4LSTH

Crystal structure of broadly and potently neutralizing antibody vrc01 in complex with hiv-1 clade c strain zm176.66 gp120
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
224
structure length
222
Chain Sequence
QVQLVQSGGQMKKPGESMRISCRASGYEFIDCTLNWIRLAPGKRPEWMGWLKPRGGAVNYARPLQGRVTMTRDVYSDTAFLELRSLTVDDTAVYFCTRGKNCDYNWDFEHWGRGTPVIVSSPSTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multidonor Analysis Reveals Structural Elements, Genetic Determinants, and Maturation Pathway for HIV-1 Neutralization by VRC01-Class Antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords ENVELOPE GLYCOPROTEIN GP120 of HIV-1 clade C
total genus 36
structure length 222
sequence length 224
ec nomenclature
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lstH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lstH01
3QEHB 1GXEA 3BGFB 5IR1A 2P5EB 4LAJH 1DLHB 5C07E 5BJTB 5CINH 1V3MA 4J7RA 1FHGA 25C8H 5CEZH 3CFDA 1U95B 2ZOLA 4NP4L 2CUMA 3QUZA 3AU1B 6FABL 3O81A 1XGTA 1I8MA 4HPYL 4JLRB 3ARGA 3NA4A 4NOFA 1BFTA 3ECBA 3WKML 3GRWA 3SKOB 1J5OH 1A2YB 1MCOH 3DUHA 2VDQH 5CLTA 2GCYB 5EU6A 4N0YH 4OF3A 4K7FB 4M4PA 3Q1SH 1RMFH 4R7NB 4PUBL 3UBXG 4DN3L 3FL7A 2OLDA 4ISVB 5I1GH 1LO5A 2ADFH 3HNSH 5BZDB 4WTWA 1YMMA 3ZE0E 3KXFB 3W0WE 1NGZA 1RUAH 4GAGL 2EDJA 3WFBL 1Q0YH 4V1DD 4UILL 5GGTH 4X6CF 2G5BB 5D7SH 5HYJA 3RA7H 5D2LF 5D71L 1MVFA 5JTWA 2WSKA 1BECA 4H0IA 4OIIH 4QY8A 2BSRA 5DQJB 3ZHDA 4Q7DA 2GYSA 1OAZL 3VI3F 3BZ4A 4EQ2A 1CLYH 3CXHJ 1P4IL 4MNHA 2HTKC 3BUYB 1QSFA 5IW1B 2AEQL 4HKXB 5T1DL 1NDGB 2IANA 3FOLA 5H2BB 4JCLA 5GZOD 1CTOA 4KFZC 3U48A 4IJ3C 2MTPA 4JM2C 4WY7L 1KC5H 3ZTJH 1D5XB 2CPCA 5IHZB 2CGRL 2XN9D 1AH1A 1FDLH 1Q0XL 2ADIA 2NXYC 3MRHB 1MOEA 3AS0A 4XAKD 2D4DA 4KUCD 1L6ZA 4PRPD 1SVZA 2Z9TA 1IAIM 1U3HD 1BGXH 1JGLL 1P9MC 4OQTH 2E7LA 2QSVA 3RWFA 3UPCA 1KTKE 5IT2H 3EOAB 4ELMB 2Q76B 3PDGA 2R0LL 4PJFE 1L6XA 1IEBB 3QUML 1CU4H 4P5MB 1BD2E 1Q9OA 3CFDB 1XF4B 2RFXA 4NBZB 1WGOA 1JF1B 5DUPH 4P2RB 4MB3A 1DLHA 4AEHL 2W0PA 3QDGD 1ITBB 4P5TA 2FHCA 1INEH 1J86A 4LLWA 4P5TB 1NKOA 3NCJH 3D39B 3RVTC 1QSFE 4JG0L 4Q9CA 4NBYB 4BKLB 5IB4B 4W4OA 4JZNB 4K2UL 3QQNA 1W0YT 1EGJH 5D72H 3RTQD 3SKMB 4M1DL 2AV1A 3BN3B 3MNWA 4NJ9H 5D7IA 1CFSB 3BD5A 2AQ1A 2VUOA 1KEGH 1DJSA 2FEEL 3KYMB 4JY6B 4Q6YA 2BRRL 4OM1H 2EDWA 3KYNA 4ELMF 3W2DH 3RI5F 3LEVL 2GSIA 2W92A 1E0OB 32C2A 3RNQB 2K9UA 3BPCA 4WU7A 3TZVD 2APWA 4GKZA 5EU6E 4UTBL 3L3JA 4L8DA 3O8XC 5IVNA 2FHBA 3GSXA 5GSRA 5C0FA 5F21B 3T0EB 1NSNL 3QUXD 4P2QA 1DEDA 5F1KC 1WSST 4WHYH 1T1YB 3DARA 4RWYL 1H8SA 1FFOA 2WMPA 4GRMB 5EZJB 5KSVA 1QSEB 4JKLA 4H5SB 1DCLA 3PQYD 5E4IA 1CD0A 1I3UA 4EUPG 4Z7WB 1QRNE 1BD2D 1N3NB 1NCCH 2EDBA 4X5XA 5HPMA 2EE6A 4PJXB 1R0AH 2WUCL 4JFED 5FYLH 3P9WB 2VLRD 4AMKL 1M7IA 3DHJA 3OAZK 1DBKL 3QHZH 2AGJL 4Z7QF 4L1HA 4JFQA 4TVPD 3ZL4H 4AENA 5CGTA 4OUUA 3H8NA 4D0CA 4BZYA 3CVHA 3S96B 3SDAB 1ZAGA 1HKFA 4Y89A 3F58H 5HHNA 1JZ5A 4Y16C 3AGVA 1UWXK 4R7NA 2CKNA 1I9IH 4X6DB 4XBGB 3SCMB 3UAJC 1JRHH 3W0WA 5I17B 5DZNA 5J13B 5FHBL 4U1IB 4PJGB 4ESKA 3HZVA 2WIMA 3C6SB 1XFPA 5AD0A 1G9EA 3QUZB 4X7FC 4NP4H 5HI3D 2L7UA 5J6GA 1KTDB 2IFFH 4YX2L 3MV01 2N7BA 4F2MA 4OKDA 4DAGH 3C6LB 1S3KL 5D5MF 3V4VH 3KPNB 4NKMA 4RRPA 4YC2B 3VXOA 2IAND 2A1WL 4ZSOB 3KPOB 1A3RL 4HXBL 3VGFA 5DMKA 4H1LA 4NQVA 1EGJA 4OIIL 3HAEG 3BQUD 1ACZA 1U8KA 4NZJA 2XTJD 1KIQA 4FMKA 3G6JF 4JREC 4XBEH 5DXWA 2AJ3B 4GMTL 4KRMB 2CIKB 2W07A 3LKQB 3QR2A 4K9EH 1VACA 1QFWM 4JJHA 1CIDA 4XP6L 7CGTA 3SOBL 5D1QC 1HKLL 4XBPB 1FNSL 4HQQL 3OXRB 3SO5A 5T3XE 4G8FA 2ZJSL 1NCNA 2EXWC 2EKSA 1URLA 3U2SB 5DHXB 4KQ4H 2A74B 4RA0C 1GVIA 2A6DA 2AS5M 1JNLH 5AUMA 1I9JL 4HDIB 1DEEA 3QEGL 4JRYE 4LU5H 4OQTA 2ZSVB 1QVOB 1OCWH 4JHWH 2YSSB 4N0CC 4NO3A 4U1MA 5EN2A 4M1CC 2E3VA 3VFPA 5CEZL 3SDYH 4UT9H 4YDLC 3QG7H 4YPJA 3QBTB 1CICA 5C1MB 5INDA 4HPOL 3S5LG 3LKQA 4P23C 3A6BH 1AXTH 3QIWA 5BW7A 3I2CH 1U3YA 1BEYH 4HCRA 3D0VA 4HHAA 4GXUM 4YDKL 3QNYB 4U2ZA 2HKFH 5CJ8A 2FRGP 2YD6A 4MDIB 3BP5A 4MCYB 4EXPX 5JDJA 3AUVA 4K8RH 4M9PA 2OQJA 1UACH 1IGIH 3KAAA 1NFDF 4PP1D 2R0KL 3TZVA 1ZVSA 3SDCA 4RFEA 3ZZ1A 5FCSH 4PJGA 4FRWA 3IFOA 2PXYC 4PJDB 2I07B 2QQQA 5J1SC 4NO0A 5DO2C 1ITCA 1A6WL 1T83A 2C9AA 3WUWB 4DCQB 3G6JE 4ZS6C 1J10A 5CBEA 2C4XA 4LFHD 3ARZA 4WY7H 3QYCA 4XAKE 3P2TA 2VZTA 3EO0A 5CCKL 3L3DA 3VGAC 1U8LB 3VD3A 2PF6A 3QDAA 4X98A 1KXQE 4M43H 4PRAB 2Z92B 5MHSD 1RVFL 3MPCA 1TENA 4FS0A 4QRUA 1A6ZA 3DUUA 3H7LA 4JFZH 4PRDB 2AEQH 3DYMA 1YUHA 5CD5C 3TO4A 1OPGH 1KN4L 1RHFA 2X05A 2CKBL 1NFDB 5D7SL 4S2SB 3MREB 3VFMA 1I1AB 5GGTL 3V95A 1P7KB 1IC7L 1QQDB 1AGFB 5D7JD 4XVTL 1XR8A 3WUZA 4UDUA 3RU8H 4QF1A 1IM3A 3CZFB 3WIIL 1KOAA 4PGZA 1BQHA 3L3OA 5E8DH 1DQQA 1IAOA 2KZ1B 2XI9A 2BNQB 3HC0B 2WQRA 4OIBA 2BVEA 1A9EB 4JVWA 5EBMB 2B7DT 2WUBH 1AQDA 4D0BA 4Z7QE 2O26U 1IGJB 2XWTB 4QXGH 3TBVB 1QBLH 4XCFH 2J6EH 4XP5L 1AY1L 3IJYB 4YXKL 5TF1L 4EVNB 1W72B 3OKNA 1IJ9A 1L7IH 1NEZB 3UTOA 5HGBB 3CVIH 4OF0A 2MMXA 3C5SA 5D93C 1Z0NA 1CFSA 2DKSA 1T03H 2L0DA 1UQSB 5DJ6A 3U4EA 2GY7B 4V2CB 4PJAB 3CJJA 4O2EA 2VZOA 5DRWB 2Q87A 4XZUA 1T2XA 4M5YH 1CGSH 4ENED 4Y4HC 4EOWH 1CGWA 5F9AC 4LLYB 4RDQG 1XH3A 2J12B 4ZSOE 5EO9B 3KR3H 2W60A 2DLIA 3BGFC 1QEWB 4U1GB 4RQQB 1N0XH 4ONOA 3MV9B 4HWUA 1EEUA 3RL1B 1IGMH 5J6GB 1L7TH 5EA0L 3MJ9H 4TSCL 3T3PE 1MCJA 1I7ZA 3QUZD 5IIEB 4TRPH 4QHMA 1GAFH 1IL1A 2ED8A 4JFDB 1ZA6B 1KF9B 2DQCL 4XPGL 3UTZA 2X7LB 3GMNA 3LHPH 4UAOC 4ZTOL 3R06B 3KPLA 3NIDF 1U8OB 1JPTL 2L4OA 4TPRH 1SYVA 4X8JB 1HQ4A 3OB0H 4PRPB 5J1AA 1I3RB 4QHUB 1MCIA 1UGNA 5I16B 1T20A 3I50H 5ENWB 1ADQH 4Z7NE 1UM4H 1I8KA 2YPKB 4MZ2A 5IOPA 3RVWD 4UMGA 4NWTL 5KW9H 2DQEH 5C0GA 1J12A 1WZLA 5KS9E 1WBXB 5JHDD 5J9PA 4ONFL 1BD2A 4PBWD 3AY4C 2Y07L 3DJ9A 3MRLA 2VIRA 3T4AA 4JO4H 2DDQH 2Z91A 4MA1B 3RZCC 2PO6C 4P4KA 1T2QH 3MJ7A 1G7HB 5GRVL 4BYHA 2GSGB 5TQ0L 1Y18B 4YFDB 4NGHL 4OKVB 5EZLB 3MXVL 2R23A 5DJ0B 4NN6C 4XPBL 1UJ3A 1UFUA 3O6ML 4XTRC 4FQ2H 2FR4A 4XMPH 1XF2B 1UC6A 2VIRB 2DQFB 3T4AB 2G5BA 3VA6A 5A2KH 1UKSA 1U8NB 1OGTB 5D70H 5KANG 3WHE1 1PYWB 4FNLL 4WU7B 1UG9A 1TITA 1DUYB 2BVUA 1JRHL 4P4KD 4ZUVA 1ES0B 3E2HC 2W9DL 1N4XH 4YUEL 3C9NA 3ZE1F 5I1DB 1CD9B 4QXGL 1LWRA 5DD0H 3I02B 1ZHKA 3LKNA 1AY1H 4DOHE 5DMGC 3RIFF 2VXTH 3HE7D 5EC2B 2DI7A 4QXWA 1CN4A 2HTLD 4NWUH 3UTZB 3QISA 5JR1H 3O0RL 4F7EB 3BDBA 4XT1C 3V4UL 4PJHA 5JW5B 1BAFH 1U95A 2R2BB 5E7BA 3SKNB 4G5ZL 2LU3A 4I18C 2Q6WA 3D39A 1EJOL 3VXMD 3ULSB 2N7AA 3O4LE 3OMZA 5EPMA 4YAQB 3SGKC 1KN4H 2YMXL 5IQ7H 4WFFE 4QTHB 1G7PB 5DK0B 4TULH 1VPOL 5HYSA 1VESA 2DWDA 4LVHB 1XMWA 4EKXA 4H25B 3MLZH 3EOAA 5I1CH 1I1CA 5HYQA 2VLME 4JAMA 5HYJE 3U6RA 4LNRA 3TN0A 3FQXB 2WP3O 5KJRH 1Q72L 3I6LD 4LP5A 5DS8A 4XAWH 1AE6H 4M62L 1PLGH 4NQXA 4UAOB 3GHEH 3UDWC 2DJSA 4ZPVB 2J8UB 1Z5LB 3O6FD 4KDWA 4EDWL 3RTQB 1G0DA 1WJ3A 1K5NB 1QFUL 1UZ6E 3CUPB 1ZGLB 4M7KL 4OFKA 4AH2B 4FQHA 3UYPA 3WE6A 5DMYA 2PTTA 1N59A 3O2DA 3V4PH 1G7PA 2YPVH 5DK0A 5GZNC 4RMRA 1NANH 3SGJC 3RZWA 4XX1G 1J8HD 3PGFL 4Y5XA 1DFBH 5GZND 4TNVK 4OGXH 3NIFF 2JCCA 5GS0D 3BRGC 2X10A 1A3LH 4O9HL 5MENB 3IAGC 4HUWB 5DHVB 4G8EA 3W11D 2W91A 1AGBB 2AEPH 1DQLH 5GHWH 4GSDL 3RVUD 3UZEA 1B0RA 1EX0A 3GK8L 3TBSA 4HPOH 1UXSB 3OR6B 1T4KA 2XFXB 1Q1JL 4K3JH 1U58B 4FQCL 4WI9A 4MSWA 5MP6H 1U41A 2EDNA 5LAXA 4LSTH 2OJZL 1YPZF 4OZGE 4I3RH 1YN7A 1T83C 3LRHA 3LN4A 1DVFC 2MJWA 1FVCA 4YFEA 4ZAKD 3IT8D 1A2YA 2DQUL 2G60H 4M3KB 3BZEB 5IMMA 3QUYD 2VABB 3AS1A 3BN9C 4YHYB 1S9WA 3D9AL 4N0FB 2APTA 5ID1A 3UYRL 4YHOH 5FDYA 4ZUWB 5B8CB 1RZ7H 4AYFA 4N9OB 1WWWX 1NUDA 4G9DA 2VL5B 4XXCA 3LZFL 1OP3K 1UM6L 3RVVD 5IESH 5ALCH 5DQ9B 4TUJA 5KSAD 1F8TL 2ILLA 2B5IB 4LASH 4NNPH 3P9LB 3G5YA 1TTGA 4ZD3H 2IADB 3FHAA 4JHAL 2XZZA 4WGVB 3DV6A 1FYTE 2EDKA 4R97C 4ODTL 2PYEE 4TOYL 2R69L 1NGQL 4TN9A 2XOTA 5IV2A 4NOBA 5E6IC 4CVZA 3MV7E 2VC2L 3QQ9D 5IVZA 3U7YH 1VKXB 1JTOA 3LRSA 4EDXA 5E99L 4LSSL 3GJEB 1MCWM 4FTVD 4HMDA 1OAXH 4QYOA 2OI9C 3O3BB 4FG6C 3MLSL 3F12A 5I73C 3R06A 1IAIH 4AZ8A 5J6HB 2R0WH 1S7WB 4P2RE 4HZAA 2GTZA 4UQ2B 3U0PA 3ULVF 5C0NC 4U0RB 3FCTB 5E2JA 3O6FB 3MTRA 4WENB 3VXRD 1QNZL 3CPLB 4W4NA 2BERA 1G9NC 4PB0L 2OXHA 3D39E 4DOHB 2K7QA 3MLRL 4N0UB 2DMKA 2HMIC 3OXRA 1VGKA 3MV9A 1T0PB 3GKZA 3MC0A 1CFVL 2WUCH 5C6TH 3VFSB 4AY0A 2VLJB 3EOTL 2GAZA 3DTXB 5JUEL 3WHE0 1QLFB 1PDKA 1FNEA 5IK3B 5IROC 5CWSB 1FNEB 2RQ8A 2OJEB 3HS0A 5F93C 4IRSD 1CDGA 4LOUC 2CUHA 2JIXD 3LOWA 3VWJD 5B39G 4J3VA 5GQBA 4PD4K 5C0BB 4OGAC 3WJJC 3JV5A 3SE4C 1ZSDB 2F58H 5T1LD 5F96H 5MERB 3G5XB 3T0VA 3HPJB 3QH3A 1NLDL 1JPTH 4JN1H 1PKQA 3OSKA 2LVCA 3PABA 3ULUH 5IFAH 6CGTA 4LSVL 2VUYA 3SCMA 3GRWL 2L7JA 4Y1AE 5D6CB 1XGPB 4KUZH 5D1ZB 3H7BB 2C5DC 1CE6B 4OD3L 4QGYA 3SDAA 4NDMB 4MHHI 5I1LA 1ZS8A 5E2VH 1JE6A 4DW2L 3DURA 1KNOB 2ADGA 4P48A 3U7AA 4PJGF 1EGJL 4LLVB 1ZT7B 4HAFA 2BOCA 3JWOL 3VXUD 4Q9RH 1CDUA 3QDJB 2CMRH 5I75B 3QXAA 3CFBA 4GKSA 3U0TB 3OKDB 4YBQD 4H5SA 3F6LA 4F57L 3WYRA 1J8HE 2PN5A 2DB8A 3TA3B 1T5XA 1PW3A 1U8LA 4PV8B 4YBQC 1VEMA 5DD1L 3UPRB 4KTDL 1F6AB 2RIKA 3QJHA 5ACLA 4OCWH 4P57B 4NO0B 4IRJD 3AAZA 2R56H 2CR6A 4LHUD 2HG5B 5F1OB 1BFVL 1V3JA 3BPCB 4G8GB 1OP5H 2ZUXA 4YHMH 3EOBB 2YEZA 3V5HA 1AD0A 5KSAA 5J11B 1KTRL 1MCDA 1CL7L 4OV5A 1CLOH 4J2XA 5DJAA 1IILE 5HGGS 1XF1A 1A6VH 4XXDB 5FA3A 2AK4D 4IDLA 1GGBL 1NEUA 1AFVH 1JHTA 3P0VL 4JHBA 1WWBX 4MD0B 5IW6B 4R4FH 4QOKE 5C0IB 2NX5E 1OPGL 4MS8D 3PXJA 5CWSA 2CKBH 3GHBH 3MUGA 1X5LA 2PO6A 1F6FB 5DD3L 5IEHB 4KMTL 1MHCA 5C9JB 3AVEA 4OCSH 2X89D 2J8UF 2DLTA 5DYOB 3TN0D 1LDPL 2NY1C 2ZCLH 2FIKA 5GRVK 3L7FA 1EJOH 5C3LD 5JW4Q 2SEBB 1WFNA 3SJVE 3V6OC 1BBDH 2XN9B 4IJ3B 3JZ7A 4YEEA 4X7DC 1B0GA 2JJTC 2G9HB 2X4PB 3WS3B 5CJQL 5ADPL 4GAGH 1ZGLA 4HLZH 4NO2A 5E4EB 1PG7X 5BO1H 3O9WB 1OSPL 2PO6D 1G9ML 3Q6FA 4ZUUB 4NKDB 1NAKL 1MRFH 3HTLX 3UZQA 4NQXB 1SBSL 3QWRD 1UACL 5ICYB 2J6EA 3O2VL 4LCWB 1OGAD 1D5BA 5FYJE 5DD1H 3LY6A 2FX9L 3DIFB 1PGRB 5C0JA 5DT1H 2LV4A 5MI0B 3ZMRA 4KHTH 1LP9F 4HV8B 4DKFH 2VWEC 5B38A 2VR9A 5HYSB 4LLQA 4NRZB 4OIAA 1WK0A 2BVYA 3I3DA 3FQTB 1T1ZA 1HIML 4FQJH 3VD5A 4FFVC 5TQ0H 2DBLL 4GRLB 3HE6B 1JPFB 5IMOA 3VA2C 1KYOK 3P4MA 3HE7C 2GJ6E 4FP8H 4I48B 2BNRE 3CXDL 3K1DA 1M4KA 3QUMB 5BVJB 1RUQL 5D2NB 2BHUA 3TF7C 4P4RA 3MLXL 3DETC 4HKBA 4UU9A 3U1SH 1H0DA 4YDIH 1RFDL 1HWHB 4B50A 2VLKE 4YWGL 3O9WC 4F15C 5K59E 3LKNB 2WZPD 1JK8A 3DGGB 5KSBA 2WM0A 4NRXB 2V9QA 4ZOEA 2F54E 3OKEA 5IFAL 3B6SB 2Z8VC 5CP3H 4LHQB 1S7XA 3SDCD 4CJ1A 2XA8L 1HH9B 3ES6A 1I8MB 3MMEA 3REVA 1ZGLM 1ZEAH 4WFHD 4ODHH 1TTFA 3L1OH 4WI4A 2F8OA 4OZFH 1AGBA 3RZCB 3GSUB 5TH2A 3RNKA 3MFGB 4ALAH 4LP4A 5HGHB 2V5YA 1LD9A 4NBXB 1XCTA 4NZRH 4ODSL 4OCSL 5T3XD 4R0LA 4F9LA 1QP1A 5T1KA 2HT4C 3ARUA 3MJ7B 4HT1L 1FO0L 1QLEL 3N1GC 2OR9H 3RWEA 4PJ8A 4Y4FD 4OSUL 3V4VL 3QDJE 4URTB 5DJ2B 5EZIH 1UADC 4U3XA 4FQHB 1NFKA 2BVPB 4DVRL 5GGSY 5L0QB 4XWGL 4WI2A 3DIFA 1ZVHA 5C0JB 4M48L 4MJ5A 3SDDA 1FC1A 5CEZD 1Q94B 2VQ1B 3RNQA 2NY0C 5IB3B 2HVKB 4CMMB 5C07B 2MSPA 3QCUH 4PJIE 3TYFA 2CLVB 1G9NL 3DRQA 3MV9D 3KYMA 1M71A 3TZVC 5F71A 4MA7L 3A6CL 5J13C 5LWYH 2X42A 3HPLB 2X7LA 3GMNB 4BQ6A 3OR7A 4OI9A 5ELIA 5D9SB 2H9GA 1BBJA 4ODUB 5ESVB 4G8GE 2R0ZH 3HMXH 4C4KT 3C5ZD 1D9KD 2VAAB 3QULB 4NHUA 1B0GB 5D7JC 4GT7A 4BFIB 1HQRA 1MY7A 1NMAL 1HHHA 4XNUL 3T0DA 5K9JH 1DANT 4F58L 1EO5A 3B5TA 1WFOA 4ALAL 3MODL 4GKNB 3HE6C 4UUJB 2NY2C 4MGXA 1SY6A 1WT5C 3D2UB 3QDHA 2F53E 4O2CA 1CICC 4JFXB 4JPVL 5DRWA 2EECA 4MNQA 4YHNA 3SKJL 2X1QA 2HFEA 3C5ZA 2CIIB 1F8TH 3TBWA 5DZLA 4FFWC 5E6IB 5F9JB 1JZ2A 2Z4QA 2WW8A 4NKOB 2MWCA 4APQA 4A6YB 1KCVH 5FB8A 1VADB 3SJVB 3CNKA 3ZTJG 5IWLC 5TE6H 1EO8H 12E8L 2ZUQC 3TWCL 1OTSC 4TTDD 3U9PL 5EO1B 2ZUQB 3TBVA 3RY6C 1QZ1A 3ARBA 3P4OB 5F7FA 3CDFA 1QPPA 2ATPA 5CEZE 4YDLB 1KPUA 2A6JA 5BVJA 1EK3A 2AEIT 1NCAL 2DQGH 4KTDH 3CXDH 4PGBB 1ZK9A 5DZOA 1XR8B 4YZFF 4CN1A 4ZFOL 4NIKB 3STLB 1T5XB 1BIHA 5F7EL 3BZDA 3TVMA 2EZ0D 4X6EA 43CAB 4JFHD 5E1AB 1OOAA 1QR4A 4RGNB 1O0VA 4YO0B 1RI8A 4FQIH 5LQBL 2HJLB 1PJ9A 1OB1A 1UZ6F 3FT4B 4N90D 4PJFB 3LQAL 1QBML 1PG7H 2BOCB 2YD5A 4QHNB 5AZEL 1R3LB 5LGJA 1BD2B 5DVNA 1U42A 1ZHNA 2VITB 5F7YC 4IRJA 3EGSA 4HWBA 2P5WD 3VWKD 1T04B 2X4SB 3Q48A 5LVEA 3LMJL 4K23L 1CE6A 4NRXA 4UT9L 3HRPA 4DKEH 1UWEH 2BP3A 3DGGA 5F6HJ 5H37H 1XF5A 5GGVH 3G5ZB 3TWCH 5KAQG 4L3AA 3KPLB 4OLXL 4WHTB 4GW1B 4N0RA 3K1KC 4I77H 1H3VA 4X6BA 3U46B 3VI4E 5FUOH 2HLFD 2M26A 4OTXH 4BUHA 5FO9A 1DL7H 3Q5YA 4LSUL 4KGJA 5BS0A 3L3KA 3RPKA 3VWJC 4Z5RA 3IXAB 3LN5B 4OUOA 3VWKA 4XHJD 1MFAH 3WFCH 3RGVB 4H8WC 4NFDA 1R5WB 1L0QA 2AVGA 3O6LL 2K7PA 4NO5B 3Q0HA 2YD2A 3H9HA 4GG6B 1ACYH 3EDKA 4QTIL 4B0MM 4O2EB 4LLDB 3WNPA 2AJZA 3HB3C 5JPMB 1Q38A 4D9RD 5FO7B 4X0KB 4ZUSB 4U6XB 1QSEE 1P5VA 2DQIL 2N1KA 4Z77B 1MJJB 2OYPA 2WBKA 1A4KB 1FVEA 5I1GL 3O3UN 4NC2B 3EOYG 2FB4H 4CGTA 3K81A 5DD0L 1FIGL 1EMTL 2R2EB 3FHQA 2ZSVA 4N0YL 3QEUA 5D5MB 1FORL 1MWAH 5JA9A 1O7VA 5SX4I 1CFNB 2FGWH 4AIOA 3NPSB 3VI3E 4P3CL 5IMLB 2G75A 4WW1B 5I71C 2BOBB 3LRSB 1K85A 3TIEA 3EDJA 2H6PB 5CJOH 1MCNA 4FTVB 5D1XD 3MXVH 3MREA 2D9CA 5FGCE 3JBG7 3CCHA 3GMPB 4G6JL 4JR9L 4XRCA 1NGQH 4PJGE 4XB7A 5CD5D 3FTGB 2Q7YB 3GBMH 1HIMH 4FQJL 3RJQB 1CT8A 1VSCA 2FNBA 3GEWB 3H9HB 4GG6A 4FXKA 1M7DA 3TPUB 3KJ4C 3ZDYF 3GSRA 3DO7A 3Q2CA 5ALBH 4YFLI 1ZA3A 1BVLB 1AXSA 1T21B 4HWZB 3P9LA 1R5WA 4P59H 2VXSL 3ZTNH 2JELH 2VE6B 1EEYA 4G6ML 3QB7C 3SE8H 1RZ8A 2R4SL 3QCTL 3GSNA 1HXMA 1ZOXA 4PD4J 3U30B 1UZ8A 3BVNA 2A38A 5F9OH 4PJEE 4KK6D 3CIQA 2HLAB 4QCIA 5BRZB 4M7KH 1ADQL 3T4YA 4NQCA 3X3GH 2MKWA 3FZUC 2H32H 4GKOA 4D0DB 3B8SA 4OM1L 2HT2C 3VG9C 4RAHA 1I85A 3IDYB 2VE6A 1ZVYA 2B8OT 2GUOB 3EO9H 4JRYB 5DD5L 4DN4H 3RGVC 3QAZB 1LDPH 2IH1B 5EBGA 5IG7B 2AJVL 1R3LA 5LGJB 3UC0H 1HWGB 4O4YL 5FUCC 2Z0BA 5HPMB 1DQLL 3BZFA 5GHWL 2E5EA 3O3DA 2A6IA 3UTTB 3LIZL 3HI6L 4RMWA 4JFFA 5F72S 3DV4A 4AEHH 3IU4H 4LLMB 5JXEC 1A0QH 2KZWA 2P44B 1DDHB 2Z35B 1E4KC 4OZFB 5CZVL 3PWNB 4QT5B 5IF0A 4U1MB 1S7VB 5M94B 1CD8A 4AEEA 2M2DA 3WD5L 1QFOA 5IBLC 1EMTH 3UO1L 4OF5A 2Y5TB 4YHKH 5HHPB 1PKQB 4PJCA 2B2XH 1U3HB 4WCYL 1MLBA 4UZGA 2G5RA 4PBVC 4CADA 1LEKB 2CK0L 4YHYC 1GHFH 1FZKB 4PTTA 1Q9LA 5H35A 4N0CD 2EO9A 4S1RL 5C08B 3TYGH 3DMMA 4EBQL 1FGVH 2DI9A 3ULVE 2YRZA 1AI1H 3IDYC 3VXQB 4JB9L 5D93B 4S1SH 15C8H 3S7GA 5DD6B 3OHXB 3KDMB 5CILH 1UM5H 4JPIA 2CIIA 5L6YH 4I18B 4TNWF 3MGOA 4RGOL 3VXRA 4F57H 4DEPC 2FO4A 2YBRB 2CH8A 4PLJD 3ZLQC 3JTTA 4AT6B 4HJJL 4MD4A 2FJFB 5JIHA 5I1AA 4PLJC 2HT3C 4NQDE 3LIZH 4Y19E 1B2WL 2YD8A 4E5XB 4LCUA 2GFBB 2ZNWA 4ZPTA 1AI1L 2AJVH 3PWUB 5E6ZA 5CUSL 2FX7L 1UM5L 2AK1H 2HVJB 5DD5H 1S7SB 1W8OA 2ICES 2KPNA 1RD6A 3OKMB 5KW9L 4IM8A 3HAEH 1CGYA 2NXYB 4X5WA 4WFED 1PSKH 2NCMA 3WIHL 3LKOA 3OJMB 5HI5C 1EHNA 4OM0L 4C56E 4XP1H 3CSGA 2X1WL 3QZWA 3VD4A 2C3XA 1A5FL 5IVXF 3FB5B 5L88H 3D6GA 4H1LG 1AGEA 5KVFL 1P6FA 5F7LB 1Y6KR 5C0RL 1NFIB 4QHNA 3K3QA 1QLEH 2YPLD 4GSDH 2VR4A 3FOLB 5H2BA 1FZMA 4L8SC 4M8VA 4OFDA 4M02A 3CX5K 5KSBF 4GUPB 4MNHB 4BZ1H 2VDKL 4JQXA 1QOKA 1CFVH 2J88L 4XI5C 5D2LB 3ULUE 3RBSA 1AHWA 1CR9H 1JHKL 4MYWB 2NY7L 5K59F 2VNCA 4L9LC 3K2UH 2DICA 3R8QA 2LQRA 1WBXA 1P84K 3IAQA 4J3TA 4L9LB 2ZCHL 4YGAB 5IEKB 4WO4A 2VXQL 3EZJB 3VXRE 3ARBB 5JOPE 1KJ2A 1P1ZA 4YHZH 3OKEB 1G9MC 1FCGA 4KI1A 1ZHLB 4R90L 5F3BB 1F90H 3DXAB 3WIHH 3Q6GH 1HNGA 5BRZE 4G9FB 4O02L 4IMKC 4G7VH 4Y4KA 4LSSH 2NR6C 5D7IB 1MUJA 2F74B 3DVGA 1EJ6A 3UTSD 4D3CH 2NR6D 2ZOLB 1G0XA 1SM3H 2CR3A 1H5BA 2Z31A 1YA5A 4G42A 4ZPTB 5EPMB 2D7PA 2ZCLL 3CFCL 5FYJD 1VEOA 4LLWB 1FBIH 2QHRL 2DQTH 4YBHA 4C56A 1DBJH 3B3IA 3CFEA 4WJ5A 3HNVL 2P7TA 3HRZA 1WUNT 5E6ID 2DKUA 4MNQD 2IFFL 3UTTE 5H94B 1WISA 1MUJB 3OHXA 3OXSB 3HR5A 1B4RA 1HH6A 3UYRH 1JGVH 1UEYA 1F4XL 4GBXC 4UDTA 2C3HA 3B9KB 1WIUA 2O5XL 3VMNA 2AABL 3C9NB 2ZUVA 1W72A 5HHQA 3BN9D 1P1ZB 1EEZA 2R4RL 4HJ0C 4JPWH 2VQ1A 3LD8B 1Z2KA 5J11C 3TA3D 2OJZH 1BVKA 1AR1D 3LSOB 4L3CB 1F2XK 1QUNA 1U8IB 1HOCA 2R39A 3LRGA 4WEUD 4K9EC 4IHOA 1GPOH 1ORQB 4OZFA 1HHGB 3HKFA 1IM3B 4QNPE 2APBA 3GK8H 1JGEA 4RISL 5INCB 2J8OA 1ZLWK 4MJIB 2BJMH 5DO2D 3MRJA 3RHWK 5M7QA 4MXVF 3GSUA 5JQ6L 4QRRB 4L1DA 2D7QA 5ITFA 1MFAL 2W65B 3LH2L 4LOUD 4YGVA 3WFCL 2Y07H 4NPYB 3HN3A 2X4NB 3P0VH 3CZJA 4JRYA 4Y19B 2Z93B 5C0EB 3SN6N 3B6SA 1AKJD 3K2MC 1CI5A 1SVCP 2IPKA 5HHVH 5FYKL 5E00B 2WWKO 4QRPE 2PYFA 4F8QA 1R24B 4Q58C 3WFHB 2FEEI 5KOVC 5FIEA 4YK4B 5GGVL 3QQ3A 1I9JH 4NZTH 4JANA 4P2OC 1G7QA 3P9MA 4U1HB 4YNYB 1VDGA 4J4PA 3NIFE 1WQVT 1GOFA 3F8UB 3UXFA 1MFDL 4WWKB 5EZLA 2P5EA 1FQ9C 3ZT7A 3NFPB 1UH4A 4LEXH 3HUJF 1BFOA 4LNVA 2OL3B 4M9OA 3W5NA 3HUJA 3TP4A 4YDKH 1CGSL 4EOWL 3IDMA 3AXLB 3D85A 4CW1B 4HH8A 4WO4D 3VFNA 5GGRY 3DOSA 1LE5B 4PPTA 1AO7B 3RQ3A 4P2CG 3IDGB 2EIZA 3WXWH 1I8KB 2YPKA 1KEML 4LARL 3SDXA 4WW1A 4L4VB 3MLRH 4KUZL 1F4AA 4Z95L 3WXVL 4MA7H 1CXIA 1OAKL 2AJUL 1U2CA 4YLQT 3V0VA 4I8DA 1PZ5A 5IT2L 5EN2B 12E8H 1U8OA 5EZOL 3BH9A 2AABH 3IAPA 4FHBD 5DMIH 3Q3GB 5T5NG 2JTDA 4ORGB 5DJZB 3WS3A 5SX4H 3ZKXB 5IKCB 5IF0B 2QKIB 5HHVL 4ZFGH 5CEXA 1MNUL 5IFJB 1VA9A 4ZXBB 3IS1X 2I5YH 4PREB 3M8OH 2JLLA 4Z77A 1ZSDA 4TULL 4UINH 3VFVB 2IG2H 4XNYL 1QQDA 4O00A 5HDQL 5D7IE 3ARDC 1C1EL 5ISZA 5C09B 3V6FB 5HHME 1OGAA 1F6LL 2C3GA 5FYKE 1MH5A 2AXJA 1HYSD 4X83A 3U4BL 2X4UB 1C08A 4LPVA 4CW1A 1KSRA 1I1RA 1KIQB 3DTXA 4KAQH 4ZO7A 4G5ZH 2AAVA 4MAYA 4AIZB 4OLUL 5I74C 4JO4L 1I1YB 3OKOA 3FZUD 5DMKB 2X9XA 3QWOB 2BK8A 3JV6B 3MOBL 3ZE1E 4UINL 5J06A 4FN0A 5I15L 2D4FA 1CL7H 3A6CH 1MCPL 1YJDH 2GJ6D 4EJ1C 4JDZB 5FO9B 2NY6C 1HHJB 1CXEA 5E4EC 1RJYA 3ZE0F 4U1IA 3H9SD 5CD3A 4NM4L 4CAGA 4ZAKC 1OP9A 3QXUA 3BPLC 4H8WH 2A0LD 1IAOB 2D2OA 3EJZC 1X5FA 1F6AA 2ICWJ 4I3RL 3K2UL 4O51A 1FGNH 3NPSC 4KKCD 2CRIA 3ARFD 4HK0B 5D7JB 4OZHA 2BVOA 1ZWIA 2MFNA 3ZDYE 2E9JA 2FWOB 3S88L 2H2PC 4ZUTB 3MZTA 3VGDA 1XF3A 5DVKA 4PRDA 5ITFB 1RJZA 1X9QA 2XTJB 1S7RA 4FFVD 1MJ8L 3EFFA 5FYKU 1YEJH 4AM0B 2JK5B 1JF6A 4LK4A 4R8WH 1UYWH 3PJSB 3BJLA 3I3EA 5KSVB 1QHPA 2OR8A 4OGXL 3PQYE 4ZDHA 2XZAH 4QO1A 2OS7A 4NWTH 3W9DB 4BQ9A 1JGEB 4Z6AT 3CU1A 1MIML 3NIGF 1M05B 1FORH 1MWAL 1T2JA 4HC1A 1OWWA 4PJDA 1F02I 3OAUH 5FYJH 1V3KA 5ACZB 1J1XL 3H9YA 1XIWB 4OLYH 43C9A 1IGTB 3KG5A 4EN3C 3STZB 3JWDH 3I3BA 4PJ7B 1EEZB 4FZEL 3TZVB 4U6VH 4W70A 4UOJA 4POYA 1YJDL 1CVSC 2A83A 3MCKB 2CRYA 4K3GA 3VJ6A 5I18H 3DMMD 4CDHA 1T80A 4N5EC 3IXTB 4XVTH 4FFZH 1NUNB 2W0FB 4HEPG 3BI9X 2VISA 3C5ZB 1WBZA 2QHLA 4MX7B 3T08A 3S34H 1CGVA 2F53D 3V6ZB 3K4DA 5E9DA 3FN0H 1CFTA 1CDCA 2AXGA 3V2AR 1N2RA 4XB8A 1W0VA 1JPGA 3W82A 4Q6IB 3I6LE 2Z31B 5B3NA 3QDMD 3SGJA 5FOBB 5F6HI 2VAAA 1C5CL 2NY4C 1IM9D 1CZ8L 1Q9KB 1JGUL 5EU5B 4ELMA 1EFXD 4G80B 4UQ2A 4X6FA 5IHBA 1UB5A 1OVZA 3KPPB 1TVBB 3P4NA 1S7WA 2OTUB 4GW1A 2X70B 2PXYB 3RVUC 3VRJA 4HIIB 4XBGA 5EZOH 3V79C 5DLMH 4OCLC 5FF6A 3SBWC 4XPTL 4I3SL 5C07A 2Q8AH 3RWIA 1RHHA 3UTPE 4ZOAA 4D0CB 3UCRA 3WFZA 4EI6A 4KJPD 4AENB 2EIBA 1NUGA 2XPGB 4LRNL 2EIZB 4D2NA 2ENYA 5IV2B 5LXGL 5I1CL 1DBKH 3PP3K 3NGBB 1YPZA 2CO7B 2V5SA 2YK1L 5GRYA 5ID0B 1QLRB 1ZT4A 1A4JA 5AZEH 4DVBB 3RWEB 4QKXB 3BQUB 4JY4B 1ED3A 3QUKB 4YO0A 3G04B 4XC1L 5T1KB 5E5MA 2NY3C 1ZTXL 2HJFA 4XVSL 1BFOB 4JVPA 1CLYL 4PJEB 4X9HA 3C2AL 3DXAD 5CS7A 1AJ7H 5CZXD 4NN6B 1AKJA 1UM6H 5IESL 3OKKA 5DQJA 3HMXA 3GM0A 3D0LA 3LN9A 4Y5VC 3S36X 1NSNH 1H5BB 1MCKA 3D3VA 4ZUWA 4JPKH 4Z7OE 1KPUB 3SDYL 2JB5L 2N56A 1S5IH 2XA8H 2NY0D 2BY2A 4GAFB 3RY6A 5B38G 1JUFB 4HFUH 1IAMA 2ARJB 5EU6D 2XACC 4G9FA 3QJFA 5J12B 5E00A 1IEAA 3K8LA 4JG1L 4R90H 4QLRA 5JW4R 3QG6A 1K2DA 4A6YA 1IE5A 2UYLA 1KEMH 4LARH 4RDQF 4FQ1H 2I9LB 3GO1H 8FABA 5TGBB 4OLVL 6FABH 4JM2A 5FKPB 3CH8A 3RWCA 1IC1A 1RZJH 5F7UA 1QBMH 1P4LA 4HIJA 3T8XB 4ELME 4IS6A 1B0WA 1GL4B 2MOVA 3JWNC 3E1F1 1PEZA 1JI1A 1P5UA 1KJ3H 3HE6D 5AAWA 1QSED 3WSQL 3QPXL 2WBWB 3D25A 1I3GH 2IBZY 4HIHA 4K7PY 5E8NB 3RBGA 5KVDH 4U1GC 3NN8A 1ED3B 2NY5C 1T66D 4X6DE 2HTKD 1HHGA 2Z31C 1C12A 1MEXH 3OV6A 4FFWD 4DAGL 3BAEL 2VLKA 4KQ3L 3MGOB 1U8IA 4NQCE 4QWWC 5CSGA 5C0GB 1MCFA 1X5YA 2XQBL 5C08E 4EI6B 4Y4KC 3VU2A 1JBJA 4N8VG 3V6OE 1I75A 1LO3L 1RHHB 2OMNA 2IH3A 3QZWB 4UNUA 5L2KD 4P9HC 1F4WH 4F33B 4H8WL 1HQ4B 4PRPA 3KXFE 3BWAB 4HUNB 5CIPA 4U3CA 4P9ML 4IRSB 3CLFH 2OTUA 2CJUH 3QNZB 4LCCC 1NJ9A 5ADPH 5HGAB 1QKZL 1EH9A 4XP6H 2ZJSH 2VLKB 4HQQH 1INQA 5E99H 3E6FB 1F11A 2SEBA 2BDNH 3RL1A 3HC4H 1R3KB 3U4BH 4NNYA 2OL3L 2V6HA 1QEWA 3MFFA 3T0EE 1IGYA 2EIEA 2XXMB 1JMXA 5C0AE 3M1BB 3T2NH 1DQDH 1YDPB 5DMGD 2IAMD 4XNYH 1WEJL 4YDJB 1EHXA 1B6UA 4NSKB 3VFTB 3V5KA 3VCLA 4M7LT 3LKPA 4WI7A 4UT6H 4JRYD 2I9LA 8FABB 3IXTA 5K33A 1XGRB 5CHNB 3WCYA 2OZ4A 1K2DB 3DETD 4PB0H 3RPIA 3M45A 3HG1E 4BFGA 4JHZA 3CD4A 5EOCH 4HC1L 5KSAB 1F4WL 1F90L 3SGDI 2ESVD 1J1OH 5K9OA 1SY6L 4G3YH 4AEIL 2FYYB 4OCMC 5DFWH 2ZCHH 2UWEF 1NCDH 5J0BA 4QGTA 4NJ9L 5M95B 1NQBA 2NY7H 1FFPA 3NGBC 3O6KH 3RWHB 4FP8L 4LDLB 1MJUH 2KQNA 3BDYL 1DLFH 2ED9A 2DYPB 3BISA 4FMFA 1JZ8A 5FGBA 1D3CA 3GMQA 5GJTL 2LTQB 3MLUH 4GXUN 1S7RB 5EOQH 1XR9A 1YUHB 5ERWA 4L5FH 3L1OL 3E3QC 3E8UH 1J0IA 3V4PL 3UTQB 2R0LH 4PJDE 5DK2A 4DUXA 1KFAH 4CVWA 5DHYA 2GJZA 2B20A 1A9BA 4G8IA 4LPYA 1X4XA 4NJAL 2ICEB 1TETL 4M7ZC 3P11H 1KCUL 5I16A 4LPXA 4PJEF 3S5LA 1TTUA 4XCEB 1T89C 4S1DD 1SYVB 2IFGA 3F7PC 1HYSC 3FB8B 2R9HD 2VLMD 4NO2B 1S7UA 1M1SA 3O4LA 3SDCB 2FX8H 5IIEA 4G6FB 4AG4H 4ZXBC 5EU7E 3FQNB 1SHMA 1YQVL 5MERA 4LSTL 2GW5A 3IJSA 4XNQA 1KCUH 3QQ4B 4KROC 1JPGB 4DKAA 2D7TL 5C0BD 1J05A 5F1IB 3ZTNL 1N2RB 4N8PA 5IGXL 3RWJA 1WF5A 3CC5A 4Z7UF 1ZA3B 2IEPA 1E6JL 4P99A 4XC3L 1LK2B 2NY6D 3VRIB 4AT6A 1KULA 2ARJQ 4XZUB 3LV3B 4M7JL 1CDHA 3LV3A 1KXTB 4HS6B 5I74B 1IT9H 4DKFL 4S1QL 3TCXA 4G6JH 1ROWA 5KVFH 2JIXA 5LXGH 2B4CC 1OSZA 3MYZA 5HGBA 1GPOL 2PKDA 1GJIA 3H9ZA 3QO1A 4TUOA 3PG2A 3MLPA 1S9XB 2X6MA 3IXAA 4JPWL 3FQRA 4RRPG 3DX8B 5EOCJ 5JHLL 3TJEH 4MHHG 2VB5A 4NO3B 4C59B 3WBDA 3KPRB 3VXUB 3BW9A 4TTDC 5JXAH 2EDYA 2R2EA 1PBYA 5L2JA 5AUMB 4G6AC 1S7VA 3F12B 4KGLA 3SGEI 3VXTB 2WK2A 2Y7QB 1MJJA 1FNSH 4QRRE 3W9DA 3MA7A 2YOCA 1T0NA 2AV7B 1TQBB 3EUUA 3O9WD 1H3GA 3TA3A 3ZT5A 4OZGA 2BMKA 2A6IB 1P2CB 5K9QI 1FBIL 2QHRH 4OFVA 2O5YH 1QYGH 5MEOB 1HHKB 3GB7B 4L4TD 3FT3B 2D03L 1K4CB 3CDGB 1BJ1H 4HUMB 4M43L 1KLUB 2NW2B 3DURB 1AR2A 3HI5L 2XT1B 2BVOB 2DQEL 4Y0GA 4NDMA 1WFUA 3C6LA 2V5MA 2FJHB 2PR4H 3RWHA 2MNUA 4KTYA 3PE9A 3U30C 3UJIL 1UJTA 4WEMB 5BRZD 1RMFL 5EIQA 5FUOL 3GSVB 4J3UA 1JZ4A 2W9DH 5HHOD 1F3JB 3CLFL 3IDJA 4NKIL 3PABB 5KS9B 2R56L 1HHJA 1UH2A 1BIIB 4LVOC 1JWSA 4KJWC 5CSZB 5C70A 2AQ2A 1T1XB 3ILQC 1KACB 2W1NA 3KWWA 1NMCB 4HBCL 5DUML 1A14L 1RZ8B 2R4SH 3QCTH 3DUSA 4CMHC 1H8OA 4KROB 3TT3L 5C0EA 3GSNL 3WO4B 3FO1A 1KLUA 2NW2A 1T21A 4MXWH 1ZV5A 1M7IB 4OLZL 2YA2A 1AO7E 2D7MA 4EXKA 5JHDB 4MAYB 3IGAB 3JV0A 4RMTA 4ZS7L 5HHOA 5EUOB 2WBJC 3UTSE 3D2UA 1U2HA 1WZKA 4HUUA 4Z7WA 5IM7A 1N26A 5DHVA 2OP4H 1YEEH 1WBYA 2FBOJ 4XNMA 3K46A 2X1OA 3EO9L 4TQEH 1OY3B 4WW2A 4FTVE 4KJQD 3EYQD 1F11B 1ZEAL 2IPTH 2IBBA 2AERT 4YHIA 4IDJH 5HSFA 4NC1E 4PG2C 4PYHA 3EYOB 1B4JH 1NJ9B 4BFEA 3DVNA 1DN0A 3R1GH 4YXHL 5DA4A 3HZMA 4I0PA 4EI5A 1MHHB 3PXHA 3T0WA 2PTVA 4MZ3A 3TYFB 4YWGH 1YEHH 4LPUA 4F33A 1CBVH 2ITCB 2IANE 1MFCL 4XBPA 2AXFB 3OQ3B 1BOGB 1Q0XH 3SDXB 4OZ4A 1OSZB 3AREA 1LO0H 4JFYB 1B3JA 1F42A 4WUUA 4N9GB 4RIRA 4IRJC 4MA3A 4JRWA 3DSNA 4HWBL 4DGVH 2DQJH 1YEIL 4PJ8B 4F9PA 1X6LA 4I0PD 4EI5D 2VZSA 4XPFH 4JQVA 3GM8A 4KK9C 4PBXA 3RL2A 5HVWA 1BJ1J 3NFNA 1GZPA 1WC7B 4GG6F 5CBAB 1AO7D 3K4AA 1TZIA 1VCAA 3LN5A 1C16B 3T65A 2A9NH 4YNYA 5BS0B 3VGHA 3RWGA 3HAEA 1IEBA 1YNKH 4YHPB 4RGMB 7FABL 4OTXL 3AC0A 4K8RD 5ESVA 3QIBD 3X13B 1OW0C 4M93B 4GBXB 4F15B 1TQCB 3WFEL 1MQKH 4HW6A 1R24A 5FA4A 1MAJA 2ATKA 4Q0XL 1DVFB 4HGWA 1G9NH 4NRYA 3QO0B 4YBLB 5JQHC 2ZPKH 4R6UA 5JW4N 2X1PA 4K23H 4O5LL 4HGKC 1ES0A 1GC1H 3BEVB 4J8RA 1Q94A 3FAWA 3QDGE 1JUFA 4JCMA 3U82B 4APQC 3MRFB 5GGQL 5IEKA 4U2YA 1SYSA 4JM2D 4AIXA 5FEBA 1RIVL 1C5CH 4KV5E 3DRTB 1QRND 1IBGH 1RZIB 3GMMB 4BH8B 4X80L 1UJ3B 5A16A 1JWUA 3CMOL 5E5UB 4JEGB 2FBJH 5MENA 3HE6A 3NIGE 1LD9B 4X9FA 1QSEA 2ZKHH 4LSPL 1MQ8A 2EIDA 3EFDH 4S10A 2Q86B 3ZYOA 1K4DB 2NX5D 5INCA 4PR5A 3PNWA 3U36B 1HNFA 4NQTA 2QTEA 1S7TA 1YEIH 4JM2F 5I0ZA 1RVFH 2EKJA 5SWSE 2P48B 3TEUA 2RGSA 3A6BL 2F9BT 4ONFH 3PV6A 4V1DA 3MUJA 5GRZA 1SMAA 2EC9T 3CUPA 3ZKMD 2ID5A 5BZDA 3TT1H 2YA0A 3V7MA 1WITA 3C60D 3U9PH 1YN6B 3LKOB 1JK8B 3WDJA 4OZIE 2E6QA 5BXFA 4ZQKB 1J5OL 3HNTL 4LNRB 2DQCH 5GZOC 4RFOL 2ICWA 3IDNA 5ICZA 3D2UD 4WFEE 5T3ZD 1GGIH 3AU1A 3C5JA 4JN2A 1WZ1H 5I71B 3M07A 4YE4L 4NCDA 2VXSH 2MPAH 3EDDA 1NL0H 1TZIB 4GFTB 5BQ7B 4KK8D 3M1BA 3HR6A 3BSZL 5DFVD 1WC7A 2VLLA 4P9HL 4F58H 5I1AB 4ODWB 1HHIA 4OF7A 2HT3D 3LS5H 3I9GH 4LF3A 5EUOE 1K6QH 4EZMA 1Q9OB 4DGYH 4MA3B 3V4UH 1QPXA 4OB5L 4PRNA 4R26L 3GMRB 4MXWL 2H9GB 5JO5B 4RZCB 1JFQL 1FV1A 4TSBH 4TVSa 1A6UL 2EE2A 3PL6A 2BX5A 1K8DB 1JNLL 4P5TD 1Q9LB 5H35B 1M7XA 5F3BA 3OB8A 3EHBC 1T0MB 5KVGH 4ZUVB 5EOCL 5GSVB 5CIPH 5BO1L 1B90A 3O9WA 5JORB 2WUBL 4Y4FC 4NUGL 4P2OD 4Y4FB 3W5MA 1JNHA 1KT2A 3MLZL 2X4PA 1OQOA 3S36H 5DSCA 3TV3L 3QJHB 4YPGB 1TCRA 1IGFL 4ETYA 2PW2A 2QR0A 2AK4B 3IFNH 4HF5L 1KG0B 3RVXC 4HIHB 4DEPB 1DQDL 1PEWA 1KBGL 4NNXB 4S1DC 4MJ4A 5L2KB 4GKSB 3RZCA 4RNRB 1OTTC 1P4LB 2NY2B 4HIJB 4HUUB 3AY4A 4RWYH 3NTCH 1ZLVK 3NABH 5A43C 2F54A 4XPHL 2P1YA 3AM8C 5IW6A 5TDNA 4IOIB 2P5WA 1A7QH 2GUOA 4D8PB 5HDBF 5FHBH 4PGEB 2HKHL 4QHUA 3M8OL 4KTEH 5ICXB 4MNQE 3ARYA 3PQYA 1BQLH 1OAQH 1EBAA 3MLTA 5EULV 1QG3A 2B4CL 2AP2A 5I8EB 4WFGE 1T5WB 3GIZH 4XVJH 1F3JA 4JLRA 1KB9K 5MHSE 2DM7A 3KHQA 4W68A 4M5ZH 5D4QA 5CZXC 3BAEH 4KZEH 4R96A 3T65B 1HDMA 3KPQB 5IB1A 5MENE 3WXWL 1GOHA 5C0BA 1WIPA 3WNOA 4JG0H 5IR1B 4NZRL 1IKFH 5B4MD 4K94H 1TPXB 3DPBA 3ULVD 2APVA 4PJCF 2VDNL 5E5MB 5LQBH 4HZLA 2F8VA 2NLJA 3NCJL 3SEPA 3MRRB 1ZT7A 4PLOB 4BSVA 2CRMA 3FFCB 4I4WB 1DFBL 3OF6A 1KB5L 2VWEE 5JLZB 4OZGB 4QEGA 3OGOE 1PX3A 3VFVA 1YEKL 3B2VH 1KCKA 2P42B 3NCMA 1F5WA 2F5BL 5EBLA 5IB5A 1BGXL 1JGLH 3VFWA 1NGWA 3EBAA 2J6EL 4XP5H 2YSSA 1EO8L 2VJXA 4IMKA 5DJZA 3DVNB 1OSPH 3ULUL 2R2HA 5EBMA 4M61B 4PJAF 2EDRA 2R2HB 3T77A 3Q3GA 4WI6A 3O41A 4QXTA 2YA1A 3BPOC 1V05A 4CL7A 4G43A 4YHIB 4JPKL 1HI6A 2NZIA 3WEXA 4X7TA 4OZIB 5DDHB 3MACH 4FQCH 4TUOB 5HY9A 2DIJA 4Y1AB 2VXVL 3ARRA 5DUBA 3PWVA 3QXDA 4BM7A 3QFJA 1AO7A 4KY1H 1GOGA 2AJ3A 3M17B 3TO4C 2ZKHL 4BK5A 5HVHB 2OJEA 3ILPB 1QFHA 3LQAC 3IDMB 4LCIL 4PJHE 5IVXA 5T33H 4MD0A 2BJML 1NBZA 4M1CD 4Q74A 2YK1H 1A8JH 5F97E 2GITA 2YS4A 1FGVL 3BDYH 4N1EA 2ADJB 1UENA 3GIVA 4PJCE 3QQ4A 1GZQA 4JRXB 5FO8B 2I60H 4XPTH 5CBEB 1LE9A 4XNXH 4D9LH 4YXKH 4Q97A 4RAUB 1OWRM 1F4YH 3X17A 1YY8A 1YY9C 3C8KB 3UO1H 3SCMC 2C7UA 2P5WE 1MHPL 3ALWA 4M6MH 3R8BB 3L5JA 1C7TA 3SCMD 4ZAKB 5F6IB 1PLGL 5IMKA 5E8DL 3EDEA 3NZHL 5FO8A 2O5XH 1MQKL 2AJXL 1NAMH 2YPLE 4OSUH 1I4FA 4QHKJ 2VLJE 1O5DT 5C92A 4MDJA 5IVZB 4WWKC 2XV6B 1G7LA 3GDBA 1W8NA 5J3HD 2VITA 1CLZH 1HHKA 3FFDB 5ANME 1CG9B 1KJVB 4WHDA 3KPRD 5A2JH 2JB6B 3G08B 1EAPB 2D3VA 5C0BE 2NX5B 4P23A 4KKLD 3CCHB 5IJKA 3C08H 3TCLA 3CSYB 1FL6B 3TVMB 3VRLE 4UQ3B 1ZS8B 2DDQL 1K3ZA 4J1UB 2BDNL 4PGBA 3DO3A 4YPGA 5I18L 3BOVA 3GSXB 5C0FB 1ZE3C 4R9HA 4JHWL 2W59A 4N5UA 4G7YL 4U1JA 1NGYB 4M61A 2ZOKB 2B1AH 3CFJA 1BVKB 3DX7B 2V2WA 2F5AH 1PX4A 5E1HB 4JDZA 3H3PH 5E9DD 2EKSB 2V7NB 5FAAA 5LGHH 4MJ6A 2BC4B 2YUXA 3SE8L 3WKMH 1CGTA 1YMME 3QDGA 1D5ZA 3CDCA 4P2RD 1JFQH 1FV1B 2Z4QB 4NKOA 3SQOL 1I1YA 3OKOB 3KGRA 4JKPL 4U0QB 4YIQB 1TJIL 4BKLA 1EFXB 3RGHA 3X11B 5DJXA 4Z9KB 3VFUA 3MV7D 4GS7B 2Y36H 5C09A 4F9PC 5CMAB 4ZSOA 4NNYB 5E70A 3HMWH 1NL0L 5C0DA 1KJMB 1J0JA 3BEWA 3ZHKA 3TT3H 2WIIB 4R96B 3PIQA 1XGUA 5C0AA 3MNVB 4XP4L 4JZOA 4KMLB 3WE6B 1MI5A 3GJFH 3AREC 5HD8C 2WWMD 4F7EA 3E0GA 5D7LD 2VRAA 2ICWB 3FT2B 5J6HA 1LP9E 5CGYD 2VYRE 3PQYB 2VDOH 3MV7A 3U7WL 1HZHH 1U3HC 4XP9H 1P7QB 3G6AB 3DXAA 2F58L 5IB3A 3G9AB 4EQ3A 4OLEA 2JJSC 4MNGA 5D7KE 5EO0B 4GOSA 1CF8H 2ZP0T 3ARFC 4PJIA 3QRFM 1XZ0A 3E3QE 5L8JB 4KRPD 2AK1L 2FL5A 4S11A 1YECL 4Y5YA 5E56A 3VMOA 3MRCB 1CFQB 2D03H 3AXLA 3ZKMC 4JFEA 4QTHA 2XKNB 4JHAH 4CRPA 4KHXH 2MQ3A 1GGTA 1T1WA 1MFBL 5DR5L 2DI8A 1G84A 2BNUB 1R3JA 5MEND 2DYPA 1BM3L 2Q86A 1MRDL 5J89A 2I24N 3FRUA 3QEQA 2VZ1A 4NNXA 5HDQH 3REWA 1YEFL 5FGBC 5HXMA 4CJ0A 1A6TB 2ICWI 3IFNL 4HF5H 1A6VL 1CE1L 4W6YB 4HX1B 5CILL 3LKSA 1G7QB 3P9MB 4U1HA 5HTSA 5IBTL 1G6RA 1WAAE 1JNHB 4GAYB 4X6CB 4J6RL 1KIRA 1U93B 1BWMA 1L7IL 4Y16B 5GSVA 4LCWE 5EC2A 4HKJA 5LBSH 5I1HH 4HG4K 1QBLL 2B2XL 4WCYH 3KYNB 2GT9A 2J4WL 4ZTPH 3G9VA 2V17H 4HGWB 4M6ML 2YN5A 1I7UA 3BX7C 4PJ5D 3WXVH 4X5WB 4HUXA 5GGUA 1ZA6A 1OGTA 2E9IA 3QIUA 4WI5A 3TBSB 3PWPE 3QCVH 2HKFL 3WJLA 4YHLH 3RWGB 1LGVA 1EVUA 1DZBA 3EW3B 3HFML 1OHQA 2Y25A 5DI8B 1A6AB 4JO2H 5CSBA 2XNAA 4POZD 4WDIB 3RVTD 2GJ6B 1VFAB 4P5TC 3FRUB 3FONA 4NN7B 5AZ2L 2GSGA 2HJFB 1KG0A 5TFSL 2XRAH 3MV8A 5I1JL 2PXYD 4KHXL 1II4E 4NRZA 4HG4J 3JVGA 5E2VL 5F7DB 1TCRB 2D7TH 3QG7L 4HSQA 5E2WH 3MRLB 4X7EC 5IBUG 1BHGA 2HT4D 4PB9L 3O3AA 4LPWA 1QFWH 5EORH 3VFOA 1ZANL 3FMGH 2XPGA 4D9RE 2YXMA 2HAZA 2EH7H 1Z5LA 3OX8B 4KI5D 1CBVL 2ITCA 2CLVA 2P24A 3RUGB 1EHLL 4H20L 5EIIB 5TF0A 1DUZA 1HILA 3SGEH 1CDIA 2DTSA 3T2OA 4NQDA 5E24E 4JFPA 4ZXBD 1AQDB 4PRBA 3QFJD 3OXSA 1ZLUK 3KLDA 4RMSA 4CUCA 3PV6B 3KYAA 2VH5L 1MELA 2F15A 2EDOA 2E27H 3MNVA 4QT5A 3VGEA 4M7LL 4N68A 2OSLB 5C09D 5F7DA 5KAQF 4K7PL 2W9EL 1IFHH 3WNKA 2YC1B 3NTCL 1RJLB 2H3NB 4PJ5E 3UBXB 2FIKB 3LPWA 1RU9H 1I1AA 2NY3D 5BQ7A 3MRBB 3MSPA 3O3DB 1A6AA 4JO2L 1UT9A 1S3KH 3IFPB 4MVBC 5GGRA 4Y2DD 4LAQH 3QHTC 1MCSA 3SQOH 4PRAA 3EYVB 3IDNB 5GS1C 5ICZB 1LO4L 3KXFA 4U7SA 3SHSA 5CJOL 3CVIL 2MCPL 2VXTL 1I7UB 5CAYB 3B9VA 4PS4L 2GTWA 1BF8A 4M5ZL 2W0LA 2VTFA 3Q1SL 5D96C 1IQDB 5CSZA 4PJ7A 3UEZA 4HC1H 4KTEL 3DX7A 4NQCB 4WO4B 1ND0A 1VERA 2FJGB 4M48H 4HKBB 4UIMB 3FO9B 3MJ8A 3GSVA 2E8YA 2NPLX 1BQSA 1DQQB 3VGAB 3VI4F 4UOW1 5FYLL 2P8MA 4P23D 4J1UA 1MJ7L 2AGJH 1JPFA 5IMOB 4MCYA 4OKVA 3MO1B 2R1WB 4Y5VA 3BQUC 4TOYH 3C08L 5D7KD 3FQTA 1WT5A 4R7DB 1DVFD 2D31A 5T3ZE 4YDVA 4KAQL 4RGNC 3PWLA 2Z91B 3LZFH 4JVUA 1YC8A 4I1NB 1XF3B 2R29L 2O5YL 1CT8B 4LASL 1T7ZA 3BUTA 4CU8A 3MBXH 1XZ0B 3KJ6H 2CLZB 1MLCA 2CXGA 1IC5H 5ENWA 5A2IH 5IOPB 1KCRL 3OG6B 5L0QC 2DL9A 4ZFFB 4S0SD 2OCFD 5FM5M 3S4SG 4WIQA 1JHLL 2ENSA 5I8KH 4XP9L 5IMKB 3LPFA 4NKQB 4I0PB 4EI5B 4KRPB 4U1LB 2NY5L 3GKWL 4L4TB 4TTGA 2V2XB 1HSBA 4OZHE 3W0WD 3IFOB 4YXLL 1D6VH 3RRQA 3DX9B 4KPHL 3QI9B 4QHMB 2XQBH 2CUIA 4RAUA 4D9LL 4LCWD 1OLZA 5DRXA 3FQRB 1RPQA 5D72L 4O2FA 1U0QA 3LMJH 3QO1B 1MEXL 3B4NA 5HYEA 2OMBA 3LS5L 2DLEA 2Y36L 4FG6D 2NW3B 1IVLA 5TDOB 2APXA 2AJZB 4ETQB 4FQIL 4PGCA 3HLAA 4X7SL 2VMFA 4V1DE 1A02N 4ERSL 1ZKAA 4R0LC 3SY0B 1GCFA 1AXIB 2VDRH 4HIEA 1HINL 1I7TB 2NY1B 1BZ9A 3WIFA 3WO3B 2PYEA 4KVNH 3KPSD 3QIWB 2VO5A 3MBEB 1UCTA 3QFJB 5AWNH 4J23A 4PJ9A 4Z7UB 4MMXC 3BT2H 5GS0H 3KPOA 3ARSA 3V0WL 2E8ZA 5ABDE 5I1KH 2AXFA 2X4TB 2C4FU 1FZOA 2DM2A 5DJAB 1G6VK 5E94B 4KKBC 5H8DA 3O6KL 5DDHA 4K3EH 2A83B 3OKNB 4PREA 1N5YL 4O5LH 5DRXB 2B1HH 1AD0B 3QRGL 4LCCA 2UY7A 3B9KC 1TJGL 3CPLA 3WNMA 5ESAA 1JWSB 1QFUH 2E7CA 5E8EA 5SWSD 4BFBD 4GRWH 1FO0A 1JTPA 3O41B 4QXTB 2AXHA 3BD3A 2XZQH 3HZVB 2AK4E 4YXLH 3DI2B 2ITDB 4L4TA 5DURD 4JO1H 4JG1H 3ARGD 3UJIH 3HZKA 2R8SL 1KPVA 4U6HB 1F45A 4HFUL 4GW4A 3GJFB 1FPTL 1MCLA 5DRZB 1R5IB 3ARFB 4EDXB 2YD3A 1E4XI 5T1DH 2LABA 3K80A 4X7CC 5JLZA 1SJVA 2VDMH 4AM0A 3MJ6A 4IRJB 1EAPA 4RSVA 3MLWH 1BZ7A 2X9WA 5SWZA 2XG5A 3D85B 1YEFH 1EV2E 3QUXA 4P2QD 1UWXH 3WV0A 2IADA 4F3FA 1CLZL 1DBMH 1AC0A 3BH8B 1AFVL 1IQWH 4X98B 2D0HA 1DLFL 3OZ9H 2X9YA 1T0NB 2AV7A 2WWKT 15C8L 2RCSH 1OF2A 1MWAB 2P8MB 4LEOB 3QCVL 4O51B 4C83A 1KTDA 4U6HA 1MI5E 4YHML 1A7RL 2P5EE 4GKZB 1S9WB 3ZHLA 2C7UB 3VXUA 4E42A 4YHKL 3Q5TA 4KC3B 1YY8B 1FO0B 4PUBH 4OD2A 2NTFA 4J6RH 3NACH 4X6DA 3NBNA 1PQZA 1YN7B 3VG0H 1SEBA 2DLGA 1N5YH 4UIKH 3THMH 1JRHI 4JY6A 1YNLH 4D8PA 4FOMA 5TE4H 1J0KA 1LDSA 3FQUA 3MBEA 4MQXD 4HBQA 4NGHH 3V6OA 4H0GA 5C86A 4ZFZB 4PRHD 4DGYL 3SO3B 5BVPL 1C08B 5F7HA 1JN6A 4QRRD 2OZ4L 4GMSL 3T2NL 3EJZD 3PWVB 3QXDB 5EU4A 1EUTA 5ISZB 4TVPH 1PAMA 3JTSA 4DK6A 4Z7NF 1EZVX 1FG2A 3G6JA 3LEYH 4LVHC 3P3YA 5IJVB 1T1YA 3JXAA 3MXWH 3VFPB 2P49B 1HQRB 1BZQK 4YJZL 2H2PD 4AEFA 4MS8C 2GTZB 3U0PB 3H3PL 3JWDL 3X3GL 3HNTH 4R4BA 2EYSB 4LU5L 3SBWA 5KSAC 1TMCB 1WFTA 3U2SA 4DZ8B 1NGWB 1DUZB 1H3XA 1HILB 1GAFL 1A6PA 4AJ0A 4H26A 1P7HL 5GRUL 3VG9B 2ESVE 3MXWL 5HHOE 3TNNB 2CLZA 3ARWA 3S9DB 2EYRB 2QBWA 2JB5H 3MR9A 5H94A 3SKMA 3GUTA 4PRNB 1IARB 3L95A 5ERWB 2K1MA 1C12B 3BKYL 5DJYB 3OB0K 2AI0H 4WV1A 1INDL 2D31B 2IALB 3RKDD 2DYPD 5I8CB 3L5XL 3L3GA 3TNMB 3TO2A 3ULSA 4DK3A 2VL5A 4F2MB 1TZGH 1DANU 4R3SA 4M6OL 3UTSB 2JJSA 5I66A 4PTUB 3SDAC 4RX4A 3VE0B 4JGMA 1FGNL 5GJSL 2J5LB 4ZQKA 1J1PH 3GBLA 3SDAD 3BKMH 1YYLL 5IFHL 1CDYA 1KB9J 2NQCA 2DQIH 3WLWC 2YKLL 2BHYA 1U58A 1YC7A 2EDQA 5LG1A 2XKUA 1U91B 3KJ6L 4ELKB 3UTQA 2VL4A 3EGSB 3QIUD 1G6RB 35C8L 5F88B 1CXKA 3O2DL 3IFPA 1XF2A 5C71A 2X4RA 4NSKA 3VFTA 4ZYKA 3U36A 1ZLSL 3GGWB 1JNNL 4KV5F 3ZYIA 1QA9A 1K4DA 4XNZB 1FAIH 3L3GB 5I75C 2JCCB 2PW1A 5B3JF 2FATL 2OL3H 2IALA 3S4SB 2YC1A 1MIEH 4U33A 4JY4A 4KJPC 2BVQA 4LHUA 2Z8WC 3MA9H 1CS6A 2VDPH 2A6JB 4JM4L 1MREL 1YQVH 4BQBA 4M6NL 5KVMC 1RUAL 5HBBA 1Y0LB 3P4OA 2DQUH 2G60L 3TNNA 4IRZL 4OLXH 3NZHH 4ISVA 3KYOA 4LBEA 3OPZL 4I77L 5BV7C 1CLOL 4JZJC 3BWAA 5DF0A 4H26B 4JO1L 4X8JA 5J1AB 4DKDC 3P0GB 4P3DB 2ATKB 1GGCL 3EAKA 4R4BB 4BZ2L 1L0YA 4JAMB 1KXVC 1TVBA 1YEKH 3B2VL 3P4NB 3X13A 5JPNA 1B4JL 4LSQH 5FYKD 1LO2H 1YNKL 4X4XA 5CLWA 1T22B 3GSOA 3RKPA 5BV7L 2CXKA 2XN9A 5FCUL 1A22B 1C16A 1ERNA 2EICA 4PLNC 1NC4A 4UUJA 2PYED 5IJKC 1W0VB 2IQ9H 4ERSH 1RZGA 5I0DA 3TO2B 3TNMA 3VH8B 4DJMA 1F00I 4UT7H 2IAMA 1OT2A 4K94L 3DROB 1JF1A 3E6FA 4O4YH 3D48R 4YQXL 4HWBH 1MVUB 2VDNH 2YBRA 4DGVL 1T22A 3GSOB 4D9QD 1B9ZA 1WBZB 4MX7A 5TGBA 5ANMA 5A2LH 2EEDA 3K8KA 4PGDA 3N06B 3DXAE 4M1GH 5TQ2H 5T5FH 4F7MA 3BP4B 3VXMB 1MFEH 3ELAT 4OV5B 5DWUH 4KQ4L 3IB4A 3NFSL 5E95B 2DM4A 1PY4A 2HVKA 3CX2A 1AE6L 4M62H 1LEKA 2IGFH 4LBEB 3STZA 4WTZA 5DEFB 3BRDA 1Y0LA 5MEQB 1VFOA 3ROLA 4NQSB 2BZDA 2DF3A 3MLVL 1UWGL 5FUCE 5FYKH 3BIAX 4JM4H 3P30L 1A1NB 4X99A 4PRPE 2HRPL 4BSJA 4J3SA 4H0HB 2PR4L 1OGAE 2J8HA 4ONHB 5I1EL 5TFSH 5I1JH 5DC0A 4LLMA 1JV5A 4Q9BA 1D6EA 1AJ7L 1EVTC 4J12A 1A47A 3WHXB 5TH2B 3RNKB 1FZMB 5HI4D 3BO8B 5EG6C 1CG9A 1KJVA 1NMAH 1BP3B 4NM8L 1JN6B 5IVOA 3GMMA 5FCUH 1PZUB 3ARQA 5HI4C 3MGTA 1CIUA 2C1PA 2UWEA 3BKCL 4IMLA 2VQTA 1OP3H 3F5WB 2XWBA 3FO1B 3ROOA 4RISH 2IG2L 5BMFH 2UUDK 3VGBA 3QG6B 3K0WA 4I9WE 3KPTA 3CMGA 2OTWA 3L3IB 3PWPB 1REIA 4ZFGL 5BV7B 3BKML 1V8HA 5EUKA 1U8PA 3QCUL 3CGTA 2I07A 2NY5H 3GKWH 3BXNA 2HFGH 3PUCA 5EBWA 3GI9H 4WFHE 5KSUB 3SE3A 1JYVA 5DURB 3UROR 5A3ID 1I7ZB 3WL9A 4H1LH 1E28B 5F1NA 4U31A 4L8CA 1BX2B 4LIQE 5BMFL 4D94A 4NQEA 3I84A 1FSKC 1JMZA 1EEYB 1AKJB 1KPRA 3HE7A 4GRLA 1BLNA 1DE4B 3I9GL 2COQA 4PJEA 3V7AE 1T1ZB 5IVXB 1HCVA 3QUKA 1JNNH 1QYGL 4M8QB 4JFOA 1RK0B 4HIEB 5DJYA 4XMLH 3FKUS 1G7MB 3D85D 2Q7YA 1KCSL 4JO3H 3VFSA 3ZKND 1KN2L 2EYRA 4NCC2 3VXQA 5D2NC 4OZ4B 3DMMB 3NCEB 4XHJC 3ZKNC 2BC4A 2JJWA 1WWCA 3VW3H 3KLSA 2OR7A 1KTLB 4LKCB 1KENL 1N7MH 3UTTD 3LEVH 4HIIA 5SWSA 4OD1H 2J5LC 3ORJA 2EYSA 1IGJA 4KJYA 4RMVA 5CZKA 4B5EA 2H1PH 4YH6A 2DL2A 3EYOA 3TLRA 3HZYA 2V2XA 5GS2D 1TVHB 1VHPA 2A2QT 1RK1A 3RAJL 3HI1B 4U6YA 1JWMA 3O11A 2R1XB 3D18B 4K94C 1I8LC 3MLYL 4L4VD 3MUZ1 4RAVB 4Z7WE 5GIRA 4MXVE 2FECI 1CK0H 1RULH 1VKXA 5J3HC 4NQDD 4OB5H 1WBYB 3NCFB 4R26H 3H2WA 1IC4H 1G7IB 1HEZA 2DIBA 1I7TA 3ARDD 2VDRL 4HS6A 3IYLW 2IQ9L 2H45A 3SY0A 5T3XL 2R15A 1O7SA 5EU3B 1OTTD 1NBVH 1I1AC 2OL3A 2VISB 4UB0H 3N0PB 5ETUA 1H3PH 3UX9B 4YR6B 4JJ5B 1I1AD 3VH8G 4LSRL 4FQ1L 5GGQH 3RGVA 3EO0B 3TH4T 5A40E 2IWGA 3IJSB 4XNQB 2E9BA 5C0RH 4Z5RB 1OARL 5B8CA 4L3ED 1I85C 3WL9B 1FRGL 4JANB 4LLAA 2VN4A 2UY6A 1U8MA 2A9MH 5EBWB 1U8JA 3C8KA 4LVOB 3W0WB 2HN7B 5CEYA 4XP1L 4WHTA 2PYFB 5I9QB 4EUPH 4WU5B 3G5ZA 1IQDA 3ARTA 3GSNB 3TT1L 3ZDXE 4PG2A 2UVEA 3T1WA 2ADJA 3CVHB 3S96A 1S5IL 5F3HB 4M6NH 2GJZB 4MSWB 4GBXD 2H26A 4KKCC 5ETUB 4Y19D 1NBZB 1N6QH 2X4NA 3T3MF 1B2WH 4HKZA 1S9YA 2A6KB 2R29H 1RJZB 4E41B 1M7DB 4OBRA 4XVSH 4TNVF 3ILPA 1QHOA 3HNVH 4QRRA 4NO0D 1A7OL 1UA6H 5C6PB 4U05A 4X6EB 43CAA 4Y4HA 3L5WA 1MFBH 2EH8L 1KBGH 1W0WA 2HT2D 4OZHB 1N8ZB 3HFMH 1GC1C 1RJLA 4OFYD 1LO0L 3MACL 1FFPB 5HD8D 5IMLA 1Q0YL 1SM3L 1RK1B 2AJSH 3QNXB 4G43B 4GAJH 1S8DB 4PRIA 5IKCA 2JF1A 3P73B 1TVHA 2ITDA 1GHFL 4PY8J 3MRQB 4R4NC 2I27N 3TYGL 3IS0X 3QIBB 4EBQH 1CQKA 1TNNA 3LCYA 2F8XC 2A74A 3OGCB 4O58L 5FYLE 1PZ5B 5CP7B 3U9UA 4GRLD 1B6DA 1A4KA 1FVEB 2D0GA 5FB8B 4LSRH 4NUJB 4HK3J 1XGRA 5CHNA 1HN1A 5FO7A 3U6RB 2CIKA 3C6LC 4A6YH 1NCBH 4AIZA 4BSVB 4TSAL 3HC3L 3MRGB 1A7PH 3WS6C 4JKKA 1LP9A 1RZFH 1G7MA 3MRDB 3MROA 3O4OC 4LDOB 3BKYH 3B3IB 2D7NA 5HJ3A 2DQJL 3GFUA 3V5DB 5TDOA 2NW3A 5CJ5A 4QHLB 1CFBA 1T2QL 4NKMB 1ZLUH 3MBEC 1MFDH 3GMLB 5IB1B 5DK3A 3QDMA 3GZKA 1XF4A 2RFXB 4Y5YC 3VXPB 4OD3H 1WZ1L 3QULA 4NHUB 5L7XL 1OM3H 1D5MA 2G2RA 3SGDH 1NC2B 5AYQA 5C0CB 2YXFA 3WFDH 3O4LB 4WI3A 5HGAA 3CVHL 1A5FH 4HH9A 3MLTB 4OD1L 4NKIH 1SEQH 1TIUA 3MRKA 1FIEA 5FHAH 2IQAA 1TLKA 4QYOB 3MRMA 3IRZA 2F5BH 1U6AH 2C1OA 5KOMC 2DJ4A 2Z8SA 1MCPH 3PHQB 5ILTL 3EKCA 5F8RC 4UV4H 1F58H 1QBAA 4IDJL 5L7XH 4ZFOB 4XH2A 1P53A 3BKJH 2K3TA 3J8F7 1HINH 4TSCH 3HCVA 3CH1A 1LEGA 1QRNB 4MQTB 4Z18A 4HCRH 1AHWB 1N3NA 2H8PA 4PJXE 4NHCH 4X7SH 2J88H 3PNWB 2EXYD 4P59L 1MHEA 1S9KC 1CXFA 3CDYA 3RWDB 2OBGA 4MAUL 3QEQB 1YJDC 3RWDA 2FBJL 3I6GB 5FFLA 1ZLVH 1AGDB 2XNAB 3ISWA 1A7PL 3EYSH 3T8XA 2GK0A 8CGTA 3T0EA 4HGMA 3CH1B 3DRTA 4QHKI 4UTAH 2FL5B 4Y5YB 4FQQB 1S7QB 3O45A 2QQNL 1A14H 3FB5A 1F2QA 1LO5B 4Z8FL 1A7BA 1OTSD 4ZNEA 5B39A 4I0PC 4EI5C 2CKBA 4ODBD 3G6AA 1OAXL 2GTWB 5TF1H 2IPKB 4YK4C 4XNXL 2FCBA 1TDQA 3B9KA 4JY5H 3LKRB 1T89A 5DRNB 3STBA 5JO5A 4AQ1B 5JNYA 4UT6L 4GAYA 4X6CA 1XGTB 4U1NB 3IKCB 1I8IB 5E9DE 3WIIH 3MRIA 4PJBF 1RZKL 3NABL 3FO2B 4DTGH 3V5KB 3BIKA 3VCLB 1FE8L 3D5OF 4JFFD 4LF3B 2WINA 3C87A 3ESUF 2A73B 5I2IA 2Y06H 5HHXL 4QRTB 5E8PA 3N1PC 3S35H 4L8SB 3C2AH 3QEHA 2QEJA 1DBML 3NFNB 1E6JH 4XC3H 4ZD3L 3IFLL 5E0QA 1R3KA 2VXVH 3G04A 3BP6A 2W9EH 3S3JA 4MD4B 4HMEA 1FFRA 2CDEB 1OD7A 1CFQA 1XGQA 4YIQA 2DRUA 2RR3A 4PV9A 4BELD 1X5GA 4I2XA 4OZIF 1WTGT 3N85L 5JW3H 3AREB 4WUKL 1OAUH 1WV7T 1KIUA 3TBTB 2DLFL 1NPUA 1DL7L 2Q8BL 5CGYC 1ZHLA 3MV7B 2KKQA 4E0RA 3PP4H 3SDDB 5J56B 5FYJL 1PVHA 3NCYS 4D0BB 1JI2A 1NGYA 1S78D 1D5XA 2BNQA 3HC0A 4H25A 4K3JL 4Y88A 4XVUC 1D9KA 4PRIB 4WEBH 5DJ2A 3LS4H 5F7KC 2CO6B 3P0YL 1S78C 1TETH 4FXGB 1CDBA 3OJDA 4WJ5B 3L5HA 3S4SA 5C0DB 5A2FA 3E8UL 4GUPA 4BZ1L 2VXUH 4S2SA 4F9LC 1BEYL 2ZUSA 1HK6A 1RZIA 4BH8A 1AR1C 1X44A 5SX5K 3QUMH 5L8LB 1IZKA 5C0IA 5FKPA 3KHOA 3MMEB 3P0YH 1F3RB 4JKWA 1SYSB 2YRPA 3K8MA 4CN4A 4OGYL 2O93L 5CJXA 5GGUB 5I1IH 1U3JA 3INUH 2FEDD 4NZUL 3VJ6B 5LGHL 4WFFD 4KK8C 2OI9B 5DC4B 5DFVC 3KLAB 3MYJB 4KKLC 3X12B 2YEZB 4XAWL 4K7FA 5C0CE 2HN7A 1FDLL 4GBXA 3WFEH 5KS9A 3CFJB 1U8MB 3BPOB 4G7YH 1OAYH 5AYUH 2V2TB 2P8PA 5BZWA 4L29B 2YUWA 1KENH 1U9KA 3QUMA 2BY0A 5GS1A 1HKLH 4KKNA 4WWID 3GBNH 3RUGE 4K3HA 5KVEL 3EFDL 3QUXC 2O61B 1KN2H 5I8CA 3S35L 1BWWA 3ULVL 3RIAK 2W9LA 4LLQB 4GS7C 4IEFB 3CSBA 4U1SB 2FO4B 5K9KB 1CDJA 4XMLL 3CK0H 3TVMC 1DP0A 3MR9B 1A3RH 3DGCR 5JR1L 2BNQE 5SV3A 1FZJB 3QEQE 5JOPD 1WWAX 5EO0A 2J8UE 2R0ZL 1W2KT 3N1MC 1X5AA 1I8LA 4DUWA 1HE7A 3B9KD 3JV4B 5T1KD 3H7BA 3QWQB 4Y1AD 5D8JH 1CFNA 3WDIA 1KPVB 1J8HB 4DZ8A 3VRJB 4HH9B 2Y5TA 5HHPA 1S5HA 2EDXA 3QHFH 1JF5A 3FT2A 5KVGL 4WO4C 5JHDE 3S6CA 3SDDD 1G6RH 2A6DB 4UTAL 3TJEL 3VXPA 1FH5L 3B2UD 4U1KB 5IJVA 4Q6IA 5E94A 2IMMA 4OT1L 2JKXA 1ONQA 5DJ8B 3TIDB 3JVGC 1DBJL 4OCXH 5FK9A 4AMKH 3BRFA 2EDLA 4XX1E 3OBAA 3QAZC 4HS3A 5HYFA 5E9DB 3FN0L 4LLYA 2XA3A 1K6QL 5IB2B 2QSTA 4ODTH 4UBDD 1JP5A 1R0AL 3AS2A 2MPAL 3PDDA 3UC0L 4F37K 3T0XA 4PJAA 1DQMH 4B53A 2X09A 2DIAA 3UPAA 2UZIH 2P8LA 2NNAB 3HC4L 3TIDA 2A77H 5FGSA 2EEBA 1J05B 4FABH 4U1KA 4O2FB 4OZIA 3ESVF 2F53B 3K74B 5ADOL 3UMTA 4JFEE 3I6KB 1PD6A 2ZNXA 5CEXB 1FL5A 4OD2B 1G7JA 4WHCA 5DQDH 5FHAL 1JL8A 5AEAA 4Y16D 3R1GL 2F5AL 3QI9D 5SWZD 3ARXA 4X6BB 3IU3B 5EB9A 2XN9E 2VXQH 3QI9C 4U1LA 5EUKB 1J8HA 4DFIA 5T1MB 3A0OA 3QUYB 5ICXA 3RDTB 2YPLA 4QWWD 2BRRH 3MJ9L 1VFBA 4MQXC 4NJAH 1T04A 2X4SA 4PJXF 5C7XL 3IDGA 4JFQB 5TDNB 5E2WL 3EFFB 3QPXH 1ZHNB 3QUXB 4F3FB 3MGTB 5BS0E 4K2UH 2WNGA 5K9KA 4UT7L 5KVDL 3BGMB 4PJDF 3H9SA 4K71C 1IMHC 1S9VB 4RGND 2XTJC 1U36A 2VSDA 5HYJD 3S88H 3WHXA 2ADGB 4MDJB 2FO1A 1MJUL 1OQXA 3WNNA 5I1LB 1R5IA 3ARFA 3DMMC 4OFYA 2AK4A 3KPQA 4CVUA 3QUYA 4S1RH 2BFVH 3HZKB 3LDBB 4PRID 4I3SH 1L0XA 4BZ2H 1RUPH 5CEYB 3RY5A 3QEUB 4OCYL 4OCRH 1N64L 1FL3B 2UV3A 2HRLA 2ZPKL 5E03A 5B22A 3GSQA 1MCHA 1UZ8B 5T5NF 2X89A 3RTQC 5JHLH 2KQMA 5J1TC 1OLLA 4PGEA 1BBDL 4R2GC 3VXMA 5JXEA 4PJHF 4APQB 1I9EA 4FQXB 2P8LB 1RUML 3IU4L 4R2GD 2ZUUA 4OF6A 2NY4D 4OLUH 1CE1H 2FX7H 5EU3A 3SKJH 1NDMA 2F54B 3TPUA 3AS3A 5DJDB 3D0VB 3H0TA 3ZO0A 2BNRD 4JFDD 3BJ91 1WEJH 2GAZB 1EEQA 4G6KH 2VLJA 5TPWH 2HYMA 3CC5B 3EO1A 4HS3B 3BYYA 4QRQA 5DTFA 4RGOH 3MRJB 1MAKA 3G6DH 3GNMH 4MA8H 1RZGB 1X3DA 2Y06L 4KI5E 3VXSE 3VFGH 3OJDB 2PW2B 1R3IL 2QR0B 2VOTA 5LCVL 4GG6E 1ORQA 5A3IC 1BAFL 1INQB 3S36L 3O6FA 3C5JB 1GGBH 3JUYA 5DLML 4D9QE 5KG9A 1UVQB 3T77B 4PP1C 4HUKB 3RWFB 2P4AB 2PUQT 4P9MH 1XF5B 1RUPL 3EJJX 5EBLB 5ISZD 5DVMA 3S5LB 3IJHB 4Z78A 5GJSH 3QA3B 5DGQA 4X0KA 5T3ZL 2Q3AA 4BA8A 4ZUSA 1VACB 5HYQB 1N6VA 3AB0B 2CQVA 2BFVL 2BVPA 3CU7A 3GMRA 3KYKH 4M6OH 5D1XC 5I19H 4RA3A 2KH2B 2V5TA 1X6NA 1XR9B 3EYSL 2BVQB 4M8QA 5FUZL 3DBXB 4ZO8A 2YHGA 2VLRE 4P9HH 1QSVA 3BUYA 5IW1A 1YEJL 3LQZA 2OTPA 4ENEC 1MRCL 4GRWF 1CGXA 2GI7A 4WWKA 3WJLC 3S34L 4QXUL 4KK5C 3ARDA 2WQ8A 2BSED 1E28A 5F1NB 3SQBA 5D1QB 4RMUA 5JW5A 3FOMA 2GK2A 2F74A 3DVGB 3T09A 1MFCH 4H88L 4ONGH 4Y4KB 5FV2A 3FQWB 1J1XH 1XIWC 2KL6A 3BEVA 5BXFB 4KXZI 3OAUL