4LSTH

Crystal structure of broadly and potently neutralizing antibody vrc01 in complex with hiv-1 clade c strain zm176.66 gp120
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
224
structure length
222
Chain Sequence
QVQLVQSGGQMKKPGESMRISCRASGYEFIDCTLNWIRLAPGKRPEWMGWLKPRGGAVNYARPLQGRVTMTRDVYSDTAFLELRSLTVDDTAVYFCTRGKNCDYNWDFEHWGRGTPVIVSSPSTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multidonor Analysis Reveals Structural Elements, Genetic Determinants, and Maturation Pathway for HIV-1 Neutralization by VRC01-Class Antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords ENVELOPE GLYCOPROTEIN GP120 of HIV-1 clade C
total genus 36
structure length 222
sequence length 224
ec nomenclature
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lstH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lstH01
4X5XA 2EKJA 1I3UA 4ONFL 3KXFA 4TNWK 3TIEA 4OCRL 1FRGH 2QADB 4HD9A 4ZUUA 4BKLA 4YGVB 4QHNA 5KVEH 1CFSB 2VLJE 3FQUB 1NJ9A 1RJLB 4O2EA 5JQ6H 1H15B 5MERA 3HKFA 1EFXB 5GZNC 1GPOH 1HHHB 4ZQKB 1KG0B 3MGOB 1A9BB 1IT9L 2J8UB 1OL0A 1EJOH 1I4FA 2DL2A 1UVQB 2B1HL 1I1YB 1WIPA 2PKDA 5I15L 3ULUL 5FUCE 5I76B 4FXGA 3HA0A 3JUYA 1JGUH 4QLRA 2NY1B 4XAKE 3X13A 4N0CC 3MGTB 5E94A 4Z7QE 2V5RA 1AXSA 1PAMA 5I1KL 1UWEL 1GZPB 4NQDE 1LE5B 5E1AB 1CFBA 2A6IB 3UTTA 3MRJB 1AGFB 2VDLL 4PGEB 1BP3B 3KGRA 1BWMA 5CGYD 4N90D 3VFNA 3GJFH 3QNZA 3BD4A 5C0GB 2YRPA 3KLDA 4X5LA 2B0SL 5HDBF 1ZLUH 5HHOD 5HDQH 3PGFH 5MENB 1A5FH 1HHJB 1KJ3L 4DK6A 3DX6A 4YDKH 5BXFB 1F4YL 2D2OA 4PGCB 1LEGA 4YE4H 1IFHH 4ZO6A 5AAWA 1IGJA 3GSOA 4C83B 2NY4C 2YC1A 1BLNB 4KRMB 1L0XA 3CJJA 1B9ZA 3BEWB 2Y7QB 4PRPB 1MRFH 4Y2DA 1QRNA 3F7VB 1S9VB 4I3GA 4HULB 4JRWA 4PB0L 3DX6B 3QG7H 4M43L 4XP6H 3MV8E 4PJFF 3RVXC 3RFZC 4V1DB 3TZVB 3IFNL 5D7LB 4OF6A 4K3GA 2P5WB 4DFHA 3FAXA 3O11B 4JHAL 5DD0H 3BZ4B 4XBGB 5KS9B 1B4JH 3OSKA 3ROLB 1X4XA 3OKNA 4Q6IA 2EE6A 5DD0L 1EDQA 2NYYC 2BNQB 1T1WB 3SDAB 3JVGC 3D0VA 2AXJA 1XF2B 1ZHLA 2Z31B 3LKNA 2HTLD 1MCEA 4OV6F 4EI5B 4KK6C 2WQRA 3G9VA 2XWJA 2XKNB 1YY9D 1BVLB 4KK8C 5DA0B 1PKOA 1U8NA 5I1LB 4QHUB 4UB0H 1KELH 3OTTA 1CWVA 3QDAA 2KPNA 3E3QE 3NCMA 4MXWL 4MCZB 3SE8H 5KJRL 3CU1A 3VWJD 1G1CA 4H5SA 5GZOC 2E7CA 4GAYA 2HG5A 2FWOB 1IKFH 4YDJB 4OLZL 5F7HA 5E8PA 1XGRA 1KSRA 2DKSA 3UTPD 1OCWL 3B9VA 1WEJH 4KTDL 1KPUA 1GGIH 5EIIA 3U0TA 3T3ME 1HQRA 4MCZA 1K8DB 1RK1B 4YHIB 1OCWH 2CIIB 4RFNC 3OX8B 5CZKA 4PYGA 4ZSOE 3H9HB 3HMXL 5I71C 3UX9B 2R23B 3GSWB 4ETQB 2F53D 2VZUA 3HMXH 1ZHKB 3MNWA 4MXVF 5D8JL 3O2VH 1C08B 1U8MB 1DZBA 3BZDA 1F8TL 4H0GA 4RNRB 1U8LA 3H9SB 1R5VB 2Q76B 2CLZA 4X9HA 4AM0B 4BUHA 2QSVA 1EH9A 1VACB 5KSVA 2XTJC 4C56B 1T1YB 4XC1H 3BGMB 5D93B 1H3WM 2OJEA 4HPOL 3QXTA 4ZFFA 1C08A 4PTUB 3ARFA 2X4NB 4N5EC 2C4FU 4JR9H 3F6LA 4M5YL 3HB3D 4HPOH 5FGCE 5C8JA 3SGJA 4HCRL 1XF5A 2BX5A 3STLA 5KTEL 1U36A 3JV4B 1G9ML 1JZ3A 1NKRA 1MCRA 1MRCL 3RVTD 3MTRA 3GJEB 4OM0L 4UIMB 1I1RA 2X70A 4ERSH 3PP4L 4HH9B 4N8VB 1FN4B 1IC1A 1MRCH 2FCBA 3C5ZB 4R7DB 5ISZA 4GKNA 1T5XA 4NSKB 5FUZL 4F9LC 2D03L 4HK0A 3UYOD 4H8WL 4YXKL 1V7ML 4R8WH 1XMWA 5HI5C 1F90H 5D7JC 2GW5A 1CU4L 3DUSA 4G42A 2YMXH 3RUGE 3KR3H 4MJ6B 4N8CL 2DM7A 3TH4T 3QT2A 3L3JA 3UTZB 1HE7A 3CZFB 2DTSA 1RMFL 2APXA 4X4YB 7FABL 1U3HB 3OKNB 3LD8C 3VFMB 4DZBB 2GIYA 1NFIB 3S35L 3V0WH 3UCRA 1FSKC 1I1AB 1ZTXH 1C5CL 5DJ8B 4Z77B 3V95A 1SVCP 4BSWB 1I1YA 1KXQE 4K3EH 4FNLH 4JRYA 2R1YA 4Z7VB 4Z8FH 1KNOB 1FNAA 3MLTB 5C3TA 1D5IL 3QH3B 5DVLA 4NCC2 3MZGB 4Z77A 1A4JB 1X5GA 2PTVA 4PJ5B 1VKXB 4IRZL 3EYVB 1I1AA 1LDPL 5MEND 3U0WL 2A9NH 5C07D 4FTVD 5JIHA 5DQDL 3VFOA 5E5MB 1UC6A 4ISVB 3TBYA 3VGFA 4MNGE 1GCFA 2DI8A 3T8XB 2IAMB 3F5WB 2NZ9C 3ES6B 3F7PC 4PLNC 1MJUL 3WDJA 4JFXB 5E9DE 3DXAE 4OD2A 5ELIA 3N9GH 2Y5TB 3EDDA 5ETUA 4U0RC 4Y4FB 1LQSR 1D9KB 3ORJA 4PJ8D 5CEYA 5FV1L 5JORB 3G6AB 3N9GL 2OK0L 4PJ9C 5JOPE 5CJXA 4KZDL 3PWPD 5LG1A 4CDGC 4W4NA 1T0PB 4Z7NF 5I8EA 3PABB 2UZIH 2ITCA 1I85C 4EUPB 4F9PC 2OQJA 4NC1E 4XXCA 3GK8H 2CJUL 1LDSA 3FO1B 2A77H 1FZOA 3CZJA 4X4MA 5DJDA 3A67H 2OP4L 4P23B 4N0FB 3RDTA 5L2JA 5ICZA 5J11C 3SY0B 3E6HA 4K7FA 5IWLA 1FV1B 1KB5H 3UTQA 4DOHE 3NPSB 3HZKB 3VGBA 5C7XL 1BQLH 1EXUA 2X1WL 4OI7A 5DS8A 1JNHB 4NGHH 1OTSC 5IHBA 5C0EB 3PWLB 4LVEA 4Y2DC 5D2LB 3MNVB 3GIVA 3LRGA 5I1AA 4WO4C 3MCLL 1PGRB 3VRLE 4DUXA 4KH2A 1WBYB 3BRDA 5EA0H 4HWUA 1S9YB 2QBWA 3MLTA 2HJKB 3D18B 3RWFA 4JG1L 2FIKA 3K0WA 2I9TA 4NQSA 1U42A 2JF1A 1MIMH 3MLYH 3M8OH 1IGIL 1YEIH 4XMPH 5D70L 3ZTJG 3PWVA 2R4SH 1T2QL 3CSGA 5EBMB 1NBVL 1YN7A 3PL6B 5DJ8A 1KLFA 2CLZB 1T2QH 5FIEA 4NKOB 1NBVH 4XCCL 2VABB 4C56D 1YC7A 2EYSA 3UO1L 4QRTA 5T5FH 3L3OA 2OTWB 4NCC1 2P5EB 3TZVC 4ZTOL 4MQXD 4ONGL 4IDJL 2IGFH 3HR5B 1CD0A 3MROA 4PJGF 4U4BA 5F9OH 2R0ZH 2NMSA 3O3AB 4J6RL 4YHOL 1J86A 3BZEA 1U9KA 2JK5B 3GHBH 5AG8A 5FYJD 2YR3A 5JPNB 2GY5A 5F9OL 1EO8L 1ZA6A 1ADQH 4P4KA 1CCZA 1CT8A 3AS0A 3C5ZD 1QKZH 3QAZC 1A9EA 4PRIE 1D5BA 3QR2A 2Z0BA 5FF6B 5BV7B 1JPTL 1IQWH 5E8NA 2PUQT 4K94H 1CFNA 4AENA 3D85D 3WFDH 4EEEA 1G9MH 2UV3A 1TQBB 3B4NA 3H9ZA 3NACH 2OL3B 3HNTH 4PY7B 4L8SC 2X9YA 3PV6A 2YXFA 4XZUB 2AVGA 5D6CA 2XFXB 4TPRH 4HV8A 5E4IA 5A2JH 2XNAA 3EW3B 4HK3N 1YMMB 2X7LB 5GGQH 3ZL4L 1SJVA 4CMHC 5D1ZB 5I30H 4OZGE 5C0DB 1IAOB 4UTBH 3VH8A 4K8RC 3T0BA 5IHZA 3F58H 2AJ3B 4JPKH 3TVMA 1ZSDA 3K4AA 5HD8D 1R5WB 1IAII 1M7IA 1CFTB 1MAML 1IGML 3F58L 5H94A 1XR8B 3H7BA 1LHZA 3DHJA 4BFBD 3LIZH 2NW3A 1BX2B 2HJFB 1IGMH 4WWID 5FUCC 3V5KA 2AERT 2CMRL 5DMJB 1KBGH 1I7RA 4Z7VF 4K23L 2HKFL 5DK0B 2BVPA 5IR1B 2Q8AH 3P30H 3S35H 3HE7C 3V0WL 2CMRH 1QQDA 1M71A 6FABL 1RURH 5CBEB 3U2SB 4P2OD 3P4MB 5H2BA 3RUGA 1JYNA 1HSBA 2J4WL 1MFAH 4N0FA 3PF2A 4NQED 5DXWA 3VCLB 2BY1A 4UNVA 4P5TD 3WIHL 5FUOL 2UUDK 4RGND 1H3XA 4OCYH 1Z9SA 1T83A 4HEME 4Y4HA 3X17A 1ODAA 3T1FA 4ZFZA 1G7JB 3IDGB 5HHPA 2M2DA 3R4DA 5E08L 4PJBA 4WEUD 2CIKB 1KTLA 5IBUB 4XI5C 3R0MA 4Y4FD 1SBSH 2Z93A 3LS5L 3OGCB 4NNXB 2IH3A 5GSVA 5SV4A 5T3ZE 3KJ4C 2EICA 3LPFA 4Y1AE 3LS5H 4KY1L 4PYHA 1BBJA 3MRDB 1VACA 1ZLVK 4I18A 3UBXI 2HFGH 5IVZB 2G2RA 3P73B 1MJUH 4G43B 4ZUSA 1GZQA 3P0VL 5CUSH 2XV6B 3HI5H 4KKLD 4PP2A 2CIKA 2Y07L 4NHUB 2K9UA 3CDCA 5CP3H 5DR5H 1MSPA 1OLLA 1CI5A 1U2HA 3BUTA 2BNRE 4JFEA 2X70B 4D9LL 3MBED 3BGFC 1ACYL 3TBTA 3F7VA 5JDSA 2FO4A 4APQC 5DWUH 3BP5B 1NAKH 4ZOEA 2NY6B 2CDFB 4GAFB 1I3VA 4DAGL 1G7LA 2APTA 3B8YA 1QOKA 3MOBL 4QRQA 1ZS8A 4RA3A 5F7YC 4QF1B 3K8KA 5C0EA 2EO1A 2OL3A 4JPWL 5FHBL 5DO2C 2VRAA 2ZUWA 3MOAL 3O9WD 1N3NA 2HT3C 1F45A 3S96B 3VFTA 2P1YA 3C9NA 4R6UA 3NGBB 3NPZB 3VXRE 2V5MA 4OLYL 4M8VA 3ZKNC 1YEDB 1H3PH 4I13B 4NP4L 1BD2B 2XWJB 4LDEB 5IOPA 1CLZH 2AJ3A 4IMKA 3JTTA 5C6TH 1OAQH 2VDPH 1DBKL 1MCOL 4PJXE 5I74B 4CUCA 3O0RH 5EC1B 3QFJD 2EDJA 3OJDB 4HHAB 3U82B 3OAUL 4K8RD 5JHLL 5GGSB 1CDGA 4HUVB 1PG7H 4Q9CA 3MJ8B 2F15A 4U05A 4EOWH 3PWVB 1QLEH 3MLYL 1DQLL 5BVJB 5ADOH 3PL6A 4L3ED 1ZVYA 5SX4I 5L6YL 1WF5A 2FATL 5DQJB 1FL3B 1RIHL 1UVQA 4YBHA 1XGQB 3FO0H 4W68A 3Q1SH 1IGYA 3BZEB 2R0WL 4OUOA 5EBWA 3PNWB 3ARBA 4A6YL 3RY4A 2NY1C 4WV1A 3K2UL 1NMBH 3RVVD 3QCTH 3S4SA 2IGFL 1IZKA 4PJ8C 1KLGB 4NC0B 2R0ZL 4JHWL 4Y19B 5FHAL 4UTAH 4HFUL 3BD5A 3Q3GB 3TBYB 4OKVB 1D5XA 2WV3A 4HAGA 1GGYA 4H1LG 1EO8H 12E8H 3GBNH 2GTWB 1F6AA 3MUGB 3OB0H 1H8OA 4HWBH 3TNMA 4IJ3B 5JPMB 3QUZA 1M05B 1N6QL 2MPAH 3BXNB 3KPRA 4M6OH 4X8JA 1JPTH 4PJEB 5DFVD 3FB6B 3IS0X 1MFNA 3FO2A 4ODTH 5C0DA 4QXTB 4AT6B 1N6QH 4JREC 4WU5A 4UT7L 3BN3B 4KMLB 3OX8A 4HGKC 2YHGA 5C0CA 3EUUA 3CPLB 1QBLH 4G6AC 4OCXL 4JFOB 3QEHA 4JM2A 2DDQL 3WXWH 5KSUA 1JBJA 1I9RL 2ATPB 4XNMA 5JPMA 3TBVA 5DD1H 1QBLL 1MWAH 2IEPA 1DQDH 4KHTL 5TE6H 3GMRA 1HH6A 2N7BA 5KANI 2ZNWA 1T21A 4OIAA 4JPKL 1X4ZA 5DS8B 1R3KB 4KHTH 5I75C 1RZKL 1MAMH 1Z6JT 5FYKU 2AGJL 5D2LA 1K9TA 3B5GA 4P2OB 5DC9B 2JJVA 3QDME 4HUMB 5TGBA 2OI9C 1IM9A 2WWKT 2AGJH 5I1LA 5CP3A 2JLLA 1ONQA 5T3ZH 3WYRA 2DWEA 2Q7NA 2QTEA 1HSAA 43C9B 1GGCH 1G9NL 1GZPA 4HCRA 4NZTH 2BP3A 4JO1L 1AIFB 1G7JA 1PZUB 1A7PH 1XCQB 1CE6A 2J4WH 2E6JA 3LQMA 5DUPL 4DN4L 1A02N 1BFVL 4YC2B 1IGFL 1L9NA 3QNYA 4ZOBA 3U30C 3ARDD 4AEHL 5JO5A 1BFVH 5D1XD 1Y6NR 3ULUE 1MREH 3QCVL 1CXIA 1QNZH 2J5LC 4NN5B 3VGAB 5LBSL 1M6OB 3LH2H 4KHXL 2BSRB 4QRUA 3EOAB 1MREL 1WGOA 3WMSA 1QFWM 1HILA 1MELA 3B9AA 4KGLA 2OR7A 3T08A 5E9DA 5LGJA 1EGJA 4OSUL 4XBPB 2EEDA 4WHCA 3VXTB 4F15C 3ARYA 4AYFA 1NGYA 1FNSL 3UTSE 1YECH 1T03L 1RZ8A 4ISVA 3F5WA 4P2RA 5CCKH 5EC2B 1VADA 4ZUSB 1XEDA 3HI5L 4NQVA 4HMDA 4MD4B 1F58L 4QXUH 3MNWB 2WSKA 2A74B 2PCPA 1UJ3C 3UTQB 4PJ7B 4NQEE 5IESH 2DQHH 5ANMA 3WUZA 2VUYA 5C3LD 3BX7C 3FFDB 4XNQB 5D6CB 2FGWH 1PVHA 4HUNB 3I75B 4MAUL 5E6ZA 5HGHA 4O4YH 3L3KA 4OV5B 3VXOA 3O9WB 5TH2A 1LO0L 4JQIH 1OP5H 4IOFD 3MCKB 4S1RL 2HLAB 5DHVH 5D2LF 1UACL 4WI8A 2OQJB 1RZFL 3K4ZA 3GEWB 2B39A 4M9PA 1I8MA 1BVZA 2JELL 2E27L 1A1OA 3GO1L 4NRYB 3WUWA 1DCLA 3UZVB 1HKFA 2XPGB 3IKKA 4JGJA 1KUMA 3TV3H 1QPPA 1YA5A 4BH8B 4MJ6A 2YN3A 1I1FA 4WDIA 4NJ9L 3QFJB 1BZ7B 1NJ9B 3EYSL 5DRNB 2XRAH 3J7HA 4YGVA 1YEDA 4Y4FA 2Z4QB 4QTIL 4F57H 2A9MH 1LD9B 4J3OC 4G42B 4BSJA 4NWTH 3QDJE 1TCRB 3KPRE 1KF9B 3JZ7A 3CMOH 4O58L 1YYMH 1N6UA 4WTXA 3QB7C 5JW3L 5HDBE 5KS9E 1A4KA 1FZJB 2EIZB 1S5HA 3EYUL 2P24B 32C2B 4GXUM 4UUJB 1MI5D 1U8IA 5EOQH 1A2YB 4Z7NE 4EUPG 1WAAE 1NAMB 1TLKA 4OFVA 5A16A 2IBGA 5D2NC 3PNWA 3L7EB 5DSCA 4UQ3A 3MRIB 2QSQA 1AI1H 3TO4A 4V1DE 4D3CL 1DEDA 1SY6A 4HJJH 5ALCL 4ZS7L 4KUCD 4DN3H 1RIHH 2B4CH 1N59A 3OMZA 2YZ1A 3AROA 3PQYE 2ZCHL 4P3DA 2W65A 4GG6F 3VXRD 4A6YH 1NBYB 1WBXA 4KRPB 1WFUA 4LCCA 4PB9H 4BSVA 4WW2A 4A2MA 1KJ2H 4C54A 4FABH 3RP1A 1F3JB 2QSTA 3VFNB 4DW2H 1A1MB 4TUOA 1TZGL 4PRPD 4G9FA 1NMBL 4NKIL 4JM2D 3WLWD 3OJ2C 1Z0NA 2AQ1A 1G7IB 2VZ1A 4LAQH 1NEZA 3O4LE 2IADB 5IV2A 2WLYA 5D7LD 4Y16B 3STZA 3NAAL 2VNCA 5I1DA 5CJQL 1P1ZA 4I18B 4MJ5A 4N0RA 5H37H 1CFQB 5EFIB 1BZ9A 4FQQB 2E8ZA 2MPAL 1S7VA 1CDBA 3OB8A 4LLQB 2CKBH 3V7MA 3VD5A 4HK0B 4KVCH 3W11D 3EIFA 2R8SL 3CLFL 3MACH 4LLUB 5F7DA 4AIZA 2C3WA 2DIBA 2Z35A 5CIPA 1Z3GH 4HH8A 4HBQA 2CO7B 4UV4H 3VD9A 1NCNA 3N0PB 1QUNA 2FL5B 4CGTA 5I1IH 4RGMB 1JTOA 2RFXB 5I0DA 2MMXA 5I73B 4IDLA 4X7FC 1JE6A 3RNQB 4ZOCA 2AEPH 5TE4H 1NGPL 5E70A 3MFFB 3TIEB 4PJ7A 1XH3B 4LSDA 1BIHA 1NBZB 4X5XB 3Q48A 4DUWA 5KVMC 1MHHB 4KKAD 4OCWH 2F8VA 3ULVD 2MHAB 2ESVE 3CH1A 3GIVB 1CDUA 1U8IB 5EBGA 3GNMH 4KK6D 1AO7B 2ARJQ 3KWWA 3WNPA 3C9NB 4EBQL 4NM4H 5LWYH 2XTJB 1FDLL 4DUVA 2FO1A 3MLZH 1IGTA 2QHLA 5EZOH 1KN4L 1XGUB 3V5HB 1GGCL 3UPAA 2RB8A 2MHAA 2K3TA 5HGAB 4DKEL 2VLJD 1KJMA 3CH1B 1DTUA 4WTWA 2I9LA 4HLZH 4JDTH 2VLRD 1DLHA 4N9OB 5DRXB 2VH5L 4JG0L 3IDMA 3DOSA 3ALPA 3LS4L 2YD3A 5SWSB 2PYFA 1TJIH 3RWFB 4U1GB 4EIZC 2J8HA 2EE3A 4KFZC 1S9YA 3QJFB 4M48H 3ULVE 1NFIA 1OGAA 3MNZB 4Y4HB 1DANT 3MGOA 1VFUA 3VJ6A 3QI9A 1U93A 5F9WC 3D1MC 1AE6L 1S5IH 4R90L 1CGYA 3G5YB 4R7NA 1Y6KR 5HHNA 1FZJA 2FX8L 1LE9B 5BVPH 3MRHB 1JYVA 2FJGB 5FECB 3THMH 4PBXA 5EFIA 1OAYL 5EIQA 3P73A 3GMPA 1DQQA 1T4KA 5JNYA 4IRSC 2A74A 4KDTC 5I9QC 1BBJB 3F8UB 2R0KL 4U1MB 4LLWA 4QRPA 4K3JH 1FHGA 3TH3T 4ODSL 5HHXL 3I3BA 1TITA 1N4XL 3A6BH 4H20H 5IMLB 4RAVB 5IP4A 5F93C 3UTTB 3BH8B 1L6XA 3JWOH 4ODSH 5HHXH 3ZO0A 4HH9A 3SJVD 2WM0A 1NEZB 3PHQB 2BCKB 3WIHA 4MAUH 3M17B 4X98B 4OI8A 3NFNB 1TJGL 1A6UH 1BEYL 3V4VH 5GIRB 4NQDB 5E2WH 1KIRB 4CW1A 1G0DA 3BFOA 1UACH 1QRKA 4FQXB 2ICWJ 4NO0D 2PO6D 3T09A 5JORA 3VFGL 4MA8H 3DJ9A 3E8UL 1OP5K 2VISA 5GGTA 5D9SA 4Z5RB 2ADGB 4L4TB 3TO4D 3P9LB 5K33A 1NUDA 2FEEL 1U91A 4U1NB 3EHBD 2Q87A 3VE0A 4PJCA 1MUJB 2EIEA 4LSTL 43CAA 5IMKB 4PJCE 3SKOA 3C87A 4AK1A 1JGVH 1JHLH 1X5FA 4NWTL 5GRVK 5EG6C 4WV1B 2LABA 4RAHA 4U0RB 1R5WA 1KXVC 1MLBB 4HXBH 9CGTA 3D9AH 2V9TA 5JW3H 3MRLB 3DUHA 4L4TA 5D6DC 2R0LL 4F7PA 2Y25A 4FQHB 5JMOC 4FQ2H 5GRUL 3FTGB 2RR3A 3LVEA 3IVKB 2AK4A 2R2BB 4NHCL 4ZAKA 3MREA 4QRUB 4NO5B 2DQDL 1MJ8H 4ODVH 3RI5F 5IWLC 4FFYH 4UAOB 4X7SH 4HBCH 4XC3L 1UWGH 2AV1A 4ZO9A 2ZCHH 2X4SA 2VITA 4GRLC 1OP3H 3O81A 3B3IB 3OKOA 2WNGA 3I6GA 3WS3A 3H3KA 5FXCH 1F42A 4FQHA 1JL8A 3NA9H 3VFUB 3GSUA 2AK4B 3ARDC 4LQFL 1JJUA 3NZ8B 2C9AA 3IDYB 1WITA 4W4OC 1QRND 3U36A 4O2CA 5EUOF 1D9KA 1T1YA 2IQAB 5A43C 3PWUA 4GBXB 1XIWD 4I0PD 5IVXE 3DX8A 1QFWL 4OKVA 2XQBH 3BT2H 3NIFE 4DGIH 5IBLD 2R56L 3GI9L 1UA6H 3OZ9L 2FR4A 2XKSA 3JV0A 1ZAGA 3UXFA 2EXWD 4R7NB 5EZLA 3QDHA 1QFOA 4XB7A 4XPAH 3TN0B 5I8KH 2XZAL 4R7DA 5ISZB 2R8SH 3RKDC 4OGYL 4GBXA 4NYLB 3CUPB 4UV4L 3OB0K 3TVMB 4RDQF 4DCQA 2FEDC 1NGWA 3QQ3B 1AQKH 5JA9A 2QQQA 5D9SB 1G7LB 2C5DC 2N7AA 1E4XI 3L3IA 2WUCL 1MCFA 2VDNL 2F74B 2UVEA 1G7PB 3IXTA 5JDSB 3RNQA 3MRNA 1BIIA 4ELME 3LOWA 3U1SL 2VDNH 1YUHA 3GJFB 1AO7D 3RGVD 5EDXA 4IOFC 2XTJD 5CAYB 4NFCA 1K2DA 2ORBL 4LP5A 4PRIB 1WBYA 4YIQB 3SDAC 5BS0B 1BVKB 3RKDD 4BZ1H 3V5HA 3DPBA 1Z9LA 3V5DA 4HKBA 2V5YA 1JCKA 2YSSA 4XCEA 4HGMA 1HH9B 5L8JB 5JHDB 2XT1B 4YUEL 1G9NC 1AXTH 3DX9B 1DJSA 2O5ZL 2PR4L 3DTXA 4X4XB 1A6AB 2CDEB 3RY6A 3GKZA 3MCG1 3C60A 1VFBA 2VXVH 5F72S 2J7LA 2IMNA 2UZXB 4TSCH 2DWEB 4X9BA 4XNXH 2R1XA 4NUJA 1U58A 5FM5O 1OSPL 4AQOA 4FP8L 3F7QA 5FKPB 2MTPA 1RUKH 1Q9WA 1JI2A 4N1HB 4L5FH 4GRLD 5T1LB 2UWEB 4WWKD 3L7FA 3T77A 4MA7L 3OV6A 4P3DB 1YEJH 4XVJH 3QFDA 2ZCLL 3ILQC 2YPLD 2ZSVA 3NCYS 2EDHA 4K3HA 1P6FA 2MSPA 4XVJL 1UB5A 2ZCLH 5AUMB 1U8HA 3RUGB 1YEFL 2G5BB 1JZ6A 5DHVB 3RA7L 1KYOK 4OD2B 3P77A 2WWMD 4AM0A 4P49A 2VERN 2DQEL 3MLSH 1I7ZA 2PXYB 2Y6SD 4ZPVB 3U9PL 4OLVL 3W0WD 3WFBH 1RZ8B 1MFEH 2ZOLA 4JFDD 3U48A 4GH7B 1MWAA 1YQ2A 1BFOA 3DVNA 4X5WB 4Z95L 4ZUWA 4ALAH 5IT2L 4OLVH 4YPJA 5E2UH 3S4SG 1WTGT 3LN4A 3WFCH 5HYJB 4FZEH 1D5XB 5DRNA 1QSFD 1GZQB 1TVHA 4JCLA 3QG7L 4M43H 2A1WL 4MS8D 5EOCL 4YXLH 3GSNB 3PWUB 4FZEL 3OKDA 1N8ZA 2HH0H 1JWUA 1LO4L 3D2UD 1Z5LB 3PWNB 5ALBL 1JWMA 3ZDYF 4U1JA 3TGXA 1WAAA 2ED7A 3P40A 5IJKC 5DVKA 3Q6GH 1R0AH 4AIOA 3UYRL 1TQCC 2BHYA 1DQJA 1URLA 4D0CB 5GS2H 2IAND 2AJXL 2MWCA 2P7TA 3Q6GL 4X6EA 3ETBF 4CVZA 2Z92A 3IRPX 5A3IC 4Z7UE 1EEZB 2ATKA 4YX2H 2RJMA 3CNKA 4BYHA 3P4MA 5H2BB 4UILL 3UBXG 1E28B 4P59L 1P5VA 4JAMB 4NO2B 4U1JB 1WZ1H 3QHZL 4KI1A 4M8QA 3G5ZB 4L1HA 1JGVL 5FYLD 1H3GA 1GXEA 4YE4L 3KXFB 3ULVH 3UJTL 3GBLA 3RU8L 1FL5B 4FQCH 2EXYC 3ZKMD 5DI8A 4JDZB 1MRFL 3QWOA 1KTLB 1NCAH 1QR1A 1OAKL 2CK2A 5C09E 3DVGB 3GKWL 1AGDB 1WEJL 2P44B 4ZFZB 4WU7A 3R06B 3DYMA 2HN7B 3QDGD 3IDGA 3LCYA 5GSRB 1VGEH 3GSWA 2VO5A 1BD2E 3QJFA 4ELMF 4UV7H 1T3FB 4HBCL 4XC3H 2CIIA 1UWGL 4UU9B 3C6LB 5F71A 2NY2D 4XPGH 2YA2A 4YDVB 3BIKB 1UJ3A 3GSOB 4PGDB 5GHWH 3FT3B 2VR9A 5CS7A 1QHOA 4LSVL 4NRZB 5GSRA 4OZHF 1AGBA 4JFEB 1CE1L 1EHNA 1T3FA 3TT1L 4M7LH 1EK3A 5F21B 1CE1H 3BWAB 3RWGB 4NHUA 3RTQB 5I17B 2FR4B 2ICEB 3AU1B 3H9SE 5IW1B 4P5MA 5IGXH 3KJ6H 1DL7H 5KVFH 4AH2A 3ARBB 4ZSOB 3B5TA 1P1ZB 5C86A 5EUKB 1XCTA 4IRJA 4D0DA 5C9JB 2OBGA 4JDVB 2YK1L 3QXAA 1DL7L 5KVFL 3GIZL 4U1LA 1MHPL 3SDAA 4L3EA 5HGDA 2XNAB 4PRID 4MD5A 3DNKA 3HZMA 4JKWA 2MJWA 4Z18A 2V17H 3RDTC 3AMLA 1P69B 1S7RB 4D2NA 3X12B 5FOBA 2W91A 3MRNB 4ZAKD 5C0AE 5F89A 4C56E 4GFTB 5C0CB 4HS8H 2XYCA 1SJEB 1CVRA 4PJ9B 3PDOA 4U2ZA 3MBEC 1JWMB 5CSBA 4PJDB 1HQ4B 1NLBL 2DQIH 3WFHB 3T0WA 1OM3L 3WNKA 1QRNE 1RHHA 5F7NC 5KW9H 4MJ5B 1YQVL 1NLBH 2DQIL 3C8KA 3DO7B 4EI5A 3FCTA 1AXIB 3BEVA 4GRLB 2X89D 1NCUA 3QO1B 1OD9A 1C5CH 1JGUL 2NY7H 4FTVA 1IGTB 1RD6A 1OSPH 4HLZG 1CICC 4OM0H 1NMCC 4MQXC 4LK4A 4XBPA 3ZDXF 1CN4A 3QNXB 4M62H 5HHOB 1GC1L 1SYSB 3SBWA 5DQ9A 2XQYK 4L5FL 1CDCA 5FUZH 2EYTB 3FONB 4P2CG 4DTGH 3V6OA 3EJZD 4QY8A 2MQCA 3WNOA 4H1LA 3MOQA 1A6TB 1RK1A 2JCCF 4WHYG 4C59B 5IB3A 1AQDB 3SOBH 1X5IA 4NQDA 5AUMA 5HTSA 3VU2A 5E1HB 3CXHJ 3P3YA 1T2XA 4RMUA 3QIWA 3SOBL 2VJXA 3ZHDA 2DLHA 3DVGA 1J0YA 4M00A 1F4YH 2W0KA 3LEXA 4JHBA 4P2OC 3WKML 1K5NB 2DQEH 2R9HC 1RUAL 4B0MM 4R96A 4XAKD 3LEVL 1UZ6F 3V6BR 4X7TB 4LLWB 3ULUD 2VMFA 2MKWA 2LU4A 5BV7C 2CK0L 4AJ0A 1EEUA 2GJ6A 2Z93B 3OGCA 4NNXA 4TVSa 4Y16A 3STZB 3SKJL 3WV0A 4R96B 4EUPA 4POYA 1JWSB 2EDDA 1OWRM 3UTSB 5FO7B 4P9HC 3MUY1 4IIQC 2NXYC 5E00A 4IRZH 3BWUC 4Z76A 1J8HB 2IWGA 1R0AL 1JPST 1EUTA 2E8YA 4ORZC 3SO3B 2R2EB 5BS0A 4TRPL 3IJYA 1GHFL 2ILLA 4U6VH 3T0EE 1DVFA 4XCYA 1K2DB 4W81A 5TE7H 3TP4A 1LGVA 1IGCL 4F37F 5F1SA 1D3CA 3TBWA 5GISH 2AJVH 4HF5H 3FRUB 3FB7B 1FYTA 3T2NL 5HYQB 3T3MF 4P5TA 3SGEH 1WZ1L 3QHZH 4E5XA 2LTQC 4U2YA 5GISL 2XTLA 5DJXB 2JJUA 1CE6B 1HCVA 4O02L 5EA0L 2PYEE 3MX0A 3C5SA 3QEUB 4WJ5B 2B1AL 3DSFL 5EUOE 4YFLF 1YEEH 4ZXBA 3DRQA 1P6AB 3CZFA 5TQ2H 3BP7A 3NCBB 1T5WA 3QI9C 4YHKL 3QEQA 3C8KB 3LKQA 4APQA 3IXAA 4Z0XB 1T80A 4QKXB 4OZ4A 5TQ2L 5LGHL 1A7QH 4DOHB 3WFHA 1T1XA 4OZFH 3EOAA 1A22B 4TULH 4Q9BA 3O2VL 4ETYA 4F33A 4OF5A 1LWRA 2OYPA 3JBG7 5GGRB 4TULL 1AD0A 3HZYA 2AV7B 4ZTOH 3STLB 4GW4A 1MFBL 2HT2D 3MPCA 1NUFA 3TT1H 2KBGA 3SDXF 4JR9L 1UKQA 3WFEL 2M1KA 4ZDHB 3MCLH 4NQUA 3QXAB 5I8OL 1A3QA 4RRPG 1FE8H 1GGBH 3K1DA 4UNTA 5FEBA 3WFEH 3KPRB 4X8JB 5I8OH 2QLVB 4JFXA 4RMSA 3PXJA 2Y06L 3MJ9A 4GJTB 3I6LD 3S36H 2QQLL 2Y5TA 5ETUB 1WIOA 4NNYB 1RIVH 5GS0C 3PWJB 2Y06H 4OBSA 1MWAB 1OPGH 3S3SA 3QUYB 2H1PL 2X4TB 3ARQA 2FDBP 2D03H 5IM7B 4F2MA 2HTKD 3FT4B 1JMXA 1OPGL 4XPFH 4L4JA 5EH1A 1IKNA 5MP6H 3BDBA 2ZZUT 4D0CA 4MSWA 3QUKA 4JANB 1U3HC 1X4YA 5SWZA 4MVBC 2NY2C 1FYTB 4PJXF 1QVOB 4L9LA 2Y7QA 4PRPA 5GQBA 3M45A 4PJ9A 3K81A 1RMFH 1WBZA 1MIEL 2RFXA 5D71L 2ZOKA 4M6NH 5GS2D 4YHML 4GRWB 1UH4A 2DLFL 5IMMB 5FKAB 4M6NL 2IPKA 5INDB 1EEYB 5KG9B 4PJ5D 1CF8H 4OB5L 2LAAA 1EXUB 3QWOB 4LSUH 5F9DC 5C07B 4WW1B 1F6LL 4FTVB 4LVHC 4RA0C 4QT5B 2ENYA 4Q2ZA 1GC1C 4L4VD 2FBJH 3HG1A 2DLGA 4OZGA 3IU3B 2Z31A 3TC9A 4R0LB 2BSTA 4KRPD 4QEGA 5GRYA 3T3PF 1KCUL 4HPYH 1S7XB 4M62L 5TGBB 4G9FB 4P5KB 1UKSA 5FA3B 5GGQL 3ZL4H 4RFOL 3A0OA 2NX5D 5I19L 3HZYB 3N1GC 4XI5D 4MA1C 1AR1D 5DQDH 1GAFH 2GSGB 3RWJB 1P84K 3LAFA 2C1OA 4PRIA 4KJQD 3BI9X 4O5LH 2VWEC 4GW1B 4YDJA 3DYOA 5KSBF 1NBQA 3Q5OA 1RJLA 4KY1H 4F7EA 3OKKB 1R3JA 4L3AA 1FNLA 2HFGL 3RWJA 3C6LA 2KQNA 1GYAA 3MV9E 5F7DB 4AIZB 4PLKD 3OAYK 4ZFOA 3ARGB 2PYFB 3FFCA 3R0NA 4YXHH 4LCWE 3ZSSA 1Q9KB 3U46A 2P5WD 1RURL 3G6JE 5DA4A 1UGNA 1VFMA 4TVPD 3BH9A 3IDNA 1SM3H 4X5WA 1DFBH 3MLXH 2EXWC 4WEMB 5E7BA 2UZIL 1CR9L 3MRKA 1ACYH 1P7QD 1UADC 4PP2B 1DFBL 3EKCA 1FLRL 1R5VA 2Q76A 4LCYA 4PRAA 5IFHL 4OZFA 5E8EA 4I3RL 5HD8C 3CFKA 2P49B 3A67L 4JRXE 3QXDB 4LDLB 2ZUXA 5F1IB 3JWOC 3ARTA 2O61B 3GSVB 3HPJB 4NRYA 1UG9A 1I1FB 1IAIH 2XFXA 5DEGB 1J11A 1NL0L 2BMKA 4E0RB 2X7LA 3CDGB 1NBZA 4U6VL 5ID1A 4APQD 1B0RB 2H2PD 3VWJB 1JHTB 5D7LE 2GTZB 3PHQA 2P7TB 4CVZB 2P8MB 5C08E 1IGJB 2AJVL 5TDNA 1VSCA 4KTEH 4QGYA 4OV5A 4F3FA 4ZQKA 3I6LE 4QRPD 3HUJB 3FQTA 2HLAA 4OFIA 3PL6D 4UUJA 5D7SH 1AR2A 1I4FB 15C8H 5EB9A 5TH2B 1CG9B 4DKFH 3C5ZC 4X0KB 3RL1B 1MCOH 1C5BH 5D7SL 1NDMB 1D6EA 4JFFD 2D7TL 3TYGH 5DK0A 1A6AA 3S8WA 1YEIL 5D70H 2X9WA 5ANME 1T20B 3QWRA 1NSNH 1VFBB 3MRBA 5HVHB 1C16A 1VGKB 5J1SC 1AD9A 4D8PB 4PJHE 3W82A 3B2VL 1NSNL 1TZHA 1T1WA 1J8HE 1ZVSB 4PP1C 4PTTB 3PGDB 2EC8A 3DX7B 2OI9B 1FIGL 4KV5E 3TA3B 3ARFC 4HG4K 4G8IB 1OP9A 1T6VN 4JY6A 3LKRA 1F3JA 5FA4B 2VQ1A 4JLRA 1OQXA 1NCCH 4J6RH 4M7ZC 3K2UH 4GSDL 4OT1L 1T0MB 2GK0A 4OLYH 1A7OH 1NC2B 1Z0MA 3ULSA 5GJSH 4LOUC 4NP4H 3TO2B 3GB7A 3PV6B 4UTAL 1ZT1B 3FT2B 2ARWA 4MJ2A 2RHEA 3BKMH 1CLZL 1KCLA 3CDYA 4G6JH 4ZNEE 3HZVB 3CUPA 1GGBL 1IQWL 2Z31C 3BKML 3RWEB 2FHCA 1JPGB 3GMMA 3O0RL 3VI4F 5BRZA 1LEGB 5DTFB 1WZKA 2QQLH 4X6DF 4MYWB 1JWSA 3VFOB 4PR5B 2QSCL 2ZOLB 1RHHB 2JKXA 1DBJL 2X4PB 3HFML 4D9QD 3VG0H 1J5OH 2D7MA 4ETQA 1Z2KA 2H1PH 3RVWD 4HW6A 1HILB 3FRPA 3REVA 2DMKA 3MFFA 5ACLA 1J05A 1NAML 1KTDB 5IQ7H 1ND0B 4Q7DA 3HNVL 2APVA 3CFDA 4ZXBD 3SGEI 3KPNB 3IDXL 1IC7H 4QXGL 3ARVA 3FMGH 2AEQL 4KKCC 3ILPA 3BKJL 2XA8L 5MEQB 5A2KH 3IJSB 3QULB 4XZUA 5CD3B 3LIZL 2BRRH 4LVOC 1I1AD 1J8HA 1A6WL 2VUOA 2XA8H 3BAEH 4L4VB 4HHAA 5EZIL 2I5YH 3GMNB 3QA3B 4XNMB 1FZMA 2HKFH 4QY8B 1MEXL 2GJZA 3BAEL 4TVPE 4CMMA 1DUZB 1MAJA 4KMTH 2I5YL 4PREB 2PETA 1RJCA 3MC0A 3MRBB 4I3SL 2I9LB 1ZT7A 4MNQA 4QHNB 1FC2D 5F1IA 4M03A 4OZGB 1XCTB 4IRJB 3U6RB 4RAUA 2FBJL 5DRZA 4ELMB 2H6PB 3B9KD 1ONQB 2GJJA 5HHME 4MQ7A 1I7RB 5ISZE 2W0PA 3C5SB 5E08H 2NY4B 5J9PB 1QNZL 3S4SB 5IEHB 5LBSH 5IW6B 4K8RH 4P46C 5I19H 5D6DA 1Z9OA 5GGUB 4KKAC 1MWAL 5HHVH 3EFFA 4GG8B 1WFNA 1LK3L 3P0GB 4UU9A 2BOCA 3PP3H 5DF0A 4YHPB 3WD5H 2VAAB 3RJDA 4KC3B 5JXED 1SJEA 2XACC 2J3SA 5JA8B 4P2QA 5IB3B 1NEUA 3TIDA 3TN0D 1HQ4A 5E9DB 3IKCA 4FFZH 1Q9OA 1CGSL 3TBTB 1LK2B 1FVEB 3MRQB 5CCKL 1ZWIB 2DTML 2MCPH 1E4WH 3PP3K 2DAVA 3G04B 4PUBH 1TNNA 5EBLA 5TPWH 3L1OL 1T89A 1PSKL 5B22A 1U8LB 2E6PA 4Y16C 2DTMH 2MCPL 5BQ7B 1NMAH 2BCKA 1CQYA 2D7PA 1IM3A 1KB5B 5EZLB 1S3KH 3HNSH 3V4PL 1OTSD 2H8PB 5I8CB 4X6FB 3RGVB 4DEPC 2JJTA 4P23D 1KTDA 2IBZX 1HXMB 2LU7A 4AG4L 3AM8C 2PF6A 3CLEL 1RZ7L 4HSQA 4Y1AB 2A6IA 3HE6C 5HPMB 4P2OA 3NGBC 2ICES 4OZIA 1CFVH 1JMZA 1JGDB 3I02B 1KIPB 1FAIL 1W0VA 1ZE3C 4XWOC 1IEBA 1J9CT 1I8LC 2GUOB 4GQ9H 1FN4A 1LEKA 2AXHA 1MUJA 4TQEH 1A7BA 4GW5B 1U91B 1FNSH 4Y5YB 1H5BA 2PN5A 1B0RA 4OFYD 4YHLH 2X6MA 4CMHB 4L8CA 2F54E 3N1QC 4MXQD 3S5LB 3TBSA 1TVDA 4X99B 1XAUA 3EYSH 2ZPKL 3OKDB 4KTEL 3L3HB 2CPCA 4XP9L 3RWIB 4JFOA 4HWZA 3H9YA 5EWIH 4OD1H 1YPZA 3S37L 3NIFF 3UPRB 3P9MA 5I1CH 4XP9H 4R3SA 3T2QA 4OD1L 2YD5A 2FB4L 3QEUA 1YY8B 3QDJB 3QIUC 3TYGL 4K55A 2HVJB 5JW5B 1LILA 1ZEAH 4D8PA 4ORGB 2Z8WC 5JIKA 3NIDE 2GITA 3IDIA 4HJJL 3P9MB 3NIGE 4NRZA 1BQHG 3G5ZA 1ZVHA 1U8PB 2IQ9L 4OCSL 3NFSL 4JKPL 2AXGB 4NNPH 4Y4HC 1TTUA 4DGYL 3QCTL 1MNUL 1ZT7B 3HE7B 4DK3A 1CICB 5EU3B 1NCBH 3NFSH 5GRJH 3D39B 4JN2B 2AS5M 4CN1A 1R3JB 3T04D 1KIQA 2CR6A 1EA9C 4R97C 4G8GE 3LEYH 4YHNB 1K8IA 1ZANL 4QTIH 4Z6AT 1KFAL 3HUJE 2GFBB 3TYFB 3HE7A 1YYML 5A40E 5CINL 3WHXA 3FQWA 1FFPB 4L1DA 4Y8AA 1OGAE 2DQJL 1UWXH 1X5LA 1S7VB 4HK3J 4NO5A 4P9HH 3CAFA 4RAVA 4UT7H 1T7XA 5DRXA 1UENA 4CU6A 4KVCL 3NCCB 3BP7B 3CXHK 1CZ8H 1AFVL 2ZJSL 4NUGL 3LD8B 3KG5A 5GSVB 5BMFL 4OCXH 2YPLE 5I1DB 3HMWL 1XIWC 2DDQH 2VABA 3GGWB 4K71B 1JIBA 5IW1A 2WK2A 1VADB 2GSIA 4O51B 4I77L 3TFKD 3BW9A 4XGZA 1ZXQA 1WCBA 3IDXH 3IDUA 1I3RA 5F96L 5J06A 2GEEA 2ICEA 5T33H 4GAGH 5KVGH 3KXFD 4YFEA 3BKJH 1FORH 3C2SA 3K8LA 3O11A 4W70A 1L6ZA 4DW2L 1YPZB 4GAGL 2HFFA 5CJOH 5JR1L 3QCUL 3IAGC 2PTTA 2VLJA 3PE9A 3L3KB 4L9LB 3BPLB 4OLUH 4LAQL 5CJOL 1VPOH 4NYLA 3CVHB 4LU5H 5INCA 1QPXA 2R29L 4QHKI 5IVXB 3QZWG 5FYKL 2Y36H 4JQVC 2Q3AA 4PG2A 4AENB 4PJAA 1NGXA 2R69H 3QDGB 2NY4D 2NNAA 5EUOA 4LU5L 5EZOL 4FG6D 3BP6B 5HGAA 5E6YA 5DVNA 1JUFB 1TDQA 5HI3D 3W39B 1LEKB 1EGJH 5IF0A 5CGTA 4ONHA 4E41E 3PUCA 2VXUH 4KVNL 5DMGD 1X3DA 1UXWA 4JG0H 4HKXA 1A6ZB 1LD9A 4L8BB 4GG6E 5K9OA 3JWDL 3LN5B 5CP7A 4H26B 2F5AL 4HWZB 1WFOA 5JHDA 3CXDL 3VRJB 3FN0H 1FGVL 3WNMA 2I25N 2P5EA 3WD5L 1EVTC 4N1CA 2G5BA 4U1IB 3I6GB 2C3VB 5FK9B 5EBLB 1I8KB 3LKOA 1Y6MR 3MLWH 4QRTB 1FGVH 1G7MA 2AV7A 3KYMB 4N0YL 5I71B 1LO2L 5IMMA 4JVUA 1CGSH 2VKXA 3VJ6B 3RZCD 2W65B 5GGRA 3THML 4QXUL 1OAYH 3MBEB 4KJQC 4OJFH 3O9WA 1A6TA 4FZ8L 2NY5H 4S2SB 5J7CC 2GJ6E 3TPUB 2HFEA 4Y1AD 2P8LB 5C70A 1JHKH 3A6BL 3CCHA 4H20L 2UVFA 1N8ZB 1J1XH 2X4PA 3V4PH 3BD3A 4IHOA 4OFPA 2A6DB 3MV9D 2FHBA 5HHMB 4X6FA 3RGVA 3K80A 4X6CE 1ZHLB 4XPTL 4U0QB 1HHJA 2PCPB 2XZQL 2VL5A 3WIFA 3GHEL 5KSBB 5BW7C 3FQXA 3U4BH 2Q1EA 3GO1H 2XZQH 4IS6A 25C8L 2ZKHH 4HUXA 3KPLB 3U4BL 5HYQA 5HSFA 3I2CL 5HY9B 1KPVB 1YDPA 1IARB 2CKNA 2WANA 4C57C 3OPZH 5KS9F 3FO1A 1AE6H 1CDIA 3C8HA 4M7JH 2NQCA 1UB6A 4HKZA 2A9ML 3KYNA 35C8L 2XN9E 2QQNL 2EDWA 3ET9F 3S5LA 3TBSB 3CFCH 5EIIB 2WW8A 4ZFOL 2UY7A 3HMXA 3S37H 1CXKA 4PJ7F 4EDWL 1KULA 1MCWM 2FRGP 4QHMA 1BOYA 4LP4A 1LO5B 1TVBA 2W60A 3D9AL 1FFRA 1QR1B 4EN3C 3VXRB 5I18H 4CVWA 3BPOC 1L7IL 5ICXA 2R0LH 2HVKA 3HAEG 4YPGB 5DJ6A 4HUUA 4D3CH 2P8PB 1W72L 5ALCH 3LZFH 1YMHA 1RJZB 1T20A 1BREA 3VXSA 2X4OB 4DN3L 3P4NB 2VXSH 5FYLH 4WIQA 1FCGA 2H6PA 4NO2A 1D9KD 1RUQH 4X4ME 5F7EL 4I5BB 4HIXL 4YWGH 5D4QA 2F58H 1X7QA 1WT5A 1KB9K 4FFYL 2C3HA 4EXKA 3JWDC 5I1GH 3V7AG 5B8CA 2GFBA 4NNPL 1TJHH 5DYOB 1OD7A 3V52L 5IJVB 5C0BE 4OZGF 5D7IE 4LCUB 4HUKB 2AI0L 3MJ9H 4P2RE 3QIWB 4JFHE 2F19H 3D39A 3LB6D 4LHUA 2NLJA 5E99L 3A6CL 2GYSA 5BV7L 2XQYG 3IFLH 2AI0H 4OF8A 3VG9B 3N50A 5T1KA 1H3VA 5E0QA 3IDJA 4XP4L 1T0MA 3D3VD 4I9WD 4JO4L 4LGRB 3OJDA 3BIBX 2BVQB 3IJSA 3UTSD 1JK8A 4N8PA 1EBAA 1T1XB 3BT2L 3O3DB 3SQBA 5MHSD 4HXBL 3OZ9H 2NXZC 4ZUTB 4GRWH 4FQXA 4P9HL 4FHBD 1IL1A 3LV3A 5F7UA 5EUKA 3FO2B 3NIGF 1Z3GL 2KQMA 3QEQD 3B9KC 5DTFA 5EPMB 1SQ2N 5FYJH 4XWGH 3U9UA 5L2KD 2HKHL 3S88H 4HWEH 1OB1A 2NY0C 4F7CA 4MDIB 2RCSL 1NGPH 3MA7A 1FFQA 2HJLB 4PJHA 43CAB 4WTZA 4H8WC 4EN3A 2VDOH 3BHBB 3GMQA 2YD6A 1FORL 1PQZA 4HJ0C 1G6RB 5AD0B 2SEBB 4G9DB 4I48B 4Y4KA 4XBEL 3X3GH 4BQCA 1QSFE 3QCUH 1F2QA 4JFZH 4J3SA 5DJ2A 1G7HA 2AJSL 3SKUD 1Z9MA 4XBEH 4GKSB 1T5XB 4NSKA 4NN6B 1PKQB 3KPTA 2VE6B 4PV9A 1A9EB 1FZMB 4KUZH 3GI9H 3EOYG 4WI7A 2DM2A 1O7SA 2LVEA 1S7XA 2YPLA 5EZJB 2A6KB 3UP1A 3SE3A 4KUZL 2VC2H 4LKXA 1JWUB 2XG5A 2X05A 1B4RA 4FMKA 5DT1H 3DIFB 1TQCB 1F4AA 4HS3A 4S1QH 5FFLA 1C16B 1VGKA 4NWUL 4NCDA 5C07A 1YNKL 2FJGA 5FECA 2WIIA 4JRXA 5JOEA 1JFQL 4X0KA 1INDL 4HKXB 2VXQL 2VZSA 4Z7UA 1YEJL 3DV6B 4YBQD 5C0AD 1NEZG 1ZGLP 4LNVA 1MLBA 1S7QB 2V5TA 2GQHA 1AJ7H 2LU3A 2DKUA 5ERWB 4R90H 3FN0L 4NQXB 5HYIA 2DBLH 4N0UB 3UMTA 3QO1A 2FX8H 3ZT5A 3VFWA 1LO5A 2EZ0C 4OCRH 3UAJC 2XOTA 3VGEA 1CDYA 4MAYA 4DZ8A 4IEFB 3GSXA 2DQUH 1RQ5A 1LO2H 1HHKA 3TIDB 1FVCB 1CGVA 1GPOL 5HHMD 4PJ5A 1VKXA 3H3PH 4FN0A 4J23A 4YNYA 3TPUA 1N4XH 4CBPA 5DHYA 4RMRA 5D5MF 5BW7A 3W11C 5KSAD 5ITFA 4Y5YA 3FB6A 4K9EH 5KOMC 4HJ0D 1IEAA 1JNLL 1VB9A 2N1KA 5E2UL 5D2NA 3W5MA 1PFCA 2P45B 2A83B 4KTYA 4E41B 4Q97A 3AM8A 1KCSH 3QHTC 5MENE 2B1HH 1T7ZA 4ZUWB 5J56B 3BPLC 2DQGL 5E2WL 1CT8B 3VFSA 4QHKJ 4KRPC 4LNRB 4P0DA 4O51A 2ZG2A 1AHWA 5DUML 3VFGH 3KS0H 1UWEH 1ED3A 3D0VB 1J88A 4PJXA 4Y2OA 2ICCA 3UYRH 4V2BA 3SGDI 2OX5A 4HKJB 2I07B 1QTYT 3QFJE 3OPZL 4U3HA 1A5FL 4LSTH 5IFAL 2Q86B 2EDNA 3OBAA 1YEHH 1S8DB 2X10A 3RA7H 3GI8H 1DEEA 1H5BB 3VXRA 2FL5A 2BJMH 3L9RB 3TESA 5IFAH 2HRPL 2NPLX 2EDRA 1BGXL 4Q9RH 5FKAA 3MREB 1WK0A 2P5WA 1MFEL 2QQKH 2N56A 3CFJB 2HRPH 5DC4B 1G7PA 1CBVH 4Y8DC 4P5KA 3QBTB 3I75A 4HKJA 4LBEA 4Q74A 5I18L 3BQUB 2IH1A 2HTKC 1CBVL 3TWCH 5HGDB 3T2OA 4PY8J 1PD6A 4RX4A 4CL7A 1RZJC 3OR6A 3QHFH 1T5WB 4Y5XB 1QQDB 1BQHA 2HH0L 2IAMD 3OXRA 2HP4A 5ERWA 1NMCB 5HHOA 2BERA 3IFOB 1OQOA 3ZE0E 3DX9A 4XVUD 3PWLA 3QIWD 3WXVL 1DLFL 5C09B 1KXTB 3CSYA 4YWGL 1YEGL 4LGSB 2I60L 1EAJA 4U31A 2E7LA 3KPQA 1YEGH 1OLZA 4OQTH 4P2QE 3ZE1F 1AGBB 1JTTA 3K46A 2HT2C 4WVRA 2XN9B 4YO0B 1KOAA 5ENWB 3BIKA 4YJZL 3MLVL 5IBUG 2G9HB 4MNHA 4B7IA 1W0YT 4HIIB 4ZFOB 2P8LA 2VITB 5T1KB 5L0QC 4KGJA 5F6HI 4UB0L 4CN6A 5J4MA 3KPMA 5E6IA 3P2TA 1ZLWK 2XZAH 3AREA 1FNHA 1N5AB 1U8KA 4FXGB 2LVCA 3KNBA 3MBEA 4YK4B 3EJJX 3SPVB 3BOVA 3DSNA 4KTDH 3RZCC 4RRPA 4JO2L 3GRWL 4X7CC 5MERB 2ADFH 3FT4A 2HFTA 1PEWA 1RV6X 2UWEF 4U49A 2H41A 5BS0D 2X4TA 5DD3H 1IKFL 4HT1L 2J12B 4JO2H 3GRWH 4OLZH 2JIXA 5ANMB 2ADFL 1I1CA 1K4CA 3O6KH 1ZA6B 3O3AA 2SEBA 4JM2F 1CLOL 2HJLA 4UI2A 4JVPA 2RCSH 5AYQA 3SY0A 1OB1B 3TCLB 3W9EB 2VLRA 4F7CB 4D0DB 5C9JA 5I6XC 4MDJB 3C09B 5DHXB 2XPGA 4PR5A 2UYLA 2EH7L 2B5IB 2XZCL 4EN3B 3EYQD 1F3DH 2D9QB 4BH8A 3OKYA 1UXWB 2H32H 3VFSB 2FLBT 4HS8L 4PGZA 5BZDA 2IADA 1U8OA 2YWYA 4IMKC 5HJ3A 2ESVB 2PYEA 5D1QC 3WUWB 4BQBA 2PW2B 4BFIB 4XC1L 4LARL 1AXTL 3HPLB 1N26A 1CD9B 1INEL 3I50L 3ZYOA 1Q1JH 4PBVC 5ILTL 3ARUA 5DVOA 2NY3D 4HS6B 4D9QE 4NZDA 5HDLA 2DB8A 4KI5F 1I8LA 3EOBA 1RSFA 3KJ6L 4IIQB 5HYSA 5GPRA 2NY7L 2V7NA 4J7RA 5E4EB 4K07A 1H15A 2LV4A 4RZCA 4ERSL 2ZCKH 5GGUA 3EAKA 5C92A 3EFFB 4GG8A 1U8QA 1JF1B 4WWKC 5KTEH 2YC1B 1AIFA 3IGAB 2ZCKL 4N0UA 1ZVSA 2DMCA 1NPUA 4LVNB 3AS2A 1JFQH 5DJAB 4Q9QL 3UTOA 2ITDA 3S5LG 1AGDA 4IHOB 1NLDL 4FQPA 5GGRY 2F8OA 3O9WC 2DBLL 3L5WA 3CFIC 4YXKH 1V7MH 2DJ4A 4LSRH 1KJVA 3MV01 3PWPA 1BWWA 1F90L 1NC2A 3IDJB 3ULSB 3G9AB 3H6JA 3GUTA 1FRGL 3WKMH 5FO8B 4ENEC 1T0NA 5KVEL 1V3JA 4WTZG 1YQVH 3VXUB 1Q0XH 1A0QL 4ALAL 5IT2H 5HPOA 3LEVH 4KPHH 2B4CC 4HIJB 4LHUB 5C71A 4EVNB 5J3HD 3TJEL 1EJOL 2V2TB 1TIUA 2V9RA 2F53E 1NKOA 1JNLH 2DI7A 1E27B 4H25B 5M7QA 4Z8FL 1KIQB 3IETB 5I15H 2IG2H 1MFCH 4O9HH 1EZVY 5CWSA 2DQGH 4MDJA 1ND0A 4L4TD 1AHWB 1I7UA 4XNQA 1J12A 4AH2B 4LNRA 5CKGA 3B43A 3KPOB 4DTGL 3FQXB 4HDIA 3W2DL 3AU1A 5GGVY 2VLME 2JCCE 5EPMA 5C0BD 4TNVK 3U0WH 1GHFH 2NW3B 1KN2H 2WUBH 2P8MA 3EHBC 4KDWA 4RAUB 4U1KA 3GI8L 1VCAA 4HF5L 2EDBA 1XH3A 2JJSA 3HI6H 1QSZA 2EKSA 3NZHH 3V6ZB 2WBJC 5E24E 1MJ7H 1WVZA 3WNNA 3H42L 3CH8A 1X5AA 2ADIB 1XZ0B 2X2YA 1MJ7L 4C56A 4UINL 2MQ3A 3X14A 3CIQA 3BSZL 4BFIA 3IU4H 5DLML 5ESVB 4QRSB 4PB0H 1J18A 3QHFL 4XVTH 2C3XA 1ZLVH 3GK8L 1RULL 2CRIA 4Z7UB 2ESVA 2PYEB 3CVHH 3IFNH 3G6JA 1FPTH 5FYKE 2WIIB 4JRXB 1KLGA 4QCIA 4X6CA 5JDJA 1DLFH 4JDZA 4QRRA 4J3UA 1FPTL 4L3EE 1W8OA 2Q8BH 3SDDD 1S9KC 5I2IA 5GHWL 4MA3B 4S1SH 2CJUH 5IB4A 4RQQA 4FFVC 2X09A 1GGUA 3MRHA 1WWAX 3TYFA 1NDMA 3VGHA 4NN5C 5EO9A 2F5BL 4F58H 4M7LL 4WNQB 1MI5E 2P4AB 4LVHB 3OKKA 2OMNA 2ID5A 2BC4B 3SDXB 1WISA 3G5YA 3RX7A 1WC7A 5ISZD 4WW2B 1AD0B 3F62A 3ZSTA 2V2TA 1FL3A 1ZV5A 5BQ7A 3B6SA 5GGTH 3SE8L 1QSEA 4JPIA 4UT9H 2YN5A 3RWDA 3KYMA 4ZAKB 1SJHB 3MMEB 2W0LA 3VRIA 1MIML 3KLAB 2DRUA 1XR9A 5C0CD 3BP5A 2O5YL 1MQ8A 4U7KA 4NM8H 1L4IA 3QIUB 4TVPH 4JY6B 4MJIA 2X9XA 2X1PA 4NRXA 3L5HA 1MH5B 4JHZA 5E8EB 2DQCL 2QADC 5CEXA 1CLOH 1HNGA 1HHGB 4LPWA 1I7ZB 2C7UA 2MNUA 2PXYA 4L3CB 4ZPVA 5MP6L 1NFKA 4R26L 2OJZL 2ZUYA 3PWJA 5IB5B 1JNNL 1XR8A 3EDFA 4IDJH 3VFTB 5E8DH 4R26H 2ZG1A 1DBML 1IVLA 3ARZA 3QDGA 4MMZC 1F8TH 5T5FL 4MJIB 2YPVH 2OR8A 1OM3H 4V1DA 3TZVA 1DBMH 5I1HL 4KK9C 2V7NB 2DQTL 3CFBB 2CUHA 2MOVA 1BF8A 4X8XA 3ZE0F 4PGJA 5ILTH 3ZHLA 3B9DA 1CF8L 3MV7E 2I24N 1I9JH 2WINA 1MCQA 4LCIH 1DQJB 4HCRH 3L9RA 3S36L 3BDXA 2ADJA 4GS7C 3RL2B 5LKNA 1Q0YL 4TOYL 4WFHE 3CFEB 1EFQA 5DK2B 2ZSWA 1DQMH 4GLRH 1NCTA 3QULA 2IMMA 1U8PA 3LKOB 3HPJA 4JQXA 3D6GA 4NQCE 4MJ4A 2FX9L 2EDLA 2IBBA 1KEGH 1UZ8A 3WJLC 3RVWC 2FX9H 1FFPA 2FJHB 3CVIH 1KEMH 5GRXG 1TXKA 3X3FH 5D96C 4EUPH 4LIQE 4DVBA 4IM8A 4FQXC 5M95B 1KBGL 3HUJA 1LK2A 3ELAT 3P77B 1KEML 5HYJD 4YHNA 4F7MA 4G8GA 4HC1L 3RX8A 1RUAH 4J4PA 4KJWD 2HLFD 5A2FA 4HX1B 3RI5K 3MCKA 1Q0XL 5HHOE 2VDML 4YNYB 3V8CA 3F12B 3FQNB 3C5JB 1PY4A 5ESQB 4MB4A 3KDMA 3O8XC 2FO4B 4RMWA 4HWBA 3WJLA 1ES0B 5D1QB 3SJVA 1DLHB 5SWZB 3L7FB 3T77B 3KPLA 1B3JA 1V3LA 3KPSE 1KCUH 3FAWA 4ODXA 5IW3A 2DL9A 5FUOH 4NQVB 4WNQA 2P5WE 4P4RA 2DICA 5GS0H 4ACPA 3O6LL 4PP1D 5IBTL 3RVUC 1CYGA 3HR5A 3MROB 3U83A 2VLRB 2H8PA 2WUBL 2V2XB 5CUSL 3RDTB 3OXSA 4H0HB 1KB5A 1IEHA 1ZA3B 3RQ3A 4ZOAA 3WKNA 2X4RA 3DTXB 4L8SB 3UPRA 1BOGB 1DUZA 5TDPA 4QRSA 3NZHL 2PW1B 1CG9A 5DD6B 4YHZL 1OAXL 1NCDL 2B1AH 3SKNA 4F7TB 1ACZA 1IEAB 1YEEL 2Y07H 1QD0A 1C5BL 1CD1B 4MX7B 2D7TH 3MLXL 2FEDD 1XZ0A 3SCMC 3IU4L 3MFGB 1WBZB 4GW5A 5DLMH 5EIVA 3MR9B 5EU6D 1IC4H 5TDOB 2GUOA 1FLRH 2DOCA 4F9LA 2D31A 2PXYC 5JXEA 3MRLA 4HFWB 5IFHH 5ITBH 3VFPA 1F11A 4ZUUB 4F7PB 1A6ZA 4L8BA 2X1OA 5B21A 4PJXB 4LRIA 5IW6A 2BSTB 2A77L 1DE4B 5F9JB 1OWWA 2JCCB 2Q8BL 2EIZA 2AKRB 2XWBA 4Q2ZB 3FOLB 3UTTD 4JFYA 3ARGC 4OZHA 5CILH 2JB5H 4LEXH 4Y19A 4ZYKA 4RIRA 1VEPA 5C7XH 3HLAB 5ADPH 1MCDA 2J2ZA 2E9IA 1IRAY 4D0BB 5IHZB 2BY3A 1P4IL 4Z78A 5DHVA 4IOIA 2BDNH 3DXAD 4ZTPH 4X80L 5IEKA 4G6JL 4KMQA 1D6VL 3ILQD 1L0YA 1J1OL 1QACA 3BGAA 4KI5C 3M1BA 1MJJB 4PLKC 1JRHL 1EEQA 5CFHA 2P46B 2WLZA 4JG1H 3QPXL 5FO9B 3WE6A 3HB3C 1P4BH 1T7YA 1TTGA 1L0QA 5HY9A 1ZLSH 3VFVB 3VXSD 1DBJH 4HIJA 5B39B 3VG0L 1T04B 1J5OL 2FATH 3H9SD 1KYOJ 5IQ9B 3TFKC 1IGIH 4XAWH 4XMPL 5C0RH 3QO0A 4PRBA 3LN9A 5T1MB 4PJIE 5DDHA 4TUKH 4XAWL 3HNVH 4ZD3L 2AK4E 1AR1C 4GQPH 1JNNH 1KTRL 4C58B 3DHMA 4LMQE 3WEXB 4P3CL 3BZFA 4AQ1B 3BE1H 1BZ7A 4M3KB 4U1SA 1E28A 4YHMH 2J88H 4PJDA 1NGQL 1FYHB 2YPVL 3U36B 1I9IL 5I17A 5FGSA 2Q6WA 2ITCB 3BDYL 2DQTH 4WEBL 1RAMA 1SYVA 3RGVC 4DEPB 4CU7A 2WINB 5E03A 4WEBH 4LL9A 4HFUH 2YSSB 4HKBB 4XCEB 5SV3A 4QHMB 3VE0B 3LSOA 2ATPA 4PRHE 2P43B 2YD2A 1FG2B 2YKLH 5L2KE 4BQ8A 2VYRE 5JZ7D 1A3LH 3CDGA 5ID1B 1E4JA 5J3HC 1AC0A 1FLTX 3HZMB 4IIQA 5HYSB 2AK4D 3PDGA 2R15A 2OTUA 5I66A 3LKRB 1U8JB 4LLAA 3QDMD 4U6YA 1NGWB 4A6YB 2XKUA 1MLCB 2EE9A 3V0AC 3LSOB 3RBSA 3L3IB 1DQDL 4ORGA 4M7ZB 1U3HD 1NAMH 4J12A 3HR6A 3CMGA 4RIRB 5I30L 4O5LL 3ARBC 3D3VB 5HYSG 2A0LC 3VD3A 5JQHC 3OXRB 2LTQB 3S96A 3KYOB 5BZDB 5F70A 2ITDB 5J89A 3CVIL 1JUFA 4YHYC 5IMLA 5DURB 1Y0LB 5T3ZL 3F7YB 2HMIC 3EFDH 2R1WA 4XB8A 4XVUC 5F7KC 4YXHL 5SWZD 1YN6A 5IK3A 2D31B 1UJ3B 3NMEA 2HFEB 3SCMA 4JVWA 3MV7B 1RIUH 4K23H 3K8MA 3NTCH 3FQNA 4Y7MA 1SM3L 3WHXB 1LO3H 4TUJA 2ZUVA 2JE8A 1RIUL 1CR9H 1A1NB 2OCFD 2FLRT 3D5OF 1MFAL 1QZ1A 2VDQL 4DVRL 1MF2H 4RX4D 2IBZY 3LY6A 5JXAL 1CXFA 3IYLW 4MNHB 3S34H 2ERJC 4W6WB 4PJCF 2GTZA 3D2UA 4PS4H 5FO7A 1IGFH 4JFDE 2FNBA 3BJLA 1JPFA 4QRPB 2AXGA 4K8RL 4PS4L 4ZFFB 1ZA3A 1NL0H 3INUH 3O6LH 4IOIB 4U1LB 5HHVL 2J6EA 3L5WB 3DVFA 5FM5M 3GMOB 5F7MC 4HLJA 3PWPB 4IJ3C 5CLTA 2I26N 3REVB 1N0XH 5JLZB 3G6JB 1H3UA 3NA4A 2DLEA 4U6HB 3T0VA 1XGTA 1H3TA 4FFZL 1WICA 2M8XA 3ROOA 1S9XB 4L9LC 2VN4A 5FDWB 5IESL 4KDVA 1B90A 1OW0C 1AGCB 3RVVC 2IFGA 3QG6A 4ZO8A 1BQHB 1NCDH 2NNAB 5EUOB 1H0DA 2FGWL 5AZ2L 5A16B 1KPUB 5C2BH 3P9LA 2JTDA 3BPNC 3GM8A 4O4YL 1G6RH 4RZCB 5HGGS 1GIGL 5AZ2H 2P5ED 5KSAC 1IC4L 3SDCD 4AG4H 1S7SA 3CLEH 3B6SB 1DP0A 2W38A 5DWUL 4P3WA 5L8LB 1I3RB 4HUVA 2CH8A 1MOEA 2HVJA 1V05A 4MQ7B 5FKPA 1U8MA 4OCSH 5ESAB 3DX8B 5JW4M 2AK1H 2P42B 2J8UF 1MPAL 4TQEL 1AD9B 5FDYA 3EO1B 5IB4B 1OAZL 1WV7T 2JELH 1HI6B 1IE5A 2P5EE 1EZVX 3I85A 5FV2A 1HDMB 3I9GL 5ESAA 4U1MA 3O2WH 1CD8A 1QSEE 4ZDHA 3VXSB 4R0LC 2HRLA 3HG1E 5EWIL 2ZNXA 3UBXA 5D1ZD 4F57L 1T66D 2JIXB 3UJIH 3QUXC 4AEFA 2VZOA 5HI3C 4E41A 3LEXB 1JI1A 1RJYA 3O3UN 1T0NB 3KVQA 3OAUH 4GW1A 1V7NL 3QP3A 3QPXH 2E7BA 3GUTB 4ELKB 3C5ZA 3ZKSD 4J4PC 1P4BL 1XF3A 4XH2A 1ZLSL 2XY2A 1AFVH 2ZJSH 5FO9A 4EOWL 1OGAB 3MNZA 4ZS7H 5DMKB 5LGKA 5ENWA 3L3GA 4PJHB 3SEPA 3U4EB 3SDYH 1TENA 1H9VA 2G5RA 5GGVL 3P0YH 1XGPB 1DBBH 3QUKB 4JANA 5EU6A 3Q1SL 1EO5A 2QKIB 4BH7A 2VLKD 4JKPH 4FQLL 1Q72H 5IB5A 4KJPC 4RWYL 4HWNA 3BE1L 5CJBA 3D85B 4P2RB 3Q6FB 1F4HA 2BNQA 4CADA 4P5TB 3B8SA 1QFPA 2R9HD 4JHWH 5LGJB 3QDJA 5DJXA 5FHAH 1TZGH 5CJQH 5DO2D 3VXMD 1UZ8B 1YMMD 1F5WA 3MRJA 5FYKH 5JUEH 4XPBL 3FB7A 3BIAX 3KYKL 2X89A 4EDXA 4U6YB 1FZOB 5DJDB 2IH1B 1GH7A 3VMOA 5C09D 1FG2A 2AAVA 1XR9B 2FIRT 2NX5B 4WI3A 4Q0XL 4JPVH 3BPOB 2A6JB 1WWCA 2FWOA 5HVGB 2BNUB 3EDKA 2KDGA 2V2WB 3N06B 3CLFH 1CD1A 3MACL 1G7HB 5DURD 2AEPL 2QEJA 3ZE2E 3FZUD 2AQ2A 4RGNC 4GKSA 1S7RA 4N68A 1O7VA 4JB9H 3IXAB 4Z0XA 5T1KD 3ZTJH 5KVGL 4MA3A 1WJ3A 4RWHA 1U58B 3V0VB 5EORL 2DF3A 1GJIA 3FQRB 4H26A 3MLWL 2NXYB 4LKXB 4Y4KC 3ISWA 4N0YH 2W9EL 1BJ8A 4JFPA 1RI8A 1Y0LA 4HS3B 3MLZL 3L1OH 1PKQE 2C4XA 3AREB 4XBGA 5SX5H 3LRSA 3HNSL 4HZLA 1PJ9A 4POZC 2ZG3A 4GXUN 2VLMD 1J0HA 1PLGL 4GAJL 3FO9B 1Q9OB 2A83A 4EN3D 3DMMA 5MEOA 2VDQH 4WHTB 1MF2L 3MRQA 1FVEA 5C8JB 3MRMB 3OKMB 4JN2A 4GAJH 2IJ0C 4MD0B 5DMYA 4OM1L 5C6PB 1SYSA 2ESVD 3S34L 3JSSA 1J87A 5CMAB 2WBWB 3QXDA 4M48L 1HHKB 2EYTA 3VWKB 3DI3B 4MHHI 4WFHD 3JWDH 2GTWA 3HPLA 2W9DL 4R4FL 3MA7B 5IJVA 4CADB 1TJIL 3VFRA 3BHBA 1U8OB 5HJ3B 4LCUA 3LPGA 4JGMA 4X83A 4WO4D 1KC5L 4DQOL 4OFDA 2YD4A 1MCHA 2Y72A 5BRZB 4TNWF 3H7LA 5F6HJ 2HMID 3ZMRA 4OZIB 1GVIA 1YY8A 1Q9KA 3ALWA 3U46B 4JY4A 1I3GL 3ESUF 3RX5A 3GGWA 4Z7WF 2X1XR 5JOFA 4HC1A 2EXYD 3DI2B 5I1CL 5BVPL 2DWDB 1IMHC 3EOTL 1S9WA 2FD6L 2NY5L 3T0EB 3O2DH 1F58H 1AP2B 3LV3B 3QIBB 4WFFE 1WLHA 1E4KC 1QFHA 2FD6H 3PDOB 4LVOB 4HAFA 2E7MA 1LP9A 5DEFB 1EMTL 2OTUB 1OARL 2NXZD 5ICXB 4FQ1L 4X99A 3U7WH 3O6FB 4MX7A 4BK5A 3CFEA 3H3BC 1TVBB 1OARH 5EBMA 4U1IA 1P7KA 4XPTH 3MBXH 3MO1B 1FC1A 3M1BB 5DC0A 1NC4D 4QRPE 5DEGA 1EFXD 2ED8A 1MNUH 3I2CH 4K7PX 5GRZA 4JE4B 5DMIH 1JPSL 1QO3A 2VR4A 5DEZA 2GCYA 3P4NA 2L7UA 3E8UH 1TTFA 2CDEA 4AEIH 3DRTA 5EU7C 5KVDH 4LRNH 3IF1A 4V1DD 3EO9H 5FGBA 5IVXF 5T1MA 3TZVD 2CKBB 3WLBB 4XNYH 5ACZA 4OCLC 3T8XA 3DGGB 4BSVB 4Y19E 4A2LA 2BOBB 4LLVA 4XXDB 4K7PL 5ACMA 4XNYL 5IHUH 3AXLA 4M6MH 2P48B 1IL1B 4NT6B 4POUB 2BNQD 3MXVL 1NGYB 2WP3T 3BUYA 1MJJA 3VI3F 3TLRA 4Z7WE 5TDOA 4G6KL 5FYJE 3LB6C 4FQIL 5BMFH 1FNEA 4NHCH 3IDMB 3MXVH 1L7TH 3TVMC 5F9WB 4ZMAT 5KBNC 4MNQE 1PX3A 4XH2B 4KAQL 3BKYL 3O3DA 3VDBA 4UT6H 2OR9L 4KU1A 2CRYA 4ODVL 4G8IA 5FYJL 2VXSL 4HWEL 3PABA 1RUQL 2V7HA 5F7EH 3REWA 4RISH 4DZBA 2B4CL 4KRLB 5T3XD 3P0YL 3LQAL 1DBBL 4XNUL 2CXKA 4HJGB 5MEQA 2O26U 3EO0B 5AZEL 5BJTB 1CL7L 5D7IF 4ZUVB 1INQA 4ZSOA 4U1SB 2Y23A 5J1AB 1DQQB 1T4KB 4NKIH 3NA9L 3BPCA 1SHMA 1QP1A 1RUMH 4DJMA 3PG2A 4X9FA 1LE5A 2R56H 2VDKL 1F00I 2WWMC 4L8DB 2NZ9D 4EKXA 1HKLH 1QSED 5HHNB 1T22B 4JRXD 1N0LA 1T2JA 2VDKH 2D3VA 2OTPA 1HWHB 2AXFB 3JV5A 4G8EB 1HKLL 5ECJE 4GRWE 3C6SB 5GS1C 1KCRL 2Z31D 1UA6L 2NR6D 4JPVL 4G6MH 1KGCE 5INCB 2BNUA 1CXLA 2V9QA 5IQ9A 1I8KA 3G6JF 3KPSA 1AQDA 5CZVH 5DD5H 1G0XA 1YZZA 1NGXB 3RWCB 5CBAB 4BK4A 5DD6A 3MRPA 5FYLE 2HKHH 3IFPA 1C1EL 4MMXC 4ZFGL 2B2XL 4YDLC 1QBAA 2YPKB 2ORBH 3O4LA 4O00A 4F7MB 4G80A 5BZWA 5GIRA 5F1OB 5KSAA 1JZ7A 1P4LA 3VFWB 3VMPA 3EO1A 4G9FE 5DK3A 3KYOA 3U1SH 3X3GL 1S7QA 5D2NE 2OS7A 3ARXA 3ARBD 5EULV 4LSPL 1SEBA 2YEZA 1FL5A 3ZKQD 1JYXA 1CFTA 5INDA 4WO4A 1U8QB 2VL5B 3WIFB 5KSBA 3FOLA 4EBQH 3SE9H 4YUEH 4G80B 3T4AA 3U0PB 1SJHA 4XNXL 4I0PC 1FO0H 2AJUH 2BHZA 4KROB 4X7DC 2NX5E 1ITCA 3L5XL 2R2HB 1AY1H 3ARGA 5CJ5A 2VXVL 1T1ZB 3V2AR 4QGTA 3RIAK 5TJWK 1UB5B 1JGEA 4ELKA 1KCSL 5EU4B 1UCBH 2IPTH 4OM1H 4TTGA 4XP1H 5DVMA 5I1KH 1SMOA 4FP8H 3HN3A 1UCBL 3CSPA 1BPVA 1MFDH 1KIPA 1C8PA 1E6JH 2F8XC 4IMLB 4R4FH 4JM4L 3VXUA 4IBLT 1LNUA 3E3QC 3QRGL 3RAJH 2GJ6B 3LQAC 4LCWD 4AZ8A 2G2RB 1A3RH 5IROA 4P9MH 4TSAL 4DQOH 2X40A 2O61A 3HC3L 1UQSA 5AG9A 1YEFH 3DECA 3HE6D 3U9UB 3ZE1E 3H3PL 4PG9B 4CVXB 5IMOB 5DK2A 2MCG1 2DD8L 5B39G 5BJTA 4GKZB 3WFCL 5IB1B 3TBVB 2WBJA 4FXLA 2DD8H 3IDNB 2JJSC 1EMTH 4FQ1H 3JWOL 1OVZA 5AEAA 4WFED 5I6XB 3MYJA 3TBWB 5HVWA 3QQ3A 4URTB 3MQIA 2ZUQC 1HSBB 2APBA 1KIUA 3FONA 4HIXH 2NX5A 4U1KB 2F58L 3FFCE 5IFJA 3NABL 1T7WA 4YDIL 3ULUF 5I1EL 4GT7A 4YDVA 3MZTA 1FVCA 2AJXH 1B4JL 4WFGD 3BGMA 4PD4K 4QO1A 3A6OA 2VSDA 3ZYJA 1HINH 4JJ5A 4M1GL 3VH8G 1R5IA 3MJ9L 5IEHA 3DGCR 5EO9B 4P59H 3DV6A 2KL6A 1IZJA 4G8GB 4KK9D 3U4AA 3SDXA 4XPHH 5D1QD 1P84J 3FCTB 4ODWB 1CLYH 1P9MA 4G8FB 5GRVL 1JYWA 1KELL 1BGXH 4Q9RL 4XPHL 1QBMH 3RTQC 4RMQA 4XCNB 1MCIA 1W0WA 2Q3ZA 3VFUA 5FGRA 2FECL 3MJ7B 3F65A 2VWEE 2HTLC 1YNLH 1P4LB 1ZOXA 1QBML 2H32B 4UBDC 3UZQA 4Y5YC 3TPKA 2CRMA 1G0YR 2WIMA 3CGTA 3D39E 2Z8VC 3DBXB 3ULVL 3QISA 4OBRA 3TWCL 3WUWG 2FJFA 4FQIH 3PIQA 4HJGA 5T1LA 4UQ2B 2DMBA 4PFEA 1OAKH 4JM2B 5D7IB 3RDTD 4Z76B 4UV7L 3CX5K 1MCKA 3I3EA 1E6OH 1JN6B 5DGRA 3QIBC 4Y5VC 4FXKA 4XPGL 3V4UL 2Z8RA 4JEGB 4OCNC 3LQAH 4XNUH 1T1ZA 2NTFB 5K9KA 1Q9WB 3K3QA 4JY5L 3MYZA 2JJTC 4G3YL 1J05B 3FFDA 3RVUD 2GY7B 4OQTL 4CN4A 2R2HA 4QRRE 4MDIA 4P46B 4X7TA 3IU3A 5D5MB 3SGJC 2QR0B 1FO0B 3FB8B 1INEH 4K3DH 2YXMA 2ARJB 3HZVA 1JF6A 1BVKA 3CK0H 1J8KA 3BJ91 4P23C 3JV6A 3RWEA 1FNGA 5C0AB 3QH3A 4M1DL 1LP9F 4PRDB 5BO1H 4JKMA 2GKIA 4PJHF 1MHPH 5DUBA 3O8XD 4TTDC 3RVXD 1KENL 2AABH 4MNQB 3KYNB 5HGBB 4R3SB 3PP4H 4XCFL 4N8VG 1CL7I 2AQ3A 1Q94B 3BRFA 3HC4H 2XXCB 1AQKL 1DVFB 4JQVA 4XCYB 3VFMA 1AJ7L 1U2CA 4ZFGH 3OAZK 4JFDA 3CFJA 1MCJA 3W0WE 3MO1A 4X6BA 1FFOB 4QYOB 4DVBB 3GZKA 1EUUA 4M93B 3K1KC 3ZKMC 1MCSA 3GSQA 3TN0A 2DYPA 1JZ5A 2VZVA 3QJHA 1BAFH 1T89C 1U0QA 5KOVC 1KJ2A 5KW9L 5DJ0B 1UZ6E 1R24B 1BAFL 3FQRA 3MV9B 4N5UA 3J8F7 1Q1JL 4OLEA 1HZHH 3TT3L 2FX7H 1JZ2A 3DROB 4ZXBB 2Z9TA 3GSQB 3AC0A 3T4YA 4KPHL 4BELD 2F53A 5A3ID 1E4XL 2X4SB 5DDHB 3GSUB 2NTSP 3AY4A 1G9EA 5HVHC 4N0UE 4YIQA 2W59A 2FH8A 2OXHA 5B39A 5E6IB 1RUKL 5K59E 3W81A 1JHTA 5F44A 4UNUA 3O45B 4F8QA 4HIIA 2Y5EA 4OLWH 4YQXH 3CX2A 5EU7E 4MA7H 1KG0A 1NCWH 4W6XB 1LDPH 3ARFD 3GSNA 4RBPK 2A9NL 4J3TA 4YQXL 5LAXA 1QLFA 1PDKA 3V6OC 1UYWL 2W07A 3NIDF 2YUWA 1PYWB 4Y2DD 3B9KB 4KKCD 4NPYB 1JF5A 5KSVB 4LSRL 2YA1A 2HJKA 1J7VR 4LCYB 4PRAB 5DJCA 1KJ3H 4IRSD 3HC3H 5SWQA 3OF6A 5LCVH 1JF1A 1WAAF 3K4DA 1TZIB 2EDEA 1V8HA 2A6DA 1ZKAA 1RZGA 2D4DA 5LCVL 4Z95H 3OAZH 3B9KA 4NPYA 2E3VA 2NTFA 5K9KB 5IKCB 3NH7H 1U8JA 2IG2L 3RWCA 5KZCD 3KPSB 2CK0H 2BNRA 3BKCH 4RCAA 5CEZD 1RULH 2GK0B 4WI6A 3FQTB 2GSGA 1JV5A 4J1UA 3X13B 4Z7OE 4N8VA 4TRPH 4I0PB 1IEBB 1VERA 4OGZA 2CXGA 4KQ4H 2EDOA 1PKQA 3C2AH 5C6WH 4L8SA 4M1GH 4ZNCD 4GRMA 3WO3B 3WFZA 1II4E 4RMVA 1G84A 3MV8D 4Y0GA 1DN2A 5D96B 5IV2B 4WUUD 5TE7L 2E9BA 4DWHA 4NGHL 4GS7B 2ZP0T 1AGEB 4MXWH 3T0AA 1A7RH 4NDMA 4RFEB 1HYSC 1AKJA 3DSFH 4YPGA 5DJ6B 5B38A 1IAIM 2E5EA 4JFHD 3RU8H 1T21B 3MXWH 4X6EB 2BVTA 2Y9RT 4YHKH 2E6QA 4XRCB 3DO7A 3QUYC 2B5IC 1MCCA 3FN3A 5C0JA 3O6KL 2QKIA 5F9AC 4BH7B 3BEWA 3PGCB 1ORQA 2D4FA 5AYUH 1N59B 2WBJD 4MWFB 2X4QA 3KPMB 3JVGA 4MSWB 3HC0A 4DZ8B 4LHQB 4Z7VA 2CGRL 3UC0H 3GSVA 1GGIL 4JZOA 3FJTA 1E6OL 1VGEL 1ZT1A 3FT2A 4GBXD 3MRMA 4WUUE 3SDCC 5IEKB 1HWGB 1RVFH 2OJZH 5ICYA 2EIDA 2BVPB 1TVHB 5IR1A 4NQCD 4NO3B 4M7LT 2VKWA 3MNVA 1RVFL 1RJYB 3DV4B 3QQ9C 1FNGB 5C0AA 1S9XA 3UTPE 4HG4J 3I50H 5DFTA 4K9EC 1R3HA 3ZT7A 4CVXA 2NY6C 3M17A 3O8XB 3BESR 4X98A 3S6CA 1JTPA 3QXWA 5HI5D 2UYLB 2QR0A 3OG6B 3QFJA 4MNQD 4PG9A 4W6YB 3UJJL 3LRHA 1MFBH 4WWKB 2W0FA 1YPZE 3VXPB 1REIA 1ZHKA 3UJJH 2YPLB 1FE8L 3QIWC 4K94L 1Q0YH 2G60H 1X5ZA 4TOYH 3GMNA 3QA3A 2ZSWB 3HCVB 4TVPL 5B4MD 1DQML 4XCFH 4Y19D 1RIVL 2ZOKB 1QSVA 4BJLA 2BY2A 4PV8B 2UWEE 2Z35B 5CIPB 3VWJA 3VW3L 4J4PD 4G9DA 1F2XK 2CDGB 3G08B 1BJ1H 5DJYA 4PJGA 4N8CH 1BF2A 2JIXD 4YGAB 4LPUA 4LFHG 4OF0A 1YN6B 4R8WL 3HHRB 4OKDA 1HI6A 1FVDB 4OTXH 5D5ME 7FABH 2L0DA 4HIEB 1UXSB 1CVSC 4HC1H 3ZDYE 1X6LA 4QCIB 1HZHL 3TT3H 4LRIC 4ODBD 5FOJA 5MENA 3R8BB 2Q8AL 2YEZB 1U3ZA 3IF1B 1HEZA 3WLBA 3ARPA 3D0LB 1TNMA 4GRWF 4LCIL 4W4OA 4PRHB 3QQ4B 2GCYB 5E8OB 2C7UB 1MFCL 4O9HL 1P53A 4E5XB 5HYJE 3QUMB 2BVQA 3HAEH 3T0DA 3OF6D 4M9OA 4AY0A 4UIKH