4LSUL

Crystal structure of broadly and potently neutralizing antibody vrc-pg20 in complex with hiv-1 clade a/e 93th057 gp120
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
203
structure length
203
Chain Sequence
SALTQPPSVSGSPGQSITLSCTGASTSVAWYQQYADKAPRLIVFDGNKRPSDISSRFSGSQSGGTASLTISGLQSEDEAYYHCNAFEFFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 CLADE A/E STRAIN 93TH057 GP120
publication title Multidonor Analysis Reveals Structural Elements, Genetic Determinants, and Maturation Pathway for HIV-1 Neutralization by VRC01-Class Antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 43
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lsuL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lsuL02
2R8SH 5INCA 5FGBC 4JO2H 2XKNA 3QDMD 4FQXB 1HHJA 1QFWI 1KTDA 1RVFH 1YEHL 3DSNA 1C16A 4JE4B 4YHZH 3H9SA 4EN3D 3UPRB 2AV1A 2EE9A 3QCVL 4BUGA 1QLFB 5D2NB 3UJIL 4Q9BA 4WV1C 4HGWA 1J88A 4PBVC 1EX0A 1YMMD 3GI8L 2AI0H 4DW2H 1OLLA 3ARRA 1HZHL 2P8PB 3K46A 5EU5B 5C09D 1ZLWK 2J4WL 1N7MH 2BRRL 5I16B 2F5BL 3TO2B 2C26A 1T7WA 3BFOA 4X4XA 4NQEE 3L5IA 1RZFH 4YC2C 4ZS7H 4QRPA 1DFBH 2Z92B 3QAZC 1AO7B 5DJ2A 3RVWC 3BZ4A 2ZUTA 4X0KA 3IDJA 1REIA 1QRNA 4X99B 3UZQA 1MIML 3C08L 4O2EB 5D1QB 5T3XD 4X4MA 1NAML 4D0DA 4CAGA 5CD5C 3GO1L 1FZKB 1A47A 3IJSA 4K7PY 4PLJC 4M6NH 4L3ED 3CXDL 5KANG 4XVTL 5GISH 3U82B 5TH2B 3ORJA 3F58L 4H88H 5IFHL 1DP0A 3Q6FB 3JTSA 4DGYL 3QPQD 3GMNB 4Q2ZB 5FXCH 3ZYOA 1ADQH 2VABA 1WIUA 2QSQA 4QRQB 3MNWB 1G7PA 4EN3C 4AEIH 2D7PA 5SX5H 2GSGB 2EEBA 1RIVL 3KR3L 4I9WE 5DJ6A 4NZDA 2MMXA 2PXYD 9CGTA 4Y2OA 3QG6B 3SKOB 3VGFA 2IPUK 2OQJB 3BP5A 3FN0H 3LKRB 2OJZH 4D94A 2FECL 3ZL4H 3TBTA 4JPWL 1I3GL 1N2RA 4CMHB 1WWBX 3L3IA 2UZIL 5HVHC 3CH1B 3U0TB 5EO0B 5I1EL 3L3OA 3MUY1 4JJ5B 3VFSA 1ZS8B 3RDTC 4K23L 4PJEB 2P43B 4NWUL 1LP9B 3NFPB 32C2B 4F8TA 4DGVL 3MUZ1 3OSKA 1CF8L 2G5BA 5DLML 2APFA 3DV6B 1KFAH 1NL0H 3DXAB 1KCKA 3ZSTA 1H0DB 2V2TA 1VFUA 4NO2A 1U93B 2AXJA 3WIIH 4AH2B 2DM4A 4WFEE 3QPQC 1W0WB 2Q3AA 5ID0B 1YQ2A 3LKOA 2FJGA 3GRWH 4LP4A 1YY9D 5LQBH 1LK3L 1WISA 2IF7A 1G7MB 5JQHC 3KPQB 1S5HB 2PXYC 1P1ZA 4MAYB 2LABA 4ZUSA 3HR5B 2M2DA 5C6PB 2CIIA 4ODWA 4UDTB 2EDJA 4WY7H 2WBJC 4AEHH 2AS5M 1JHKL 5BRZA 5JXED 1KLUA 5EZOL 2DD8L 5DJZA 2Q7YB 5JDJA 4KK9D 3RL2B 2F54E 4LSVH 3PWUB 3FB6A 3BGFB 4R3SA 5CEZL 3QNXA 4EI5C 2ARJA 2BP3A 4GRWE 4WW2F 4LDLB 1U8HA 1QA9B 2I27N 1WTGT 2CK0L 2YA1A 1UM5L 2VDOH 3EBAA 4KHXH 1XF4A 1KCSL 3GMRA 4F33A 2P5WE 1R3JB 3KLHD 3SDDA 1ED3B 3VXME 3NTCH 3QDAA 1KEMH 5HDQH 4NRZB 3WFEH 3PWVB 1IRAY 4M43H 1KG0A 5JZ7C 2Y4SA 3ZDXF 4TQEL 1ORSA 3ULVL 2FEDC 2Z35B 1U3HA 3C9NB 5TDNB 4ERSL 4AEFA 5DK0A 1UH4A 3MJ8B 3BSZH 1T20A 3NOIA 1Z6JT 2Z4QB 4U0RB 5D7LA 4JEGB 2B20A 4OI9A 1FG2A 1KTLB 3IDGA 1GAFH 2XNAA 3OKDB 2IANE 4UTAH 1I7ZA 5DMJB 2RR3A 1V8HA 1D5ZA 4LRIA 5B39B 2VISB 2SEBA 1FORH 1NDGA 4NP4L 5CD3A 1FFNA 1LO5B 3ARGB 4KK9C 5DA4A 5JW4Q 3S96A 2BSRB 3MACH 5I9QB 5I17A 1ITBB 1QQDB 1CDJA 2WUCH 3GMOB 3UJTH 2DOCA 2VE6B 3GSWA 3P4MB 1WFTA 5LVEA 3HC3H 4AT6A 4LVOB 2A74B 3EKCA 4LSSL 3KLHC 3P0VL 2GSIA 5HDLA 4EBQH 5I1GL 5F6IC 5ALBH 3OB0H 3WXVL 2DM2A 4XNXH 5KSAD 3T0ED 1A1NA 1R3IH 1UZ6F 1AD9A 2AABL 2W9EH 2HLAB 4QXUL 2XXCB 5C0BA 5LGHH 2J8HA 1H3WM 4JFQA 3IS1X 1V3LA 1WJ3A 4JVWA 4P2CG 4OM1L 3PGDA 1U92B 1B4JH 5KG9A 2ZOKA 2UY6A 4HZLA 1U2HA 5HYQA 5DDHB 1INEH 2D0GA 4OIIH 4J1UB 2X89D 2WWKO 3PQYE 3O45A 2HRPL 1GOFA 4UIMA 1QZ1A 4XP9L 1EEZB 4OGXL 4P59L 1B88A 4YWGL 1MY7A 3GBNH 3FB8A 3VWKD 3ZDYF 4Z0XA 1I7RB 4D3CL 2R1WA 3O41B 3ELAT 4F37F 4MQSB 2V6HA 3U83A 4UNUA 3P4OA 3RJQB 3RVVD 5C7XH 5IESL 5F9DC 1MWAL 4OFVA 4NQDD 4X6EB 5F7EH 3PWPB 4GW4B 5FO8A 4FP8H 3MRLB 5E2UH 5CINH 3I6LE 5FHBH 4XPBL 2IGFH 1TZHB 3HI1B 4AIZA 2BNRD 1QFWM 4BKLB 3WDJA 4F7PA 1DBJL 4YHKL 3UTPE 1ZA3B 2H26A 2ITDA 5E8EB 5CZXC 3EDEA 3TNNA 1OARL 3CLFL 3T2QA 2H32A 3RDTA 2IC2A 1FL5A 5FA3A 1EERB 4KI5E 5I66A 4BFEA 3F7QA 1KPVB 2EYTA 5JHDB 4PJEF 3VMNA 2LVEA 1LP9F 3V0VB 1FFQA 3QNYA 1RZJC 5JPMB 4I77L 1IEAA 5DGQA 1T89A 1O7VA 5DRZB 3WL9A 3V0WL 3RVVC 1P2CA 1JGUH 1SJEB 2GFBB 1HHGA 3KJ6H 4WFHD 4HV8B 4MD5A 4D9QE 4NWTH 4XRCA 4Y5YB 4N5ED 5D70H 2A6DB 1KUMA 3MRGA 3JWDL 4GKZB 5SWZA 3P9MA 3V79C 4NN5B 5I74C 1BQLL 1HWHB 1W8OA 2Y6SD 1WFOA 1MF2L 1ZT4B 3X3GL 1LO2L 4OLVL 3L7EB 1CL7L 4JZJA 5DRWB 3D1MC 4U1IB 4Y4KC 4G6ML 3K3QA 3JXAA 3P0YL 5EOQH 5T3XH 3OKMA 3QJFB 4U1MA 3UXFA 4N0CD 4D0BA 5I2IB 2EDNA 4RFEB 2ZSVA 2A6JA 4EI5A 4EOWH 1I7TB 4OD3L 4R97C 2J2ZA 5GRVK 5BQ7A 3RWIB 1AD0A 2VTFA 3FQRB 2XZCL 3BKJH 3E3QC 3GSRA 4OCXH 3C5JB 4UQ3B 4MYWB 4MB4A 3IDYB 3EYUL 4GG8B 1YJDC 3MRBA 5CIPH 4O9HH 4M62H 1N26A 3BDXA 4PJ7B 4X9IA 3HCVA 5T1LD 1R5WB 4NNXA 1IGML 2R56L 1G7HA 1KIRB 3IAPA 3C5ZD 4JFOA 4FTVD 3QDHA 2HP4A 4G6FB 4QCIA 3WNLA 3KGRA 1J8KA 5GSVA 3VWJA 3W0WE 5DD0L 4KZDH 4MWFA 3BAEH 4XC3H 3MV11 4L9DA 3J8F7 2QADB 1EO8H 3BP7A 4GW5A 2YA2A 4HWZA 4AENB 4Y4HD 5DO2D 2EDQA 1CCZA 5DHVH 1MJUH 3DX6A 4YGVA 2WWKT 4L8SB 5F7WC 1KJ2A 5FYLL 5DMKB 3DROA 2YD6A 3X13A 3L3JB 3OAZK 1SMOA 3CSBA 3AS1A 1AGFB 1QFUL 3K4DA 3NCBB 4GRLD 4OZFH 4YHLL 5A2IH 1WITA 2XY1A 3H3PL 4X7SH 3AC0A 5IB5A 3ME0A 4HF5H 2ITCA 2W0FB 4XBEH 1S7TA 1PKOA 4K9EC 4UT6H 3BH8B 3LHPH 3F7YB 5E08H 2XQBL 4LHUD 1H3UA 2QKIB 1Z5LA 3QI9A 2BNUB 4XTRD 3IYLW 3AM8A 2Z91B 3VRJA 3C5ZC 1BD2E 3KVQA 4HKZB 5FO9B 4L5FL 5I1JH 5DJYA 5DD6A 2EE2A 1NKOA 3OJDA 1QKZL 5FUZL 2YD8A 1FZMB 5LWYH 1FVCB 1H3GA 3EJYC 1HDMB 1P7KA 4FQIH 5I75B 4E41A 3RTQC 3KPRE 2HT2D 1AKJA 2N4IA 1JUFB 2HTLC 4Y19E 3MRFB 6CGTA 1H5BB 4ZUVA 1BJ8A 2NW3B 4FFZH 1JE6A 3BN9D 3MR9A 5EOCJ 1U3YA 3RWEB 5KJRL 5GSRA 4J3SA 2E7MA 5KW9L 4K7PL 1MAKA 4GRLC 3ESUF 5KVDH 1TXKA 3U79A 5IBUG 2C1OB 3WN5C 1F2XK 4QRRA 1QLEL 2JJUA 5FB8B 4MQXD 1RU9H 3EDKA 5ENWB 3DMMD 3TWCL 5IW1B 3ARVA 3STZB 5F97E 4D0CB 1NMAH 2VQUA 2WLYA 1LEKB 1MFBH 1P7HL 1ITCA 1JGDA 1AQDB 3JV0A 1J1XH 3WHE0 4CGTA 1JPFA 1QPXA 4DUVA 2D0FA 4KV5F 3LKSA 3FCTA 1GSMA 1DLHA 2K7QA 2YHGA 4XI5C 4DJMA 3DOSA 3HN3A 1YNLH 3CFKB 2PN5A 4FN0A 2DJSA 5DJ0B 4MXVE 1TNNA 3LZFL 4P5TD 3UTOA 4PGEB 5CBAA 4LVNB 2ZCLL 3QIUC 4PJXA 3BN9C 5KS9A 1CR9L 2NR6C 4IRSC 1UGNA 4XMKL 1I8MA 4HCRH 4JFEB 1A21A 1C1EL 2EICA 3MLVH 4GMSH 4QRTA 2LVCA 3FQWA 2AJVH 1XFPA 4TYUA 1TNMA 3O81A 3GUTB 4P2OB 3QJHB 1NCNA 2E6PA 5D72H 1BX2B 1NMCB 4XP5H 2BOCA 4DKEH 2XWBA 1X5AA 4S1DD 3WDIA 3ZTNL 3QRFM 2VRAA 4JQIH 4Y4KA 5DC4B 1I3UA 5J0BA 4Y8AA 4H1LA 5E2VH 1YC8A 3JWNC 3EDJA 1CXLA 3MUGA 5CZVH 3TBSA 1I85C 5F3BA 1DBAL 1ZEAL 5CJOL 3H42L 2DL2A 3NGBC 1JZ7A 1U91A 1D5MA 3O3BA 2EDDA 3MLYL 4JPIB 3FMGH 3MA9L 5C08A 5DJCB 1G7LA 5DS8A 4KVNH 4PIRF 4P2QB 3OKNA 4KKBC 2VXVL 1RJLB 3PP3H 4XB8A 2P48B 3VH8G 4U1SB 1MFCH 3ROLA 4XPFH 3KPTA 4D8PB 1IL1B 1I9IL 3QNZA 4RRPA 4R2GD 3U46B 4UT7L 1QNZH 3HAEH 3QDJB 3NN8A 5I15H 4WNQA 3M45A 1NC4D 5K9JL 1DTUA 1GOGA 4X6CB 3DV4A 4PJ7F 1QBML 2GITB 1JPGA 3AXLA 1E28A 1VGEH 4JM2D 1PY9A 3SQOH 3O6FD 2HA1A 3QWOB 2NY5H 1N64L 4P5MB 4YHOH 3CFJA 3RY5A 3HE7D 1INQA 1HINH 5SV4A 4OGAC 5F1NA 1CFBA 4C56A 1KB5B 5J7CC 5GGRA 2FJFA 1JI2A 5JOPE 3V5DB 1YMME 5CHNB 4MJID 5D5MB 3T2OA 3ET9F 5E6IB 3SKUD 1WC7B 1NMBH 5HI5D 3WHXB 4YQXL 5C09E 3HE6B 3KS0J 3VI4F 4XBGA 5D7JA 3EO1B 1CYGA 2GTZA 1RIHH 4KROD 3GK8L 4Y16C 5IM7A 2JLLA 5GQBA 3RNKB 2VZTA 1CFVH 1VB9A 4OZFG 1MRCH 1DE4A 3X12A 3VFTB 4ONHA 2CLZA 3L1OL 3N1FC 3DVGA 1CDIA 1K6QL 4K8RL 4NQCB 4NUJA 5EO9B 3UYOD 3T0WA 5KSUB 3GI9H 3HNSH 4X7DC 2OR7A 3QEQD 1PQZB 1FO0B 5H8DA 5C0GB 1AXTH 1IAOA 4FQ1H 3FO1B 2R9HD 1K2DB 4UIKH 1FNSH 3CMOH 4ISVA 2VZUA 3MRQA 4CU8A 2WZPD 5JTWA 3PWJB 2M26A 2MFNA 1EA9C 2OXHA 4PJIA 1MH5A 3TNMB 4KDWA 3RTQA 1QEWA 4ZFZB 4NHCH 3NIDF 4IDJH 5HD8D 1N6QL 3VFVA 4IOFC 3GSQB 3CDGA 4NSKA 3NZ8A 4WU5B 5IB1A 1J0HA 3T4YA 4JFFD 4HUNB 5IB3B 4RAHA 5SWQA 4KROC 5EIIA 1VDGA 4NQEB 4ORZC 2AKRB 4JFZL 2DB8A 1WFNA 3HC0A 4NCC2 4LHQB 3HNVL 1T0MA 4X5WB 1C08A 4PRID 1G7IB 5JNYA 5L7XH 4LQ1A 3G5XB 3T65A 4PJCB 3LRSB 3RPKA 3SDCD 4JCMA 1ZSDB 5KVGH 2R9HC 5DEZA 1WAAF 2RGSA 4DKAA 2MKWA 2BVPB 3G5ZA 2HJKA 2D03H 2B5IB 3WUWB 3PL6A 3EYVB 4P46D 1NEZB 2NXZB 4JKLA 4R7DA 5ESQB 2DQDH 5HD8C 1YEIL 4W6YB 4B7LA 4JGJA 3MJ7A 1W0VB 4EVNA 2XRAH 5E8PA 4LLVA 1ZT1A 3PABA 5E94A 4QXTB 3RX7A 3V52H 4ZXBC 3VXNA 1RULL 1T7ZA 5ILTL 3CVHA 3RNQB 1IVLA 1CVRA 3RP1A 4FQPA 3JWOL 2AXGB 4LOUD 4BQCA 4QHLA 4TN9A 1SY6L 2CKBA 5IR1B 3KDMA 4MD0A 3MJ9A 4GQ9L 4Z7QF 4NT6B 3TH2T 1W72A 4HWEH 2LU3A 3VFRB 4YBLB 1R0AH 3KPOB 3RZCB 5JDSA 3AROA 4HLJA 1TTUA 43C9A 4EIGB 4XPTH 4YAQB 3BW9A 2R23A 1BOGB 3H7BA 4U6YB 4YIQB 2DRUA 4NC2B 4XNQA 5B21A 4P46C 2NY2C 5J11B 4M93B 2OK0L 3ZKSD 3G04B 1D5XB 1T6WA 4PG2A 1C12B 3QHFH 4YXLL 4TOYH 2WBWB 2IH3B 3SE9H 2AJ3A 3MLTA 1EVUA 2A73A 3FOMB 4MQ7B 4O2FA 2DKMA 1VHPA 1WFUA 3BT2H 4LOUC 4IIQC 4QYOB 5D6CB 4L4VA 3TBWA 2OJEA 5EBLA 4BFGA 5HJ3B 3E8UL 5MEQB 2P24B 4KKLD 2EIEA 4QRPD 3D3VA 4ZTPH 2BNQA 2F54B 3HFML 4G80A 5IVXA 4H1LG 3MCKB 4KMQA 4YDIL 1T03H 3FT4A 4X6CF 4ELME 3FT3A 3N9GH 3PWNA 1QRND 3JBG7 3PGFL 2VDQL 4GRWB 4Y2DD 1S7SB 3CFCL 4NGHL 1V3MA 4Y88A 4ZNEA 5TF1L 2VLKB 3MRRA 1OTSC 4YBHA 1CDGA 1KOAA 2P5WB 2VDRH 4ODTH 3VXMB 3T0EE 3OQ3B 3KPNB 3RGVC 4NYLA 3QULA 5D5MF 1TZGH 3SE4C 4Z6AT 1RUKL 3QZWG 3DYOA 2E5EA 4G6KL 2VN4A 1BF8A 1FE8L 3MJ6A 1UB6A 3UPAA 3BZEB 3ZKXB 1IKFH 1SYSB 1DQDH 2HFEB 3DRTB 2IPTL 3IETB 4L4TA 4LBEA 1MCOH 2PO6D 1MFEL 4NKOA 1JL8A 2B1HL 2I5YH 4D9RD 2YD4A 5IMKB 3LQAH 1X5LA 2IJ0C 3QEUB 4NHUA 2AQ2A 1KJVA 2L0DA 2R1XA 2ICWJ 2XYCA 3AUVA 3IDNB 4LDOB 4KKLC 1OAYL 1S9XA 5KSBA 4A6YH 2WP3T 2Y36L 4KRPB 5IJVA 3HMXH 3RAJL 4YHIA 2ID5A 4NQDE 4LRNL 4XXCC 4ZTOH 3LPGA 3D39A 3GSVA 3MUHL 3V7AG 35C8H 5T1KB 3SE8L 1OGTA 1U8LB 5E8OB 3VXSA 3DX7B 1BWWA 1IQDB 4FXLA 1DQMH 1Q94A 3U0WH 2BNRE 4H0HB 4QO1A 5IROA 3SKMB 1XGQA 2BDNH 1S8DA 1FZJA 5IEHA 1QOKA 4O4YH 5ICXB 1S7UB 4OF6A 5EU7C 2BVOA 1BJ1J 1OB1A 2AAVA 2A1WL 2E7BA 1QR1B 3PQYB 3MGOB 1Y6KR 1MCLA 3I50H 6FABH 1HHKB 3WJLC 1F4WL 4HG4K 5DYOA 4PJCF 1SYVB 4N8CL 3MUJA 3CFDB 1OW0C 2B7DT 4N68A 2P44B 4XMLL 4UBDD 4WFHE 2FIRT 1NC2A 2CRMA 4FQCH 4G3YH 1GZPA 3MYJA 5ID1B 3AU1A 4XWGL 2JB6B 3MMEA 2XPGA 4E42A 1BFOB 5SX4I 1I1AB 2A83A 1UWGL 4PR5B 2FYYA 1P4LB 1QTYT 3S3PA 5FGCE 4ZXBA 3EFDH 3MREB 2EH7H 5IOPB 1R3KB 2LFGA 1FDLH 5EU3B 3P4NA 2YD1A 1INDH 2J5LB 1B6DA 3UTTA 5C07B 3V7AE 5TDOA 3RIAF 3OG6B 5FM4A 1HI6A 4KKCC 5FA4A 2CJUL 5D7LD 2FATH 7FABL 2ED7A 2FR4A 1TTGA 3EOAB 1FGVH 1NUFA 3BYTA 3O9WB 4WW1B 1J86A 4LP5A 2NY7L 4TSBL 1HXMB 3CSPA 5IHLB 3HZKA 3WXWH 3REVB 3THMH 2XFXA 1MCFA 2GUOB 4LNRB 5EU6D 4UBDC 5TQ2L 1RJZA 5DRXA 4H0GA 4OZ4A 5AZEL 4ZG1A 3OTTA 1CGSL 5LXGL 5ITBH 4TUJA 4PJAA 3CDFA 5CUSH 3PIQA 1B90A 3EYOA 1FH5L 3MGTB 1MCWM 4LASL 1JPST 4KKNA 3TVMB 2NY0B 4JRWA 1JPTH 4JY4A 4PRPB 4M7LH 3W11D 4IIQA 4YK4B 4OIBA 5BMFL 3QUXB 4KMLB 4S1RH 3EJJX 2ZCHL 4JFHD 4YE4L 4JPVL 5B3JE 3VG9B 4F3FB 1WQVT 4I18B 5GS0L 1SM3L 1MQ8A 2DM3A 2X4SB 5KTEH 4LLDA 3L5XL 3MV9D 2OXGA 3JTTB 3L95B 1MJ7L 1KB5L 5CP3H 3C09B 3S5LG 4PJ8B 3NZHH 1I3RA 4G8FA 2XT1B 4UV4H 3C6LC 4LPWA 3VRLF 1UFUA 4GRWF 5J1TC 3WNKA 3ZE1F 1TJHH 2OBGA 3RGVA 2X9WA 2WQ8A 3M8OL 3VXUD 1AGEA 1VERA 3NFSL 4GBXB 4FXGB 1P69B 4U7SA 4ZPVA 3GSXB 1HSAA 1T4KA 3D0LA 5TE4H 1VKXB 2AJXL 3KYNA 5J89A 3UTSE 5KSVB 2MQ0A 1N6UA 4XC1H 1G84A 3B8YA 5HYEA 5E1AA 1MRFL 2RQ8A 1HK6A 1DBML 1FN4A 3W0WB 4Z0BL 1FO0L 4RBPK 3PJSB 5KZCB 5IB2A 3C2AL 1WUNT 1S7WB 4NO3B 2X9XA 4Y4FD 1UJ3B 3DUSB 2V2XA 3JV4B 4FFYH 1ZVSA 1BGXH 2DICA 3S35L 1CFSA 1EIBA 1EFXB 5AUMB 5IB4B 5DWUL 4LL9A 4G6JH 1MCEA 2JB5H 4HC1L 5KOVC 2QSCH 3NFNA 1ZLSL 3VGGA 1YNTB 1LDPL 2VLLB 3WJJC 1EGJA 4OLXH 1HN1A 5JIHA 5DQ9B 5HPMA 5I73C 4OI8A 4N0RA 4LCIH 4C4KO 4R4BB 1C5DA 4RMVA 2DQIL 1DQQB 1DQJB 1BD2B 5ETUA 3SDXA 3MOBL 4MNGE 3CZFA 4UU9B 5EOTA 5H2BA 1P7QA 1HYSC 2AXFB 1E0OB 5CEZD 2AK1H 4S2SB 3D25A 5F72S 4Y19B 1ZE3C 4LEXL 3MRMB 3MRPB 4Y4FC 1FGNH 2FD6H 4J3TA 3GBML 4WTWA 3ARBB 2WIIA 5ICZA 1IARB 5D6DC 1A7BA 4MXQD 1FAIL 4HT1H 4XCNA 2IPKA 1IEHA 5DXWA 5C2BH 2YPLD 3BPLC 4JKKA 3U2SB 2R29H 5JA8B 4YUEL 4F7MA 1MVUA 4GAYB 3WKNA 3ULVD 2GJ6E 3REWB 4XX1E 1IBGH 5D7IB 5HYSG 3MNVB 3MODH 4BZ1L 2UUDH 5D1ZB 1F3RB 4NBXB 4GSDL 1KIUA 5JXAH 2ZCKL 4WTZA 2R4RL 1MUJA 4GFTB 5DQDH 1EJOL 1U41A 3CK0H 5IFJA 1DN0B 5FYJD 3IRZA 3KPSA 4G43B 3T0VA 5KN5B 4LFHD 1I9JL 1UB5B 3BEWA 3QUKB 5C0FB 3WLBA 4KKAD 1B0GB 3QEGH 4KTYA 3FHQA 1MVFA 3L3HB 3O0RH 1A7PL 4UT9L 3SEPA 2A6IB 3OXSA 3VWJD 5F7DB 1PKQE 3GBLA 3NABH 3FONA 2R2HA 5DEFA 3KHOA 1J5OL 1RPQA 4ONGH 1F8TL 4WTXA 1HKLH 1EZVY 1IGFH 2P1YA 3O11B 4XPAH 2R0WH 1KTRL 5LGKA 5EZJB 1MJ8L 4HFWA 4PJBA 1E4WL 4MXQC 1NAKL 1KLFA 4OJFH 4QKXB 1XGYL 1DUYB 4P4KA 3ULVC 1NGXA 2F58L 3NACL 1IM3A 4XNUL 4DAGL 1CTOA 4JREC 3QB7C 4NFDA 3BQUD 5ISZA 4U33A 5DQJB 3GMMB 3MV8A 1KCVL 3LH2L 1JF5A 2X44D 2VXUH 3MRIA 4CVXA 4TNWF 1QSEA 1A6AA 1GC1L 4GRMA 1ND0B 3FFCA 5CMAB 4CRPA 4PGDA 3TYGH 5L9DL 1NCAH 4B5EA 2FX9L 3PV6A 3S9DB 4JFXA 5T33L 1DL7H 2YN3A 4LCYA 4RWYH 1JYVA 3GJEB 4LSUL 3VFPB 3MCG1 5CCKL 4PRAA 5D93B 3L3DB 3QEHB 4HIHB 4M8QB 5C0ND 1NLDH 5CEYB 2OTWB 1WBZA 4AM0A 4JG1H 3R1GL 4UUJA 4E41D 1T21A 2KDGA 4NDMB 5INDB 5GGSA 3C6LA 1CU4L 2VITA 4PTUA 2ILLA 4OCNC 3HZYB 5DUML 1SVZA 3W9EA 2EDEA 2PTTA 1CLCA 5I8KL 3QEQE 1KELL 3QRGL 5GGQL 1U8MA 1P9MA 4K71C 4N0YL 4IS6A 1SBSL 3LN4A 3BIAX 1SEQL 4B53A 4YDJA 1N5YL 2FBJH 3MLRL 1CN4A 4BH7B 5F88A 4QRRD 3BN3B 3TA3B 4G5ZH 4JN2B 1NCTA 5B4MC 1CDHA 2W65A 1BAFH 5LCVL 4HXBL 5BW7A 2WM0A 2NX5D 4P9HL 3QDGA 3IAGC 4DFHA 4PY7A 4Y1AA 1E6OH 2FJHB 4I0KA 1Z9SA 4C4KT 4N90D 4F9PC 4LSQL 1NAMA 2CSPA 4G42B 5F1KC 4YPGA 3U1SH 1YPZF 2ZUYA 3ZDZF 1YMMB 3SO5A 1F58H 3QCVH 4PJFA 2AJUL 5C09B 5E5RB 3T8XA 5C0NC 1T3FB 2ORBL 2DTSA 3K2UH 1FNEA 2NCMA 1TPXB 2EXWD 2J4WH 2F5BH 4YHPA 4HH8A 3V8OA 4PRIE 3U4EB 3SKNA 1MFDH 4JZNB 3K8LA 4HHAB 1UT9A 1CFTA 1FVEB 4ODHL 3O4OB 5CGYD 3D69B 1RK0A 2YMXL 4ZAKD 4IRZL 3QFJA 4S0TD 3W5MA 2X4UB 4YDKL 1YDPB 3C08H 4LSPL 5DGRA 4UILL 3AGVA 1K4DA 1CICC 1ZHNB 3QPXL 4N0FA 4NQVB 2OMBA 1B4RA 4M1GL 3TPUA 1OD7A 4XVTH 3T2NL 2FRGP 4RIRA 1L7TL 1NGWA 1VFBB 1X44A 3S3JA 1J8HE 4DGYH 5ACZB 3BKCL 4JDVB 2NXYD 5GJTL 1N59A 4OZHA 2PXYB 3HS0B 1Q38A 1HYRC 3DSFH 2BRQA 1NBYB 4PPTA 5CIPB 4Q0XH 5DI8B 4PJGE 1VENA 5I8EA 5D6DA 2E9JA 5FK9B 4G9DA 2QHLA 1PAMA 1BREA 1CLOL 4JPWH 2HWZL 1S7QB 3ILPB 1J87A 2R8SL 3IVKB 4HUXB 3JWDC 3RIAK 4GO6B 3U7WH 4JO2L 5I1EH 5D7IF 2GYSA 1NFIA 3C6SB 2G9HB 4XB7A 2E6QA 4V1DE 5CGYC 1ORQB 4K23H 5F8RC 5HGDA 2WMPA 4PREB 2UVEA 4YNYB 4NWUH 5ABDE 1D5IH 4ZFOL 1KEGL 4UMGA 3RWFA 1RVFL 3QUZD 5DHVB 3OGCA 3TO4A 4U6HA 1S7XA 2UWEF 4I0CC 4WW2C 4MLIA 2IADA 5BS0A 1E4XI 3RKDC 3GMLA 1FVDB 2H32H 1ZHBB 2J3SA 5IV2A 3D9AL 3FT2A 3H9SE 1RAMA 3ECBB 3MOQA 4OZFB 4PRBA 2DM7A 2FNBA 3MLZL 1DSFL 3L5WB 2NXYC 3ZZ1A 4DW2L 2DWEA 5EFIB 4M9OA 4F7EB 3F62A 3MQIA 1LK3H 1XGUB 3FN3A 2ZSWA 5I18H 4GXVH 4UQ2B 1MCRA 4PV8B 4HKXA 4FQQA 1N5AB 4ZS7L 4MDIB 4OSUH 5JHLL 5GS1A 5JW4M 3BPCB 4QRPE 1JZ5A 3DO7A 2YXFA 4Z5RB 3P73A 3P9WB 4RNRB 4LSTL 1QRNE 3ARFA 1UXSB 5CWSA 1FNLA 4X4ME 5D1QD 1QHPA 2C1PB 4OKVA 5GISL 5CEZH 1L9NA 3QUZC 4X8JB 5HY9B 1JF1B 4FQXC 5IBTL 1ADQL 1TJIH 1YYMH 4KRLB 2CK0H 4AEIL 3S4SG 3GFUA 2ATKA 2EEDA 5TE7L 3N1PC 4L8BB 4KZEH 1PSKH 2W60B 2YEZA 3QUYA 5J8OA 1NGZB 5GGTH 3FN0L 2ICES 3VRIA 2OJZL 5D2NC 1LO4L 3KXFA 3SHSA 3ULVH 4NQXA 4K3JH 4H5SA 3DX9B 1OP5K 3I02B 3DX8A 4R90L 1TZIA 4QXWA 5KBNC 4D9RE 4ERSH 43CAB 3SCMD 3D5OF 2H3NA 1U8QB 2BFVH 2CXGA 4OGZA 4F7CB 4ZOEA 2L7JA 2O26U 2P8MA 3ARXA 2VLRA 1ZHLA 3F8UB 5FYJH 2OL3A 2A9ML 1MHHA 5HI3C 5ICYB 3OWEA 1FFPA 4PYGA 4JO1H 4OFYD 4BZ2L 3W81A 4LAQH 1NL0L 3U30B 1LEGB 5T1MA 4ELMB 3MRDA 5D1QC 1E4KC 4WHYH 3WIIL 1BZ7B 3T0XA 1TVBB 3ZE2E 2EXYD 3H8NA 2V5RA 1GCFA 2ESVA 3GRWL 2DLEA 4RQQB 5DEGA 3T0EB 5KSAB 5LQBL 2ADJB 1L0XA 2FGWL 4JKMA 4LSSH 3QWQB 3K80A 1T83C 3RWHB 2C3WA 1KJ2H 2VAJA 3BZFA 2AABH 4DCQA 1A7QH 1FPTL 4J8RB 3BGMA 4AEHL 3GKWL 3BIBX 2QQLH 2OSLB 4Z77A 3I75B 1XR9A 2EIDA 1LO0H 3JVGC 4N9OB 4HIJA 3RKPA 4HKBA 1XGRA 4WEBL 1ZA6B 4DEPB 1N8ZA 1GGCH 4ACPA 4CMHC 4JFYB 3WFBL 5BRZE 4LSVL 3ZT7A 4PRDA 3VWKB 5F8QC 4JRXD 4OGXH 3FL7A 1EV2E 4OZGE 1CICA 2CLVA 1ZT7B 1NKRA 2X9YA 3FTGA 4G8GD 4LLWB 2VDOL 1MEXH 4D3CH 4HMEA 4NQDB 1E6JL 1RZKL 3HRPA 3L9RB 2ICEA 2YC1B 2HT4D 3D0VA 3ZKNC 2JCCF 5TPWH 5IESH 4ZFFA 4M43L 5I74B 3BHBA 2FBOJ 2BNRB 1Z9LA 4MA3A 1MJJA 3GMQB 3HAEB 4QHKJ 2PW2B 2ICWA 4KJYB 4BM7A 4EKXA 1T1XB 2DBLL 4HXAH 2Z31A 4X7FC 4U4BA 3VFMA 1DBJH 3INUL 4LKCA 4YHKH 1GAFL 4MAYC 1LQSR 4UTAL 5D7LE 4JAMB 1XIWB 1UWXH 5IBLC 1FSKC 1FORL 4L3CB 1LO3L 3O4LD 2NTSP 3RPIB 1WBYB 3MACL 2I9LA 3QUMA 3RRQA 4DOHE 1ACYH 4L4VD 3TCLA 2WUCL 2CO7B 4LCWD 2HFFB 3D3VD 3FB7A 3HC3L 1HWGB 2BNQD 3MBED 2NW2A 4I77H 2XA3A 5D8JH 3D85D 1CGTA 4EBQL 2HT4C 1WBXA 1XF2B 5L8JB 5BXFA 5ALBL 2APWA 4XNXL 5H35A 3BXNA 1R3IL 2W9EL 1S7VB 2LU7A 5F89B 2C7UA 4DUXA 1BVLB 3H3BC 2FIKB 4BFIA 3O6MH 1B4JL 2DQUH 5FGCB 4NFCA 5C0BE 2R69H 4TNWK 1OHQA 4ZUTB 1AJ7L 4EXPX 3X3GH 1LO2H 4OLVH 4P5KB 1CL7H 1INEL 2KZWA 4OIIL 1IGCH 1T66C 3KYMB 2AJZA 4HUWB 4MB5A 4U0RC 4JO4L 1HKFA 5I8CB 3KNBB 3GBNL 1RUML 1WLHA 5FM5M 2GHWB 1OGAA 3LQZB 1EHNA 2CR3A 2VLMD 4OD3H 1U3ZA 4OUUB 5C7XL 5LGJB 1QBBA 2A9NL 3U48A 4FQXA 3BVNB 2R4SH 5SX5K 4M7ZB 2NYYC 4H0IA 5LAXA 4MA7H 3MBEC 1ONQA 4PD4K 5I9QC 4FP8L 1I7UA 2VXSL 4NIKB 2NTFA 5E2UL 3EYUH 1BFVH 4LVOC 3VD7A 1KXTB 1QLFA 4I0PD 2IGFL 4XHQA 3P30H 3LV3B 1P4BH 4MDJB 4NPYB 5IWLC 4GOSA 1JGEA 2R56H 4KJQC 4ZO8A 4LCUB 3K74B 4ZMAT 2VXTH 5IMLB 3IJHB 5C9JA 3OF6A 4K8RC 4OLEA 3TO2A 2MCG1 5J57B 3STLB 4MNQD 5DD0H 4Y4HB 1NGYB 2Z92A 3BD4A 1LE9A 4HK3N 4YFLI 1MRDL 4LFHG 2CD0A 4JDZB 1FFRA 1JV5A 2BSTB 4X99A 4X8XA 1WIOA 4TUOB 1IAKB 1CD1A 3VA2C 2BY3A 1E4KA 4JZOB 4ZUUB 5F9WB 4Z7NE 1FZKA 3SJVA 3B9DA 1F3JA 4YHLH 4NWTL 1PDKA 1UENA 4Q2ZA 3GMNA 3GM0A 4LHUB 3I84A 4CNIA 4QRQA 4UDUB 4P23D 5CJQL 1XCTB 5DJXA 1YEJH 1VGKA 4DTGL 1TCMA 1JF6A 4W4OA 2GTWB 3S7GA 5SWZE 1FV1B 3OKOB 3D6GA 4HUUB 4K94H 3NH7H 4Q74A 3ZHLA 1JBJA 5K9QI 1U8NB 3SKOA 4NOBA 4WHTA 3UTSB 3IDIB 4NC0B 3JVGA 1R3LB 3AREA 4XP6L 1OOAA 5BVJB 2DIJA 5DUPH 3O3EB 1QKZH 2AV7B 5FUZH 1ZGLB 4J6RH 3QG7H 5AD0A 5F7FA 3V9FA 2A77H 4J12A 4JJ5A 4EOWL 3DBXA 1CE1H 1G9NL 5TE6H 2I07A 1RJCA 3G5YB 3BRGC 4NOFA 2VWEC 2BY1A 1LP9A 1QSFA 3CDYA 3VFUB 1J1OH 4R4NC 3DV6A 4W6XB 3DXAA 3FRUB 4G9FA 5E8NB 3BJLA 2A0LD 1H0DA 4W4NA 1V5JA 1E4JA 1DUZA 1IFHH 1QBAA 1U93A 3HZMB 4M62L 2W92A 3DMMB 1W0WA 2XZQH 1QLEH 1EO5A 3UBXI 1EVTC 5FYJE 4P23C 5F44A 1ZGLM 3OKKA 1DBKH 1I8LA 1G7MA 5DRNB 4DFIA 5BJTB 5HHNA 3IS0X 3JWOC 3U9UB 4KZDL 3HLAA 2IMNA 4NN5C 4MAYA 4XC3L 4G6FD 3NGBB 3PDDA 1JIBA 4MNGB 2X4PA 1EO8L 4UDTA 1EEYB 4EUPA 1M6OB 4E9LA 1MJUL 1YEDB 1M71B 3MRKA 4P5TB 5DFVD 1RZIB 2Q7YA 2XTJD 4R7NB 3GMPB 3LZFH 2N56A 4OV5A 1IGJB 1QA9A 4BQ8A 3GGWB 1T6VN 3OX8B 4HF5L 4MJ5B 4XBEL 2APVA 4OBRA 4UT6L 3LHPL 1G6RL 4NRXB 5E08L 1N0LA 2K1MA 1SJVA 3W39B 3IDYC 5DVKA 4PGCA 3ARDB 1T2JA 5D2LA 3FKUS 2BERA 2Z35A 5ERWB 3C9NA 2AXHA 4KVCH 2J6EA 4DZ8B 4QRUA 2GJJA 1GZQB 5IHZB 2BOBB 1V3JA 3T04D 3LSOB 2DYPA 4FQIL 4K55A 4XNMA 4FQHB 2CKBH 3PV7A 5ADOL 4R8WH 2HLFD 5GGUB 4EDXB 3H42H 3HUJE 4FFZL 4E41E 5C0JA 1YC7A 2VISA 2QADC 4KJPD 3C60B 1UEYA 4MSWA 2XKSA 5AAMA 5AEAA 4AL8L 5DD3L 2L7UA 3ARGA 3KYOB 3MLYH 2D7TH 3BO8B 4O02H 2BSRA 5I1LB 4XP1H 3CD4A 4L8SC 4F8QA 5KVDL 1MCPL 4R2GB 1QQDA 1GPOH 2HJLB 4OF3A 1NC4B 3D2UB 1RU9L 1I9IH 2A74A 2OR9H 4O00A 5DTFB 1I1FB 4ALAH 4QRRE 1SEBB 1YUHB 2P4AB 1B0RA 4XNYL 1NMAL 5FOBB 1TCRB 3K7UA 3P2TA 4JM2B 1T5WA 2OM5A 3O6FB 2NX5E 2E9BA 2LU4A 2YPKB 1J1XL 5CBEB 1QBMH 3ABZA 4PP1D 3HE7B 4N90E 5EN2A 1DCLA 1PEWA 4HIIB 1NANH 1Z0MA 2Q20A 4MNHA 2J1KA 4P2YA 5DDHA 3ARUA 1JN6A 2YUWA 2HJFA 2VDKH 5FCUL 2WLZA 1EEZA 3IKKA 2FGZA 4YQXH 4CADB 5LKNA 1G0XA 1JVKA 4WDIA 1H5BC 2DI7A 4PYHA 4PJXE 2IG2L 5KS9E 1I7RA 4ODUB 4RZCB 3MLVL 5DK2B 1DN2A 4BFBD 2IALB 4PJ9A 3UC0H 2UVFA 5B22A 3QEQB 1MHCB 3PWPA 3T4AB 4GW4A 4DKEL 4H8WL 1ZTXH 3MRLA 2PTVA 5IIEB 3MRHB 4JQIL 3HI5H 1TZHA 5E2VL 1UKSA 4MCZA 3IU3B 4RAUA 1QFWH 5I1AB 2VIRB 1SQ2N 3PHOB 4HH9B 1W2KT 5GIRA 2GEEA 5E8EA 4PJDA 5CFHA 5J6GA 4TTDD 2DAVA 4CDGC 2GCYB 3FMGL 2QV2A 3LEXB 4JFFB 3T77B 4RGND 4KVNL 3D87B 1A6ZB 5JHDA 2YSSB 2ZG3A 5C08E 4XVUD 3HA0A 4EQ2A 4X9BA 1MFCL 3V0VA 4DKFH 3E3QE 5JPMA 4ENED 1QD0A 3DVIA 3L3GA 5GHWH 1FYTA 1QNZL 5DRZA 4JFZH 5I15L 4PRIB 3O3DB 1KLGA 2GFBA 4HV8A 1M7XA 3QDJD 3OV6A 4Y5YA 3SDCB 2VAAA 3UTZA 4KUZL 1VGEL 2A6DA 4J3XA 3SQOL 3ZTJG 4P2OC 1A1OA 2NY1D 4PD4J 5EUKA 1GHFL 4YHOL 5ISZD 1EXUB 3BWAB 2AK4D 4KHTL 1NMCC 1FCGA 1ZT4A 4ODBD 1HINL 5DHYA 4GKOA 4P46B 5DRWA 1ZANH 4U49A 5EBMA 3FFCD 1NMBL 1J8HB 1LGVA 2ADIB 4U1HB 4C56E 1G1YA 3TZVD 4TTDC 2EYRA 4CJ1A 5E6ID 3TYFB 4H20H 3ZE0E 1BIIA 1RIHL 2O61A 2BMKB 4ZD3H 4RGNC 2G75B 5GRZA 3RWIA 1S5IL 2DQJL 1MRCL 1RULH 5ILTH 4K07A 1VADB 1FRGL 4R0LB 2MSPA 2C3VB 1MHEB 3GI9L 3HNSL 3OXRA 4UQ3A 2EDHA 4M6OH 2W38A 3SE3A 1MCBA 2UV3A 1SY6H 4GG8A 3VU2A 1AR1D 3KPPB 4FQ1L 1SHMA 4GQ9H 4APQD 3M1BA 1MFAL 5INCB 4UIKL 1FNSL 4JKWA 1LE5A 1I9RL 1KIRA 2F19H 3QHZH 4LF3B 4OQ1A 8FABB 2NY1C 1E4XL 1F00I 1HHJB 1KNOB 1KTDB 4NHCL 4IDJL 2H9GA 1FLTX 5GS0C 4PJIE 1C16B 2H45A 1OT2A 3H9SB 3F5WB 3QDGD 4HS8L 4Y1AD 2AV1B 5F7YC 5HHQB 2CDFA 3TZVC 1IKNC 1VFMA 5E6IC 1A3RH 2OK0H 3Q2CA 3HE6C 3ILQD 3I2CL 4DN3L 1O5DT 4X5XA 5HHME 1OAUH 4YXLH 5DMKA 3QXUA 5ESAA 3TH4T 4HKJA 2YPVL 4NQED 5F1SA 1MI5A 4QRPB 5L7XL 4GXUN 5E99H 5C0DA 3BZ4B 4IMKC 4M7JH 3IDJB 3E8UH 3F7YA 1JHTB 1QRNB 2QKIA 4Y2DB 2BNUA 4APQC 1TDQA 4JM2F 3B3IB 4YDIH 4D0DB 3QFJD 5K93A 2D03L 1TJGL 3A6CL 3IJSB 4HKZA 4NGHH 1TQCC 2NY6D 5B39G 5TF1H 1CFNA 1QHOA 2DQDL 1FZMA 3JTSB 5F6HI 2VABB 2NXZD 3L5HA 2XRAL 3KPMB 1JUFA 2NZ9C 4KRNA 1OAKH 2VZVA 1D6VH 3MRFA 2PO6B 1RUKH 5DJ6B 5DF0A 2NW3A 4KPHH 5MHSE 1C7TA 3C8HA 5IVOA 3MZGB 1Y18B 5DZNA 3PHSA 2B1HH 3UZVB 3G08A 1T22A 2C1OA 3TPKA 4HWEL 3L3OB 1E27A 3VFSB 1R0AL 2V9RA 2YD2A 3PGCB 5FB8A 5ENWA 1OAYH 3STZA 3AVEA 5HBBA 3B43A 4NM8H 3DTXB 4XPTL 1WAAA 3Q48A 4LEOA 1AQDA 4LRNH 4X7TA 2OZ4A 1UVQB 2C4XA 3OPZH 3EGSA 4M5ZH 4GAFB 2B5IC 3T0AA 1YEFH 3PP3K 4YDLB 2NXZC 3LKOB 5EUOF 3BMVA 5K33A 2KH2B 4LKXB 5AG8A 2JIXA 3SE9L 4WHDA 2WBKA 3QHTC 3BT2L 4PG9A 4JFEA 4RMQA 2CIIB 2IMMA 3HPJA 4ODWB 4ZUWA 3O4LE 1KN4L 3ZT6A 1U8IA 4P4RB 1F6FB 4ZTPL 1ZWIA 5FKAA 12E8H 1IQWH 3MRCA 4L4VE 1T03L 1VFAA 4LCWE 3N9GL 4P2OA 3D3VE 3QJHA 2BNQE 1AE6H 4OZGB 5IVXE 4YXHL 1K4CA 3BIKA 3FB6B 3MC0A 4R96B 3KYKL 3QNXB 4QWWD 3VW3H 2ARJB 1O7SA 4F58H 3A6OA 2VDRL 4ODTL 4ZNEE 1U42A 3RZCC 5J1SC 1SBBA 3O2DA 3RWDA 1XF4B 5SWSA 3NCCB 4F33B 5C86A 1FP5A 4LVHC 4MJ6A 1TZGL 2IBGA 5FUOH 3VXMD 4WHCA 1OAQH 2EEAA 2GW5A 1KG0B 4JFPA 4UNTA 1MCOL 1ORSB 4JPIA 4M93C 1U3HB 4Y7MA 1IAMA 1XZ0A 5CSBA 1GGBH 4U6XB 4L4TE 4P2QA 1A7NL 3LD8B 4LGRB 1T20B 1C5CL 3LQAL 5D7LB 4U1SA 4JLRB 3UDWA 1DVFA 1FG2B 2Y1VA 3OR7B 4I3SL 1ZXQA 3U46A 2XNAB 1FIGL 1A8JH 1I7ZB 2CJUH 2IAND 3MBXL 4OQTA 5DJAA 1R24A 5I71B 3B5HA 1GC1C 5L8KB 3IFOB 1NDGB 4JHZA 4X6CA 5KSBE 1FFNB 5EG6C 4DOHB 4XPGH 2W9DL 3S96B 4KRPD 3G6JB 1RZ8B 3Q5TA 1KC5H 4QWWC 3BJ91 1S9WB 4WJ5B 5I17B 4QNPE 3QWOA 3D39E 4P5MA 5IHBA 1DQML 1DBBH 4XCEB 1KSRA 2YKLH 5E9DA 1TQBB 3VXSE 1KB5A 3IU4H 2DF3A 2YRZA 3V5DA 5CHNA 5AZEH 2BDNL 1Z9OA 1WC7A 5BZWB 1CGSH 1OY3B 3MLPA 1ACZA 1A1NB 3L5JA 1AD9B 1L0YA 3EO1A 5FEBA 4JFQB 4MNQE 4K3DH 5IP4A 1FH5H 2HG5B 3ZKXC 2ENSA 5KG9B 5T1DL 4LASH 4OLUH 1K85A 1U0QA 3IFLH 4HZLB 4XAKD 3RWGA 4Y5XA 2DI9A 5EO9A 1G7JA 4KJWC 5BMFH 3O45B 1Q9LA 3MV9B 3PQYD 4UIMB 4RA0C 1KGCE 3S88H 4GAGH 4WGVB 1EK3A 4S10A 2CO6B 1SM3H 4P9HC 3FB8B 4Z0XB 4OFKA 2R1WB 4BK4A 4KRPC 3QXAA 5IJKC 3PWJA 1T0NB 5J4MA 1CT8B 3VXUB 3ALWA 3S97C 4HWBA 1JYWA 5E4EB 3TNMA 2CUMA 5FO8B 3EFDL 2EH7L 2ZOLA 1U8KB 2J88L 3GSQA 3PUCA 4UZGA 4WU5A 1XMWA 2NLJA 4KDTC 4O58H 4P2RD 2C3XA 1FDLL 4KQ3L 1K8DB 2AJXH 4F7PB 1LILA 3DHJA 4CU6A 1MRFH 5C6WH 2H26B 3MCLL 3VXRA 4Z0BH 2Z31D 2A6KB 3UTTE 4C58B 3C2AH 1NBZB 5ANMB 1RI8A 2H32B 5FA3B 4X5WA 5JQ6H 4KI5D 1FGVL 3T3PE 2VO5A 1HOCA 2EYTB 5TGBA 4BA8A 5C0EA 3WXWL 4PJCA 5HYJD 3S35H 4CJ0A 3CGTA 3THML 4TTGA 4MS8D 5DWUH 5GS3A 5TFSH 2ZNXA 4ZSOA 2Z8RA 2BVPA 1C7SA 1AHWA 3V6OE 3WL9B 3HI6H 3KJ4C 1RMFH 2F53A 3IDMB 3WUWA 4HJJH 3I85A 1HHGB 1BWMA 1R5IA 4MD5B 5CUSL 4D9QD 5CJXC 3MRGB 1W0VA 3LEYL 3P9MB 1JPTL 4QXTA 4OF8A 5HGHA 2DQIH 4M7LL 2D31B 2Y7QA 3EUUA 3MOBH 3C8DA 3TVMD 3RNQA 2NY0D 4S1RL 5C3TA 5A3ID 2AXGA 4Q7DA 2XTJE 3UZEA 2P5EA 1S78D 3LB6D 3DVNA 4U1MB 1D9KD 1RUQH 4GAJL 5KTEL 3WUZA 3KS0H 1WEJH 5IQ9B 3NZHL 4KI5C 4NT6A 1MCNA 2A6JB 2D0HA 5DMIL 1WT5C 3GBMH 1BFTA 4MLSA 4OZGF 2AEPL 1EHLH 4PJ8D 1AD0B 3KPOA 4WWID 1R6VA 5MENA 3O9WC 5DZLA 3CU7A 3PG2A 4MS8C 4FRWA 4DQOL 3GSRB 4YAQA 2K7PA 4YUEH 1HSBB 4U6YA 5A16B 4YIQA 1OM3H 2V5TA 3I6GA 1V3KA 5E0QA 4BZ1H 3MRBB 5TE4L 3MA7A 3O2WH 3MO1A 1T2QH 5TJWK 3HCVB 5E70A 2OYPA 3GNMH 2R4RH 3G04A 1D5XA 4NNXB 3TLRA 3ARTA 4NQSA 1BMGA 1G7HB 3BEVB 1C12A 4BQ6A 5I76B 3FAXA 2HKHL 4JFOB 1HNGA 5GRYA 3Q6GL 4OCSH 3L7FB 1CK0L 1OTTC 4X7EC 5GSVB 3VWJB 3TVMC 2NY0C 1AGDB 3OF6D 5DJDA 5A3IC 1A7PH 5DMGD 4K7PX 1V05A 3LB6C 1UACL 1BGXL 4QYOA 3BP7B 4WEUD 4YK4C 3QUXC 4PJ5D 5MEQA 2P24A 3OKLA 2QBWA 3HG1A 4H26A 4G6JL 2F54A 5HHOA 3DX6B 1TFHA 3VG9C 4I18C 2JB5L 5DHXB 1KJ2B 2R2CA 2CIKB 1S7SA 2DBJA 3G6JF 4PJ8C 2JF1A 1MJ8H 4QHUA 2VLKA 2APTA 1NAKH 5DD1H 1QPPA 3BQUB 1XGYH 2G5RA 3MLSH 4HK0A 4OLXL 2WINB 3Q0HA 2ITCB 2F58H 3KPNA 4I8DA 4DAGH 5F21B 1Z5LB 1KCVH 5I8OL 3VGDA 2X1QA 4PUBH 4GBXC 2WQRA 1RURH 4UOW0 1JWMB 2HFEA 4POZD 1CXEA 1GC1H 2J12B 3STBA 1PJ9A 4LLAA 3MV7A 1MFNA 5DD6B 3HRZB 3OJDB 4OFIA 1Q9KB 3LCYA 2WWMD 5T33H 5HSFA 5IMKA 5CCKH 1FNHA 1P7KB 1FGNL 2FD6L 3HUJB 4E41B 2DWDB 3QEUA 3KPRD 4U1KA 3S8WA 4JRYA 4ZUVB 1UJ3C 1XF3A 5C2BL 5L0QB 1CU4H 5IJKA 2R29L 2DQTH 1L6ZA 1IBGL 3IGAA 4JM4H 1T7VA 5DUMH 3MODL 5FECA 3FQUA 3B4NA 1S9YB 5T1KA 1UQSA 4CMMA 4OLYL 5E8OA 1KELH 4G9FD 3DX7A 5ITFA 5DFWH 4FFWD 1SBSH 4QRRB 5D1ZD 3E6HA 5F71A 5FAAA 5T5FH 1X9QA 1H3TA 2NX5B 3KLAA 1DQTA 4P48A 3QEGL 4U1NB 3KPSE 4RISH 5LCVH 4P57A 1J10A 4LLMA 3O0RL 4POZC 1S7UA 3RWCA 1UC6A 3SGJA 5ADPH 4NM4H 2X2YA 2OL3H 1PG7L 4HFUL 3NABL 4XXDB 3LKSB 4DVRH 3FCTB 1JZ6A 4HUVA 4LSQH 2QLVB 1ZLVH 1QR1A 1ZVYA 4ONGL 3VXTA 3MGOA 4O2CA 3TN0D 5A2JH 1IGFL 1WCBA 4XPAL 2AJUH 3DHMA 2R0WL 4IRJA 1HHKA 1RZKC 1LEIA 3BKMH 5F93C 3X14A 2ORBH 3WFDL 5CBAB 1OF2A 4OJFL 4PJXB 5J13B 1Q8MA 5KS9B 1FC1A 3ARBC 4Z7NF 5L2KD 2D4FA 5EDXA 4PJBE 2PR4H 2Z8WC 3V0AC 1KXVC 1XF5A 4ZAKB 3BPNB 5ID1A 4QRTB 1RIUH 2VXUL 5AWNH 4NC1E 1BFOA 4RFNB 4ODHH 3S36H 1TIUA 1U8PA 5FGSA 4FFWC 5ISZE 1I1AA 2AK4E 5D1ZC 5HHXL 4LLQB 3MV8E 3QWRD 4PR5A 4YDKH 4C55A 1P4LA 5CEXA 3MREA 1EO7A 3K8KA 1NCAL 1QSEE 2XWBB 3V8CA 1UADC 1R3KA 3H9HB 3FFCE 4RWYL 3CCHA 1RFDL 3SDAA 3L3KB 5EU3A 2OR8A 4N8VG 3MOAH 3TBSB 1NLDL 2BHZA 5F3BB 5C07A 2RB8A 1AR2A 4KK5D 5A43C 4NZUH 4GT7A 1SJHB 3GZKA 1FLRH 1D6EB 1U91B 3O3AB 2JK5A 1F45A 3CPLA 2P8LA 3IJYA 2HMID 3O9WA 4WW1A 1CDUA 1G7LB 3QT2A 5DS8B 1NEZG 2M8XA 1NLBL 1U9KA 2LQRA 4PBWD 4XZUB 3ULVF 1CLOH 3WBDA 2GUOA 4LNRA 1HH9A 2FBJL 3ROLB 2DMCA 3PWLB 3FZUD 4G5ZL 5J1AA 3QUZB 4WNQB 3HHRB 1OWWA 3NCJH 1BAFL 5GGRY 3DV4B 1F4XL 4HX1A 3TA3D 1E6OL 5GRJL 1KEGH 2GY5A 3AXLB 3MGTA 3IFPB 1PVHA 5GJSL 1M7DB 2BXZA 1WSST 1EBPA 3QDGE 3U1SL 2RAMA 1IC4H 4Y1AE 3GJFH 3HPLA 2DQCH 2DQGL 1F58L 4PRPA 1INQB 1KPUA 5F1NB 3D9AH 5GGRB 3S3SA 5JOPD 4Z95L 3MLZH 2R15A 3K2UL 1DSFH 4PJFE 3B9VA 5D93C 1M1SA 1WZ1H 3BGAA 3Q3GA 2X4SA 5EIVA 4XBGB 3JTTA 4P3DB 1CD9B 4AG4L 1TVDA 3B9KA 3DI3B 2HMIC 2ZUWA 1MFDL 5IM7B 1FIEA 1I1YB 5JHLH 2RHEA 2CR6A 5EZIH 2YWZA 1DE4B 3LRGA 3VDCA 4ONHB 2CLZB 4OF7A 2VDMH 4EJ1C 4KXZI 4LSTH 3RX5A 3FZUC 3VD3A 2MQCA 3QFJE 4GBXA 3CFIC 4FXGA 1OTUD 4U2ZA 4JDTH 1B6UA 1AXSA 5KSVA 3QIWD 3TA3C 3BYYA 5IFAL 3HNTH 4ISVB 3MRQB 1I4FA 3TJHD 5J06A 1Q0YH 5IBTH 2FCBA 2XN9A 4Z7VE 4M61B 4WU7A 1YPZA 4PJIB 1MH5B 2B1AL 3DSFL 3RVTD 4EXKA 5TE7H 4ZYKB 1QEWB 2J8UA 4OZHE 4Q0XL 2CUHA 3TBVA 5EBWB 3VFVB 3HUJF 4NSKB 1UJ3A 5JA9A 2UY7A 3DUSA 5IMOA 3JV4A 3SCMB 1LO4H 3AB0B 1LWRA 1NCUA 1EFXA 2M1KA 2UUDK 1BECA 2Z8SA 1WWAX 4R90H 5ACMA 3BZDA 2X5PA 2VR5A 1C5BH 1NGPH 1TPXC 5EIIB 3U7WL 4LCCA 3P9LB 2MQ3A 3HC0B 5E6ZA 1G1CA 2FL5B 2ZUQC 3CNKA 2EDLA 3ARQA 1T0MB 2A9MH 1YNTA 1D5IL 1C08B 2VLLA 5DC0A 1UZ8B 3O4OC 5JNYB 1YN6A 4L1DA 3AY4A 4BZ2H 1IGYB 4OCWL 5DQ9A 2DTMH 3ARPA 3T65B 1OTUC 3AAZA 2EDOA 2EH8L 4R4BA 1BD2A 4DGIH 2HRLA 4UU9A 5E00B 3TJHC 3G5ZB 2HJKB 1G9NC 2HVKB 1HCFX 2AXFA 3QQ9D 5I18L 4R7DB 4GXVL 2FGWH 1ZOXA 4R26L 4Y19A 3MRMA 3MRPA 5DVNA 4OCYH 3T0BA 2FHFA 3MJ7B 4EVNB 4OSUL 1N3NB 5E8PB 1KXQE 5E94B 2LAAA 3QO0B 1FSKB 1FPTH 3VXNB 5IG7A 3GKWH 4NN7B 4PJXF 2X4OB 2BVEA 2BVQA 2ZKHL 3FQXA 3OGOE 3U2SA 4QHNB 4LVEA 4WEBH 3BKYL 3REWA 2BK8A 4AK1A 1JWSA 5D7IA 1P53A 3MNVA 4JRXB 3WFBH 2CKBB 2AVGA 1P4IL 2FSEA 4G8GB 4MD0B 4NQTA 4PJHB 5D1XD 1W72B 4YFDB 2UWEA 4HIEB 1U6AH 1TJIL 1YYML 5J56B 3EDDA 3RWJA 5KN5A 2C3HA 4Y5VA 5JDSB 5D96B 1E6JH 1RZKH 1HXYA 2BSSA 1HH6B 2YXMA 3QUKA 4XBPA 3UYPA 43C9B 5C0FA 4KZEL 1PSKL 4FOMA 2N7AA 2OTUA 2WUBL 3BW9B 5GGTL 3H7BB 3N50A 3RUGA 2AERT 2GT9B 3L3HA 1T1YA 3PDOA 2A6IA 4K3JL 5I6XB 5F7DA 1YY9C 3K4AA 4RX4A 1RZGA 5DSCA 3IXAB 3CC5A 1ZLUH 4NO0D 2DLHA 2BFVL 4OKDA 5FDWB 2DBLH 2PYFA 1A9EA 5FYJL 3INUH 3MLTB 3GSUA 3O4LB 5FGBA 4O2FB 4JO1L 5JXEC 4LAQL 5JLZA 4L4VB 2OJEB 1J12A 1LO3H 4LCWB 3D3VB 3GMMA 2BNQB 3MBEB 5IVXB 4LPYA 1LK2B 5TQ0H 5F96L 1CBVH 3D85B 4X83A 3FT4B 4G7YL 4XGZA 3FT3B 3PWNB 1ND0A 3NIGE 5D9SA 5CMAA 3WMSA 4EUPH 1F6LL 4JY5L 15C8H 3MRRB 4GUPA 1YECH 4WV1A 2ESVE 1RV6X 4YLQT 2ZP0T 3NPZB 1Q1JL 1KJ2L 5SX4H 3OJVC 5CKAA 3NCYS 4HIHA 1A7QL 2GY7B 1F3DH 2R2BB 2R39A 2QQLL 3CLEH 1UB6B 3UO1H 1LO0L 5K9KA 4XAKE 1AJ7H 1L7IH 1GGCL 4ESKA 4JB9H 4NKOB 4OF0A 1IE5A 4PRNA 3QIBD 1HHIA 5JIPA 4JO4H 1X5HA 4J3OC 1A1MA 2DQEH 1KIPB 1U95A 2EC9T 4NHUB 2IAMD 1KJVB 3QDMA 1RUMH 1MEXL 1CDCA 1S9XB 5KSBB 5F7UA 4N9GA 3OAYH 4JN2A 1CIDA 1X5XA 2NZIA 5IJVB 3U30C 5TPWL 2A9NH 1BVKA 4FZ8L 4M3JA 4EN3A 3D39B 2FJHA 3EOYG 4I0PB 4IJ3B 2VXSH 5JORB 4G42A 5I1CH 4P2RE 5A1AA 4KTEL 3IDXH 3BP4B 2AEQH 3T0EC 1Q94B 5IK3A 4AY0A 5KSAC 3TBYA 4PGZA 3LS5H 4HXAL 3LKQB 4HPOL 2KQNA 1T3FA 1S8DB 1FZJB 5IEHB 4KC3B 1CE6B 2B0SH 4MNQB 3BRDA 3FFDB 4BQBA 5I1KL 2Y5EA 1U2CA 3GM8A 4KWUA 5BO1H 1OB1B 3DO3A 2FX8L 3ROOA 1QBLL 3BD5A 1XIWD 4U1JA 3BH9B 4Z7OF 3X11A 4DEPC 4YEEA 4JJHA 5HYJE 3D69A 1ACYL 5DVLA 1MRDH 1F4YH 2C4FU 1R5VB 3VWKC 4HGMA 3MNZA 4L3EA 5D8JL 1XR8A 2VKXA 3EYSL 3CMGA 4L4JA 1A7OH 2JCCA 3NCFB 4G6AD 4ZDHA 1VFBA 3P40A 3MPCA 4P23B 4XCYA 3VH8A 1GZPB 3AU1B 3D48R 1GIGH 2BCKA 2NY3D 3O6ML 2DQUL 2PXYA 3HS0A 5SWSD 3ZDXE 2R69L 5CJQH 2A83B 3JSSA 4KTDL 1X4XA 4DTGH 4NN6B 5K59F 1SJXA 4E5XB 4HIXH 5DI8A 2WBJA 2VMFA 1IGCL 5B8CC 5CILH 5CAYB 1YEGH 3O8XD 1C8PA 3P4NB 4XP6H 4M03A 1IZKA 1S7QA 3WEXB 4WGWB 2QQNH 5TDOB 4HUXA 1XIWC 2NY5C 2FR4B 1DVFD 4M1DL 1G9NH 2R4SL 4H25B 4PREA 3G6DL 1OGAE 4NQUA 3UROR 4PS4H 4MA7L 4D2NA 4FZEH 3BP6A 4PJHF 5DHVA 3QH3B 4XNZB 2H8PA 1OSZA 1IC5H 4JN1L 3LQMA 3V6ZA 4NO5B 4Z7UA 1BFVL 3VXOA 4LLUB 4MX7A 4AMKH 4M6ML 3EHBD 3P30L 4G6AC 1GOHA 1P4BL 4J3UA 1RJZB 4OZFA 3O3UN 5DRXB 3QCTH 3B6SB 4Q9QL 2B4CL 4N5EC 3L5WA 2VXTL 5E9DD 2Q8BL 2WAHA 4TUJB 2Y6SC 1XGUA 5IW6A 1U8OB 1YMHB 3V4UH 3P77A 3ES6A 4M7LT 2X1OA 2X4QA 3VFOA 5KAQG 1N5AA 4M3KB 4PV9A 3S35X 3O8XC 4L3AA 4A2LA 5JXEA 4PJ5E 4JQXC 1KCLA 3MFGB 2XTJB 4N0CC 3VGAB 4RNRA 2X7LB 4FMFA 5BOPA 3CSYB 1PZUB 3ZDYE 1UXSA 4LLDB 2C1PA 3KHQA 3NAAH 4RMRA 3SPVB 1XH3B 3LN9A 3OG4B 4G8FB 4WO4D 4GQPH 3SJVE 4X8JA 1BLNB 2XWTA 1MNUH 4M7ZC 5FGRA 3ULSA 3IF1A 1G6RH 1H8SA 1YEJL 4J7RA 4K94L 3NH7L 2H6PA 2IEPA 4HQQH 1AGEB 1KV3A 2CH8A 4Q9CA 4ZPVB 1Q72L 1OP3H 1HSAB 1T4KB 2FH6A 1D5BB 4HMDA 3DURB 3LDBB 3DX9A 5DUPL 3I02A 3UTSD 4J6RL 4HGKC 3QG7L 43CAA 5E1AB 3UAJD 1FN4B 3H6JA 2A77L 3B5TA 4K7FA 4RDQG 1CE1L 4GG6E 5TE6L 5ADOH 1MCIA 4Y4HC 5DO2C 3FB5A 2FLRT 1J1OL 2GJZB 3W9DB 3C8KB 1XAUA 3EYFA 1BFSA 1CQKA 2IFGA 4OD2A 5DD3H 4AL8H 1G9MH 1LEGA 1QSFE 1WGOA 4LPTA 1U58A 4B50A 2VQ1A 2XWJB 4NUGL 4DVBA 1IFHL 5F9WC 1TVBA 4G9FE 1MCPH 1CFQB 4X7CC 5EO1B 4RAVB 2XZQL 2X42A 4QNPF 5F9JB 2DQFB 2FEEI 4HCRA 1RJYA 1QG3A 4JY6B 4RQQA 2WK2A 2X41A 3T0EA 1DBKL 1XEDA 1JMXA 2ADJA 3FOLA 4XTRC 4G7VL 4XNYH 2DMBA 4NBYB 3RWHA 1UWXK 1T1ZB 1MOEA 3V5HA 5HPMB 3CDCA 1JHLH 3B2UD 4CN1A 4J8RA 1OQXA 3LKPB 5ETUB 4QOKD 5F3HB 1TITA 1M05B 3I75A 3CZFB 3VFWB 3T1WA 5C9KA 3SO3B 2FH8A 2HT2C 4FFVD 4YDVB 4HWUA 4JFYA 3D25B 5FCUH 3H0TA 3VWKA 2VDPH 1SMAA 1OPGL 1IMHC 4ODSH 5DT1L 5L2KE 3JV6A 3WIFB 1JYNA 1ZT7A 4LLWA 2WIIB 5ICZB 2IG2H 3MLXH 3M17A 2XZAH 4QTIH 2I26N 4F15C 3L9RA 4XCNB 2IPKB 5JIKA 1HEZB 3OL2A 4XWOD 4WEMB 4YO0B 5ESVA 2GJ6D 2F5AL 3RVUD 4MQXC 3DMMC 1DQLL 5K9OB 3CVHL 4H8WH 2D9CA 2NNAB 4KVCL 5D2LE 3ARDD 3GMQA 2PW2A 4QGTA 3WO4B 3TIDA 4KJYA 4Q6IB 1OAXL 1MCCA 1IGTB 2CKBL 3B2UC 3MJ9L 5IEKB 4R8WL 2ZG2A 3WLBB 1S9VB 4JAMA 1W72L 4RGNB 1KJ3H 4BJLA 3OXSB 2D7TL 4O02L 2QQKL 2R2HB 3FONB 4P5TC 3RPIA 1WBYA 3P11L 3C60D 4Z76A 4XP1L 4HJ0D 5EA0H 1GPOL 3QZWA 2FWOB 2IFFL 3FN9A 3ULUD 5FCSH 2ZUSA 2OR9L 4HFWB 4ALAL 2CXKA 4W70A 2HN7A 2JKXA 2UZXB 2X10A 1JNHA 4P4KB 3D2UD 2W0KA 2VC2H 1S7VA 2NY1B 5F89A 5ISZB 2AK4B 1LDSA 4KUZH 2DDQH 3ARDC 1UCTA 3MRIB 4S1DC 3LQAC 4GLRH 4UB0H 1GHFH 1QSEB 3WFHB 1A3LL 4KHTH 1QVOA 4ZUTA 1MAJA 3FFCB 2Y07H 4OIAA 1ETZA 2ZUXA 3QQ3B 4PGDB 2VDKL 3OKEA 5GGSY 3TZVB 1RHHB 3PV6B 2EKSA 4JFXB 4HUWA 4LCYB 3FO9B 3T2PA 3MV7D 4OLZL 2CDGB 4PRAB 1JNNH 5I8CA 3KNBA 5C0CA 1CLZH 1URLA 2YN5A 2W1NA 5IF0B 1HNFA 3RA7H 1JNLL 3LQZA 3C60C 1A5FH 1T21B 4HJ0C 5GGSB 5LGJA 3UC0L 3T1FA 1S5IH 2DQJH 4QHMB 5F1OB 1JK8B 1FRGH 3W9EB 4UI2A 4R2GC 3G5VA 1ZTXL 5KOMC 4APQB 7CGTA 5EU4B 2OTPA 3EO0A 1FFOB 5T1LA 4YDJB 3HI5L 3C5ZA 3LV3A 4FTVA 3CX5K 1MFAH 1TQCB 4NPYA 1QFWL 3UJJL 1P6FA 1I9EA 4JM2C 1NUGA 4HBCL 1I9RH 3O6FC 4X6FB 5IMLA 4J4PD 4WWKD 2W65B 4WI8A 1E4XH 3QDGB 3HE7C 4PY7B 4Y1AB 2H2SD 4OQTH 4PJDE 4Y4HA 1NGYA 3WLWD 1IGIH 5HI5C 2ADGA 4HS8H 5E2TH 2COQA 4PJFB 4JDZA 2VWEE 5CKGA 4DKFL 2YBRB 5JHDE 3FAWA 4TUOA 4JZOA 3I2CH 5GHWL 4DN3H 2R0LH 4GRLA 1FNEB 3S98A 3WN5A 4YR6A 5FYKD 1FYTE 1EHAA 2WP3O 3QISA 4KK6D 2YPVH 3BWUC 4N8VB 3SKNB 2ICWI 2MCPH 4UDUA 5ECJE 3QFJB 1HHHA 1A4JA 1VSCA 2NY6B 3JV5A 1U8NA 1ZANL 1K4DB 4WI4A 1DEEA 3WFCH 4K2UH 1TJGH 3A6CH 4J4PC 4N0FB 4WWKC 3TPUB 3IKCA 4RGOH 3SDYH 1ZHKB 1EAPB 4NFBA 4RIRB 4Z7VB 1NGWB 1WZMA 2AV7A 3Q5OA 4H20L 1J8HD 4HBQA 1IEBB 3V7MA 3WLWC 4ZD3L 2E7LC 3QIUA 2YUXA 4IRSA 4Z78A 3D18A 1MLBB 1F11B 4KDVA 1IM9A 3VFUA 1XGTB 2P42B 4G9DB 2EDWA 2EIBA 3FRUA 4HWBH 4M6OL 1P5UA 5M95B 3NVQA 3MSPA 3HZMA 1A14L 3KWWA 4XCCH 3WYRA 2LV4A 4IMLA 1AP2B 4I48A 1NFIB 2F19L 3QHZL 4V1DD 5HGDB 3TM6A 2P46B 1GGIH 3SDCC 3NA9L 3T09A 4OCRL 1XCQA 5JR1H 1JFQL 1GH7A 1I85A 4LVHB 4XVJL 4U6HB 1S7XB 3DETD 4LNVA 1UWEL 3S5LA 3SY0B 1WV7T 3GMLB 1EEYA 2JTDA 5IV2B 3SBWC 1M6OA 3C5SB 2IBZY 1A3RL 1BEYL 1YEDA 1BZ9A 3H9SD 4PRBB 2BXYA 4P5TA 4NKMB 4QY8A 3TH3T 2RCSL 5F7KC 2X4TB 2IH1A 4R7NA 3VI4E 1OAUL 1HILB 3OR6B 3TFKD 4CVWA 1LNUA 3EOTH 2ZSWB 4BK5A 3TP4A 2XQYG 4HKXB 5C0RL 3OB8A 2ZJSL 4FQQB 2X70B 5E4IA 5E99L 3MRJA 4PY8J 2IWGA 2F8XC 5GS1B 4MJ5A 4R0LC 4M7JL 3HAEG 1KN4H 1MI5E 4ZO6A 3DO7B 3P73B 1CWVA 1PW3A 4MHHI 5T3ZD 5ACLA 4YHNA 2V7HA 2V7NA 3U4BH 4YBQD 5BZDB 4I2XA 5J12B 3ARFB 5CWSB 1QFOA 4YXHH 5DURD 2X4NA 3KYKH 4A6YA 3L6FA 1GZQA 3DETC 5IHZA 2BOBA 3HMXA 1IILE 4M48L 2E9WA 5GRWA 4FQHA 1T1WB 2ATKB 1OAKL 3NIDE 1J0JA 1D6VL 5J3HD 5EB9A 5GGVH 4EDXA 2YEZB 3QUYB 4KPHL 3I6KB 1RK1B 3B9EA 4Z9KB 3TJEL 5BV7H 4Y16A 2X6MA 3BE1L 3RZWA 3KYOA 4NQXB 5J9PB 4JHWH 1ERNA 2H2PD 4HLZH 1FZOB 3DX8B 1TZIB 3WE6A 4F80A 5I1LA 1QO3A 5C8JA 1A7NH 2GIYA 2IANB 1C5CH 2W0PA 3EIFA 1NC4A 2P8MB 4RSVA 1ZHLB 1NFDA 5DTFA 4I3SH 2OL3B 5MEPB 1SEBA 1FIGH 2O5XH 4Y8DC 5HGGS 3MBXH 4NM8L 1FL3A 1FFPB 2VSCA 1PZ5A 3O6FA 2YPKA 5CBEA 4X80L 4Y2DC 3K81A 4JVUA 1A2YA 2W9DH 1WAAE 3GSNH 3HE7A 3OPZL 2E27L 2EC9U 2BHYA 4M5ZL 1K5NB 4HIIA 1YEFL 4MJIA 1R3HA 2MTPA 3MGAA 5IT2H 1AXIB 5EZLA 4YZFE 2CDEA 5KVFH 3ULUH 5HYSA 5B38G 3DNKA 1PY4A 5DR5L 4DCQB 2PO6C 3CX2A 1BBJB 4KAQH 2EZ0D 3WIHA 4Z77B 5T1DH 3F7VA 12E8L 1IQWL 1KT2B 4HKBB 1N8ZB 1NFKA 3QEQA 2R0KL 1N4XH 1AE6L 3T4AA 4Z7QE 1QFHA 3BPOB 4XPHL 5BRZD 5DD5H 1GJIA 3VW3L 3UX9B 4F58L 3MRHA 2CLVB 2HYMA 4MCYA 4FA8A 3FQNA 3KJ4B 3NPSB 3IU3A 5E03A 3ZKMD 5D7KD 1AI1L 2Q76A 2VIRA 4HH9A 5FUOL 4LIQE 3D0VB 5SWSE 1EZVX 1FYHB 1OAQL 4Z7VF 4ZO7A 4GS7C 1U8JA 4P2RB 1ZKAA 1NEUA 3SDDD 5EUOA 2NY4D 1V7NH 4LPXA 1I3VA 3LEXA 4JFFA 1GGBL 3T77A 3O6LH 2J88H 1MJJB 1T5XA 4YDLC 3MFFA 4R4FH 4KMTH 5L6YH 3EFFA 4KQ3H 1U3HD 4LHUG 2AW2A 2Z31B 4JPKL 1KJMA 1CGUA 4ZFOB 3VFMB 4LKCB 2FO4B 4RFOH 1TETH 4MQTB 2EZ0C 3MCLH 5HHVL 5HGAA 3QO1A 4WIQA 3O3DA 3GJFB 3FO2B 5HYJB 4MD4B 1AIFA 5EOCL 4XPGL 4WI7A 1KC5L 2I9LB 5C0AA 3RY4A 1X5KA 3TCLB 3O6KH 1EXUA 1DBBL 1A4KA 4GKSA 2YKLL 4CL7A 4G8IB 5CP3A 4P46A 3IU4L 5F1IA 4DZBB 5E9DE 1AGCA 1WBXB 3CX5J 5BXFB 2GK0A 3BXNB 3U36B 5FYKH 4NNPL 1CZ8H 3SDDC 3VFGL 2C7UB 4KQ4H 3TYFA 2OCFD 4K3DL 4AQ1B 1WTLA 2BMKA 2OI9B 4BFIB 3LEYH 2CKNA 3KLSA 4FQLL 4OLUL 5C0BD 1GXEA 3IFLL 1Y6NR 3DPBA 1U3HC 2E7CA 1KPRB 1VADA 1D9KB 2C3VA 4XVSH 1MHEA 3LD8C 2AJZB 2B2XL 5FKPB 3S88L 4GAGL 2X4RA 4V2CB 3RVWD 4LARL 1DR9A 1FBIH 3OZ9H 2O5YH 3X3FL 1ODAA 4GAJH 2QL1A 3KPPA 5GZND 5JOFB 2MHAB 5EORL 4LRIC 1JMZA 4TNVK 5I71C 1OGAB 3R0MA 5CD5D 2MPAH 3UPCA 1CG9B 1P84K 5DMIH 4LF3A 1YYLH 3QFDB 4PLJD 8FABA 2AEPH 1Y6MR 3ZYIA 2BJMH 1ZMYA 5LAXB 1ONQB 1J0IA 4DQOH 1KNOA 5C6TL 3QQNA 2UYLA 1I7UB 3SE4A 4L9LB 3PHQB 2NTFB 3F5WA 4I5BB 4O58L 1TQBC 4UV7H 1S7RB 5HHQA 5CJ5A 3F12B 1JGEB 1MREH 2HKHH 4XX1G 5C9JB 2HFGL 4HLZG 3RHWF 3Q6GH 3W11C 1CK0H 4YGAB 1EUTA 3VXRE 5CJ8A 5JQ6L 4PJ5B 1NBVH 1XF1A 3P4LA 1LE9B 3RDTD 5IKCA 1UACH 3GIZL 1JV5B 4X9GA 1JHTA 4XXCA 5GZNC 5L2JB 2NPLX 4Y2DA 1LMKA 5TFSL 3TESA 1CD1B 5HHPB 3ALXA 3QYCA 4PJCE 3B3IA 1H8OA 4ELKA 4QF1A 4RGMB 25C8L 5EC2A 3SJVB 3HI6L 3VCLA 1KIQA 1RMFL 1F3JB 4HJJL 4EQ3A 4AIOA 3NIGF 4M6AA 4ZSOE 1JZ2A 4Z7WA 4OAWA 2F53E 4CNIB 2RFXA 5E4EC 3KPMA 4WENB 3DUUA 2Q3ZA 5DJXB 3WHE1 1VGKB 1X5JA 2PO6A 4QOKE 3DIFB 5I8OH 5H94A 5SWZD 4OZIE 5E5MB 1UYWH 4WHTB 5JIIA 1F02I 5T3ZH 3AREB 2YZ8A 2WBJD 1Y18A 1RUQL 2A38A 1Z9MA 3KPRB 3WJLA 3VG0L 3EO9L 2XY2A 1BQHB 1WEJL 2P5EE 5AD0B 2CQVA 4X6DE 4GG6B 4LLYA 1VPOH 4PRHA 4P99A 3DBXB 3PGCA 1EHLL 1OW0A 2I07B 2CRIA 2EDFA 3RL1B 3NIFE 4OGYH 1QSFB 3WD5H 4EI5D 1Q0XH 3DTXA 3CFEA 3H2WA 3QCUH 5IHUH 4YHML 5MENE 5MI0B 4G9FB 1OM3L 2Q8AH 2FEEL 4JFDA 4U05A 1DLFH 4OT1L 1T89C 1DUZB 1UVQA 3O2WL 4ZFGH 4OLYH 1T2QL 1AY1H 4NJAH 3LAFA 3GNML 5EPMB 5FF6A 4I4WB 1JRHI 4U6VH 3RJDA 5JZ7D 5E6YA 3VE0B 2I60L 2FEDD 1JWUA 2DMKA 3OKKB 5MERA 1CGYA 4OCSL 4B0MM 5J6HA 4LKXA 4WI2A 5HHNB 1BM3H 1OAZL 3HLAB 1MHPH 1AFVH 2X4PB 3B5GA 3QQ4A 4JZJC 3MROA 3TN0B 1RQ5A 1PG7H 4HFUH 4EUPB 3VFNB 1K8IA 4P4RA 5I30L 3CUPA 4KI5F 1KF9B 5CLTA 3S4SA 5I1DB 4U1GB 3MRKB 5FO7A 2PW1A 3ZYZA 3ARYA 1UG9A 4BSVB 1HQRA 3HG1E 5I1HH 5L2KB 3ULUE 5HHOE 4OZGA 1J1PH 3BOVA 1BP3B 3WFDH 4KUCD 4R96A 4OV5B 1DDHB 3VRLE 2EDKA 5DD1L 5D4QA 3MLSL 3ZE1E 2Y06H 2VLKE 4WUUA 5AG9A 5GRVL 4YHYB 1A3QA 1BIHA 3F65A 5A40E 1YY8A 2R1YA 4PUBL 2CLRB 1RURL 4PGCB 3T08A 5D2LB 1RSFA 3DWTA 5HHXH 1UKTA 1EUUA 4Y0GA 3QI9D 4QXGL 1YNKH 5K9QG 5TDPA 4BH8A 1UJTA 4U6XA 4QTHB 4KKAC 1AGBB 4QRUB 3MV7E 1RFDH 4IOSD 2IQAB 1AC6A 2DYPB 4XNMB 1NJ9B 1B9ZA 4JLRA 3P0GB 3VWJC 3OR7A 2GAZB 3UTQB 1OT1A 5C0JB 1B2WH 4U7MA 3QA3B 2V2WB 1AKJD 4MSWB 2DQTL 3IFOA 3MRNB 4XT1C 4JRYE 5FUCE 2APBA 4GMTH 3VJ6B 4PTTA 4JM4L 2AJYH 2EO9A 3G6JA 5EU6A 1RZ8A 1S9WA 4WJ5A 1NLBH 5C0IB 4XAWH 3V6FA 4XCEA 4HG4J 1WF5A 1BBDH 5T5FL 2QR0A 4ODXA 3BQUC 2FZ3A 1B0RB 3UBXG 3I9GH 1NCCH 5JW5B 2D3VA 5BZWA 4RCAA 5E8DH 4RISL 1T5WB 3MLWH 4M02A 1F4XH 2DI8A 4Z8FL 3QI9C 5ADPL 1FNAA 4NM4L 5GRJH 2OL3L 1UM4L 3AM8C 4DVRL 2HG5A 1JJUA 2X1XR 5EN2B 5GJSH 5CZXD 1N0XL 1RUPL 4JO3H 2HVJA 4CVZB 2DQGH 4MNHB 3BKML 1JN6B 1TLKA 2HJFB 4Z95H 3MV9A 1I8KA 2O5ZL 1FJ1B 2D7MA 5FFLA 4MA8H 4QGYA 5FYKE 4WDIB 2PR4L 2AQ3A 2ZUQB 4AG4H 4L8CB 1X4YA 2DQHH 4XMPL 5L0QC 1RIUL 5AWNL 4PJ9B 1T0NA 3WJJA 2ADFL 3S36L 1CT8A 3VXUA 1H15B 2Q6WA 4X98A 1I8IA 1U8KA 3QIWB 5D7SL 4GLRI 2OLDA 3I3EA 2V5MA 2QSVA 3U7YH 1AQKL 1K8DA 4TULL 4MCZB 4RAUB 1Y0LA 3MOAL 1F42A 4AQOA 4KY1H 5IFAH 3R8QA 4M9PA 4Y4KD 5GIRB 4NZUL 3GKZA 3WS6C 1FLRL 4PJDB 1L6XA 2A6KA 4Y4FA 4ZO9A 5C07E 2B1AH 4MZ3A 1NBZA 5DA0B 5ANMA 5J6GB 4ZNCD 4TVSa 4GG6F 4PB0L 5DMYA 4EZMA 4ZPTB 4O5LH 4ZOBA 4ETQA 3FQTA 3H3KA 2HAZA 5C08D 2EXWC 1CLYL 4PGBB 2VL5B 4I1NB 5JW3L 2Y72A 4UAOB 5J13C 1KCUH 1YEEH 3L3GB 1FCCA 1FYTB 4G8EA 5KAQF 1KLGB 4M1CD 3IDMA 3NCJL 1QYGL 2Y23A 3CXHK 2UZYB 4ZAKC 5JW4R 1P84J 3BPNC 1MPAL 3V95A 5KVEH 4O51A 4RFNC 4QT5A 1X7QA 2VAAB 3UTZB 2OS7A 4OCWH 2VZ3A 1VEPA 3SKJL 4ORGA 1YEKH 1A1OB 4PP2A 3E0GA 1IC4L 5EUKB 1QLRB 2DQCL 4JANA 2EH8H 3R8BB 1OD9A 4GW1B 2D31A 5DHYB 3S37L 1JPSL 4YJZL 1FQ9C 5AYQA 5EBMB 3QUML 5E5UB 1NCWH 4PRPE 5IVZA 1TVHB 1WZ1L 4C56D 2EDRA 4QHKI 4HS3A 1IT9H 5EC1A 1G6RB 2EYRB 4MXVF 4R26H 3CFBB 5IQ9A 1BIIB 2O61B 1JZ4A 5GGTA 5C0CD 5D7JD 1ZVHA 2YPLA 5E2WH 3DGGB 5JUEH 5EZIL 3G9AB 4W81A 2VDML 1VACB 2B4CC 2ZKHH 2EIZA 5T3ZE 2XOTA 3OXRB 2Y5TB 1XGPB 1HSBA 5A16A 3BKYH 2P45B 4M1CC 5D1XB 4JDTL 1J05B 2ERJB 4RDQF 1P4IH 3BDYL 3M1BB 3HNTL 1F90H 5D2LF 1IZJA 1Q0YL 4WRLA 1LE5B 3BEVA 5I76A 3OAUH 3V5KB 3L7FA 3OHXA 2XN9E 2H9GB 3EJYD 2WUBH 1AGDA 1YPZE 4NJ9H 4BSWB 3ZDZE 3U4AA 3HKFA 3RTQD 1NCBH 2VN7A 2J8UE 4NO0B 3G6AA 5TF0A 2HTLD 3VI3E 5JMOC 2CDFB 4FQ2H 3HZVB 3UEZA 3A0OA 4OBSA 3Q1SH 1C5BL 1NGPL 2NMSA 4X5LA 4X5XB 5D7JC 2CIKA 3FJTA 2QHRH 5HHMD 1MSPA 1M7IA 2XV6B 4N0UA 3RHWK 3DI2B 5ESAB 4HKJB 2F9BT 2EECA 4K94C 4PB9H 1YN7B 2EYSA 3BQUA 3LPWA 1MI5B 3VXPA 3W82A 1EDQA 2WINA 1Q9OB 3TT1L 5C0DB 2DTML 3MV01 2FX7H 5DJ8B 1JYXA 5FYJU 5T5NG 4X6BB 4FABH 5HGBA 3GSOA 4DGIL 1ZLVK 1JGVH 5F96H 2X1WL 4G7YH 1JWMA 4F9PA 2HH0H 2JE8A 4JY5H 2CRYA 3QXDB 1CFNB 3HRZA 1Q9KA