OA 3VGAC 4ZUUA 3EYQD 4UOW1 5KOMC 2A9NL 1S7VA 5EIIA 2NR6D 3ILPB 4RAVA 1K5NB 2PYFB 1G6RL 5TE4L 3WHE0 3HMWH 1WWAX 4ZTPL 4HT1L 4WW2F 1BX2A 1T83C 1JHKL 3FL7A 1QNZL 5FXCH 1NC2A 1MFCL 2PTTA 1NCTA 1YPZB 1WVZA 4OZFB 2NXYD 5D1QA 3IKCB 2GIYA 1RK0B 4P5MB 1ZVSA 4LQFH 1MH5A 2X10A 1M7DB 5E95B 1QHOA 1JNNH 4DVRH 5I1GL 4OLZH 3MBEA 4CVWA 1I7UA 5CJBA 3X17A 4DQOH 3SE8L 2X1XR 4AIZA 3FQTA 3KPOA 3MLRL 4PJ5A 1T7XA 5AYUH 1ZT7B 3V0WH 4F7PB 5F9JB 1JWSB 3N1GC 1NAMA 2ZCLL 3T4YB 1KT2B 1BQLL 3MYJB 4FQ1L 5BQ7B 5L0QC 1JYVA 2XACC 2NY0D 5GS0H 1YC7A 1EXUA 2V9TA 3VGFA 2A1WL 4DZBA 5I75C 5HYJB 3OX8B 1HHJB 2APWA 1CLOH 3MFFA 3VJ6B 2VZOA 1MQ8A 1HZHH 4L4TD 4Z77A 1UCBL 1V05A 4RMUA 1SJXA 3KJ4B 1VADB 3FONA 4ZTOH 3C60D 2NY7H 4RMTA 5DMIL 3STLB 4HG4J 3L3KB 2Y07H 4P4KA 4QO1A 4FQJL 2FNBA 3QDME 4U6YA 1EV2E 1DVFB 4NQEB 1BZ9B 4JFDD 1H3WM 3QI9A 4QXTA 2PO6C 2VB5A 1SYSA 3GUTA 2BY3A 1F3JB 4A2LA 1KENH 2BOBB 2GCYB 3P30H 2G60H 4FTVA 4R90H 6FABH 1F90H 3KPTA 1XGRA 1JVKA 1AC0A 3PABA 4KZEL 5ICZB 3GSXA 4LSDA 5EOCJ 1D9KC 5KANG 4NQVB 3FO9B 5JNYA 1JGDB 3EFFB 4GMSL 4U6TA 4HUVA 1L7TL 1OB1B 4OCXL 4YHYC 3R06B 3KR3L 2AJXH 3DSNA 4U0QB 5E6ZA 4QTHB 3T09A 1NQBA 5J4MA 4HUXB 5FYJE 2A77L 4KJWC 5EU6B 1UXSB 5GGVY 3F12A 5D5MF 4XNUH 4WO4C 4PJDF 4XNZB 1U3HD 4JKPL 1HH6A 1JJUA 2VLRB 3G5XB 4A6YA 5F9OH 2X4TA 4OKDA 4GBXC 3CFJB 3OKOA 3IFLL 3S37X 2ATKA 1L9MA 3LDBB 1ADQL 4YC2C 3TIEB 4M1DH 3VG9C 4S1QL 1A6VH 3AU1A 5T1DH 5ESAB 5DHVA 3LVEA 1P7KA 2AJVH 1VCAA 3H7BA 1NL0L 3V5DB 2O5ZH 1B0GA 1YQVL 5E5MB 1GL4B 4XAWH 1XIWB 3RX8A 5D7IF 1EK3A 1RVFL 3D25A 5E7FA 1S9YA 4YXHH 1FRGL 1IC7H 4UTBL 3WO4B 1QPXA 2EZ0C 3S5LB 2XWJB 3CSYA 1IQDB 2GTZB 5A3ID 2A2QT 3G6DH 4XCCL 1JYXA 3TZVD 4ORGA 4F8TA 1G7PB 1TZGH 3QIBD 4MXWH 1BQUA 1N4XH 5D6DC 4GAYA 4N8CH 1X5IA 3EBAA 5CJOL 1HHKA 1KG0A 4N0UE 2G2RB 1F13A 5IVZA 1A6UL 2AJSL 1JZ4A 1FNHA 3GSUA 4GG6E 1JYWA 5J89A 5JZ7C 1W8NA 5EBWB 1KPRB 3PGDB 2CLVA 4JANA 4JO3L 4H8WL 4PTTA 4PP1C 5K9OB 3BD4A 3S4SB 3NFPA 5LAXB 2R8SH 3GSVB 3D39B 3WXVL 2HTKC 3QFJE 1J9CT 2EDRA 4OLXH 3MRJB 3CUPA 2A6DA 4JB9H 1D5XA 3D85B 2NNAB 3RIFK 3TYGL 3DRQB 4HPYH 5K9JL 4L4VB 1XF5A 5F7KC 2VZVA 3N85H 4DN4L 3WNKA 1LQSR 5H8DA 2AJUH 3TN0A 4TULH 4JGUA 2BCKB 3N0PB 3E6FA 1NCWL 1P5VA 1Z2KA 2WUCL 3GHEL 4JFXA 3O9WD 4L1DA 2VSCA 4OB5H 1A6AA 1TCRB 3L3JB 2CUHA 4ZD3H 1Q9KB 5CEZH 5JPNA 1A6ZB 2F53A 5BS0D 4HDIA 3A6CL 1PG7L 5IBLD 1LP9B 3A0OA 2H1PH 3GJFB 3BZFB 3NACL 3NCJL 1JNLL 4ZO6A 2OJZH 2IBZY 3BAEL 5FYKD 2XWBA 4FMKA 2APVA 1NFIA 2FDBP 2W0PA 4JFEE 2EDLA 2BNQE 1R3LB 2P5WA 1Y6KR 3WN5C 4R3SB 3WIIH 1C08B 1N2RB 1AO7B 4XNMB 4U3HA 3VA2C 3WFEH 1T2XA 3VDAA 4CADB 1T1XB 4BSVA 4P57A 2WQRA 1HQ4B 4NBXB 5EU5A 4N0CD 4PLOB 3RA7L 3BUYB 3O3DB 4U1KA 4MX7B 1WEJH 1E4WL 5CIPB 2JKXA 3VXTA 3DETC 4NO0B 3RAJL 3FO0L 1YUHA 4O58H 1A0QH 3GHBL 4WEMB 1A7QL 4G5ZH 1KLUA 3HC4H 3QH3B 4M1GL 1J8HE 5ACZB 1ZT1B 1OPGH 4JM4H 1WTLA 4NPYB 4M5ZL 3CD4A 2VLJD 3FHQA 2VLLB 3WEXA 4OI9A 4TRPH 3FFCB 3ZHDA 3HZYA 5LG1A 5E6ID 3VXOA 4NJAL 4FFWD 3ETBF 5EN2A 2EDFA 3SY0B 5I73C 1YEJH 2YD9A 3VWJA 5J06A 1T7WA 1MEXH 1JMZA 4PJIF 2ZPKL 5D96C 4AMKH 3MRGB 3FCTB 1AFVH 2X1QA 5IBTL 4PJFB 4AT6A 5TPWH 4XC3L 2ZP0T 1TNMA 5GS1A 4PR5A 4FQXC 4UNVA 3PGCA 1CXHA 5K93A 4Z7OE 2QBWA 3C6LD 4F3FA 4LCYA 4AEFA 1GHFH 3VRIB 2WMPA 2MNUA 1LDPH 1JGEB 3KYOA 4P2QB 5D9SA 3GK8L 1U8MA 4LSQH 1R5IA 1MIEH 3LDBC 3V6OA 4PLKC 4HGWB 3EYVB 3IU4H 5F97E 2MWCA 3HUJF 4EI5C 4PJEA 4JM2C 2O61A 1QSFA 1T7YA 4LNRA 5CHNB 1CE6B 3U36B 4YDKL 1CVSC 4HZAA 4Y2DA 3WXWL 1XIWC 2ICWJ 2XZQL 2ADFH 1N5AB 3ES6B 3ZYZA 2X9YA 3HI5H 5C0AB 4KWUA 3SDAC 4FZEH 4KTDL 5HGBA 4LKXB 4NHCL 5F8RC 4HWEL 3FZUD 3X13A 4JHAL 5C0IB 2K7PA 3V5KB 4HBCH 3WD5H 1PGRB 4XTRC 2H32A 3RDTA 3TWCH 1UB5A 5FA3A 2WWKT 2IAMC 2ICEB 2MFNA 3QXWA 5K59F 1QYGH 1TDQA 1YNKH 4QTIH 3VFTA 5ADOH 4M62L 5HYEA 3K80A 1EHLH 4HXBL 4BUHA 5IFHL 3WJJC 4Y4HC 4RGNC 2OTWB 4QYOB 2UV3A 4XPAH 4NT6A 3PP3H 3DGGA 4JPIA 1NEUA 4G7VH 4AM0A 5DZOA 1CU4H 5KSBB 1YMMD 3AB0B 4CMHB 2A9ML 3L3IB 4HS8H 5IQ7L 3DPBA 5CGMA 4DCQB 3FFDB 12E8L 3SE3A 4JAMB 1MSPA 5IK3B 3MNZA 5MEQB 4POZD 4S2SA 1KB5A 4Q0XL 3BSZL 4HZLB 5JO5B 4Z7QE 2P8LA 1KPUB 4PV8B 3I6KB 3EJYD 4XNQB 4RIRB 2PCPB 5HHVH 4UQ2A 3O8XA 1IAIL 2F8XC 1NMAL 1MFAL 4Y16B 3SJVB 1HXMA 1NUGA 3CVHB 1U8NA 4U3XA 3W11C 1XZ0A 3Q3GB 4EUPB 3B9VA 3VXUB 3MJ9H 1LO5A 3H3BC 4OCYH 4P2RE 1AGCA 4GRLB 1NUNB 3W0WA 2DDQH 4K23H 5HHXL 1Z5LB 2HT2D 3GSOA 4TN9A 1ZA3B 1RUKL 4LPCA 3GIVB 3RWGB 4JFOA 4Q2ZB 1PYWB 3ZHKA 4S1SH 4IRJC 4X6DE 4PY8J 4NHUA 4U6XB 2H6PA 4PB9L 3DYOA 3QG6A 1IVLA 3HMXH 5FGCB 3LN5B 1C8PA 2RCSH 4L3ED 1FGVL 2FX9L 5DJ6A 1IC4H 4ZUUB 4XB7A 5AG9A 5DZNA 5IMMA 5EIIB 4FA8A 1MUJA 5E8EA 1AI1L 2YK1L 4XCNA 4R7NB 1A4JB 1DQLL 1PG7X 1T1ZA 3QQ9C 4NN6C 1B6DA 1TVHA 3DVFA 4JQXA 4PUBL 4UBDC 3GEWB 1NC2B 2PTTB 3N9GH 3DVNA 3GI9H 5A1AA 1E4KC 1UCTA 5D1QB 4P46A 3RFZC 1P69B 3B4NA 1F2QA 1RZKL 1ZVYA 4HS6A 4LASH 4ZQKA 1PVHA 1INEH 3PXJA 3V7AE 3TNMB 1G1CA 3MBEB 5MEPA 2A6KB 4EI6B 1I7UB 1A7OH 4AIZB 4GT7A 5DD1L 4APQA 3G5YA 4KXZI 1J18A 1WISA 2Q3ZA 3NH7H 5DSCB 2K9UA 2OBGA 5AZ2H 1JHTA 4WWID 4GMTH 3MRQA 5JQHC 2CD0A 2YS4A 3OAYK 5HVHB 1RZFH 2YD6A 5T3ZH 3I75A 5C0DA 4DZBB 5FEBA 4ODTL 2CKBH 4RGMB 1QP1A 3QEQE 3HG1D 4PBWD 3MFFB 4J4PD 3LEYH 1BPVA 1T5XB 4KAQL 4E5XB 1A47A 3T0BA 2C1OA 4IIQC 4Z77B 1QFHA 4L8SC 2BXZA 4FN0A 2VZTA 3MODH 1ZANH 4P4KB 2CXKA 2PETA 3JV4A 4B5EA 2Z4QB 3TIDB 3QI9B 3Q5YA 2FWOA 3A67H 3CSPA 3GUTB 1LNUA 3OL2A 1CD1A 4XPFL 3DV4A 2UZYB 1T0NB 3VWKC 1CFNB 3T0AA 1QLRA 4FTVB 2B1AH 1U42A 3MCKA 3T0ED 2Z35B 2ZSVA 3V6ZA 3QFDB 3BKJL 1ZOXA 4QHNA 1XGRB 3WUWA 1HINH 3TBYB 3SKUD 4MA7L 4LSVH 3PABB 3GSXB 3QUYC 5JXEA 3DX8A 5CBAA 5JNYB 2JJTC 1CLYL 1LEKA 1N8ZA 4HUVB 4C59B 3L3HA 4HUMB 1EGJA 5TJWK 4BQ8A 5LXGH 1IGYB 2Y23A 2ZKHL 3ARBC 1DDHB 1ZHLA 3HZMA 3F12B 4P9ML 1UVQA 3G9VA 3T1FA 4ZNEE 5I30L 5DDHA 3BD3A 4PRNA 1Q0XH 2ZOKA 3AB0C 2HJLB 5SWSD 4LSUH 3H3PL 2X4TB 5DA4A 1ZGLP 1FNGB 3VFUA 5CBEA 4WU5B 3ABZA 4KK6C 1EBAA 2R0WL 4R4ND 4H0IA 2XRAL 1RZJH 3GIZL 2FSEA 3AU1B 4U1HA 3O11A 5DHVB 4JPKH 1NC4D 1P7KB 2QR0B 3BIAX 3H7BB 1FLRL 2C4FT 4LLQB 4LRIA 1B0GB 1YEKL 5DVNA 2CLZA 4CMMB 3GM0A 1GSMA 2GITA 4M9PA 4XGZA 4O2FB 2EXYC 4NCC1 3RIAF 1YEIH 3D25B 3BKCH 1P84K 4N0YH 1PX3A 3HZKA 3MLTA 1S9YB 2WIIB 1BJ1J 4MAUL 3O6KL 4I3GA 5J1AA 3B5HA 1G0XA 5CCKL 5IJKC 4HKBB 3EGSA 5F6IC 1BFVH 1E6JH 3ET9F 5E4EC 4BQBA 4NKOA 4ORGB 2E6PA 4LVHB 4N1HB 4GAYB 1I3VA 2W1NA 3LKPA 5FGBA 1DLFH 3OJMB 4PGEB 4M7LL 4L4TE 1HHKB 1KG0B 5D2NB 3RWCA 2WIMA 1OSZA 4CW1B 1SJVA 3IDXL 5D7LD 2FGWL 2FRGP 4PJ8B 4GG6A 5T1KA 5B4MC 1KTDA 4X5XA 2DYPA 1PD6A 1MCWW 4JFDE 5L2KE 2CLVB 4JANB 1YJDL 4PTTB 5KS9A 1AC6A 3BHBA 1DCLA 2DM7A 3QWRA 5E8NB 4OZFG 3ARRA 3GSNL 3QFJA 4KKLC 3CUPB 2A6DB 1GC1L 5I1IH 1X5KA 1C5BL 3W2DL 1U8QA 1WZ1H 3BD5A 4E41B 1MCOL 2D2OA 3MRFA 3MCLH 1YY9C 3VFOA 1OTSD 3TN0B 1P7QA 3M45A 4IOFC 1DBKH 1HHGB 4PJAB 4YFLF 2I5YH 4JFXB 2CGRH 5K9KA 3GSWA 5JPNB 5F7EL 2F53B 4LSSL 4OFDA 4YDVA 5CSGA 1S7WA 1KF9B 4M8QA 3MBEC 2FCBA 5TF1L 1C7TA 2NY4C 4TNVK 4F80A 4DZ8B 3MA9L 3RX7A 2VOTA 3UTSB 3K81A 1MCQA 5A16A 3ARFA 4O02H 4PJCF 2L7JA 1TTFA 5IFJA 3QXDA 1JZ6A 3BPCA 3OF6A 4LQ1A 4E42B 2BNQA 2GW5A 3AREC 1JWMA 4K7PY 1IT9H 2NW3B 2C3WA 4PRHD 1UM6H 5C8JB 1FNSH 5BJTB 3GMNA 3T2PA 1T20B 3RWEB 1FGNL 2BX5A 5ETUB 4X9IA 3EUUA 4JFFD 2P42B 4Z7UB 1QFPA 5INCB 1ZS8B 2XY2A 1LE9B 3HC3L 2UWEF 4K3EL 3JV6A 5GRVK 1LE5A 5DK0B 4BH8A 3IDMB 3QI9C 4M6NH 3NIFE 3IDIB 1YC8A 3DVIA 3QQNA 4P49A 1UZ8A 2SEBA 4XWOC 2NYYD 2PKDA 4X4ZA 4PG9A 3BW9A 5E9DD 4YHPB 2R0LL 4M03A 4UOW0 1ND0B 2AXGB 3HE6B 1AKJD 3MGTB 1P1ZA 2E8YA 3HZYB 4ZAKB 1A9BB 5IMOA 5EN2B 5HHPA 2HJFA 3O3UN 1FO0L 4OFVA 3BKYH 3O45B 3ZTNL 5GS1B 3PP4H 4PR5B 1YEFL 3PGCB 1UWEL 5DS8A 4PTUA 1OAQL 4ZXBD 3NMEA 3MNVA 3SEPA 4FABH 2Q86B 3KYOB 3QO0B 4LSTL 5D9SB 3LB6C 1BGXH 4XHJD 4YDJA 4Y5YA 1U8MB 3O81A 4P2OB 1OWWA 5MHSE 3EOBA 1CGSL 3QIWB 4NGHH 4WFGE 1R3HB 3V9FA 1XGYH 2O61B 1QSFB 3S5LG 1FPTH 4JRXD 4RAHA 4Y2DB 4DUVA 3NGBB 3LQAH 4UIKL 5FYKE 2VDQH 4YHKL 3SDDC 4EEEA 5CP7A 1AQDB 2NZ9C 3UTTB 1AH1A 3KLDA 3MLYH 4H26B 4KUCD 1YMHA 3IXAA 3CX2A 3CFBA 3S8WA 4HXAL 4FQPA 4DK3A 4JO2H 5GZOC 2H32B 5DJZA 2KH2B 4IRSA 4Y5VA 4I18C 3RDTB 4JJHA 5FA3B 4R7DA 2W65A 4I4WA 1LEGA 5IHUH 2UVFA 1QFUL 4TUOA 1XF2A 3S4SG 3DVGA 3MNWB 3QSKB 4KZDH 2CIKA 2VYRE 4NT6B 4DVBB 4AM0B 4U05A 5DT1L 1HXYA 1NBZA 2HJKA 3HB3C 3CC5B 4PV9B 3B6SA 3SE9H 1BECA 2HG5B 4XP5L 5FV2A 4P59L 4J8RA 1QO3A 4U1MA 1UWGH 3VFRA 1PZUB 2XY1A 3NVQA 4ORZC 3CLEH 3MNZB 2CDEA 4K8RH 1L0XA 4S2SB 1KB5B 4P5TD 5E2WH 3DI2B 5ITBH 4UT9L 1DP0A 1CL7L 3TN0C 2W38A 5IMLB 3PL6D 4P2CG 3O8XB 4KQ3H 3MXWH 2QQLH 1HXMB 1U8NB 5DXWA 4ISVA 1QEWB 3QJHA 2GFBA 1LO5B 2YUVA 1AGCB 4P2RA