4LSTH

Crystal structure of broadly and potently neutralizing antibody vrc01 in complex with hiv-1 clade c strain zm176.66 gp120
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
224
structure length
222
Chain Sequence
QVQLVQSGGQMKKPGESMRISCRASGYEFIDCTLNWIRLAPGKRPEWMGWLKPRGGAVNYARPLQGRVTMTRDVYSDTAFLELRSLTVDDTAVYFCTRGKNCDYNWDFEHWGRGTPVIVSSPSTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN GP120 of HIV-1 clade C
publication title Multidonor Analysis Reveals Structural Elements, Genetic Determinants, and Maturation Pathway for HIV-1 Neutralization by VRC01-Class Antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 36
structure length 222
sequence length 224
ec nomenclature
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lstH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lstH01
5F1IA 3UTQA 3ZDZF 12E8L 1F42A 3O3AA 1W2KT 3EDJA 1F3DH 2AI0L 2KBGA 4JFFA 4N0YH 5GRVK 2JJWA 3OAZK 3IVKB 4YC2C 3FFCE 1S7XA 1TPXB 4WFGE 5HXMA 4RMSA 1UZ6E 2CLVB 3IFOA 3SDDD 4YHNA 4RNRA 4HV8B 3L3IA 3DXAE 1MFEL 2VITA 2H8PB 2XKNA 3OAUL 4LVNC 4Y4FC 4EDWL 3QJFA 3GSUB 3D2UA 1DVFB 4G3YH 5IB2A 2NY3C 1XH3A 4QRUA 3IT8D 4HS3B 4HIJB 3GK8H 3WE6B 5J06A 1DP0A 2X4SB 5JA9A 3QRGH 3KPQB 3V4VH 5IROC 3JWNC 2QR0B 5GGUA 2XFXA 1FNEB 3GSNH 5DD5H 4WJ5A 2XI9A 2QTEA 5HDQL 4WEBL 4YHIB 5F7HA 2NR6D 4OQTL 3MBXH 2AK4E 4NSKA 1A1MA 5FYKU 3AAZA 1AI1L 1RHFA 4WUUB 1KB5B 4P2RA 3ZTJH 2IEPA 4JO4L 3OJVC 4K71B 1NLBH 3HE6D 1B9ZA 5EU6A 1KIQA 5T1KB 3UTZB 4X6BA 1KIRB 1TJGL 1YEHL 4P9HL 5GGSB 3UJIL 1M05A 5HPMA 4AYFA 1FLRL 2NPLX 4Y5YC 3FAWA 4CJ0A 1VFAA 4KZEH 1NCBL 2RFXB 5IVOA 2AQ2A 1A7NH 3RU8L 4AIZB 4I48B 4O58H 4P5KB 4NHCL 2HT4D 1FIGL 3ARDC 1A6TA 4OLVL 2O61A 1PQZB 2CSPA 3HE7C 4MGXA 1DQTA 1YEGL 3PIQA 4PJGB 2J8HA 4P3WA 1RURH 4PRPB 1HDMB 4ZODA 2EO1A 5TQ0L 2HFGH 5KVDL 2P5EB 4XMLL 4JQIH 5IT2L 1A3QA 1Q9KA 2ILLA 3FJTA 2R4RH 3IJYA 3ULSB 2ENYA 3WLBA 4NDMA 1NDGB 1QLRB 3P4MB 4GUPB 1UQSA 1QKZL 2APFA 3BIKA 1J10A 4NQUA 4MQ7A 1W0YT 2Z8RA 5I0DA 2A6IA 4P3DA 5F9OH 5C92A 1EMTL 1G0DA 2FX7L 3SGEH 2VDRH 4S1SL 4AEEA 5EN2A 3ES6A 3HCVA 2MKWA 4N5ED 1LO5B 1TTFA 5EORL 1V3JA 4D3CH 1IM3B 5L2JA 4WWID 1YJDH 3SDXF 2CXGA 4UINH 1NUGA 4YEFA 2E7LA 2F8VA 1Z3GH 3RZCA 4P99A 4XT1C 5GS2H 1SJHB 3TBSA 3QZWA 3QUKB 7FABL 3VMOA 1CDIA 4JKWA 4RGOH 4PJEF 5D1ZD 1IAII 3IF1A 1S9XB 2ZJSL 2XPGB 3MR9A 5EA0L 2JLLA 3CDCA 4FA8A 3KXFA 3A6CH 3MUZ1 4MA1C 5DD3H 3D6GA 3MRBB 3F6LA 3C6LA 5B38B 3X12A 1ACYH 1ORQB 1KELL 2GJZA 5BS0B 4YQXL 3GI9H 1HHIB 4LRNL 5DJXA 5DRNB 2WNGA 1MCPH 4OBSA 1A0QH 4Q9RL 4O51A 3D25B 1MCFA 2ATKB 3P4OA 1X5ZA 1WAAF 1ZAGA 1BFOA 2I9TA 5F9WC 2QQNL 4IRSD 2XKSA 5C0AA 1KTLA 3RDTC 5DJ8B 3WIHA 2DQEL 2DWDB 3HI1A 5C0CB 5IV2B 4RBPH 5GISH 1XF1A 1PZUB 1KN4L 1P9MA 2MMXA 1FO0H 1D5IL 1JWMB 5LGHH 2VAJA 4OUOA 3GUTB 3QPXH 4U6XA 2GIYA 3B9AA 4ORZC 2QSQA 1N0LA 3CMGA 3QFDB 3DVGA 2EH8L 2UYLA 5DK2A 4WI3A 2P43B 5IVXF 4OV5A 4PJCF 5BRZB 4NO3B 3QCVL 3WEXA 3I75A 3EO1A 3QXWA 4MJIA 4L4TB 4YIQA 4R6UA 4IRJB 1LDPL 5C0IB 3MLPA 2VKXA 1QFOA 4N8VB 3OR7A 1JK8A 4YDJB 1ORSB 3KPSE 5DUML 5CILH 4PJ5D 3TO4D 1CLOL 1W72L 2MKLC 2XWJB 4JM4H 4UQ3A 1XF4B 5IEHB 3U6RB 1HQ4A 5J6HB 1JI1A 2WUBL 1OD9A 1T66C 4OT1L 4TUOA 3GNMH 3DYMA 4M8QA 2X1OA 3RPIA 1NAMA 4P59H 1C16B 2ATPB 1MAMH 4FQCL 4R2GB 4OF5A 2FGWH 1RV6X 3KPOA 2PXYC 2EDKA 5CEZL 3CSGA 1F8TL 4BQCA 3ARGB 1ZE3C 3WKMH 2YKLL 1QRND 1ONQA 4RGNC 1R5IB 4WI4A 5GHWH 3CCHB 5I1CH 2C7UA 4QHNB 4KI5F 4FRWA 2E7CA 2ESVD 1TNNA 2YRZA 1S7TA 4HS6A 4OGAC 5A3ID 3GBLA 3FT3B 4NOFA 1T04B 2GJJA 2GFBA 4G8IB 5HHOE 5JXAH 4UILH 3M1BB 1Z0MA 4KUCF 2F58L 4LF3B 1QSED 3UP1A 4ZPTB 3RPKA 4C4KO 4F7TB 5ESAB 2W65A 4OV6F 2GK0A 1IILE 3O2WL 3WDJA 3OGCB 5GRYA 5JIKA 4ELME 4K9EL 4IIQB 4HPOL 3QQ9C 3CU1A 4Z95H 3BYTA 4YBLC 3L5XH 3CFEB 4P9ML 3LIZH 2GEEA 2YK1L 3FN0L 3MRCB 2IBBA 4OZ4A 3GSNB 1UWGH 1NCCL 4ZTOL 4OZIB 5KG9A 5CP3A 1MIML 4NO5A 2I27N 1CDCA 4KQ3L 4HGMA 3P4NB 1EVTC 2CMRL 2FL5B 3MLWH 1IM9D 5I15L 4U1KA 1QR1B 3CXHK 1MH5A 1CWVA 3UTTD 5E99H 1ZS8B 5JLZA 2P5WE 1KXQE 2DI9A 1B4JH 3T4YA 3GMQA 5I9QB 3SJVE 4GAJH 2VDLH 3T0DA 4M00A 4L8DA 2V5MA 4RZCA 1C08B 2YBRB 1TVDA 5DD1L 3VDBA 2BERA 3C09B 2AJUL 1U6AH 3MUHL 4G9FB 4KTDH 5DRWA 2M2DA 1O7VA 3H42L 4JY5H 4NQXA 5D1ZA 3SKUD 2AXGB 1QBMH 5SV4A 3RWJA 2QKIA 1I3RB 3FFCD 2GKIA 4H1LH 3KG5A 4OUUA 4YHLL 1QG3A 1NBYB 1F97A 3EZ8A 4W6YB 1D3CA 4JG0L 1R3HA 32C2A 1OAYH 4HK0A 1L6ZA 1N59B 1R3KB 3DSNA 4MLIA 3VXNA 1IGYB 4K3JL 3T3PF 2P48B 1YY9C 3GIZH 2BVQA 1SEBA 3IGAA 4U1GC 3MRJB 3TN0B 1OOAA 5BO1L 2QJDA 3VRLE 2IANB 4IRSA 4WI9A 5T3ZH 1WEJH 3HUJF 4JRYD 5EZJB 4R0LB 5E9DB 4DKFH 4F15C 1IFHL 3BD5A 3D9AH 2BFVH 4XP6H 1IE5A 1FLTX 4NWTH 3PHOB 2VDPL 4B0MM 3QUYD 4Z78A 1EVUA 3GKWL 3IKKA 2F19L 1AGDB 1Q9OA 1KF9B 1BOGB 2Q76A 4Y19B 4XVUD 3VE0A 2X9YA 3LQAC 5J8OA 5IBLC 3O2VL 4HKBA 5C0DB 1CTNA 1S8DA 3ARED 5FGBC 3ZYOA 4Z6AT 1RSFA 3INUH 2DTML 1KGCE 3QCTH 5AEAA 3ISWA 2CR3A 3MUY1 3RAJL 4PJAE 2HRPH 4O9HH 3RNKB 2BVTA 2EH7H 1FPTL 2R39A 3B9KB 1NDMB 5IR1B 3LHPL 4U49A 1T0NB 2J8OA 3O81A 3TO4A 4PJ5A 2ZUTA 4QT5B 5TF1H 3DRQB 2LAAA 5FFLA 1EHAA 4MNQE 1EA9C 1LD9A 2VE6A 1MRCL 3VD7A 2V5RA 3QDMD 4R96B 2YHGA 5FO9A 2L0DA 5IKCB 1P4IH 1Z6JT 3BN9C 4WTWA 5DJDB 5KSUB 3SDAA 1U8NB 1G9ML 2HRLA 3RY4A 3C9NA 5EIIB 3MJ9L 1BIHA 4HCRH 3HS0B 4XNUH 5JDSA 1FO0B 4JM2D 3PWUA 1QRNA 2GW5A 4GAFB 2AJSH 3PQYD 2YC1A 1EZVX 1MNUL 1K9TA 3KYKL 5D70L 3SDDC 1A6VH 2AJVL 5I8CA 2ESVA 5T3XL 2P49B 3LKSA 5KSBF 5L6YH 3U30C 1MY5A 3C5JA 4YBQD 4P48A 3CVHA 4KROB 3ARWA 2DOCA 1I8IB 1QSEA 1AD0A 4BH8A 1I8LA 1RK0A 5F88A 1CT8A 2VKWA 4PRID 1MRDL 1RI8A 3BE1H 2XTJE 3CFKA 2A6KB 4ZOEA 2CJUL 4PLKC 5FKAA 1U93A 1T03L 1P7QD 3TH4T 2AXFA 5IJKA 2NY5H 5D7IF 4XAWL 2HKHL 1A47A 4P5TB 1JV5B 3LQMA 2NY4D 1T20B 5GS0L 4LASH 3HE6C 3NOIA 5DSCB 5TDOA 3REWB 1YEDA 4ZS6C 2Q3AA 4MJ4A 1IM9A 1B90A 4NHUA 4DCQB 3L5JA 3UTTA 3DYOA 4MCZB 3MXVL 5BV7C 2BVUA 2YUXA 4G6FB 3W82A 3C87A 1NC4B 4KC3B 1ZK9A 4MXQD 4OGZA 4PTTB 3RVXD 1BFVL 2ORBH 1XGUB 1UYWH 1MHPH 1QSFA 2OJZL 2YA0A 1U95B 3GI8H 4LPTA 5F9JA 2BC4B 5HDBF 4QRQA 2OTUA 3MGOB 4M61B 4W4OA 5E8EA 1G0XA 3PGCB 3KWWA 3RWFA 5TFSH 3FFCA 1FYTB 1BZ7A 2I5YH 1W0VB 3GMPB 1UZ8B 3ARFD 1C1EH 2V5SA 3V6FB 1ETZA 1OVZA 4U7KA 1IQDA 1M7DB 2BNUA 3KPSD 5EU5A 1RZJC 1B6DA 3GHBH 4EVNB 1IAIL 4FQJH 4TOYH 3RJQB 2R2CA 3E3QE 3KLDA 5I1JH 4P2YA 5FUOL 3HMXA 4QOKE 2Y5TB 4MAYB 2DLHA 1KTDA 1PKOA 4NPYA 4JRYA 1ACZA 3RKPA 5E2UL 2HLAA 3D48R 2CLRA 2BVOB 3LB6D 4IOIA 5ESQB 3SPVB 3KPRE 1UCBH 3TT1H 3MGTA 5FK9B 3CJJA 4WV1C 3TT3H 4JRXB 3TCLB 4OZHE 3QUYA 1A4JA 1KLGB 2AK4A 2VH5L 4XAKE 3K1DA 1DLFL 4Y5VA 5IB3A 4U31A 1ZMYA 3L7FB 4NQCB 4ZO6A 1K5NB 1GPOH 1KNOA 4G8EA 3AREA 4XB8A 2BMKA 5I16A 2DQHL 3VXRB 3JV6A 5HBBA 3E6FA 3OKNB 5L88L 4HBCL 5FKPB 2HH0H 3D87B 5FAAA 2R1YB 3UJJH 4GMTL 4Z7NF 4PJDF 4H1LB 5L2KE 4MJ5B 4EEEA 1ADQL 2JB6A 1A3RL 3BKYL 5FYKD 3JVGA 3X13B 4LLDB 4WWKC 2EDLA 3ULUD 1OAZL 1S9VA 1CYGA 5SWZE 2B2XH 4JO2H 1U92B 3CH1B 1FCGA 3WFDH 4TNWK 3NGBC 5C7XH 1UXSA 3QDMA 5DTFA 3W39A 5E2TL 5JHDE 4Y4HC 4PP2B 4UT9L 4JFXB 5IBUG 2CUMA 4MCYA 2HVKA 1JNHB 2DQCL 3IS1X 2FR4B 2PN5A 3W9DA 1E4XH 2I07B 1P7HL 2C1PB 1KJ2L 3PV7A 2C1OA 5DR5H 1NFDE 4OLUH 3RTQD 1ZEAL 5IHZA 5EWIH 2HP4A 2W9DH 4JM2A 5D9SB 4LVHC 1V7MH 2P5WD 2R0ZH 3PQYA 4HPYH 2D4DA 4QYOB 3WS3A 5C1MB 1SVZA 3O2DL 3MC0A 3TO4C 1PZ5A 3GRWH 1BJ8A 1EJ6A 4HMCA 4KDTA 3HFML 3LRSB 1A9BA 4G9DA 5I17A 3KYMB 3M17A 5D2LE 4DK6A 1MFAH 4XP4H 2JTDA 3VA6A 5F6HJ 2EXYD 1IC5H 5EBLB 5HVWA 1BLNA 2XOTA 3FB7A 4WTZA 3QYCA 4FQHB 4U2YA 3SDCB 2D31B 3BZEB 4PJHE 2DS4A 1YEIL 2XWBA 4JLRA 2UZIH 3TJHC 3U9PH 1OGAD 4HKXA 1ZHNA 1TVHA 4NQED 2H32H 4YBHA 4MMZC 3BW9B 4ZO8A 1QFPA 2GTZA 4WNQB 1ZLVH 1F3RB 4I2XE 1XGTA 3W81A 3QEQE 3JWDL 4C56D 1FIEA 1N6UA 5TPWL 4FFZL 4AG4H 5T5FL 2W1NA 3KYNB 1QPXA 4X6CF 4HS8L 3SO5A 4XCYA 4Y4KB 2YXMA 4LBEA 3Q6GL 3FQRB 3PWPB 2YD7A 5HHNA 5GJSH 1RJLB 2LFGA 1S7QA 3H9YA 3LSOB 2Y7QA 3T0EB 4FQXC 3ZE1E 4PLNC 3DGGA 2Q7YA 2Y36H 3OAYK 5DMGC 1CL7H 3Q5OA 4XTRD 3IU3B 1GGIL 4OB5L 3H9HB 4ZFOB 4GRWH 5J6GB 4JHAH 4LKXB 1EBAA 4OLYL 5ALCH 4WU7B 5CD3B 2XY1A 1HKLL 5AG8A 1YPZF 4FQ1L 3DX8B 4TQEH 2P8LA 4HAFA 4M7LT 1ZWIB 5IGXL 3ARFA 4MA7L 5D7JC 5CCKL 3KPSA 3V0VA 3V95A 5EOQL 4N5UA 4DKDC 1OAKL 2KZ1B 1N8ZB 4YX2H 1BJMA 2HTLC 1FVDA 5ICXA 1XF5A 1T1YA 2PF6A 1S9YA 2OBGA 3EOAA 1EHNA 1UXWA 3FFDB 2AXHA 4PJBA 1KTKE 2CDGA 4DKAA 5FV2A 3O3BB 3MXWL 3N9GL 2EE3A 5C8JB 4FN0A 4HBQA 1DBBH 1NCTA 4N0UB 1VPOH 2WIMA 5EC1B 2J8UA 3RX7A 1G9NC 3CNKA 5DC0A 3S96A 5DJCB 1C12B 4OZGB 4UV4L 2E3VA 4UAOB 3U9UA 3ABZA 3FO2B 1DSFL 4JFEE 4NJAH 5H94A 3ZT5A 5C0EA 3TP4A 3HNVH 5F21B 1GHFL 3RWDA 1LNUA 1U58A 3T2NH 1KXTB 3BEWB 5HPOA 4G8FA 5LAXA 3TESA 1L9NA 1FSKC 2XA8H 4KDVA 3KLHC 1AO7D 2AEPH 4PLJC 4DGIH 2FBJL 4C4KT 4YDKH 2BY3A 4F33B 2XNAB 2W07A 4R90H 1UKSA 1DBML 2Z92A 3A6BH 4ENED 3X3FL 1FZMB 3C60D 4I3SH 4LPYA 2YA2A 1X6NA 3UJTH 5FM4A 4POZD 2E9JA 4KKLD 4ELMA 2V7HB 2VZTA 1FVCB 2MFNA 3OZ9H 2XACC 1J87A 1QVOA 4U3XA 1OP9A 3QUYC 1J1XH 1V3LA 5D7KE 5KSVA 2VISA 3NIDE 4RMVA 1CGSH 4UU9B 3GSVB 5K9JL 2G5RA 3B9VA 5KTEL 1NCWH 1AIFB 3AREC 4KI1A 1DJSA 2HJFA 2EYRA 3MJ8A 1WCBA 5T1LB 5E8PB 4DVRH 3EFFB 3RTQA 1MJJA 2OQJA 2ED8A 2ZSVB 2DRUA 3RVWD 2P5WA 1RVFL 5F8RC 4S0TD 3QEUA 5ADPL 4P5MB 4WI2A 3QHTC 5FDWA 4MA3A 3DHMA 5TQ2L 2R0LL 2W0FB 4YAQA 4Y16D 3BH8B 3QQ4B 4V2CB 5EZIL 1YZZA 3OAZH 3LPWA 3MRPA 1J0KA 4X7TA 2M1KA 3VXSB 4LSQH 4O2CA 2DQFA 5FGRA 5H35A 4OM0H 3MYJA 3LOWA 1EAPB 1MVFA 3HR5B 3BWAA 3MRQA 3HLAA 3NPSB 4JPKH 2F74A 2VQ1B 4PJIA 2BNRB 1FZJA 1TZHA 1BAFL 1Q9LA 2Y6SC 3D85D 2ICCA 1E27B 2BSTB 1OGAA 1TVBB 4ONGH 4ZDHA 2VABB 4NQEA 4JM2C 1U8HB 1YQ2A 1Y18A 4CMHB 4I3RH 3CVIH 1OSZA 3BQUD 3PGDA 4KKCC 3I6LE 4AQOA 3SKMB 4ZNCD 4ZYKB 4QOKD 3D3VE 4YK4B 5TE6H 3FAXA 4C56A 1NMCB 5KVGH 3BIBX 4UV7H 4LPCA 1GCFA 3LEYH 5EU7C 3L7EA 4I18A 3W2DL 2JJUA 1K2DA 4U6YA 2DDQH 4RFOH 5BZDB 3KPRD 4M7LH 4TVPL 5TDNB 3WDIA 4JZOA 1MIEL 3U46A 4LSPH 1CLCA 3CXDL 2DTSA 4CU6A 1WWBX 5D2NE 1T1ZB 4F7MA 3ULVL 2BJMH 3VFUA 1IAKB 4Z18A 3GSRA 2W60B 4UNVA 5EUOF 3NCCB 4G7VH 4HK3N 4S1QH 1WIOA 1MHHB 1ZT7B 4NKOB 1JPTH 3MNWA 1K3IA 3EYOA 3UDWA 2NY4C 4PJAA 5EIQA 3MA9H 3CLEH 4H5SA 2DQUL 1JNNL 3MRFA 3DURB 4R4ND 3BSZL 4JJ5B 5FHAH 4ESKA 3PDDA 3WUZA 4GKNA 3DUSA 4XPGH 5I8OH 2H32B 5HDOA 4PR5B 4QRTB 3DWTA 1A6WH 3H9SD 1UM5L 5SWZD 5FXCH 3MRLA 4TNVK 3FOLA 4MB3A 5CJOH 1MFDH 1YEFL 1KJMB 3N1GC 3B6SB 1DQML 5HYIA 3UYRL 3V6OC 5JHDD 1OB1A 3TFKD 2CIIB 4XX1E 1YNTB 4OD2B 3JWOC 5J1SC 2C3GA 3C5SA 3NTCL 1NMAL 1BWMA 1QBLL 1U8OB 5AYUL 3T2OA 4XVTL 1K4CB 1QEWA 2ZUVA 4PRDA 4LSVH 5DVLA 2I26N 4X9HA 1UWXK 1A7BA 1FNSH 5CJ8A 5CWSA 3BDYL 4HJ0C 1PG7W 1YMMB 4Y1AB 5K33A 1OM3L 5L0QC 1P1ZA 5EH1A 2YMXH 4GKSA 1A9EA 2WBJD 1JWSB 4KDWA 3C5ZC 1JRHH 4GRWB 2ADJA 5IG7A 4YFEA 1TDQA 4M5ZH 3U0WL 1PBYA 4PJGE 1R24A 4JFOB 3U0TA 4PRPE 4JY6B 2W9EH 2P5EE 1AO7A 5JMRA 2YD4A 3SKJH 4UT7L 1ZXQA 1I3GL 5HI3C 4HXAH 1C5DA 1UB5B 5B8CA 3C60A 1NEUA 3UZVB 4XVJH 3LN4B 1VKXA 5L9DH 5C6PB 1UH3A 3UTSD 1R3JB 3EOBB 2X4OA 1NLDL 4XHJC 5MEQA 1JPGB 2NY0D 1HNGA 5DMYA 3W0WB 3GSQA 1HINL 2AAVA 3CU7A 1MCEA 5E00A 2A1WL 5HGDB 1YY8B 1SM3H 1DBJH 3H3KA 3FQUB 4XZUB 3VFNA 1L7TL 3VRIB 2VZ1A 4XWOD 5D1XB 1RMFL 2X42A 5JW4M 3QEQD 3ARRA 4HIXH 1LP9B 4NIKB 1MVUA 2XIDA 3U36A 3QWOB 1FCCA 2MQCA 3WFCH 3LQAH 3FQNB 5HI4D 1MFCL 3WNPA 3L5WB 5JW4R 4F7EB 4WEMB 2VLRB 4Y16A 3ULUC 5C9KA 3FCTA 5F7WC 1J5OL 4YHOL 1K8IB 5CGMA 4M62L 3PWVA 4MA1B 4WW2B 1RZ8A 2IQAB 4U6HB 3S88L 2R2EA 4NRZB 4BQ6A 1PSKH 3MRRB 5TGBB 4RMRA 1F3DJ 1JUFA 2WIIA 4PJFB 3WIHH 5BVJB 1REIA 1LK2B 1FN4A 3HRZA 4RWYH 3D85A 4ONOA 2DBLH 3T4AA 3FN9A 2WQRA 1HHJB 1N3NA 5C0CE 1JZ3A 3S37H 2WINB 4JHZA 4BFBD 5FV1L 2CLZA 3GSWA 3BQUA 5IB1A 5I1DB 5ECJE 3TH3T 4ODXB 4KRPD 4QOKA 2VLKB 5I2IB 1TZIA 5M7QA 4XCNA 2W92A 2AJXL 3SGEI 1LO3L 4U05A 1H5BA 2EKSA 1FQ9C 1AR1D 5BRZE 1D7FA 2VIRB 1IGIH 4YH6A 1AFVL 3KPRA 4HQQH 2ZNXA 5F96L 1QYGH 2BHUA 4LCWB 4MS8C 5KS9B 5C2BL 5DJZA 1NCAL 5CKAA 2PW1B 5F7MC 4X6DF 3QDGB 3VGBA 4LHJB 3QRFM 5I1IH 1X5JA 4D0BA 1OAXL 4EOWL 1A1OA 3DPBA 6FABH 2LABA 4ZUVB 3DX6B 1FFPA 1RZGB 1NAMH 2ITCA 2XZAH 3B5HA 2P24B 3D0LB 3GSXB 4NQDD 5L2KA 3OKLA 4JPIA 3G6JA 3GBMH 2BDNL 3S34H 2P8PB 1BIIA 3BPLB 3QP3A 3OQ3B 3ZE2F 3P4LA 4K23H 3SGDI 2X4PA 3H9SA 4ETYA 4Z7UF 1M71B 5SWZA 3QQNA 1RUQL 4LCYB 4PJ9B 5F1IB 3UTQB 2B1AH 3O3AB 4KQ4L 3QG7H 1BWWA 1YYML 1E4WL 4QXGL 3MACL 5JHDA 4JFFB 3EYUL 1Q94A 4OI9A 2VQUA 3BAEL 1IGFL 3MFGB 3LY6A 5F9AC 1S7XB 4EIGB 4FQQA 3RZWA 2FYYB 4K7PL 5BV7H 1PG7H 2ZOKA 3STLA 4BZYA 3QIBC 4I77H 4ZUSA 4ZTPH 4RNRB 3L3IB 1JPST 3CD4A 2XKNB 2VITB 4K8RL 4M6OL 4XC1H 2VDKL 3QJFB 4WFHD 5BXFA 3D2UB 4Z76A 1A7QL 2WBJA 1XH3B 4QRUB 5DVNA 1CGXA 4GQ9L 4MXWH 3EJJX 4KVNH 3PF2A 3NH7L 1RAMA 3SQOH 2O5XL 2F5BH 5CUSL 4M5YH 4Z77B 2HT2C 3A6OA 4G80A 5JQHC 4XPAH 1U3ZA 5GGUB 2XFXB 4JANA 4D9LL 4WJ5B 4GKOA 3FOMA 3VI4E 1P2CB 1PW3A 3LH2H 5D2LA 2VL4A 4NSKB 2NLJB 3ALWA 4H88L 1A1MB 3IRZA 3AAZB 4OF8A 5D4QA 3HR6A 1VDGA 4DOHE 4Z7QE 4P2RB 3U7YH 1Q0XH 2A6JA 5EU6B 2GHWB 1E6JL 3UTSA 1KIQB 3F7YA 5E4IA 3IDGA 4X6BB 5JA8B 5DVKA 2NZIA 4S0SD 1M05B 5FUCE 3UBXA 5HPMB 4LQ1A 2D7TH 1CQKA 1OP3K 1VFAB 2BNQD 3GSOB 3OG6B 3RIAK 4J7RA 3B3IA 3V4UL 3TH2T 3RY5A 1L7IH 4XPHL 1P7KA 5LG1A 3QEQA 1A6TB 4J3TA 2FEEL 3RHWF 1P53A 3C08L 2O61B 3BGMA 4G9FE 3PIQB 1IAOA 3ZKMD 4Q9QL 1FL5A 1JGVH 1MJUL 2YRPA 2ICWA 4L8SA 5F7KC 5DZNA 1FHGA 1N2RA 4ENEC 4WFFE 1Q9KB 3IJYB 1OTSC 4ZUWA 1OWWA 4NDMB 3WLBB 4HWZA 5FO8A 3V7MA 1F58L 4XPBL 1UQSB 4NZRH 3BIKB 3OXRA 4MQ7B 4QRPB 2A6IB 3R4DA 4P3DB 2NY2C 3LMJH 1O5DT 3V52L 1CXHA 4APQD 5CGTA 2QQLL 2X05A 3B83A 5I1GL 3K0WA 5EN2B 3ES6B 3HCVB 4XNXH 1IEHA 1CLYL 1YNKL 5GGVH 5MI0C 5CZXC 1VEMA 2APVA 1LO0L 4U1GB 5CD5C 5C9JA 4G5ZH 3V5KA 2DYPD 4EQ3A 1OAQL 1RHHB 4JKKA 1MHCA 3RY6A 2O26U 3RZCB 1WC7B 5I74C 5J1AA 4UBDC 3TBSB 2IG2L 3QZWB 3RVWC 1VACA 3ROOA 1T80A 3HC4L 4Y19E 3IF1B 5B4MD 1CLZH 4I1NB 4NC1C 2CIKA 3MR9B 3EDKA 1LO2H 5DQ9A 4HK3J 3MLUH 4NUJB 3KXFB 1CFNA 4DKEL 3IYLW 1G7MA 2APWA 2DD8H 1JMXA 3C6LB 3AU1A 2JCCF 3X12B 5DLMH 4M6AA 2QADD 1DR9A 1HEZA 2NXZC 2GJZB 1F4YH 5DJXB 1GXEA 4JPVH 5F1NA 4NP4H 3V7AG 3LV3A 4O51B 4JFEA 5D96C 3BZ4B 4PJ7E 3SGJA 2DQJL 1BFOB 2I9TB 4XBGA 1FZKA 4N1CA 3WFEH 2VXVL 1PLGH 4I13B 4YXKL 5C0AB 1KTLB 4PV9A 5F7EL 1RIHH 4JFDE 1F90H 4MJ6A 1A7PL 5IFJA 3EDDA 4U1SA 4NQDA 4D0DA 4YDIL 3EAKA 1NUFA 5K9KA 3LS5H 5HHVL 1JPSH 3BRDA 3BPNB 2YUWA 3QIUD 4U6XB 4X98A 4FHBD 4EI5D 3DVGB 2UYLB 1MF2L 5DK2B 4GT7A 4OV5B 2EDTA 3BPOB 4HWBL 1XF2A 1U8KA 2HTKD 3IJSA 3WEXB 3MLXL 4LCIL 4S1DC 3I75B 1S7WA 3U79A 5BOPA 3EO1B 3V0WH 4YIQB 2DWEB 4DQOL 2DF3A 5CEZD 3CVHH 4AEHH 1P4BH 4OQTA 2FJGA 3OR7B 4LRIC 3SDDB 1T3FB 1JK8B 1PEZA 4R97B 4XI5D 5D7SL 1KEGL 3U30B 2PTVA 1XGYH 4UQ3B 3TBTA 4KH2A 2X4UA 4ALAL 1HQ4B 4PJXF 4R4NC 2J2ZA 3O0RH 4TUOB 4M8QB 4OLWH 4ZUTA 3PWJA 2IFGA 3RPIB 5LBSH 1NAMB 1IGJA 4TSBH 4HJGB 5E8OB 1MCWM 1ITCA 1XGQA 3MRKA 5DT1H 4OLXL 4YPJA 4A6YA 4BKLA 5LXGH 3L3DA 1JHTA 3KPOB 3TPUA 4F57L 2P46B 2GITA 4Z0XB 1ONQB 4UZGA 1WV7T 1F02I 4QTHA 1NAKH 1EX0A 2BVPA 3NFPA 2NY1C 3HE6B 1P69B 3F7VB 1W8NA 2C7UB 4EN3D 3R1GL 5FYJL 3TNNA 1OLLA 3T08A 1FFRA 2GFBB 3K80A 1OF2A 5C09D 3TZVC 2MPAH 1FL3A 2AV1A 2PW2A 1FNFA 5E03A 5BV7B 2BNQA 3VG0H 1X9QA 5IMMA 4DN3L 2W65B 2GK0B 4W4NA 1G9NH 3ZT7A 1JCKA 1CGWA 5B21A 1FFNB 1DANU 4KY1L 4ODHL 3U4BH 2FB4H 5BRZD 5KJRL 4XB7A 2H26A 5AD0A 1ZT1A 3LQZA 1WZ1H 4U1IA 1I75A 4AMKH 5C3TA 1SYVA 4O02L 1T89C 4HWEH 2ZG3A 3BJLA 4OZ4B 3FRPA 3W9EA 2V9QA 1BQLH 4Q74A 1YNLH 3BDBA 5D2NA 1AXSA 4HV8A 2WW8A 5KG9B 5CS7A 3HMXH 4NO5B 4YPGA 2XXCB 2DQTH 4L1DA 1RZKL 3TIEA 5DO2D 1LEIA 4U1KB 4APQA 1MH5B 3I6KA 4CGTA 1MELA 5JLZB 1LO4L 3HMWL 3T4YB 3GMQB 1QACA 5JW3L 1F4WH 2F53D 4RMTA 4RZCB 1D5BA 2DYPA 1HHHA 5HHQA 4GW4A 1RIUL 5KVEH 3P9MA 4JRXE 4YHIA 5HI4C 1XR9A 2DLEA 5DRWB 2R0WH 3D39E 3QR2A 4NQXB 4X6FA 2YD2A 3GMRA 4LLMA 3P0VH 4NQCE 4NZUL 4OD1H 5D1ZB 1BBDL 3RWJB 2QKIB 4CU7A 2MHAA 4CN1A 3UTZA 1SEQH 2CPCA 3VXRE 4OUUB 2FBOJ 1ZA3A 4KGJA 1R3HB 2FX8L 2RJMA 2DIAA 4ODWB 5MHSD 4HK0B 2Q86A 1NANI 4FMFA 2APBA 3VXNB 5A40E 3ZTNL 4P0DA 2JF1A 4HUUA 5E95B 3VD4A 2BVQB 3O41A 4G7YH 5BW7A 1SEBB 3IGAB 2NY6C 1CR9H 4ONHA 5HYSG 1OARH 3O6MH 1T5WA 4I9WE 4XCCL 1MCBA 4RRPG 1KYOJ 3OTTA 3A67H 4IRSB 2EIDA 3IFLL 4JPWL 4YLQT 3WS6A 5T3ZE 1HOCA 2DLGA 3MQIA 1W72A 2VXUH 4JFZH 4Z78B 1NSNH 1DUYA 1QD0A 1Q9OB 4LPXA 4QO1A 3OGOE 2Q76B 4GUPA 1GYAA 4YFLF 3QIUA 3VE0B 4PG2A 4FFWD 1AR1C 1N6QL 4HKBB 1S8DB 2VZUA 5JZ7D 3BKCL 2D7MA 4KZDH 4FABH 3VXPB 4JFQA 4BZ1H 3QEHB 4XHQA 4JO1H 4XP1H 1JI2A 1NBVL 1XMWA 3AS1A 4F9PA 1FGNH 2HJKA 3WHE1 3VGAC 1U8PA 4L4VD 4M4PA 5H2BA 3C2AL 3MRNB 4PJ5B 1I1AC 3TO4B 3OAYH 4ODSH 5INDA 4WHTA 5GGSY 3C8KA 1LD9B 4K2UH 2VE6B 4UDUA 5T3XD 4DAGL 4EDXA 3MODL 2IGFL 1DQLL 5AWNL 4ZOCA 5FO9B 5C6TL 1V7NL 1RZJL 3ILQC 2HFFA 3T3MF 3UC0H 5B39A 4PB9L 3C9NB 3QXAA 5FGSA 4N0CD 5JDSB 15C8H 2NXYD 1QRNB 4K3DL 4LLYA 1U8MA 5ICYA 2ATKA 2YC1B 3FB5A 4NM4H 3ARSA 1CGVA 4KXZH 5BMFL 4EN3A 3HZMA 5T5NF 3SDYH 3T8XA 2ESVB 5I8CB 4XP5L 1KJ3H 3LKSB 3H3PL 1EHLH 5GS0D 4Z7VF 3VXUE 5C0CA 2DMCA 3BFOA 4YWGH 3C5JB 1N4XL 5C09A 4L5FH 3CVHB 1QLEL 1T0PB 1VCAA 4OGYL 3T0EE 4BH8B 1AD0B 3IETA 5F88B 1CT8B 2WUCH 1R0AH 1UWEL 2QV2A 2F8XC 4FQXB 1JGUL 3CFKB 4M48H 4YXLH 4M6NL 5FKAB 5FM8A 1U93B 4MJ2A 4J3WA 5HTSA 1CBVL 2AXFB 5BRZA 1CD9B 5C07D 3IFNL 1H9VA 3AXLA 1YQVL 2WMPA 4GJTB 4NGHH 2V17H 5IFHH 5C0IA 5E1AA 1OWRM 3H3BC 1B0GA 4YDJA 2FIRT 1TMCB 1YEDB 5TDOB 1JFQL 3FQTA 1IM9B 2OS7A 3K46A 1CDUA 1XF4A 4NHUB 4BELD 4HFUH 3UTTB 4PJ8C 4JFDD 4PY8I 1TXKA 3NAAH 1JZ2A 2OLDA 1J12A 3R0MA 4GS7C 2O5ZH 1JNJA 4UTBH 3RBSA 2AS5M 3AY4C 3MNVA 5TE4L 4N0UE 1KCSH 2K1MA 1IZKA 3CFJA 3GBNH 5F9JB 1X5FA 5E8NB 3O45A 4L29A 1U42A 4QRQB 2OTUB 5E8EB 3N0PB 4QHNA 5D5ME 3KWWB 4OCXL 3RWFB 1MCOH 3ETBF 3FFCB 5CP7A 3CPLA 1BZ7B 1CQYA 4EXKA 3FT3A 1EGJL 3HB3D 1ETZB 4DTGL 1IQDB 5FYKH 4D2NA 1Y6NR 2BNUB 5EU5B 5D6DA 4OCMC 2JJSA 3ULUH 5DRZB 2BXYA 3S36X 4LL9A 1FSKB 4ZPTA 4Y88A 5DVMA 2XYCA 3QT2A 5ESAA 4PGZA 4BZ2H 3HNSH 5IBTH 3MCLL 3MV7E 3OGCA 1K4DA 3QUZC 4O4YH 3L9RA 1A02N 1CZ8L 3MOAL 4JQXC 4NPYB 4HX1B 3CX2A 4JRYB 4OF0A 5EC2A 2HLAB 1S5HA 1FE8L 2CLRB 4IOIB 3CFEA 4UNUA 2EO9A 4NN6B 1X5HA 3MGTB 3LRHA 3QUYB 1A4JB 3RGVC 1WT5A 5T33L 4X7SL 2OSLB 4Y5VB 1CICC 3CFCL 3GSNA 5IB3B 1DZBA 2OX5A 2HWZH 1D6VL 5EO0A 4PY8J 2GCYA 1EIBA 1KNOB 1XEDA 4G8EB 3AREB 1FFOA 5I16B 3JV6B 3E6FB 2QADC 1RUAH 1N64H 4FQLH 4X7FC 2YWZA 5FA4A 3T0VA 4JO3H 3U1SL 1R3IH 3L3KA 4GW5B 3ZDYF 1D5MA 2EEDA 2JB6B 3WJLC 4L4VA 4EI6B 3VXSE 1IGCL 3ORJA 1S9VB 4FQPA 4KJWC 1JNLH 3Q48A 5IB5A 4J6RH 5A16A 2VZOA 1JL8A 3P3YA 4Z7WE 4YR6B 4YHZL 1MLCA 4JFPA 2AEQH 4MNHA 5J4MA 3QDMB 3W39B 4XPFL 1KPUA 3S36L 2A2QT 3WO4C 1QOKA 1I3RA 2OP4H 4NKQB 3HNTH 4MCYB 2HVKB 4LEXL 1WICA 1DDHA 3TV3H 1SMOA 4B50A 1HH6A 5J57B 3MRHB 3W9DB 4EI5C 1RY7B 5EBGA 1SHMA 4CUCA 2EDBA 4H26A 4W70A 5KN5B 1EXUA 1F2XK 1R3KA 2C1OB 2VXSH 4ZAKD 2WWMD 4POUB 5IHZB 4UOJA 5ESVA 4JM2B 3M8OL 3P30H 4C58B 5EZOH 2VJXA 3PQYB 3MLVH 4XPTH 4DW2H 1H8OA 1NCDH 1ZSDA 4NM8L 3L1OL 3RIFK 5C0ND 4BQ9A 1A9BB 4G9DB 3QCUL 4L4JA 4JRXD 5I17B 3DSFL 3M17B 1UWXH 3D39D 4PRIB 4OF3A 3KJ4C 1BREA 1J1PH 2AK1L 2UWEF 3FB7B 1P7QB 1BF8A 4F7CA 3VXRD 1EEUA 4OCYH 5C07A 2XWBB 4JLRB 4IOFD 1A6UL 4HKXB 1ZHNB 1TVHB 3QHZL 3I3BA 1A7RH 1KCLA 2GTZB 2NY4B 2RCSH 3BMVA 4H0HB 5IESL 1NDMA 3HRPA 5KSAC 2ID5A 3ROLB 2OM5A 1XGTB 4OCWL 3FQXA 3GMOA 4PJ7A 2KUTA 4JKPH 5HYQA 3H7BA 2PCPA 3ARTA 2FH6A 3G5VA 3KPLA 4DN4H 4LBEB 4PJEE 5HHNB 4JFDA 4PD4J 1S7QB 2DI8A 3NABH 2GAZA 3QWQB 4XP9L 3Q5TA 1U8NA 4JFYA 1G6RL 3OG4B 3DGGB 2Q7YB 1ZANL 1VFUA 3CFIC 4AEIH 3LS4L 5SX4I 5LQBH 4LPVA 2AJYL 3RUGF 3O8XD 3MRMA 1KPRA 5GSRA 1YMME 2D03L 3PE9A 1FH5L 3F7PC 3ZKND 2NY5L 1IC7H 1OT2A 3PWNA 4KK8C 3SE8L 4D0CA 4GRWE 3MX0A 2P8LB 4GG6A 4NO0D 4GSDL 2UUDK 4LOUD 3VGDA 4U4BA 2CR6A 2B4CH 3UO1L 2RR3A 3WFHA 3WNMA 3OJ2C 1UZ6F 2DI7A 3KPSB 4P23D 3AB0C 3V0VB 4XH2A 3V6ZB 2XY2A 2JIXD 1DQDL 4UDTA 5AZEH 1UA6H 5HY9A 1FVDB 2PTUA 3F58H 1RUKH 5ICXB 1EFXD 3BP6B 5CBEA 3ARVA 1T1YB 4GRLD 2A6KA 4WDIB 1S9YB 3EOAB 4CJ1A 2WSKA 2X4NA 3S9DB 1UXWB 4PJCE 5ITFA 1ADQA 1FNAA 4PJBB 4XXDA 1TJHH 1CF8H 2CDGB 1U8QB 5FYLL 2A83A 3W0WE 4OSUH 3KHQA 5ITBH 5I0ZA 4NBYB 2J8UB 4P5TA 1MWAL 5KVFL 3RX8A 2MCPH 3MZTA 3S96B 5IB4A 2AJZA 1XIWC 1KBGH 3U9UB 1J0JA 2BHYA 2VUYA 1BJ1H 4LLQA 5H94B 5C0EB 1JGEB 1F3JA 1T2QL 3CK0L 3RWDB 1LNUB 1U58B 1MCCA 5E0QA 1S7UA 4Y4KD 2OCFD 3VXUD 4P2QD 1MCSA 3DI3B 4LAQL 6CGTA 1BGXL 4LFHG 4QRSA 4XC3L 1I9IL 4ZFGL 1KJ2A 1G7QB 1CD8A 4PV8A 2Q8AL 5FECA 5I18L 2FO1A 3V5HA 1S9KC 2Z92B 4B41A 3LN5A 4HH9A 2XZCL 1KFAL 4M43L 3PGFL 4ELMB 4ZFZA 2K7PA 5F44A 3O2DA 1OCWL 1QVOB 3Q1SL 4FG6D 3MGOA 4PJFE 1DQJB 2M26A 1LK3L 5KSVB 2VISB 4G8GE 4WGVB 1MRFH 5EOCH 2I25N 1UZ8A 2IAMD 5FA3A 5K59E 4FFWC 4YHKH 4JGMA 2ED7A 1M7DA 4JN1L 2HJFB 4JEGB 1J8HB 2EYRB 3I3DA 4N0FA 3TVMD 1BM3H 1WCBB 1CU4L 2B0SL 3QH3A 3ZYZA 5CJ5A 1RFDH 4UT6L 4ZAKA 1MJJB 3RTQB 3QXUA 2BSED 2OQJB 3NCJL 4MMXC 5GS1A 4J4PD 3JWOL 4ODTH 3O6FD 5SWSE 4XWGL 2P5WB 1D6EB 3C2SA 3ZKXC 3QEUB 5FDWB 5E08L 3I02A 4MSWA 2FX9L 4MA3B 1OT1A 4LSSH 5GRZA 4YAQB 1KB9K 4X7TB 4P49A 4HLZG 1OAUH 4K3GA 4JCLA 4QHUB 2DQFB 1TCMA 2NY7L 2VXTL 4W6WB 4Q7DA 4JRXA 5H35B 3MYJB 1T2XA 4LHUG 3D39A 3OF6D 3QDGE 3MRQB 3HLAB 5DEGA 4R26L 4K7FA 3P9WB 5ILTH 2AABL 3P77A 1G7PA 4GG8B 1NGQH 4NQCA 4PJIB 1QP1A 4R4FH 1K5NA 1FZJB 1TZHB 4TVPD 1ZGLA 4AL8L 1YEKH 1Q9LB 3VXRA 4UMGA 1N7MH 2LAGB 1VB9A 5JNYB 1AXTH 2GJ6E 3WXVL 1OGAB 4ZDHB 43C9A 4NQEB 4YE4H 1U3HD 3ULVD 1Y18B 3JTTA 3B43A 4RA3A 5DUPL 3O3DA 1OSZB 1UENA 2H1PL 2WP3T 4EQ2A 4ACPA 4OTXL 3PGDB 1X5XA 2VLME 2FLRT 3GIVA 3MV7D 1BEYH 4FNLH 4Q0XH 4C56B 3EFDL 5T1DH 3NA9H 4MD5A 4NN5C 4I8DA 3KR3H 2DM4A 2FLBT 1WCQA 3L7EB 4I18B 1U8IA 2AERT 4H8WH 1I85C 4EKXA 4JZOB 4LQFL 1MCKA 3U46B 1AKJD 4YFLI 1B6UA 3CDGB 3K3QA 1OP3H 3UCRA 2R23A 5GIRA 4F7MB 3VFUB 1YYLH 3GSRB 3T3PE 3ZT6A 3O8XA 5A2FA 4TRPH 4UIKL 3MNWB 3I50L 3EYOB 4PJAB 1RK1A 5A43C 4PS4H 4H5SB 3G6DL 4NO0A 1H8NA 4Y2DD 1GGBL 2G60H 4GKNB 2NMSA 3DUSB 1IQWL 2B20A 3X3GL 5IEKA 1I8MA 4QRRD 3K74B 4DJMA 4YEEA 2JIXA 2XRAH 2BSSB 1MREH 5TF0A 1MEXL 2X2YA 4MNGA 1J18A 1PD6A 4XMPL 4TULL 3BISA 1EFXA 4GRLA 4NWUH 25C8H 4URTB 4XNYH 1FNHA 2Z31D 1OB1B 5A2IH 2Q8BL 3LKOA 4FQHA 4PUBH 3EW3B 4HG4K 3C5SB 4K3EH 1DTUA 2D31A 2XQYG 3B2UC 1MPAH 3RA7H 4PRDB 3BH9A 3SO3B 3WJJC 3RWHA 1CDJA 5CWSB 3S97C 5J3HC 5BVPH 3ZSSA 1MFBH 1P1ZB 5FOJA 4GKSB 5IMLA 3RGHA 1A9EB 1E28A 3VD9A 3EGSA 1UJTA 1IVLA 3L95A 3VFMA 2ADJB 5IG7B 2WANA 2HT3D 3QI9C 3I85A 3HB3C 3OB8A 1YEEL 2O5YH 3B5GA 2YA1A 3QXVA 1OTTD 1R24B 4WENB 4EBQL 3U0TB 1IKFH 4X4XA 2VLLB 4Y4KA 3VXUA 4P2QA 1TIUA 2H45A 3T09A 1UM4H 1RJLA 1N6VA 1FG2A 2VXQL 3PXJA 3QZWG 1AO7B 5AG9A 1J86A 4CDGC 4QXUH 5A1AA 1RIVL 3QHFL 4WGWB 1C5DB 4M7JH 4U1HA 1VGEL 4IJ3C 2UZXB 5B8CB 3C60B 3OBAA 2A9NH 5F7LB 3IU4H 3IU3A 4QRPE 4UIMA 3H9HA 4O5LH 5DQDH 2GQHA 1A7OL 3IJHA 5MEQB 1NCUA 2X9WA 4Y4FD 3GSQB 5FM5M 2NY3D 3H8NA 1BQHG 2JELH 2LVCA 5E00B 1ZA6A 3K2UL 3KJ6H 5DURD 1WFTA 1UJ3A 2IAMA 5MI0B 3VFNB 2Z35A 1A3LH 3Q5YA 5GJTH 1V5JA 3NZ8B 4YDLC 3QAZC 2R29H 2ZPKL 1F6AA 3QNYA 4CVXA 1QPPA 3U36B 4GRMA 3SE3C 5I8EB 1AQKH 3O6FA 1CS6A 1I9JH 4OCSH 4HUNB 1YDPA 3EOTH 4Y16B 5CJXA 1BPVA 3FCTB 1SY6L 2CRYA 3IXAA 4OJFL 5C8JA 12E8H 3UJTL 3PWVB 4J3SA 1RZ8B 1GGCL 3VXME 2AI0H 2R2EB 4U0RB 3X14A 5DJCA 2EC8A 3OF6A 5KW9L 1JUFB 4BUHA 3CXHJ 3D0VA 5D5MA 4HGWA 5CLWA 1FN4B 3CZJA 4IDLA 5E7BA 2NTSP 5ETUB 5FGCB 3IDNA 1Q8MA 1MFEH 1S3KL 3D85B 3ARDD 3OAUH 5C0AE 5GRUL 2Y23A 3T4AB 4EDWH 3HE7D 1U3HA 1F6LL 5D71L 4NNPL 1IKNA 2CLZB 2XZZA 3GSWB 3BQUB 5IB1B 4X4ME 1FZMA 4QOKB 3O11A 1TZIB 3MV7A 3O9WC 4XCNB 1M7IA 2EECA 3E8UL 4KTYA 1H5BB 2EKSB 3EBAA 1RUPL 1V3KA 5HDQH 4WEBH 3JWDC 4OQTH 3KPRB 1INQA 1AI1H 5L8JB 4JO4H 4S2SA 5DJZB 3F65A 1AKJA 2VAAA 4BJLA 1VEPA 1TJGH 4HJJL 1YEHH 4P9HH 3UJIH 5D1QC 4QEGA 4D0BB 1FLRH 1CGTA 1A1OB 1DBKL 5CINL 2JJVA 4U2ZA 1NCBH 3RU8H 2ITCB 4K8RD 1G7IA 4NHCH 3OKLB 4JPIB 2H9GA 3G6JB 4OLVH 3QQ4A 1BIIB 5DC9B 3EJYC 4Y2DA 2H2PD 3ZDXE 1YEGH 3TWCL 3CC5A 1IC4L 2WWKO 1BMGA 4QRRA 2X4PB 3H9SB 4HEME 5TQ0H 3R8BB 5KVDH 5SWZB 3DX9B 4M1GL 1CFQA 4NJ9L 4XMLH 1NEZB 5IT2H 4Z7WA 2OZ4L 5B3JE 2Z31A 5JHDB 4KI5D 1D5XA 1Q94B 4G8GD 1QKZH 3H7LA 3EYVA 3LAFA 4FQQB 3TYGL 4NN7C 2ZOKB 3STLB 3MCG1 4LNRA 1EMTH 4ZUSB 4Z7NE 1A6ZA 2FX7H 2X5PA 4PJDE 3RDTD 4KUCD 1U8HA 3EDFA 4S1SH 1ES0A 2EZ0C 4JHBA 5A2JH 3CAFA 5BXFB 4ZMAT 3EO0A 4QHKI 5I19L 3V5DA 4Z76B 1FAIL 2YZ1A 5EORH 5SWSD 1FNGA 5ACLA 5J11C 4LOUC 1Z5LB 1TITA 1NGXA 2WBWB 1PGRB 3SGKC 5IQ7L 4P23C 3DX7A 4G80B 4CAGA 1D5ZA 7FABH 2HVJA 3OKEA 2EDNA 3FOMB 4JFHD 2KZWA 2ZJSH 3GRWA 5D2LB 1DN0A 2Z8SA 3M45A 5EA0H 4DGYL 4Z0BL 1VADB 2YD6A 4G43A 4B53A 4ELKA 1X4YA 2A6JB 3TNMA 3UTSB 2Q6WA 3F7YB 1MCRA 3IDGB 4N1EA 4PRBB 1KELH 4JDZA 2AEWA 5F97E 4YQXH 1WZMA 4Y4FA 2D7OA 4N90D 3UBXB 2GJ6D 2QHRL 4LRNH 2EDQA 4MQXC 2V2WA 2WBKA 4Q9RH 3V7AE 4IOSD 4JJ5A 1T66D 2HKFL 1CK0L 3B3IB 2QQNH 4RAUA 4S1RL 2VLMD 2Z91A 4PR5A 1P7KB 2DQEH 3QEQB 2C4XA 8FABB 3BGMB 4OQ1A 2EDYA 3WN5C 2HAZA 2PXYD 1KN4H 4YHML 1QHPA 4PJEA 1FL5B 3TJEL 1IRAY 2ICWB 3HPLA 4L8SB 3WD5L 1WTLA 1D5IH 2E7BA 3BX7C 1P5VA 4RGND 4ZUWB 2EH8H 2NZ9C 4HWZB 5FO8B 4HKZA 1K4CA 2VDNL 3MBEC 4OGAD 3T04D 3OXRB 1H15A 3S37X 5E4EC 3QCVH 5FF6B 5I71B 2JKXA 1YMMA 1INDL 5E5RB 1LDPH 4Y5YA 2OTWA 1FJ1A 1MLBA 4DFIA 1UJ3C 2IAMC 5IMOA 5CEYA 3UXFA 3DYPA 3S8WA 5C9JB 5DUMH 1QFWI 2G9HA 5E6IC 3V5KB 2CGRL 1S5IH 5HHXL 1CLOH 3ARDA 5IHUL 1W72H 3TVMC 5CZVL 3QSKB 3HE7A 3QQ9D 4AEFA 1MHCB 2JK5B 3ZHDA 3KNBB 2ZUQB 3PDGA 5J1AB 4J4PC 3TBVB 2WUBH 1VACB 4OT1H 2A0LC 3ROOB 2UVFA 4XMKL 2BP3A 4JQVC 1UB5A 5D6CA 1I7UA 4KRPB 5CJXC 4NZJA 2CIKB 4FQCH 5DQ9B 5IVXA 2E6PA 4PJCA 1X7QA 2QHLA 5CEZH 1CFNB 1JPGA 4F2MA 1YPZE 1G7MB 1F8TH 1Z9LA 3HI5L 1QNZL 2YKLH 3AU1B 4TN9A 1HEZB 4XZUA 3PV6B 3VRIA 5F1NB 4OZHF 3LV3B 3JBG7 4HFWA 1T5XB 1GVIA 3EYSL 1MAKA 1FZKB 3DMMC 4XBGB 1EEYA 1CFVL 3N85L 2F58H 4PV9B 4RMUA 3O6KH 3UZQA 2EXWC 4MJ6B 4OGXL 4KAQL 5IFJB 4U1SB 3U2SA 4NQDB 4D0DB 5GGTL 2W0LA 3O2WH 3QUXD 5K9KB 2PO6D 2X1XR 4K9EH 4HPOH 4Q2ZA 2B5IC 2N56A 4X98B 2EDFA 5MEND 2WM0A 4P9MH 1BD2E 1O0VA 1U8KB 3CSYA 2YK1H 3FN0H 3MLTA 2XA3A 3BZFB 1YY9D 4B7IA 3IJSB 1S7WB 1NCCH 4G8GA 4ZTOH 1MIMH 2ESVE 2DM3A 4KQ3H 2FJGB 2CMRH 4RAHA 1HHJA 4IDJL 5I15H 4ZO9A 2HN7B 4XCFL 3RDTA 2C5DC 1AR2A 3FZUC 5DJYA 3TBTB 2X4UB 1NFDF 5SWSA 3MRGB 4GBXC 4OLZL 3DV4A 5E70A 2ZKHL 5DD1H 3T77A 4P4KC 4ZUTB 3CMOL 1F4AA 2GYSA 3PWJB 4KKBC 3U7WL 4WI5A 3UZEA 5IBLD 1IGJB 2AJUH 5FUZL 3H42H 1XGQB 3MRKB 5ACZA 5I1EL 5HGHB 4BKLB 1Q0YL 2BRRL 3MZGB 1JHTB 1OY3B 1KUMA 3VXMD 5JR1L 2PW1A 3S3SA 2GITB 4FXGA 3QDGA 1Z9SA 4QTHB 4YHLH 2BVPB 3NFPB 2GI7A 4JG0H 5JMOC 1BF2A 4PPTA 4ZUVA 3QIWD 3UTTE 4K3JH 4W81A 2GJ6A 4NCC1 3Q6FA 4KRLB 1OF2B 4PJHF 5JHLL 1Y0LA 3D0LA 3GSXA 1FL3B 1PEWA 2AV1B 4G6ML 2BNQB 2QSVA 4NQTA 5BO1H 4JZJA 2R1XA 3BN9D 3KPNB 4NRXA 3TPKA 2Y07L 5IMMB 1N5YL 2IMMA 1TENA 4JREC 1IFHH 1U9KA 2R2BA 4TUJA 1FGVL 2VDPH 4RFNC 2PXYA 2H26B 5AD0B 1ZT1B 3LQZB 3GKWH 4FQ2L 4P2OC 1QHOA 3MRDB 3VCLA 2F19H 1HSBA 4U1IB 2ADFL 3CUPB 4BYHA 1SYVB 35C8L 1AY1L 2FYYA 1G7HA 3O2VH 3W9EB 3BGFC 5D2NB 1AXSB 2DTMH 3DNKA 3QA3A 3ZE1F 4AH2A 5JORA 4YGVA 5DHYA 4IMLB 3RAJH 4YPGB 3TIEB 4JZNA 1LEIB 2IALA 3N06B 4APQB 3I6KB 3MJ7A 4BA8A 1FPTH 1KTRL 1D9KC 3JUYA 3LHPH 4OI7A 4JRYE 4PLKD 4Z77A 1D5BB 2DYPB 2DAVA 1HHHB 1X5GA 2IPTL 3IDJA 5HHQB 5AZ2L 2B8OT 4GW4B 1MRCH 5C0FA 3P9MB 1P2CA 4KWUA 1FZOB 2NLJA 1XR9B 5EU4B 4MDJA 3EO9L 4LIQL 5JTWA 3LKQA 1S7RA 3C8HA 4X6FB 3GMRB 2B39A 4LLMB 1G9MH 1A6PA 2MHAB 2OK0L 1JJUA 4ZS6D 5EUOE 3MJ9H 4NNXA 2CO7B 1ZA3B 4NOBA 1C5BL 4LAJH 1YA5A 3FB8A 2V9TA 2Q86B 2QADB 3GSOA 1MNUH 4HUUB 3MLYL 1QBBA 3O41B 3KYKH 5D70H 4HWBA 4DGVL 2AJVH 4LSDA 1IGTA 3MLZL 4ONHB 5T3XH 1TQCC 2R69L 1T5WB 4TSAL 3S3PA 1J7VR 3DVNA 2EEAA 3FO9A 5DYOA 5CKGA 1XR8A 1CFBA 4F8QA 3E6HA 4WY7L 1ZGLP 3QDME 4X9BA 1MRDH 1HOCB 4TTDD 4X7EC 2Y1VA 1H0DA 2R8SL 3I6GA 1W72B 2CJUH 1DUYB 3QUXA 3WO4B 1LEKA 1TCRA 2PO6A 1T03H 1OSPL 4KJQD 5FCUL 4YHPA 3ZHKA 3QIUB 5JOEA 4QRPA 4WTZG 3QWRD 1I3VA 3E2HC 3VH8G 1QZ1A 5MENA 4XAWH 4EI5B 4Z8FL 4BFEA 2HKHH 1F4XL 3QULA 3IDYB 1EO8L 2APXA 3PQYE 4JFQB 1K6QL 5GS0H 3WNKA 4HT1L 1WGOA 5C86A 1SBSL 1TPXC 3ECBA 4JVWA 3LD8B 5KSBA 2HJKB 4MD4B 3GEWB 3LN9A 4JVUA 1U8PB 3NIDF 3V0AC 1RHHA 5F8QC 5H2BB 1NGZA 2IH3A 5EU7E 4CW1A 1WC7A 3MXVH 4R8WL 4XXCC 4KK5C 1DVFC 5INDB 3JV0A 4GMSL 1HSAA 5GGQL 4WHTB 4H20H 3C8KB 4PRIE 5ERWA 4UDUB 4EDXB 1J1OL 4TSCL 4K8RC 3ARZA 5ANME 4ZQKA 1A1NB 3AM8C 2H2PC 3MLRL 4ZNEA 2CDFB 4HZLA 5ID0B 1BFVH 4NUJA 2HFFB 4LP5A 2OJZH 4L1HA 5FGBA 5B39B 5CSBA 2UUDH 5J12B 4HIIA 2DLFL 3IDUA 3EJZC 2L7JA 3QXAB 3VXMA 1KT2A 4D94A 4KI5C 5A2KH 3U4AA 2OMBA 4LLYB 1U8MB 5ICYB 3BZ4A 2YD1A 3FB5B 4O2EA 4WWKD 1I8KA 4EN3B 3HZMB 2IBGA 4NYLB 3T8XB 5JOFA 1IAIH 4CDHA 3QIWA 4UOW1 5DJ6B 5E8DL 5C09B 4UTAL 5FUOH 2C3HA 3O4OB 1Q1JL 3IETB 1INEL 3V6OE 2W0PA 4Y4HD 4X4MA 1DN2A 5E6ZA 4OIAA 3GO1L 3VFTA 1AGBB 1UKQA 2J6EL 5E2UH 3HZVA 1JGDA 1IEAA 3HG1D 1DFBL 2AEIT 2VH5H 3UTOA 3AXLB 1DLFH 1RU9L 2DWEA 2WLZA 2J88L 1NPUA 4L3CA 4LPUA 1HH9A 2ZCLL 3MMEA 5E1AB 3FT2A 3SDDA 1B0GB 1BVZA 1T3FA 3ESUF 2DQHH 4JG1L 1MI5D 1FBIL 5L88H 4HBCH 3FQTB 1TZGL 2GUOB 4AIOA 4GMTH 4ZS7L 1ADQH 5F7YC 3AS2A 3BKYH 1JZ4A 3QUML 4JZJC 2F53B 1RZFL 3H2WA 3LEVL 1S7VA 5CBAB 2E8ZA 4BQBA 1L0QA 1KEML 4PJBE 2WWKT 4HJGA 3UAJD 4X4YA 5E8OA 3MNVB 1KSRA 4OZFG 4XVSL 5CFHA 2J8UE 3TJHD 5E2TH 4G6AC 2IMNA 4IEFB 3CFJB 1BD2D 2J4WL 1QFWL 3O45B 4L29B 4Z0XA 3BPCA 4UT9H 3I2CL 3VJ6B 3LKPA 2DQCH 5CSZB 1JN6A 3HE6A 1GC1C 3F7VA 4FOMA 5CP7B 1KJ2H 3CPLB 4YNYA 3HZKA 1WJ3A 1ZEAH 3MROA 5IP4A 3BHBA 2DLTA 3PJSA 4PJDA 2FD6L 5F3HA 1FV1A 2F5AL 4Q9BA 3WSQL 1YECL 2A74A 5IW3A 3VXQA 3FL7A 5FYKE 3V4PL 2OYPA 1BVLA 2L4OA 3O2DH 3ULUE 4FQXD 4Z7UE 4V1DB 1MJ8L 1K4DB 4M7ZB 3D69A 1FFNA 5DMGD 3L9RB 5AUMB 3HFMH 4FQIL 3BD3A 2K7QA 2R4SL 4NKDA 5EC2B 1S5HB 4PJGF 1NL0L 4EIZC 5DI8B 5GGRA 5C0BB 2OMNA 4TYUA 5BJTA 3FMGL 3BKML 1NGWA 1JBJA 4DOHB 5EO0B 5KZCD 2NTFA 1J8HE 1YEIH 5D7JD 3QWRA 2GCYB 5HHME 3U83A 3CSPA 1FFOB 4NUGH 4JGUA 3STZA 4XBEL 1QTYT 5FA4B 3U0PA 2HTLD 4IRJC 3L3KB 4ZSOA 4U3CA 3ALXA 1A6AA 1D5MB 2YUVA 3JWDH 3RVUC 5TPWH 1WBYA 4FFZH 4L4VB 1DANT 5T5FH 5ICZB 1X44A 4HS8H 4NRYA 4KGLA 3Q6GH 5IB5B 4YXHL 5A16B 3QNXB 2EIEA 4U1JA 2MOVA 4HWUA 2YPVL 2YSSA 1KIPA 4WV1A 1G9EA 1MLCB 4XNZC 4JFPB 5F1SA 1OGTB 4MNHB 4OCLC 4PJIE 5EUKA 1KPUB 3QUXC 2PO6C 4C57C 2FIKA 2UVEA 1GGIH 5E2VL 4OB5H 4KJYA 5FHBL 1DDHB 4OLYH 4R2GC 1HH6B 3O3UN 1OGAE 4ODWA 4NQEE 3IFPA 4H26B 5DRXA 1HKLH 1EXUB 1GAFL 4FQ1H 3ARGC 1ERNA 3S4SG 3KLHD 5ESVB 2NXYB 4PLJD 1MSPA 2C3VA 2DMBA 5IGXH 4MA7H 5CCKH 4DUVA 2BOCA 4C56E 4QLRA 4WWKA 3RI5F 1ZSDB 4MWFA 4X6CA 1GSMA 1OAKH 1KCUL 5FOBA 1RUML 2A77L 3P40A 2F8OA 2KKQA 3KDMA 4OKVA 1JHKL 5E2WL 5JXEC 4LKCA 1KCRL 4R4BB 4Y4HA 2DN7A 4NKIL 4PGCA 2BSRA 1GOHA 3MXWH 2ENSA 3N9GH 1U3YA 3HG1A 4F7CB 5C07B 1YPZA 1BVKA 3VXPA 4GLRI 3IAGC 5H37G 4EJ1C 4UV4H 3QEHA 3TLRA 2VDQL 1DSFH 4RAVA 1KC5L 3MV9D 3G08A 1GHFH 3IDXL 1MI5A 3FQXB 3MRNA 3GMOB 4N9GA 4PJ7B 3QIWC 4PBWD 5HYQB 3H7BB 2PCPB 3FTGA 4TVSa 1KJ3L 1PKQA 4RISL 3G5VB 2ITDA 2FBJH 4AJ0A 1AP2A 3KPLB 4JFDB 1DBMH 2E7MA 1RZKC 3S5LG 2J7LA 3X3FH 2GAZB 4LVOB 4JFYB 1ZLSL 1LQSR 4M1DL 2JCCE 5ALBL 3ZE0E 2Y6SD 4U7MA 1B2WL 3C09C 4CMMA 3MRMB 1KPRB 2FECI 2YPLD 5GSRB 1BD2A 5BZWA 3UYPA 3ARBC 5GGVY 3PWNB 5FYLD 4D0CB 4C83A 5K9JH 1IMHC 1JGLL 5KTEH 4KKCD 4GG6B 5EOCJ 3FHAA 2QL1A 2ADIA 2OI9C 3QDHA 3WFHB 4POYA 2VDML 1WVZA 5GS3A 3TM6A 4XH2B 1AC6A 2CUHA 4NFBA 1AO7E 1FRGH 1RVFH 1E4KC 2EE2A 2NNAA 5ADPH 4UDTB 3KPPA 3R8QA 5HY9B 4HFUL 1BECA 5TQ2H 2E8YA 2R0LH 5DD6A 1HYSD 5E56A 2EIZA 5CBEB 3ME0A 4FQXA 2BY2A 2GTWA 5EZIH 1ZVYA 5I75C 2X4NB 5CJQL 1XF3A 3DHJA 1HXMB 5ITFB 4R0LC 1RJYA 3PP3K 4XXDB 4WW1A 4XBPA 3UPRA 2A83B 5I6XB 1HWHB 1UVQB 1YJDC 1JF1A 5ISZD 4X0KA 4IRZL 2IQ9L 2V2XA 5IW1A 5IB4B 1BAFH 1YMHA 2AJZB 1HCFX 1I1CA 4LLQB 5D7JA 1RJCA 1F3JB 3B9EA 4YDLB 4OFKA 4OZIF 1A14L 1S7UB 3UBXI 1SJXA 4NBXB 4QRSB 3MUGA 3KPTA 3G9AB 3CZFA 3GFUA 1KJ2B 1HNFA 3JSSA 1YN6B 2V5YA 3AVEA 4PV8B 5FECB 3MV8E 5HYSA 2P1YA 4NC1E 3V5HB 4RRPA 3C6SB 3LN5B 1T6WA 4HH9B 4KV5F 5J56B 2PUQT 3TBWA 1QFUL 3W2DH 4HC1L 4HWNA 2G2RA 4ZFZB 2BRQA 4TVPH 5E8NA 2E6QA 4RGMC 3OWEA 1MIEH 4TTDC 4ORGA 4HJ0D 2P8MA 3CXDH 1SYSA 4AENA 2W9LA 1HIML 3C5ZD 1WISA 4KUZL 5GZNC 3ULVH 5FGCE 4KJQC 1J05B 5C0JB 5FA3B 2ZSWA 1T7ZA 2FWOA 3JV4A 3OL2A 4FP8L 4N0FB 3QH3B 5DRZA 1OW0C 4ZAKB 5J13B 2DQUH 1JNNH 2R9HD 5GS1B 3OPZL 4CVZA 3BSZH 5HI3D 3I02B 4MSWB 2D9QB 3GJFA 2F54E 4X5WA 5FEBA 3ARQA 2W91A 4HX1A 1UM5H 3T0WA 2IPUG 1YEFH 4XHJD 4KROC 1DQMH 3UYRH 1VHPA 3P2TA 3BMWA 4MB5A 4X9IA 2QQKL 2OSLA 3D39B 5HYFA 5DEGB 1MCIA 4LCUA 4K7FB 3NTCH 1NMAH 1WBXA 3QQ3A 3P77B 1QBLH 1G7PB 5AYUH 1FDLL 2LTQC 4XVTH 2GSGA 3SY0A 5EUOA 1ZGLB 5CJBA 1IARB 3HAEG 5HVHC 3NCBB 5F6HI 3BT2L 1G6RA 5K9QI 3BDYH 5F9DC 1OM3H 43C9B 3RP1A 4GW5A 3JTTB 2FJHA 4GQPH 3P9LA 5IMKB 3O3DB 3MV9A 3G6JE 1DBAL 4QWWD 1CXEA 4EI6A 3U0WH 3GIVB 3BKJL 3GJFK 4CADA 2ICWJ 3H9SE 2J5LB 1S7SA 2WZPD 2R0KL 1MUJA 1Z2KA 4MD5B 4YR6A 1U8IB 4UT7H 3JXAA 1I3GH 4D9RD 1KYOK 1RZ7L 4X83A 4AQ1B 3K4AA 3MRHA 1NLDH 2X1QA 2R23B 3LVEA 1J8HD 1J1PL 2JB5L 5GIRB 4NN7B 4YDVA 2DM7A 5KN5A 5HHMD 1HINH 2ZCHL 3O8XB 2YPLA 3UBXG 2A1WH 4ZOBA 1CN4A 1L7TH 1IT9L 1RK1B 3QO0A 1RMFH 1QLFA 1KN2L 4OD3L 4OIBA 4NO0B 1MWAA 2HJLA 3HC3L 2CKBL 3S6CA 3VXTA 1JHLL 4QY8A 1CE1L 3IDMA 4P23B 5IEKB 2HG5A 4DZBA 1I8MB 2F15A 1MFCH 1TLKA 2JIXB 3SBWC 3ZL4L 4JKMA 4MNGB 4PRIA 1J0HA 4MS8D 1EFXB 3BD4A 4HUXB 1J5OH 5ANMA 4YHOH 3DROB 4GRLB 4MAYC 4QTIL 5D93B 1GIGL 3VWKC 3MA7A 1JYWA 1KCVL 5CHNA 2YEZA 3UAJC 4M62H 3LKOB 3UTSE 1NKOA 3OKMB 1P7QA 4LCCA 3ZMRA 1RD6A 1YC8A 3S88H 3GM0A 2CK0L 3BH9B 4IS6A 2XQBL 4GAGL 3RWHB 1UM6L 1ZVHA 1WWWX 2R2HB 3O6LL 3EYQC 5ISZA 5EBWA 1ZGLM 1FORL 1MCLA 3TA3D 4LMQE 1WIUA 5IMLB 3MOBL 1E28B 3WUWG 2Z4QA 3EGSB 4I0CC 3ROLA 1Q9WA 3L95B 3VFMB 2YZ8A 4R3SB 2G5BA 3DUHA 4RQQA 1ZT4A 1ODAA 5DD0L 4W6XB 4X4XB 1UH2A 3VXUB 1ZOXA 4P2QB 2LU7A 4ERSL 5DMIL 3NZHL 1FG2B 4YZFF 4WTXA 3EKCA 5CMAA 5I1AA 3I9GL 3V6OA 5CEXB 2B1HL 2AJXH 3BZDA 4U1HB 1LO3H 3MNZA 3LKNB 2PR4L 4UIMB 5I66A 5D8JL 3QIBD 5JUEL 3JTSA 3NVQA 1AFVH 2X4TA 3IKCA 1AJ7L 5F96H 5K9QG 5E4EB 2VLJD 3IJHB 5C2BH 1NCAH 4HUMB 5C0RL 2SEBB 1ZA6B 3C5ZA 1UJ3B 2IAMB 2X70A 4O2FA 5MEOA 1OAXH 2Z35B 4EOWH 3U48A 2KQNA 1EBPA 1JZ8A 1KXVC 3V6ZA 2HT2D 3TVMB 4OIIL 3QNYB 1F6AB 4CVXB 5DS8A 1C5CL 4GRMB 3GM8A 4ONFL 3NIFF 3BWUC 3O6FB 3BP6A 4MD0B 2BDNH 4OM1L 1WWAX 4WDIA 4MZ2A 1YDPB 4YO0A 1RUQH 1U8QA 3IXAB 3IXTA 4KQ4H 2VC2L 3BESR 1YYMH 1E4WH 4QXGH 2X4QA 3MACH 3EYUH 3X14B 4X6DA 3BAEH 1IGFH 3ET9F 4KKNA 4RIRA 5JPMA 5JW5A 4KHXL 4NZTL 3PDOA 4K7PH 1JGEA 1VSCA 4FMKA 3D0VB 1JF5A 5D5MB 4HGWB 2X6MA 1VENA 3SDCC 3Q0HA 3IDNB 4K8RH 4F9LC 5LGJA 4M6OH 4IHOB 2VDKH 2OR8A 2Y72A 1WBZA 4YFDB 1A7QH 5GZOC 1T22B 1U3HB 5LVEA 2Q3ZA 1G7QA 1FAKT 4NQDE 3NH7H 1CGYA 2O5XH 3L3GA 4LSTL 4DEPB 3CFBA 5CUSH 4FFVC 3MUJA 3O11B 1OTSD 3MV7B 5KOVC 4Z7UA 4B5EA 1M7IB 3GGWB 1VA9A 3KS0H 2B5IB 2VR4A 4D9LH 1I1FA 1T4KA 1RJZA 2V2TA 1DQJA 3CX5K 2NY2D 4H88H 4LHUD 4HF5L 2LU3A 1INQB 3T0EC 4S2SB 2DKSA 1AD9A 1AKJB 5CZXD 1NMBL 2VAAB 5CD5D 1E6JH 3LZFL 4I0PD 1J8HA 3GMLA 2DQGL 4WHYH 1M4KA 4WFHE 4HEPG 3BO8A 4UBDD 5I1HL 1U8LA 4KMQA 1D6EA 1WTGT 1K85A 2E7HA 4M1CD 3V4UH 1KCKA 3WIIL 1G7IB 4XPHH 3MV8D 2H9GB 2NY5C 1WQVT 2EICA 4MA8L 3C08H 3VW3L 4Y2DB 2FECL 1QO3A 4MLSA 3U4EA 2ICEA 3CC5B 4X5XA 4QHUA 4QRRB 4Q9QH 3VXOA 1OPGL 1MJUH 5IM7A 2DQDL 1CFQB 1U3JA 2OL3L 4GKZA 2NXZD 4Z7WB 3UX9B 1OTUD 4GG8A 1YC7A 2Z31B 1D5XB 5DFVC 1F58H 2EEBA 4XPBH 3EYVB 2PETA 3FRPG 1X5LA 3QXDA 5DUBA 2EDEA 5JNYA 1K3ZA 3SE4C 4LNRB 3LPFA 3V52H 1JYXA 1A6ZB 2QQLH 4NFCA 5I1GH 1ES0B 2FEDD 4BSJA 2BNQE 1CLYH 1YNKH 3TA3A 2VUOA 1LO0H 3EO0B 1EJOL 3V5DB 2VTFA 1FNGB 1BZQK 3KGRA 1JTPA 1Q38A 1R5VA 1KJVA 1OAQH 5F89A 2F54D 1NGXB 4WVRA 2KQMA 1MHEA 3DX7B 2IG2H 1EV2E 4LK4A 3HI6L 1HZHL 5FIEA 1D5ZB 2N4IA 3AUVA 2HVJB 2KDGA 4RFNB 2VN4A 4HHAA 3OKEB 3K81A 3HC4H 1HYSC 4S1DD 5JQ6L 1DN0B 1WF5A 5DHVA 3BP5B 4YC2B 1MJ7L 3CDGA 4G43B 1JTTA 4J3VA 4XX1G 4U0QB 4BSVB 4LCCC 4XGZA 2CUIA 4DKEH 2VDOL 4ELKB 3QIBA 3TNMB 4PGBB 3KHOA 3BP4A 1G7LA 2Q6WB 1X3DA 2E27L 4FXKA 2VLJA 4JDZB 3OSKA 4LVNB 3NACL 1SY6A 4Y4FB 1HILA 4PG9A 1H3PL 3HHRB 1CVSC 3EUUA 2NY3B 4H25A 2V2WB 4PRNA 1CE6A 3OR6A 5DURB 4PB0L 3SDXB 2DQJH 5CGYD 4J1UA 4RAUB 1HQRA 2VXVH 2Z91B 5C08D 5DJAA 3RHWK 4YXKH 5F7EH 2D0FA 3WFBL 2VWEC 4ODVL 2P45B 1A7PH 2BSSA 1H3UA 1LGVA 5HD8D 3NCYP 3VFPA 4YDIH 4F58L 1C7TA 4PJEB 3ZYIA 3HPLB 2UWEE 4RDQF 5HHVH 4UI2A 2AJ3A 3SHSA 1XAUA 2NY1D 1LE9B 5MERA 4UUJB 1JYVA 2FO4A 1MF2H 4HKZB 4QXWA 4FFYL 2JCCA 1JVKA 2Y06L 4HWBH 4OBRA 1BX2A 1H15B 1DE4A 3MLXH 3NCEB 4LCIH 1JWUA 3VRJA 1KENL 3TZVD 4DQOH 3NPSC 1AGCA 4Y5YB 1T21A 2FATL 4TPRL 2OTWB 3FO0L 1FJ1B 4OZGF 1MLBB 2QQQA 4JJHA 1T7XA 5CEYB 5IMOB 1II4E 4ZOAA 2G9HB 1TTUA 4G6KL 4M9OA 4XNMA 5D7SH 3RL1A 1KEGH 3ARDB 2VLLA 1QA9A 3HE7B 1NBZA 4LGRB 4ALAH 2R9HC 2FCBA 1XFPA 2ZCKL 5E2JA 4KHTL 5D6CB 1I7UB 4YK4C 4CVWA 4C59B 1NMCC 2D0HA 2XT1B 4EZMA 4PRAB 5IVXB 4OLXH 4PJCB 3EHBC 1X7QB 5C6WH 5B39G 3E2HB 1ZTXL 5B38G 4F2MB 4F57H 3L6FB 2AGJL 4LHUA 2Z0BA 2DQIL 1UT9A 4U6VL 3RWIA 5CEZE 4MJID 4P3CL 4C55A 3NIGE 4JHWL 3NZ8A 3R1GH 3QDJE 5E5MA 2V5TA 2OZ4A 4I0PA 1LWRA 5FYJH 4HFWB 3NCMA 4A2MA 1TETL 1WFNA 2AV7B 3OKKB 1EEYB 5I8EA 4TUKL 5DGQA 4FTVD 4JDTL 4PJXA 5KAQF 1WZLA 1N0XL 2UY6A 4PP1D 5LWYL 4MVBC 4DN3H 3SE9L 4QWWC 3U2SB 3MV8A 3SCMD 4KY1H 1TJIL 3DETC 4ODHH 2P47B 5SX5K 4Q2ZB 3PP4L 3VWJD 5KJRH 4JCMA 1VGKA 5IHBA 4E0RA 4LDOB 4F3FA 3ILPA 1OD7A 5I1KL 1V3MA 1IBGL 1EHXA 3CSYB 3MLTB 4O02H 4BH7A 3B2VL 1AE6L 4Z7WF 5J9PB 2NY6D 4G8GB 4KMTL 4M6ML 4WCYL 2QSCL 2A9ML 4N8VG 5ETUA 5KANI 4M7KL 5F9WB 5HJ3A 1RZKH 5B3NA 3TIDA 5C09E 3RDTB 1LO4H 3HMWH 2C4FU 5AYQA 5JW3H 5DJYB 1S9WA 2OR9L 1UACL 5SWSB 3OKOA 2XG4A 3NFNA 1ITBB 1DUZB 3DJ9A 3DV4B 3ALPA 3LDBC 4HUVA 2F54A 4A6YL 1FL6B 1Q72L 3T77B 1LEGB 5MP6L 1RIUH 3B5TA 3UEZA 4O00A 4ZXBD 2KH2B 5ACZB 1T83C 1R5WA 3QG6A 5DWUL 8CGTA 5L7XL 4NZUH 4WO4C 1BBDH 3WXWL 4FXGB 4NFDA 3WIFA 1CXLA 3RL2A 1P84K 4LRIA 2DJUA 1NGPL 4PRHD 5IVZA 2FX8H 3E1F1 1I1AD 1U91A 5IFAL 4HMEA 3ZTNH 2GJ6B 3WLWC 3SOBL 3Q6FB 3TA3C 1Y0LB 2F53E 3P0YL 4U1NA 2XN9E 4XCCH 4HXBL 4JZJB 2R1XB 1TNMA 2CKNA 5D1XC 1U8JA 2WV3A 4NRXB 4KTEL 4P2CG 5C08A 3ILQD 5JOPD 5L8LB 1F45A 3VFGL 4WUKL 2X7LA 3IFLH 4JPWH 3Q3GA 3QFJE 3DX9A 2R2BB 4TUJB 3DI2B 1NEZA 2MQ3A 3IDIA 4G6JL 1A2YA 4YUEL 2PXYB 1WSST 3OB0K 2J3SA 1JZ6A 3VCLB 1HSBB 4WU5B 1RULL 3EDEA 3TO2B 4RGNB 3QEGL 1SQ2N 1CG9B 4M4RA 3FT4A 1N6QH 1G7HB 4JB9L 2XQYK 3L3OB 3BKCH 1S78C 4AH2B 3QA3B 4WW2C 1CD1B 5JORB 5MHSE 4YGVB 5DHYB 3KVQA 2ZP0T 3KYAA 1FFQA 4LLWA 3ZTJG 4JZNB 4KPHL 3TZVA 1BQHA 2IALB 1NBVH 4RMWA 3SGDH 3MJ7B 3ELAT 4X8XA 1GZPA 3B4NA 4XRCA 1QBAA 4V1DE 1Z5LA 1MQKL 4U7SA 4ZD3L 3C2AH 3HUJB 5SWQA 4GRWF 4BQ8A 1NGYB 1KACB 5DZLA 4WRLA 2QBWA 3IDJB 4DAGH 2CXKA 1KB5L 2IGFH 3MODH 1DQLH 2H3NB 5AWNH 5C0FB 5C0BE 3VG9C 4YBLB 4MDJB 3CH8A 3L5HA 5C6TH 1V7NH 1RZJH 1VADA 5DA4A 4YJZL 3LKQB 1S7RB 1O7SA 1T89A 5I30L 4YHYC 5LGKA 5KANG 4PB9H 4HSQA 4F37F 4PRBA 5GGTA 5F1OB 4FZ8L 1QUNA 4NNXB 3STBA 2PYFA 3RQ3A 1T0MA 4L8CA 1DQQA 3S35X 3FB8B 3NFSL 4K3DH 4PJ8D 3LCYA 3RVTD 5BMFH 1ULVA 4L4VE 4X7CC 1IGTB 3GHEL 4XP5H 3H3PH 1E6OL 4C54A 5FO7A 5F7FA 1SVCP 8FABA 4MZ3A 1N4XH 3VD3A 1S5IL 3DVNB 4LLVA 1QLEH 2R56L 5DYOB 3FO9B 1LP9F 4FTVA 4OGYH 4P46D 1XR8B 5T3XE 3E6HB 3HZYA 1UWEH 4EUPA 5F6IC 4LU5L 4IMKC 1H0DB 1A5FL 4OAWA 1JGUH 4XNZB 3I6GB 3BPLC 3QUXB 2VR9A 1LEKB 1TCRB 2PO6B 4M6NH 1OP5K 3SCMA 3SDAD 3N50A 4KVCL 1CBVH 2YS4A 4YHPB 3VWJA 3IFNH 4PJ9C 5FF6A 3V8OA 2YD8A 5MENB 1YQVH 4WW2F 2QEJA 4MXVF 3QULB 4LSUL 1JF6A 4ZFFA 2AVGA 3KYOA 4PJFF 3ECBB 1JFQH 2CDEA 4EXPX 5KSBB 5LCVL 4I0PC 4Z7VA 4JAMA 3QUZD 4U33A 2JE8A 5MEPB 2JK5A 1NGZB 5K59F 2IH3B 4CW1B 3KNBA 4MAUL 3TBVA 4F15B 1HSAB 3O4LD 1GC1L 5TDPA 3WBDA 5F7DA 1EO7A 4M1CC 5ERWB 5LKNA 3O6KL 2N7BA 3DTXA 3S35L 5ADOL 5HYJB 2VZVA 4GAYA 3RGVD 1IL1A 1A4KA 3VFSA 4FZEL 2I60L 3T1WA 1CICD 4M8VA 4ZQKB 4E42A 1EDQA 1SJVA 3G6AA 4HZLB 5TE4H 5TE7L 5C07E 2ZUWA 5D7IB 1DL7L 2GT9A 4ZXBA 3WHE0 1I9RL 4HIIB 2DL9A 3MLSL 4ISVA 5HGBB 4GXVL 3VXMB 3MYZA 1KT2B 5GRJL 1G0YR 3PV6A 1OTUC 3VD5A 4OCXH 2IADA 5KS9F 3V9FA 1TFHA 1T5XA 1EGJH 2NYYD 4DTGH 5F3BB 4O2EB 4CU8A 1L0XA 3P11L 1I8KB 4PRHA 3DBXA 2PYEB 1LHZA 5D72L 5D7LE 5JOFB 4KJWD 2C9AA 4N8CL 1I1AA 3DIFA 1EH9A 3QIWB 2FEDC 5DJ0A 4JR9L 3PHQA 3CLFL 3PP3H 1KB9J 1YN7A 3MREB 3MCLH 4WI6A 4OKDA 2AKRA 2Z8VC 5E5UB 3RVVC 1X5IA 1CZ8H 5JIHA 3MOAH 3VFTB 1B0RA 2DKMA 3HZVB 3O3EA 4FXLA 1EEZA 1YEJL 2GK2A 1FE8H 4LARL 1JGDB 5DFTA 4E5XB 1IEAB 5AAWA 2BX5A 43CAA 1QSFD 4MX7A 1WWCA 3BZFA 5T33H 4X7SH 4K94L 3ARBB 4L3EE 3CFCH 4GG6E 1D6VH 1G6VK 4L3CB 1HH9B 3MMEB 4HGKC 1XCQA 5I8KL 3FT2B 4WFGD 2IBZX 3QDJD 1NC2D 4X80L 2HLFC 4NCC2 1OL0A 2HN7A 1BBJA 3NN8A 2OI9B 3TGXA 2A6DB 2RGSA 3U1SH 3DXAD 5FB8A 1QQDA 4I5BA 5ENWA 3MRGA 5CGYC 1IGCH 2ARJB 2EKJA 5TH2A 3QPQC 1S7VB 2Y9RT 4QHLA 4MDIA 2IH1A 3U7AA 4UB0L 5I75B 4X4YB 4HIHB 2E7LC 3BN3B 2XZQL 3RZCC 3K7UA 3VGEA 1IGML 4LSRL 5IK3A 4YHZH 3WHXB 5HGHA 5HD8C 2BK8A 3LEXA 4XPFH 2IFFL 3S36H 5EU3B 3J7HA 3BPCB 2PNDA 5IVNA 2AK4D 2IJ0C 1AHWA 1CFSB 4LEXH 3LKPB 4N0YL 4S10A 1JN6B 5KSAD 2AP2A 5T1MA 4YNYB 3WFZA 4NO2A 3HZKB 5CIPA 3DV6A 1T1WA 3C6LC 3MROB 3BHBB 2K3TA 3M8OH 3PJSB 4PJDB 5GRXG 3SKNA 3OXSB 1UH4A 1FV1B 5F3HB 4PJ8A 4CNIA 2A74B 4G3YL 3VXQB 3KPNA 1BVLB 2QSTA 4NM8H 1KPVA 1J0IA 3GK8L 3L1OH 4BK4A 3D69B 4HW6A 1EFQA 3AY4A 2H2SC 3GMNA 3QRGL 3V4VL 5F70A 4CN6A 4NKDB 3QCUH 4P46A 3DSFH 5IW6A 1J0YA 3FB6A 4HG4J 3GSNL 3MRDA 5DD5L 4RGMB 1P9MC 3CUPA 5GGRB 4KK8D 1MCNA 3MBXL 5EOTA 2AK1H 5BJTB 1NGWB 3VI3E 1X5AA 1Z0NA 3BPNC 2NTFB 1NLBL 4IMLA 1PYWA 3RFZC 1A6UH 3BPOC 3GJFH 3QHZH