4LSUL

Crystal structure of broadly and potently neutralizing antibody vrc-pg20 in complex with hiv-1 clade a/e 93th057 gp120
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
203
structure length
203
Chain Sequence
b'SALTQPPSVSGSPGQSITLSCTGASTSVAWYQQYADKAPRLIVFDGNKRPSDISSRFSGSQSGGTASLTISGLQSEDEAYYHCNAFEFFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 CLADE A/E STRAIN 93TH057 GP120
publication title Multidonor Analysis Reveals Structural Elements, Genetic Determinants, and Maturation Pathway for HIV-1 Neutralization by VRC01-Class Antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 43
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lsuL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lsuL02
3JV6A 5HI5C 2Z8SA 3KPMB 2OK0L 5TE6L 3ARFA 3BE1L 5E95B 3W0WB 3ZT6A 5I1JL 2W0KA 4PBVC 3C08L 5HY9B 1NCUA 4NFBA 3PWNB 1DQLL 5LQBL 2YPLA 1R5IA 4WI6A 1ORSA 4X0KB 5C0AE 2X4SA 3TZVB 1EZVY 2XG4A 1FAIL 2Y23A 2I9TA 4Z95L 2VR4A 1MVUA 2YS4A 2FX9H 1NCWH 1Q9OB 4K9EC 4R4BA 1P69B 4I18B 4KK8C 3GKWL 3QIWB 5L8JB 5IW1A 1BM3H 1SY6L 4F57L 3KPRD 1E6OL 2Z91B 4M3KB 3CX5K 1G7PB 1MWAA 1EBPA 1YQ2A 4DK3A 1NGZA 1M7XA 5GGVY 4X6DA 1FYTE 2D7TH 4GQ9L 5SX5K 5CGYC 3BEVB 4KROC 3L3OA 1FNGA 43C9A 5EZLA 4QWWD 3FZUC 4Y4HA 5C0FB 3P9MA 4M1DL 4H0HB 3IKKA 1DJSA 5E2UH 3VW3L 5SWZB 4K7PY 5E00B 2D7NA 2AJXH 5D1XD 1S9XB 3BN3B 1C12A 4CW1B 2LE9A 2Y07L 1UKQA 5KG9A 5L9DH 2XT1B 2YD3A 3TYGH 2E27L 4HHAA 4PJFE 4NZJA 3MRHA 4OLYH 4P2QE 5HDLA 3NZHH 4LLDB 2BSTA 1EEZA 3DRTB 3LPGA 5D71H 4LAJH 4X4ME 5I1LA 4B7IA 4PJXE 3ULVC 4Z7QF 3ZYJA 5DFVD 1G9NL 1BQLL 2YXMA 1PSKH 4PJIE 1CGSH 5KJRL 3C60D 5HHMD 3Q5OA 4Y1AD 4QRRA 5DR5L 3DUSB 1LNUB 3IXTB 3Q5TA 4G6JL 3NIDF 3V6FB 4XVSH 4WFHE 1GOFA 1XZ0A 5ITBL 5JHLL 4GRLD 3S37H 2AJZB 4P46B 3TNNB 2R0LL 3ARGA 5L6YL 1G1YA 3MZGB 1B6DA 5EU6B 1LD9A 2Q76A 4GW5B 4PJBA 3Q3GB 1S8DB 1OAUH 4KK9C 3JUYA 3VWJA 2VXTH 2NXYD 3X14A 3O6FD 3F6IA 2CRMA 2XY1A 2X1XR 4O02L 4HKXB 4DZBA 4FG6D 1QA9B 3OAUL 1JZ8A 1CDIA 4LDLB 4ZDHA 4D0DA 1PKQB 3HI5H 3QWQB 3H9SD 3C5SB 2CDGB 4OZGE 4LVOB 1XFPA 2AEQH 4MAYD 2WBJD 4WO4C 4RMQA 2NYYD 1QLRB 4LPWA 1ADQH 2DJ4A 3FT3B 2XN9D 4RIRB 2P5WB 4LGSB 1WSST 1UACL 2XTJC 4JFFB 5F89B 4TVPD 2CDFA 4P9HH 3F62A 3NZ8A 4UIMA 4LLQB 1N6QL 1NBZA 2HVJB 3BZEA 4MMZC 3LKOB 1HKFA 3SE9H 2FGWH 4LCYA 2Z92A 1KPRB 3EO0B 2PTTA 2HYMA 1NBYB 3HNSH 5C0BB 4LPUA 1ZLSL 4DKEH 1UYWH 5DRZA 1QO3B 5JR1H 1QBML 4L8SC 2RCSH 5J57B 2FCBA 2PW2A 1JGLL 5DYOA 5JOPD 3MRCB 2CGRH 2HJFA 5HHPA 1TZIA 4OAWB 4PJDB 4ZUSA 3IDGB 1KTRL 4HUNB 4XBGB 3ZLQC 1I8KA 1RU9L 1XCQA 1MI5A 5T1DH 2GTWA 4F7TA 3I3EA 3MRLA 4LCCA 3TBSA 4LSPL 5CJOH 5DRNA 1CFTA 2OCFD 1I9JL 4NWTL 1ITBB 1MIMH 2Z93B 2DQEH 1MHEB 1AGFB 3E6FA 3HUJB 5D2LB 5KS9A 3JWOL 2BHUA 3K2UH 2R4RL 3KYOA 5J3HD 4B5EA 5EUOA 5HHQB 5CILL 1L6XA 3QDGE 3H3PL 5CKAA 3NAAH 1U8QA 3PWPD 3OGCB 4YE4L 3PQYD 5DHVH 5J9PA 2F53B 4JVUA 4UOW1 1H5BB 5D7KD 3FN0H 1HZHL 1ETZB 3OKKB 4NO3B 4QRQA 1AXSA 4NKQB 5CJXC 3HLAB 1Q1JH 2Z31C 1U95B 4GXVH 5GSVA 4YXHH 3VGFA 3VRJB 2XPGB 5DSCB 1C5DA 1JZ6A 5J4MA 2X5PA 5J12C 3TO4D 2G75A 2ZJSL 3ZTJG 4E41A 4P2OA 1IGTA 2EKSA 4U0QB 3B9KC 3O3DB 4G8EB 3SE8H 3Q1SH 3GNML 4Z18A 5H94B 3VGAC 2GTZB 4XPTH 5DJYB 3NN8B 1P9MC 3ZSSA 4JN1H 4OIIH 3IETB 4UTBH 2EO1A 1AGCB 1RUKH 4EVNA 3UAJD 1JNNH 3GIZL 4IRSD 1LMKA 4KUCF 4K23H 4MLSA 3UYRL 1DN0A 4XRCB 3VDAA 3LQAC 3L3GB 2VZ1A 3W11D 1FN4B 3Q0HA 1IGYB 5DJ2B 4HGWB 1T03L 1P4LA 3RJQB 3DURB 1B0RA 5IJVA 1MRDL 4P2CG 4LHUA 5CJ8A 3MJ9H 3QULB 5BZWA 3V4PH 3LB6D 3TJHD 5CBAA 2JCCB 1W0VB 3BKJH 1LK2B 1QACA 5GGVL 1PGRB 4XCCL 4ZO6A 4WWKC 3EOBB 4FOMA 3UZEA 5IG7B 1JPSH 5D7LA 3FQUB 1TVHB 1JTOA 4PRHE 4NGHL 1ZVSA 5TDOB 1MCNA 3IJHB 1S9VB 2GHWB 1FNFA 2EDFA 3MRKA 1A3LH 4ZNEE 4V1DD 2XQBH 1T7WA 4K7PL 5FM5M 4HDIA 2G2RA 1T20B 4OM1L 3S4SB 1CD1A 1JWMB 4L4TB 1HIMH 1X5KA 4XMKH 4PLOB 2FBOJ 1GJIA 1N64H 4HKJB 1EJOL 3U82B 3QUKA 3HMWH 4J12A 4NM4H 3SJVB 1MRFL 1P84K 2A77L 2APWA 3PXHA 4QCIA 2DQIH 4GG6A 4WI7A 2YZ1A 4TVPL 1AGBA 1RK0B 1YYLH 2C3VB 2X6MA 4LCUB 4MYWB 1RULL 3NFNA 4H0IA 4AG4H 4MDJA 1N3NB 3DLQR 4LPXA 4GS7C 1ZHBB 1ZLVK 5JXED 4M7LT 2D4FA 2A6JA 1I7RB 3RVXC 1DBKL 4ODSH 5K9QI 4OF3A 1V7NL 2HJLA 2WWKO 3SKUD 3OKDA 3UYOD 1JWSB 4HS6A 2DQDL 3HG1A 1MJ7L 1C08B 4OLVH 4U31A 3SGEI 1CE1L 5JPMA 3BDYH 3LKNB 5IHZB 4NKDB 4I9WD 4H88H 1T2XA 2X1PA 4PJEE 4XAWL 5GRVL 3BD3A 3JV6B 4M9PA 5CEYB 1JE6A 1IBGH 1HHKA 1LE9A 4WEUD 3ARFB 3ARBD 1IT9H 4X9IA 2YPLB 4PJHF 1R5IB 2YA2A 4IJ3B 3CMGA 4GJTB 1ORSB 4H1LB 5AYUL 5CZVL 3DUUA 4Z7WE 4MA1B 1I1YA 2X4SB 4LBEA 4NQCB 1JZ3A 4G8GA 1MVUB 2R1YB 4JZNA 4N5UA 4X7DC 1TPXC 4HD9A 1BMGA 2BVPA 3K0WA 4PP2A 4R4BB 3ZL4L 2MKLC 2YWYA 4FQQA 1OP5K 3DJ9A 3UPRA 5IW1B 1GC1L 1OARH 4AL8H 2EIEA 3DYPA 5KW9H 3KYKL 1CVRA 3MNVA 1JHLH 3EO1A 4U1SA 5EZJA 1MWAB 4NO2B 5ISZE 4X6DB 1U8NA 2XZZA 4PJ7A 1FNGB 2CXKA 3THMH 43C9B 5IMOA 1QVOB 4S1QL 5D7IF 5EZLB 4Q9QL 3QUYB 4HC1A 4QHUA 1BLNA 4Y4HB 2NX5D 3EJYC 3EYFA 5IESH 3P9MB 1CF8L 1A6AA 5BRZA 4KTYA 4QGTA 1Q0YL 1JGDA 4UB0L 2BVTA 2HH0L 3O4OC 3G6DH 4I2XA 4JPWH 3ARZA 3OKYA 4JQXA 5KSBF 4R4ND 5DMGD 1MIEL 4GMSH 5KG9B 2QL1A 5EO1A 2R1WA 5EBLB 4HHAB 4WVRA 1IKNC 5E9DA 3MZTA 2BSTB 2ICWJ 4NZUL 1H3UA 2ZWLT 5I1LB 1J5OH 4IOSD 1PEWA 5IHBA 1NLBL 1WCBA 5D70L 1FHGA 5ID0A 1C5BH 4QRRB 2IANA 3IJSA 4QNPE 3QFJA 4MD0A 1QEWB 1OM3L 1IC5H 4M5ZL 1A5FH 2ZUUA 3ARGB 4HWBL 2P8PA 4PJAE 1YEDA 1MHPH 1LD9B 2Q76B 4PJBB 1OHQA 4ZAKC 1L7IH 3PJSA 3PL6D 3V0WL 4WU5B 3P30H 4NN7C 2VN4A 3VWJB 4ZFFB 3X14B 2NR6D 2AEWA 5CSBA 3T0EB 3EYOB 3ZTNL 3U48A 3FQRA 5IK3A 2RBLA 5ICYA 3QO1A 4ZDHB 4D0DB 2VDNL 5CIPH 5FA3A 3MRPA 1UWGL 1I9IH 2X9XA 4C56E 5IJKC 2W60A 1FVDA 5GS0H 2BMKB 1OOAA 1EMTH 3RA7H 1AP2A 2CDFB 1JNLH 4R7NB 4CADA 3NZ8B 4UIMB 1NMAH 1BD2E 1CXHA 3CVHH 1NAKH 1NBZB 4BSVB 3BZEB 5C0CD 1LVEA 3H3KA 1C1EL 4LCYB 2Z92B 2PTTB 5ESVA 3QDMD 1RURL 1INDH 2H3NA 5DRZB 1AE6L 3ZKMC 2PW2B 5DYOB 3HHRB 5I76A 3VCLA 1RK1B 4JM2D 1X5FA 5TFSL 1CK0H 2AEPL 4K8RH 3WJJC 2HJFB 4NPYA 3W81A 1JNJA 1TZIB 1D9KC 4N5EC 3MBEB 1O5DT 4MXQC 4OJFH 2VLJD 1XCQB 1MI5B 5B3JE 2B0SH 3MRLB 1HXYA 4DKDC 4LCCB 2GJZA 1RZ7H 4F33B 5DRNB 1CFTB 3B3IA 3LV3A 5JQ6L 1OF2A 2R29H 1E4XL 5HI5D 3OAYK 3O2WH 5DC4B 3RZWA 1M05A 5DURB 2JIXD 4YBLB 1K5NB 3HE6D 1NCDL 3E6FB 1KOAA 3WL9B 5CP7A 1IGMH 4L3CA 1DBJH 3MGAA 4APQC 1BWMA 2MJWA 3KYOB 4JY6A 2H26A 4PS4H 5H2BA 4NNPL 1MAJA 4XPGH 4F37K 4Y5YC 5EUOB 5IR1B 1I8MA 5F9AC 3ARDA 1CLZH 2X4RA 4NNXA 4GW4A 5JW3L 1U8QB 5L2KE 5F7DA 5T3XD 2R0KL 2E7HA 4JQIL 4ZFZA 5BQ7A 4GLRI 3EYUL 1KCUH 5J9PB 2VDPH 1BZ7A 3I02A 4M7ZB 5DMIL 1NC2D 4KK8D 4QRQB 1AXSB 2IMNA 1ADQA 4JREB 5T5FL 2ADJA 5I1HH 1CXIA 1JV5A 4N0YH 3DYMA 4NZRL 3V0VA 2QEJA 4MA7L 3K7UA 3MFGB 4QOKA 4XCEA 2MPAH 3N0PB 4OV5B 1C5DB 4J3WA 5CGYD 4Z7OE 1HSBA 3IDNB 4KROD 2G75B 3O8XA 1YECH 4JG0L 5DD5H 4E41B 4I4WA 3WN5A 5LWYL 2EKSB 4PJGE 4U1GB 4PRBA 1BREA 1QFPA 1ZS8A 1M4KA 1WTLA 1RIUL 2DQGH 2C3HA 1EGJL 1D3CA 3AREC 3DXAE 1BFOA 3BYYA 2BERA 2X1WL 4X8JA 4EVNB 4X7SL 1DE4A 4KMLB 4KKBC 4NOFA 3FB6B 2VDLL 1FGVL 1DN0B 3F58H 3UJTL 1D5XA 2GK0A 4PB9L 2X4NA 3K4AA 5MP6L 1P4LB 2COQA 2AJYH 2MCG1 5DJAA 3S3SA 3PWJA 3ULVD 4HXBL 2WWKT 4LHUB 4JR9H 1T89C 2GY5A 5BZWB 3HR6A 5E08L 4DAGL 2A6KA 2VL5A 5KVGH 5CBAB 4F8TA 4LMQE 2ED8A 2ID5A 4M02A 4AM0B 5EORL 2EXWC 3QCVL 3MNWB 3E1F1 1S7UA 4XVTL 5I1EL 2O5YL 3PHQA 3QRFM 3C6LA 2O5ZH 4H20H 1LEIA 3SGDI 2PYEE 4FABH 1T2QH 1GAFL 3O2DL 3HRZA 5D1ZB 5D7LB 1BX2A 4PRPA 1CFVL 1HH6A 1UM4L 5I1KL 3D3VE 3UTZA 5DVMA 4WENB 1PVHA 5DHVA 4KK9D 2FX7L 1CDBA 3MRKB 5EU3A 1IEHA 3FL7A 4HDIB 2G2RB 1Y0LA 4FP8H 3HS0A 4AQOA 1CD1B 5DJ8A 4F9PA 3OF6D 3ELAT 3O2VL 1QRNA 3MRNB 1G7QB 1U8MA 2W9EH 4ELKA 4ZSOA 4MJIA 5IOPB 4KHXH 3CU7A 2OL3L 1WEJH 2QQLL 4XBEH 4Y7MA 4CN1A 1YJDH 3X17A 4GG6B 4PJ5A 3EUUA 1CGWA 1YEJL 5A3IC 5ACLA 4K71C 1AJ7L 3KPRE 3HZVA 3NFNB 2H41A 5T3ZD 4MDJB 4Q2ZA 4M6NH 2SEBA 1QNZL 2A6JB 2BP3A 1I3GH 4P5TB 1KB5L 3L1OH 3W2DH 2UWEE 1BP3B 2HJLB 3OKDB 5MEPA 5E5MA 1GPOL 3SGEH 1Z3GH 1HKLH 1QLFA 2C9AA 4GOSA 1BEYL 2XRAL 1HN1A 2XACC 4GRWE 3LMJL 5AZEH 3RTQA 1NBVH 2Q86A 1WFTA 3H0TA 1HHKB 1EIBA 1LE9B 2OL3B 4AJ0A 3MJ9A 3T2NH 2LTQB 3S96A 4M00A 3LRGA 4Y4KA 2IFFL 3T77B 3GMRB 3IDXL 4LGPB 4CBPA 3DUUB 4U1MA 1I1YB 1LEKB 4LBEB 4MD4A 4PJIF 5TE7H 1PG7H 2KQNA 1KB5B 4WI5A 2XWTA 4PP2B 2BVPB 4FZEL 2I9LA 2MQ3A 4GAJH 4LLVA 5LCVH 4FQQB 5SWSD 1FIGH 1WWAX 4S1DC 1N5YH 4XP9H 2AQ2A 4Y1AE 3MLWH 5HHME 2B20A 2JK5A 4UT7L 3VDBA 3K1DA 4U1SB 5EZJB 5FYKD 3GSRA 4PGCA 1DSFL 4K9EL 2I5YL 4QHUB 4Z7NE 3EYFB 1MUJB 25C8H 4YHLH 5BRZB 1A6AB 2Z31D 5L88H 1RJLA 4OZGF 1CLCA 3FN9A 1UWEL 1QFHA 3PDGA 2KKQA 4NHCL 1I8LA 2NMSA 1DVFD 4I2XB 3MV9A 3S36X 3LD8B 3RPIA 4BSWA 3FFCD 3H9SE 2OQJB 4UBDC 2W1NA 3B9KD 2VDOH 5EO1B 2R1WB 5E4IA 4OCMC 5DVLA 5HHXL 2XN9E 5EU5A 4P3WA 5DD6A 1IM9D 3QG7H 5E9DB 4TVPE 3GHBH 2GKIA 2NY2C 3TIEB 5ESAA 3NCCB 5K9OA 4KI1A 1WCBB 2JE8A 4UV7H 1GL4B 3TBYB 2EDKA 1FSKC 3CFBB 3L5WB 2IANB 3EGSB 3WE6A 3IJSB 4L3AA 3QQ4A 3TZVD 3QFJB 3WKML 4MD0B 1MJJA 2ZCLH 5DLMH 1HHJB 4QXUH 3BZFA 1RY7B 2HFGL 5JOPE 3CH8A 2JB6A 4HUXA 1IE5A 2P8PB 3NH7L 1YEDB 4B53A 4Z7VA 3PJSB 1KTLB 2OBGA 4LIQH 3Q6GH 5TPWL 5D8JL 4R7DA 3FQRB 3RNQA 1J1OL 3BD5A 4WWKD 1NANH 5EOCL 4QXGL 1NCAH 2AK1L 2QHRH 2Q87A 4HF5H 5ICYB 3QO1B 4ZTPL 1IRAY 5FA3B 2UVEA 4QF1A 4Y16B 5C0IA 2V9RA 4P2OC 4UNVA 2W60B 1FVDB 3QRGL 1YEEL 4ZQKB 4BH8A 5DUMH 4XC1H 5EPMB 1OAKH 1EDQA 3DGGA 2F74A 4OZHE 5D4QA 1WZLA 4O58L 1CL7L 1AP2B 3PWVA 2YK1H 3RFZC 3BW9B 3STBA 5CZKA 2XXMB 3IAPA 4OCYL 1S7WA 5L8KB 3MLTA 1G7LA 3PWPE 1IM3A 3PQYE 4W4NA 5ESVB 3AM8C 4F80A 5DD1H 4YWGH 1LDSA 4ELMF 5FYLH 9CGTA 4BK5A 3O9WC 1A6VL 5I76B 5CS7A 3WFBL 4JLRA 4NDMA 2J8UB 1ZANL 4IM8A 5DJDA 1NAML 3MLUH 4P9MH 3RVXD 1I1AC 2PTVA 4NQED 4FXLA 3HTLX 4UTAH 1ZKAA 1RUQH 1AKJB 3QFDA 3OKNA 5GPRA 5DA4A 1K85A 4N8VG 3LV3B 3B3IB 1OF2B 1MF2H 2ORBH 4QGYA 3DMMA 5KVEL 1WBZA 5EU6D 1KC5L 3LQZA 3ILQC 3QIBC 4F2MA 1M05B 3UTTE 3EDJA 3FQXA 3P4LA 4JKWA 1EAPA 5CP7B 4L3CB 4R9HA 1IJ9A 1YMMA 3IKCB 5AG8A 5JIIA 1CWVA 4JY6B 2H26B 2VB5A 5E70A 1DEEA 1J8HA 2GUOA 3QUXC 3S7GA 2Z8RA 3RVTC 1I8MB 5D6DA 4I3RL 4GW4B 4IIQA 5F7DB 4GLRH 1MCPL 2VXVH 4C55A 5BQ7B 3IRZA 3CMOL 5CIPA 5IB1A 1BZ7B 4M7LL 5JW4N 1FP5A 2OR9H 4RMSA 1Q72L 1A9BA 5FGCE 1HE7A 4OUOA 1D5BA 2R69H 1TDQA 3KXFA 2APFA 4FMKA 3V0VB 1EFXA 2HFEA 2FLRT 4QOKB 4PTUA 1VENA 3ZT5A 4HGKC 1HEZB 3MO1A 1IGJA 4LCIL 3CVHA 3F7VA 2EYTA 5ALBH 1JGUH 4I4WB 4JRXB 3LEVL 3WN5B 3U7AA 5C2UB 4PRBB 4JO3H 4CL7A 1ZS8B 3EJYD 5HYSG 5EU7E 2X09A 4V1DE 4JO2H 3OR6A 4YAQA 1RUPH 4EBQL 1BFOB 4L8DA 1FCCA 5E2WH 1LK3H 1DE4B 1SYVA 4AEHH 4OLZL 1TQCC 1RUAL 2BRRH 1OAZH 5EOQH 2BFVH 4OF6A 3CFIC 4PLJC 4J4PA 3RGVA 3MUHL 3JVGA 1D5XB 5FXCH 2GK0B 3ARRA 1F3DH 3RWEB 3FJTA 3B9AA 2H32B 2QADC 5HI4C 3RY6C 3H9ZA 4IOIA 4IEFB 3PWJB 4RFNC 5DJAB 4H25A 3SDYL 4Z7UF 2CH8A 1IKFL 3BP7A 3RHWK 2FJGB 3LQAL 4PJEF 5F9WB 3O11A 3SGDH 1U36A 3LDBB 1NMBH 3MYZA 1LEIB 2F58L 4ONFH 3RWJA 1A9EB 3ARSA 2YMXL 5INDA 3HRZB 4RFEA 4I9WE 3SGJA 1BX2B 4PRPB 3IDYB 1HH6B 3VRIB 3TPUA 3UTZB 1BFSA 1J7VR 1YQVH 4ZAKD 1LHZA 3WXVL 1JK8A 4WUKH 5CUSH 5EU3B 4I8DA 1CLOH 3O3AA 4WFFD 3P4MA 3HS0B 3LEXA 4HT1L 5DJ8B 5A2FA 5IGXH 5MI0C 3PE9A 1YC8A 1QRNB 4TPRH 1MJ8L 4LARH 2MNUA 2DS4A 3V8OA 1U8MB 4JQXC 3MXVL 3RL2A 2M26A 4ZSOB 3MRBA 1UCBH 4O4YH 3ZDYF 1RUML 3I6KB 1N26A 5KAQG 1TJGL 5B3NA 5CFHA 1KJ2L 3AU1A 1KBGH 1IGCH 4K3JL 1QPPA 3DPBA 4XB7A 3QCTH 2VAJA 1AHWC 4PJ5B 4X83A 4DCQA 3RU8H 3RNKA 1BAFH 4Y19A 5FO7A 3HZVB 1CDJA 35C8H 4Q2ZB 2ATPB 4TUKL 4UQ2A 4LLYA 1JF6A 1T0PB 1B88A 3GJEA 4KMTL 1JRHL 3ISWA 5ILTH 2CSPA 2XYCA 4P2RA 1I8IB 1FH5L 2OYPA 5E5MB 1GZPB 3JBG7 3VXUA 2FJHA 1A7NL 4UV4H 3ZKMD 4RMWA 2NX5E 3WJLA 4C59B 1L9MA 3VFTA 3RTQB 5F7KC 1AI1H 1S5HA 3L5HA 1D9KD 1UCTA 4N5ED 2E6JA 4M93B 4HPYL 4MXQD 1KJ2B 5I66B 1IVLA 2B1HH 3D85A 3S96B 2FIKA 5CINL 1T83A 3D39D 3VXOA 4IS6A 1XGUB 3QQNA 3U0PA 3W39A 2J5LC 4U1MB 2VIRA 5D9SA 2X1OA 3RZCC 2QQKL 5DMKA 1AC0A 1UXWA 4HIXH 2FB4L 3O6KH 5FYJU 4HAGA 4LLVB 1Q38A 1N0XL 3L3IA 3MV11 3V6OC 1ED3A 4APQD 3QI9C 1JI1A 1KIPA 4X6CA 3G9VA 4L4TD 1ES0A 4IHOA 4WY7H 5I1CH 3Q6FA 5E6ZA 3GSRB 3QUZA 3G5ZA 1NLDH 4PGCB 5IVXE 1U92A 4D94A 1OTTC 1W8NA 4LVEA 5IMMB 1T0MA 1OGAB 1R3LA 2ICWI 3FONA 4R8WL 5IWLA 1T22B 1RJLB 1PDKA 4LP4A 5BV7H 1NMCB 2IJ0C 4NO0D 3BDXA 3MV9B 2QTEA 3RPIB 4NSKA 4YO0A 3RWHA 3HI1A 5GS3A 1P4BL 4JGJA 5E5UB 1TVBB 4R97C 2D7PA 1UM6L 3SO3C 4LPTA 5HDQL 3BP6A 5M7QA 2P45B 5EU5B 5DJ0A 3ARED 1A64A 3MV7B 5DD6B 2HAZA 3ETBF 4ZTOH 3FO0H 4HEPG 3LIZH 1SMAA 3ALWA 1UB5A 2FLBT 4NYLA 3WSQH 4OZIE 5ESAB 4KKBD 5CBEB 1F3RB 1FRGL 5K9OB 2YPLD 3FQTB 4JDTL 4M61A 3DTXA 1TQBB 2IBZX 5GRVK 3M45A 2Q20A 5JTWA 3WE6B 1MQ8A 1OP3K 3SE4C 1NH6A 1MAML 3NCBB 1KENH 4EI5C 1YEIL 3ARDC 3QQ4B 4IOFC 1ZHKB 1MJJB 1S9WA 2J88L 3BZFB 1TNMA 1WICA 2JB6B 2CD0A 1KJ3H 4Z7VB 3MUJA 4ONGH 4YQXL 4CDHA 4PJCE 2BOBA 3SE3C 4FQ2H 2EXWD 4R7DB 2V9QA 5C07D 2IQ9L 3S34L 3U30C 3CK0L 4KTDH 3BXNA 4XB8A 5C0IB 3MRQB 3O8XC 4JKPL 1DR9A 5E7FA 2DQUL 4BH8B 2QSCL 4Y4HD 3DGGB 2F74B 3SKJH 4J3XA 5C08D 5FEBA 5BW7A 3PWVB 4LF3A 4GBXA 3VI3F 4X4XA 4RWYH 3UMTA 5KN5A 4YEEA 1S7WB 1KLGA 3MLTB 1KELL 2XICA 3GSWA 4AMKL 1X4ZA 2A38A 3OX8A 1NDMA 4KK5D 3CNKA 4OQTH 5T3XE 4BFIB 1VGEH 4RISL 3MRJA 3QQ9C 2F54A 3V4VH 3MLYH 3NIFF 5C0JA 5C0EB 5K93A 5A3ID 4JLRB 2WLYA 4XNUH 4NDMB 2E6QA 3DX7A 1A6PA 3QCUL 3B6SA 1YMHA 4NQDA 2WWMC 3W5MA 2V2XA 2VWEE 4Y5VA 3UBXI 3C6LC 4HFWA 3OKNB 1P4IH 3ZMRA 4M8VA 1RSFA 1RHFA 1WBZB 1YNKH 4OB5H 1SM3H 2UYLB 3LQZB 4LHUG 4E42B 4F2MB 5D2LF 4YXKH 3FQXB 3RKPA 3KJ6L 3BIKA 1EAPB 3VWJD 3QNYA 2CLRB 3T1WA 3WHE1 1P6AB 3FFDA 4XPBL 4AIZA 3IT8D 1J8HB 2O5XH 3HCVA 4X4ZA 4OCNC 3WKNA 1A1NA 2Q8AH 1UJ3C 4L3EB 1FZOA 5GRJH 1YNTA 4WUUD 5CIPB 4FFZL 3ULVE 3TH4T 5IBLC 1A9BB 3RWDB 5DT1L 1DN2A 4HLZG 3KXFB 3IGAA 3FRUB 1EFXB 3HZYA 3V52H 2VISA 4PTUB 5GHWL 3OG6B 1CFQB 1BHGA 2VR5A 3O0RH 3MO1B 1IGJB 4GG8A 3CVHB 2FD6L 3F7VB 2VABA 5KVDH 1TTFA 5TQ2L 2EYTB 4MJ5B 4PUBH 1SHMA 3AS2A 4HJJH 15C8H 1DBJL 4FTVB 3LKSA 4YAQB 4XP4H 4PIRF 2D0FA 4L8DB 4LL9A 3I3BA 1CD8A 2IPTL 4LU5H 2P24A 1WT5C 1OSZA 3X11A 5L2JA 2VERN 1SYVB 4JB9L 1M71B 1JF1A 3NFSL 4GAGL 4MNQA 4Y4KC 3RGVB 4CJ1A 3QDJA 1LILA 2ENSA 3GM0A 2WNGA 5F72S 5MHSD 2BOCA 4L9LA 2DQJL 1FFNA 4XHQA 3S37X 2XTJE 2VRAA 2DLFL 3O3UN 2PO6A 1S7QA 2NY2D 3QT2A 1KFAH 5T3ZE 4G6KH 1OPGH 4H25B 3D48R 4R4FL 5ALCL 2JLLA 3P0VL 1B4JH 2VLLA 4XC3L 5HHOB 2JCCF 4P23A 2JJSA 4O9HH 3BP7B 3RDTA 2QKIA 3EYSH 5A2JH 2R2HA 4ODHH 3VG9B 4DVRH 3SPVA 1QBLH 4TULH 4HUKB 5HI3D 4FQXB 3RWJB 2A6DB 2XZQL 1A7PL 6CGTA 4NQSB 3BN9C 5INDB 3ZE2E 4RFEB 3VXSA 1HINL 2B1AH 4P57A 1ZLVH 5IVOA 3VRLE 5IB4A 1JK8B 4QRSA 4JY5H 4NUGH 4WCYL 4AK1A 3O3AB 3SDCA 3P4MB 4XPFL 4A6YL 3LEXB 1CG9B 2ZUWA 1I8LC 5IVNA 1JHKH 2X7LA 2Z35B 1BVLA 4JFEB 2PYFB 2A74A 3DUHA 2ADIA 4P2OD 4YH6A 3MRBB 1KYOJ 3BP5B 2J4WH 3GBNH 3V9FA 4DTGL 4OD1L 3TT3H 5SWSE 4DCQB 1K3IA 4N1EA 4OGZA 4Y19B 5FO7B 1VFMA 3BDBA 5J13C 2Q6WB 1JHTA 3T65A 4UQ2B 4LLYB 5DK0A 3MLSL 1KEML 2VZUA 1MVFA 4P2RB 1UA6H 4XP6L 3LQMA 3ZHLA 3ULUC 5C6TL 2OP4H 2HRPH 5D5ME 2FJHB 1BVZA 5D1QA 4OLUL 4JZJC 4XCFH 3VFGH 2IBGA 3KR3L 3VFTB 4LHUD 2ZG1A 1S5HB 2PR4H 4HV8A 1I1AD 2AJSL 2KQMA 4WV1A 5I8CA 1CBVH 3WIHL 2E7LA 3D85B 3ZKQD 2FIKB 5EBMA 3C5ZC 4AEFA 4IS6B 1KSRA 5ADPH 3U0PB 3W39B 4RX4A 5D9SB 2VIRB 3KG5A 1X5GA 3OKLA 3M07A 5BMFL 3REVB 3LZFH 1UXWB 4HIIA 4JE4B 2OMBA 3QIBD 4YDVB 5I2IA 4C58B 1QLEL 2W9DL 4YHYC 1ED3B 1CDUA 4PG9A 1KIPB 1YDPA 3GSXA 4X6CB 2X4OA 2VE6A 1ES0B 3DECA 4IHOB 4LQ1A 5MEOA 4X6DF 4M8QA 3V6ZA 3Q6FB 4AIOA 3QUZB 3G5ZB 3D18A 1FL3A 4IRJA 5C0RL 4W81A 1FPTL 1S78C 3GMNA 2XY2A 1U92B 1KV3A 5HVWA 4TNVK 1XEDA 4HK3N 4K3DH 1R3LB 2CUIA 5IB3B 3FONB 5MERA 4TSCL 4ERSH 1NCBL 3GFUA 3GKZA 4XP1H 1IC7H 3E3QC 2BJML 1U58B 5E4EC 4RAVA 4NSKB 3RWHB 1C5CL 2N4IA 3OMZA 1S7VA 4YBQC 3HG1D 4MXVF 1CQKA 4JFHE 2P44B 4NJ9H 5FECA 1YPZE 5LCVL 5ECJE 5DJ0B 5FV2A 3DMMC 5FUOH 1Q0XL 3D25A 5I73B 1OGTA 2VXSH 3AS1A 3S5LB 4OZ4A 3QBTB 5E03A 1UB5B 4LLWB 4PRDA 4G5ZL 3QWOB 1FBIH 2EH7H 5C1MB 3EAKA 4M61B 3DTXB 3BRDA 1MFEL 5BS0A 1NL0L 2J2ZA 5D6DC 1JNHB 4IIQC 1S9WB 2AK4A 1GGIH 4G8GD 4PRNA 2QADD 5HI4D 1MFCH 4DN3H 5FHAL 4PB0H 2GQHA 2X41A 3P3YA 4NNYA 3OJ2C 2WSKA 4MNHA 5KSAC 3FN3A 1V05A 1INEH 1JCKA 3NIGE 4NQEE 5GS0C 5E6IC 2JTDA 5EA0H 1TETH 3DVGA 2M8XA 4PJHA 2OR7A 4YHKH 1AO7B 2MCPL 3U4BH 3PIQA 3TV3L 3HI6H 4MJ4A 2IPUG 5AAWA 1HCVA 3BXNB 4ZMAT 4LPVA 2G60L 5C8JA 1DLHB 1LP9B 5BO1L 2FEEL 2PKDA 4M6MH 4F3FB 5J89A 1I7UB 5BRZD 4S1RH 1G6RL 1IGFL 4LF3B 3DO7A 3MLZH 4GBXB 2DI7A 3TBTA 4Z0BH 2EEAA 4X8XA 5KN5B 4DQOH 1KLGB 3WNMA 1JYNA 3BGFB 3QXAA 3OX8B 2NY0B 5ANME 1ACZA 3LAFA 2WLZA 3OAYH 2J6EL 3MRJB 2F54B 1HXMA 3L5IA 4HULB 5J11C 5INCA 1JZ5A 3MXWL 3U0TB 3HE7A 4QHNA 4Y5XA 2GIYA 3CFCH 1FC1A 4ZFGH 1FNEB 3HNTL 4U1NA 4HIJA 2PW1A 4OFPA 4Q9RH 3DX7B 3TN0C 1WAAE 3FB8A 3T1FA 2EXYC 1W0WA 5FOBA 3B6SB 2JELL 2IG2H 4WFED 5DTFA 3TBWA 4F9LA 4CU8A 4LHJB 1GIGH 1F4XL 4M6OH 4NQDB 4BKLA 5KSBA 2V2XB 4ODTL 4Y5VB 2B5IB 1KJVA 1UFUA 2IH1A 7FABH 1KIQA 1KN2H 2OZ4H 3TVMA 1PQZA 3NTCL 4XMPH 3B4NA 1KCSH 3RI5F 1LO0H 1ZT4B 5LXGL 3U7WL 1V7MH 3X13A 3QEUA 3BIKB 3FOMA 4CVUA 4PJDE 4DOHE 1C7SA 3QNYB 5ICXA 1N2RA 1IQWH 5GJSL 2F5BH 1H3XA 1Z9LA 2V6HA 4ZUUA 1HH9A 1YEKH 4KVCL 4UINH 3UYPA 4AIZB 2WINA 5C09A 5EUOF 2ZOKA 3HCVB 5F6IB 5E8EA 4KQ3H 4AH2A 1A1NB 4LLAA 3RZCD 3ZKNC 3SCMC 5I8OH 1L4IA 3G6JE 4JFXA 5EOCJ 4XPAH 5AUMA 1FZOB 3L7FB 4LSSL 4HBCL 3DHMA 1SMOA 1CIDA 1I4FA 3DSFH 3PGFH 5EZOH 1IC4H 3PABA 3O9WB 1FG2A 4YK4B 5I9QC 4QT5A 3IGAB 3AGVA 2JKXA 4I13B 3HZYB 5DA0B 4EOWH 2VISB 2DI9A 3AMKA 1MCHA 3C09B 4OI9A 3G08A 3D0VA 4LMQI 4GG8B 3WNNA 2CLZA 2VABB 3GI8H 3E2HC 1EHLL 4N8CH 3GBMH 4S2SA 1OAYH 1OTTD 5L7XL 2GW5A 4LQFL 3DRQA 4OQTA 1Z5LB 3BMWA 4FQJH 1RZ8A 3LKSB 2A1WH 4LNRA 3UPCA 1WTGT 3ALPA 4WFFE 3SKMA 4ZS6C 5IP4A 1SEBA 2K7PA 5FYJD 5CJQH 5T33L 1OSZB 2R0ZH 5L2JB 2BY1A 1NEZA 2MHAA 4MNQB 4N90D 3LH2H 1QHPA 4X9GA 4H5SA 3MRMA 1BQSA 4LKCB 2BOCB 3R1GH 4L9LB 4GSDH 3QUXB 1FFNB 1NFDE 5IMKA 3QXVA 3GI9L 2EDJA 5J56B 1TMCB 4K3EL 4U6YB 3SOBH 3SDDB 4U7MA 4KI5F 3FMGL 5KSVB 4DN4H 5J6GB 3O45A 5D7JC 2VLLB 3UO1H 4P23B 3H42L 4DVBA 2QKIB 1CDGA 2NY3C 3SPVB 4OCLC 3ARDD 4IOFD 3QPXH 2BNQA 1VEOA 3SHSA 2Z4QA 4XHJC 3VXSB 3SDAA 4G9FB 4P57B 1NBQA 5I8KH 1K8IA 1N7MH 4NCC2 1RVFH 5HHNA 4DGYH 4WDIA 5L0QC 4LKXB 1GOHA 1FO0L 1G6VK 3D39E 2X7LB 1BVLB 2FO4A 2A74B 3O8XD 4JPKH 2ADIB 4R90L 5TF1H 5JORA 5C6PB 3BKML 4ALAH 5DS8A 4GG6F 4BQ9A 3S35H 3VFSA 1U41A 3ZSTA 2YSSA 2YOCA 2P8LA 2FHFA 1PX4A 2ZPKH 3IFNH 1NQBA 5C6WH 5AZ2H 5DFTA 1S7RA 1JHTB 1XGQA 3T65B 4AENA 2CMRH 1KGCE 5DK0B 3MX0A 3CFDA 2BVOB 5FUCC 3C9NA 2XKUA 4LCWA 2B2XL 3ZDZF 1V5JA 3QQ9D 2IPKA 3QAZC 1UG9A 1VB9A 4I0PC 4WUKL 5B39B 4QRPA 2NY7L 1OL0A 2NW2A 3V4UH 5TH2A 1UQSA 1NGQL 2CIKB 4QY8A 4KJPD 5CHNA 2AJVL 1LO4L 2XOTA 2AXHA 1D5IH 4OCRL 4KGJA 1ZHLB 4HV8B 1BZQK 4WV1B 4EJ1C 1FE8L 5I8CB 4MQTB 2WWMD 4J8RA 4NN6B 4UIKL 3MRGA 1MCCA 2HWZL 3C6LD 3QDHA 3CVIL 5EBMB 4KRMB 1Z6JT 1QRKA 1EHNA 5EC2B 4PRPD 2ESVA 3MYJA 3GSOB 1Q9LA 4HIIB 2YEZA 4LFHG 4DEPC 3FAXA 1A14H 5CSZA 5I2IB 1JWUB 4YC2B 2V2WB 5F44A 3C6SA 2ILLA 4PG9B 1AHWB 1YDPB 4NC0B 3GSXB 4XH2A 2X4OB 2YPLE 4M62L 4XXCC 2IH3A 4LASH 3WYRA 3AVEA 5I30H 1WZ1H 1QRND 4ZD3H 4Y2DB 4YDLC 2IAMA 2FECL 5MEOB 4OGAC 3V6ZB 3R0NA 1UH3A 4MB5A 2KBGA 1ND0A 4MJID 5FO9A 2VQ1B 4TSBH 5GISH 3FO1A 4BZ2H 3MPCA 3U2SA 4HUMB 5JZ7C 5C0AA 5K9KA 5MERB 3BEWA 3NFPB 1WGOA 1I1FB 5C07E 2OK0H 5FF6A 5TE6H 4RAVB 3BE1H 4P59L 5I1JH 3C08H 3FAWA 3KNBB 3CCHA 1DQLH 3S6CA 5LQBH 3EOAB 1SJEA 4WJ5A 5FECB 1OLZA 5TDNA 1EVTC 2GAZA 4JRYE 5C08E 1FYTA 1FAIH 4U6VL 4Z95H 3D25B 5HSFA 1B0WA 5FYJL 5DUBA 1P7KA 3CPLA 3VU2A 4PRDB 5IF0A 3GKWH 3EOTL 4F57H 4P0DA 4Y4KD 1E6OH 5BS0B 2BCKB 1I1RA 4EQ3A 4LRNL 3NPSB 5GSRB 1PD6A 1CFNB 2BNRE 4GQ9H 1Z2KA 2AK4B 3OXSB 4PRNB 2R2CA 4G3YL 1XT5A 2J12B 3QNZA 4FQLL 5I1GL 4NNYB 4M4PA 4MNHB 4M1DH 1YN7A 2C3GA 4OTXL 4XNZB 3DVGB 4P2QA 1AFVL 5KZCB 3VW3H 2AXGB 4X4MA 4JVPA 1MFNA 3R8QA 2BX5A 5F97E 3ECBA 3BN9D 3BPNB 4PJIA 4R0LA 2Y07H 3UXFA 2BRQA 2HP4A 2W59A 3MTRA 2E27H 4R97B 1TTUA 3P0YL 4K3HA 3QEQB 4KY1L 4AIXA 2HLAA 2ICWA 3E8UL 4HX1A 3DYOA 4OF8A 1UH2A 3TBTB 4B50A 1EH9A 4KUZL 3T3PE 3MV9D 4X5XB 4Y88A 3V8CA 1NGYA 1XGPA 1G9NH 1BQLH 1KIRA 5BV7B 3OL2A 3QXAB 5KJRH 1VSCA 2R9HC 2IALA 5DR5H 1N6VA 2EE9A 4G6JH 1CS6A 2DF3A 4J3UA 4WUUE 5DJXA 5INCB 1BGXL 5ITBH 5JHLH 3HE7B 4Y5XB 1K8DA 1IZKA 1ZOXA 1O7SA 2J8UF 5AAMA 1T80A 2R0LH 4HIJB 2PO6C 2PW1B 4OZGA 5L6YH 5E8OA 5TGBA 3U1SL 3NA9L 1CCZA 3FB8B 3T1FB 1FDLL 5FOBB 2IADA 1VFBA 4XPHL 2JJSC 3DV4A 5DTFB 2VLKE 3RDTC 1FCGA 3RGHA 5KSBB 4O02H 3ULUD 4JFDA 2IH1B 3VWKA 1KIQB 4U0RB 3OAUH 1PQZB 2R23A 1WLHA 4BJLA 1PJ9A 2P47B 3A6BL 3T09A 4F15C 4LFHD 3GSUB 3T2PA 2AP2A 3X13B 1RMFL 4P48A 3QEUB 3FOMB 4JFYA 1PAMA 1UACH 5ICXB 1N2RB 5CEZL 3SDCC 1FZKA 1MCWM 4ZUUB 1HH9B 1CICB 4RBPK 4LP5A 4TNWK 1IAIL 3GO1L 2WINB 4GKSA 5DD0L 4JZOA 3C5ZD 1N6QH 5IW6A 4HZAA 2ZOKB 1FZMA 5E8EB 5MHSE 4NJAL 4AH2B 2EECA 3KPQA 5BJTA 2CRIA 4JFXB 5AUMB 3QEGL 2Q1EA 1ZLSH 1J1PL 1UADC 1QBMH 1I4FB 4XNYL 5KS9E 3RIFF 1ZTXL 3EBAA 1JGLH 1E4KA 3BQUA 3GSNL 3PABB 3VXME 1FG2B 1K2DA 3ZE2F 4XAKD 2H6PA 1XH3A 4QT5B 5HDBE 4ESKA 3HR5A 5FFLA 3G08B 3QG6A 3D0VB 4FQIL 3QYCA 2IEPA 5A43C 3QIUC 2DICA 1RU9H 1S78D 1MCIA 4S2SB 5HD8C 3L9RB 1L0YA 2VAAA 4LSPH 1QHOA 1I9JH 2AJUL 4NWTH 3UTQA 3QDGA 1RZ8B 3WCYA 4LNRB 3B5GA 5C0NC 1SEBB 1WUNT 2XZCL 4NO5A 1E4XI 3TA3A 1EV2E 5HYIA 4X80L 3WS3A 3JWOH 3N9GL 2RR3A 1NEZB 2MHAB 2E7LC 2R4RH 1OTUC 1NUGA 4YBQD 1MCRA 5CGMA 3GSNB 4OI8A 4U1IA 3UBXA 4H5SB 5CILH 3MRMB 3H3PH 2NY5C 4L4VB 4F7EB 5IMKB 3DMMD 2OZ4A 2H8PB 4YE4H 4G8IB 3CDGA 1HZHH 1QFWL 1I85A 4PYGA 5C9KA 5HYJB 3O45B 1F6AB 3MUY1 1YMMD 3VFUA 4DVBB 3SBWA 3DBXB 2ICEA 3I85A 4PUBL 1U3HC 1YUHB 5GGQL 4Z76B 2ADGA 4DW2L 2NZ9C 1FL6B 2VUOA 4IRJC 3K8KA 3MOBL 2ZJSH 4EN3A 1MH5A 1K8IB 3GK8L 4GRWH 5D2NB 4RMTA 3MODL 3CX2A 3D6GA 5FKPA 3GNMH 2IQAA 5GS0D 3BUTA 3I2CL 3NCYS 4I3SL 1JTPA 4WHCA 5E6ID 5FA4A 5HHNB 1MLCA 1EFXD 3ZE0F 4WDIB 3GMMA 1MCSA 3NCMA 2EKJA 5DEGA 2VQUA 2LAAA 3GIZH 2FO4B 5D72L 4GKZA 3UYRH 3V5KA 3JWDC 5ACZB 1EO7A 3OZ9H 1J87A 1T0NA 2OTUA 4LVHB 3VFSB 1JMXA 2GJ6D 4OFYA 1T03H 2YSSB 2P8LB 4O2CA 1MRDH 2YUZA 4PJ9C 4PRHA 1S7RB 1XGQB 2GEEA 4AENB 1CGYA 2NY4B 3CLFL 4BZ1L 4ZNEA 3CAFA 5IQ7L 3C9NB 4QRUA 4J4PD 1F13A 4LCWB 5K9QG 5GGVH 3RGVD 3IVKA 1HYSD 1URLA 2VKWA 1SEQL 1W0YT 3DIFA 3STLB 4YDIL 5K59E 4ZO8A 4XCCH 2IPKB 4GRMA 3VDCA 2ERJC 4QHMB 2FJFA 1T1WA 4KDTC 5KOMC 1UQSB 5TH2B 2AEIT 4KKLD 2FSEB 4PG2C 5CHNB 1N4XL 4NGHH 5GQBA 3TJEL 3JSSA 3DVIA 5IW3A 4Z78A 2EXYD 1WVZA 4EUPH 4HJGB 4G8FA 4NRXA 2Z8VC 1YPZF 2VXQL 4K7PH 3P11L 3ULUL 3C60C 4J8RB 4OM1H 3MRGB 3HG1E 2DTML 2DM7A 2EDDA 4HWZA 1JUFA 5DMYA 3P40A 1WQVT 4U6XA 1EJOH 1F90L 3EDDA 3MYJB 5FM4A 1MRFH 1Q9LB 2A77H 2YEZB 3ESUF 4ODWA 5CSZB 2VXUL 4HCRL 4Z7UA 3U0WL 3C6SB 2ZG2A 4TVPH 4H1LH 2NXYC 5EO9A 1B3JA 2EEBA 1H15A 1XGRA 4NBYB 4XH2B 1RULH 4PJEA 1NGPL 2P43B 4FG6C 2IH3B 3HFML 2IAMB 4JKKA 1QSZA 3S88L 1ZV5A 1DBKH 4YDKL 1AGDA 3SDXE 4G8GE 3GMLA 1V7NH 2NY6B 5CD3A 5FO9B 5DUPL 2DQDH 3BVNA 1MJ7H 3FO1B 4U3XA 3LVEA 3FKUS 5KTEL 1H3VA 1CE1H 4YFLF 3U2SB 2CK0L 5C0AB 5K9KB 4BUHA 1CGXA 1U8OB 4XAWH 1MEXL 2VMFA 4WEMB 3BEWB 4X6FA 4EDWL 4KDWA 1OP3H 5A1AA 4CNIA 1P5UA 4Y4FC 5FF6B 1P6FA 4TUOA 2CLVA 4P2RD 4PJ7E 1GCFA 2APVA 1KLUB 1MJUH 3LZFL 4J3SA 1A7RL 4Q0XL 3VXUD 3DVNA 4WJ5B 3TVMC 5AYUH 5CZVH 5TDNB 2GAZB 5GGSY 1FYTB 5E8NA 5ABDE 4ZS6D 4XCYA 5FDYA 2V5RA 4YHOL 3O4LD 2XZAL 5DUBB 1P7KB 1HHHA 4OCWL 1JYVA 3CPLB 3ZL4H 4OGXL 1CDYA 5IF0B 4NN5B 4G6ML 3ARYA 2YD8A 1GC1H 5T1KB 3F7RA 3UP1A 2OJEA 3KYKH 3WO3B 1F6FB 2BNUA 4ENED 1WAAF 3RUGE 3RWFA 3PWUA 2GYSA 4QTIL 3VGEA 4S1QH 2PETA 1I9RL 4Q9QH 4D9RE 1HNGA 4Z7VF 3TCLA 3U9PL 3W0WA 4IRZL 1YN7B 4PJFB 3VXRE 1CF8H 4F7MB 1Q0YH 3ARXA 4P2QB 4UB0H 4JJHA 5F93C 2NY3D 2HH0H 3PP3H 3EHBD 4YPGB 1CLYL 1EHXA 3QUZD 1UENA 4KAQL 4FQCL 3KYAA 3ECBB 1S9YA 3FRPA 4PJIB 4R0LB 4XHJD 5E4EB 4YX2L 5JDSA 1VA9A 2DQHL 4FZ8L 2J7LA 3IDMA 1MIEH 1X4XA 4NQUA 2OTPA 4UDUB 3QIWA 3WFDL 1KPUA 4R96A 4WRLA 2HLAB 2ICWB 4HX1B 3G6JF 1FL5A 4NZUH 1WWCA 3QISA 5DI8A 1CE6B 2PXYA 1XGPB 2H1PL 3L5XL 4G80A 1XF2A 1AY1L 1KIRB 3BEVA 4MAUL 4O51A 1H3GA 5D70H 3WS6A 2IALB 5DQJB 5DJXB 4OF5A 1U9KA 3WBDA 3GJFH 5I1IL 1OM3H 3V6OE 4W4OC 4M5ZH 3D9AL 2WV3A 4HWBH 1AC6A 1OAQL 4OZGB 4C56A 5E8OB 5TGBB 4PJ8A 3VFPA 1RJCA 4YHZL 1PW3A 3X3FL 2IADB 3UAJC 4WTZA 4Q6IC 3V0WH 1VFBB 4CW1A 4IRSC 3R4DA 4U1LA 3DV4B 4PRID 2DQFA 4XVUC 1SBSL 5D96B 2QJDA 5F8QC 3ZTNH 2M2DA 3MC0A 3W5NA 1X9QA 3KHQA 4I0PD 5EBWB 4NRYA 3IU4L 1QQDA 2VDNH 4UUJB 1V3KA 1XF5B 2XWBA 1UWGH 3SDAC 3U4EA 1U42A 5EUKA 5FYJE 4NRZB 4JFYB 4U7KA 4E5XA 4J7RA 4KRLB 1QBBA 1QSEA 5I17B 1CL7I 1EO8L 4N90E 3RWGA 4GKSB 5IW6B 3HMXL 4PD4J 1FZMB 3VD7A 4HWNA 3KPQB 5BJTB 1C1EH 2AJZA 2AI0L 4PD4K 5LJYH 3ABZA 1GHFL 3NGBB 2C3WA 1RURH 3Q3GA 2NXZB 1KCLA 2OM5A 3ILPB 4QO1A 3F5WA 5DMJB 5EU7C 3MRDB 1OTSC 3BQUB 2FNBA 1VFUA 1K2DB 1XH3B 4HIHA 5TFSH 1UKSA 2AEPH 3HR5B 4OFIA 1DTUA 4D2NA 5C0DA 3QG6B 4XGZA 4R2GB 1FNHA 1N0LA 3V6BR 1F4HA 2P7TA 4NOBA 2B39A 2F54D 3UDWA 4F7CB 2VAAB 4RIRA 5FDWB 5JZ7D 5JQ6H 4JFFA 5F89A 3UTQB 3QDGB 4JVWA 5L2KA 2E9JA 3DX9A 1E4XH 1T7XA 1XGTB 5B8CC 4NO5B 5JXEC 3TA3B 1KCVL 1ZLUH 1E4WL 3WS3B 4XX1G 4PGEB 4YHML 5I75B 3K4ZA 1KPRA 3KAAA 4JKLA 1FLRL 2JJTA 5J0BA 4NNPH 4MB3A 5FOJA 5HBBA 4X4YA 2YN5A 4KRPB 3MRCA 2R0KH 1P5VA 4JHAL 4JQIH 3CDGB 3EYUH 2ZUQB 4PJGA 5HVHC 5DMIH 3VFUB 5T5FH 1NCTA 2ICEB 4NZRH 3UCRA 4MA7H 2ADGB 3DXAA 2UZYB 3DETC 4MD5A 4I1NB 2VKXA 3ZTJH 4JKMA 4DGIL 1QFUL 4JG0H 4EN3B 1MHEA 3SEPA 3JV0A 1MH5B 5LWYH 2W07A 5ELIA 2B4CC 1RIUH 5FKPB 3S97C 5EC1B 2IQAB 1EGJH 3ESVF 3OB0K 1MLCB 4PGJA 1UB6A 4E0RA 4QTHB 4X7SH 3R1GL 4H26A 2D9QB 5DEGB 4ODUA 1OAXL 1TCRA 3G5YA 4P4KA 2VDLH 4PRPE 1FGVH 4HS3A 5F1NA 2BVQB 3UJTH 4GQPH 1ETZA 4PB9H 1T0NB 4NO3A 2OTUB 5MP6H 1ZWIA 5FYLD 3HLAA 2HFFB 1MHHA 4PYHA 4DUXA 4GW1A 4HXBH 4PRHB 2NY1D 5HJ3A 3T4YA 1QRNE 5DSCA 5E08H 1FNAA 4DAGH 3MRIA 1XF4B 4QXTA 3BSZL 2ADFL 4MJIE 5EORH 3RX5A 4Q7DA 5DMGC 3IVKB 3QCVH 3DIFB 3QDJD 1HNFA 4XVTH 5I1EH 1NKOA 2O5YH 4CDGC 3O3DA 2X10A 2WW8A 2FJFB 1GAFH 3OHXA 1ZEAL 3O2DH 1T1WB 3SKOA 3TBVA 4FXGA 1CFVH 1UM4H 2PO6D 5I1KH 1OW0A 3LPWA 5BZDA 4OT1L 5EWIL 4Z78B 5DK3A 5HYEA 2FX7H 4G8FB 5JW5A 5BVJB 3WO4C 2FL5B 3RDTD 2D0GA 2VN7A 2AQ1A 3KPRA 3L3GA 4ALAL 4HWZB 1R3IL 3O2VH 1OD9A 1JUFB 2OTWA 1CD9B 3KLDA 4UAOC 3VXSD 2DIJA 2UWEA 1XIWA 2OL3H 2QQLH 4ODWB 4U1HA 4HMDA 3KLSA 3L6FA 1YEJH 2FWOB 1LK2A 3SDCD 1W72L 2NR6C 4X6CF 5EO9B 5GRUL 1H15B 1WJ3A 1DUZA 1AJ7H 4AZ8A 4PJEB 3BH8B 1SJVA 1QNZH 3HC4L 1KB5H 4ORZC 1DFBL 1AGDB 1JRHI 5D1XA 5EZIL 3FQUA 1TVHA 3GMLB 5CD3B 3FHQA 4JRWA 1GPOH 3QA3A 3BVNB 5GZOD 3EFDL 1JGVL 3IJHA 3WFEL 1BEYH 2XRAH 3OBAA 5CD5C 2R8SL 1J0JA 3TT1L 4Z7WB 1MLBA 4HUWA 1PZUB 3LMJH 3S4SA 4NKIL 4CAGA 2DYPD 3CSPA 2YD6A 5MEND 2Q7NA 4PV8B 3BKCL 2EEDA 1OY3B 2CLVB 3SN6N 3UTPD 5C7XL 3SJVA 4HK0B 4ZS7L 1ROWA 2OI9B 1ZHNA 2IFFH 4YFLI 1MELA 3DVNB 4MSWA 4Y1AA 3IDXH 5HD8D 3VWKC 2EDNA 1W72B 5D1QD 5TDPB 5ISZB 5T5NF 4LCUA 4GRLA 4JM2C 5CSGA 1MCDA 1ZHBA 2GJJA 2ZUVA 5F1SA 1HHHB 4FZEH 1X5AA 1I7ZA 4KUCD 2VZVA 1QR4A 5HXMA 1OTUD 4EUPA 5ITFA 2OJEB 1C08A 1T04A 1OWRM 4X6EA 4UT7H 3LKNA 2BNUB 3B83A 1A4KB 3EJJX 3RWFB 5HGHA 1G0DA 1R0AL 4LSRL 4ZXBB 1UXSB 1RIVL 5HPMA 1TZGL 1DSFH 4K9EH 4N1CA 5CEYA 1XCTB 2I5YH 3HE6C 3TCLB 5KSUA 1AD0A 4MAYA 1X5XA 1E4KC 2XN9A 1DDHA 1U3HD 3RAJL 4KGLA 4H1LA 3ULUE 1UWEH 4NHCH 4WNQB 2NZ9D 1FQ9C 1MREL 2D7QA 4U7SA 4G7YL 4NQCA 4Z77A 4IRJD 5JA9A 1S9YB 5JDSB 2YD7A 1Z9MA 2R1YA 2X40A 3RWIA 1PEZA 1LP9F 3IDMB 1G7HA 3BKYL 1QP1A 1I3VA 2Q8BL 1MFDL 5HHXH 4LVNB 1KPUB 1HI6A 3CX5J 2R1XA 4R96B 5F71A 5GZNC 1FL5B 5DI8B 4PJAB 4NO2A 3HN3A 3L3KA 3KPPB 2PXYB 4G80B 3RIAF 1XF2B 4O51B 2VWEC 4D8PA 2AVGA 1OB1A 1QVOA 1JPGB 3QUYA 5GS2D 1TXKA 4PY7A 3WKMH 3S9DB 3PGDA 2A0LD 4JN2A 2HFGH 1VHPA 2F5AL 1QOKA 4C56B 3MLXL 3NH7H 4XAKE 4PJ9D 4OUUA 4PJ8B 1I85C 1PFCA 1K6QL 3PWLA 3VFPB 2V5MA 1A1OA 4U1LB 1AR1C 3SBWC 4OZHA 5TPWH 3VFNA 3OPZL 2DQFB 5D8JH 1VFAA 1J1OH 5EBLA 5EOCH 4QXGH 2AK1H 4NRYB 5GGRY 3BZ4A 2NPLX 1QQDB 4ZTPH 1HQ4A 4M5YL 2AQ3A 2XWBB 3U4EB 3PWPA 3QRGH 1QTYT 3PQYA 1YEEH 5EUKB 5JNYB 3E3QE 5H8DA 3GHEL 1MNUL 4E5XB 1AGEA 4O58H 1CL7H 5F7YC 1RZJL 3UC0L 1QSEB 3ULSB 3RWGB 3TIDA 3FT2B 2KL6A 3MCLL 4OCYH 1Z9SA 2FX8L 1QEWA 3LN4A 4X7TA 2YRLA 4PPTA 2IF7A 1GGBL 3TO4A 4QXWA 3JV5A 3T2OA 4PBWD 4GMTL 1F4WL 3MQIA 2IPUK 3F5WB 4WU5A 4ZFFA 1A6VH 4TTDC 2W38A 1YMME 3R06A 4X9BA 5E56A 3WFBH 4XMLL 3T0EA 5E8PB 3EYOA 1ZANH 4HIHB 1NAMH 3T0AA 3PP4L 3UTTA 1WWBX 1D7FA 3UJJL 3UZQA 5C0DB 4XGZB 3CFKB 3L3JB 3KLAA 2P7TB 1UGNA 5IT2L 4JM4L 4MQXD 3PG2A 1F2QA 5TE4L 2BMKA 2AV1B 2YWZA 3PNWB 3TC9A 2PNDA 3BJLA 4R7NA 5KVEH 5L2KB 3DX9B 2AXJA 1KC5H 3GJFA 2QLVB 3GRWL 4W70A 4BSVA 4Y4FD 4RMRA 4HWBA 1C16A 1GOGA 2FYYB 2F19L 1MCQA 4NP4L 3TVMD 3ME0A 3U79A 4I3RH 3MLVL 1RK1A 2GJ6E 4X4YB 1MCPH 2LU7A 4X7EC 3CMOH 4M7LH 5K59F 3KYNB 5FYKU 3MBEA 4PJGB 1Q72H 1YYML 4NKOB 5D6CA 5T1LA 4V1DA 2XXCB 4O2FA 5C09D 1KACB 2P1YA 1Y6MR 3DXAB 7CGTA 2DWEA 4F33A 2H32H 1D6VL 2NY5L 4MD5B 3KPOA 4I48A 1CQYA 4LCIH 4L5FL 2BVUA 2Q7YA 5HHVL 1X5JA 4JGUA 5CMAA 5ERWA 1CGVA 2V5TA 1K5NA 3LEVH 4NQXA 3DOSA 5FHBL 3BPLB 5F7HA 3WL9A 3AC0A 3O6LL 4JHWL 4EEEA 4XNQA 1PBYA 2DLGA 4OZFH 1UZ6F 1HWHB 4EBQH 3BWAA 4MS8C 4IDJL 5ADOL 1F97A 1CD0A 5DJCA 5IR1A 1UB6B 4E0RB 4PREA 4KV5E 4H26B 4OLZH 4ODUB 1RUAH 4U6TA 1TCRB 3G5YB 5CAYB 4P4KB 1I9EA 3KJ4C 1WF5A 4HS3B 5F1NB 3ALXA 1F42A 1H3PL 4HPOL 3RY4A 3QXDB 4M7KL 1EEQA 1ZWIB 1FYHB 2PYEB 3BFOA 3QPQC 1MHHB 3ZKXB 2G5RA 2BSRA 1GGYA 3D3VB 2D31A 4GW1B 3SDYH 3SGKC 3QEHA 5HJ3B 1DVFC 4E9LA 3T4YB 4OV5A 4PBXA 3IDNA 3MRIB 4QXTB 3JWDL 1IKFH 4NUJB 5IB2A 3ARBA 3LQAH 2KUTA 1L9NA 2HTLD 1T7YA 2F58H 5F88B 1G7IB 2RB8A 2YMXH 3OHXB 3SKOB 3TBVB 1JMZA 4FXGB 5DXWA 2VLMD 5BZDB 4OCXL 1OVZA 3ZDXE 3WXVH 1ONQA 5JW5B 3FB6A 1NFIA 4XVUD 1VDGA 4HT1H 2EICA 3KPRB 3H8NA 3OZ9L 3VXUE 5JLZB 2WANA 4JQVC 1Q94B 2BNQD 3TZVC 2OTWB 1MJ8H 4BA8A 5A2KH 4H8WL 2XIDA 3MXVH 3SDAD 1NUNB 4HQQL 2UWEB 1ZGLP 1RUMH 1XIWB 3MJ8A 4LRIC 4JJ5A 1TJGH 3O4LE 1KJ2H 4I18C 4U1HB 1BBJA 4K3JH 1TJIL 3QIWC 4OQ1A 2MOVA 3L6FB 1A3RL 2NX5A 4AM0A 4GRWB 1DUZB 3MNWA 1NDGA 1AXIB 1EGJA 4TUKH 4MJ2A 4WW2A 4KMTH 3F7PC 1P1ZA 3QO0B 1JRHH 4RCAA 5D1ZA 5D1XB 1FH5H 2E6PA 4HXAL 3M8OL 3QA3B 1KF9B 1A7NH 5E99L 2P8MA 3H3BC 4C83A 1TJHL 1OTSD 1VESA 1MLBB 1V3LA 4HJ0C 4HUWB 3MFFA 1UWXK 2VLRA 3WFCL 3WXWL 4RGMB 5I1DA 4CJ0A 1JN6B 3B9VA 3BUYA 5D93B 3MRNA 1G7QA 1IQDA 1P84J 3CXDL 4HPYH 1MRCL 5IEKA 1A6WL 5IOPA 1ZHNB 3HC3L 4NQTA 4MSWB 4Y1AB 5CINH 5HHMB 4QRPD 1F3JB 3BRGC 2R4SL 3MROB 2QQKH 2VZSA 3UTSD 4KZDL 4GRLB 1FFOB 2YA0A 3TGXA 3OTTA 3QP3A 3O2DA 2VITB 2FB4H 3BPCA 1QYGL 2EDLA 4P5TA 1I7ZB 1N0XH 4EUPB 5I1AA 1S7TA 5ITFB 3O6FB 1T04B 4X6EB 1QR1A 4YHIB 4KFZC 2ESVD 3OKEA 5HGHB 4P46C 5FGBA 3U46B 5HPMB 3H9SB 1X5IA 5I74B 5KSUB 1AD0B 5GGRB 3WUZA 4MAYB 2R2EB 2WBJB 1RZKL 2OL3A 4OLWL 2XN9B 5FUCE 1R6VA 1DDHB 1MJUL 4PRIE 4R8WH 2NW3A 4X98A 4OLXL 2VDRL 3T77A 3GMRA 3DETD 3M17B 1LEKA 4Z77B 4OZIA 2IGFL 2NY6D 5DK2A 4LVOC 1G9NC 1P4BH 1KB5A 5EOTA 3RWIB 5EBGA 4L29A 5DQDL 1HSAA 1G7HB 1UM6H 2W91A 4V2BA 5HDQH 2P49B 5C0AD 1HI6B 3L7EA 2D9CA 5FAAA 3DSNA 4ETYA 2R1XB 4XI5C 3HZKA 2X9YA 1YNLL 2WQ8A 3L3KB 2BZDA 1RJZA 1FRGH 2YBRA 4JDTH 5F7LB 2CRZA 5FGRA 4D8PB 1OB1B 3BT2L 5F9DC 5F96L 4LEOA 1MAMH 2DM3A 3HKFA 1YEIH 4PY7B 1J1XL 1MUJA 1FYTD 3PGDB 3C2AL 2J88H 4JN2B 1WIOA 4OUUB 1CXEA 3LEYL 3PWLB 1A1OB 4YQXH 3DGCR 4M7JL 4OZHB 3EW3B 2OQJA 1IFHL 4UILL 3VFNB 2OR8A 1IILE 2VOTA 4JFQB 1VFAB 3I6GA 3UBXG 2KZWA 4K2UL 3TCXA 3BZ4B 5C71A 2IQ9H 1ZSDA 3S34H 5CCKL 1HQ4B 3CK0H 2X1QA 4OCSL 4JKPH 3PWPB 1OWWA 1G1CA 3PQYB 2DQUH 3NACL 1DQDL 2QSCH 3LHPL 3TIEA 3F6LA 5E6YA 4XWOC 2FEEI 1T3FB 1AGEB 3TBYA 3NMEA 4P2QD 2MSPA 3CFBA 3L5WA 3EGSA 1G9ML 1K4DA 3TIDB 4KJWC 2LABA 3LN4B 1KELH 1HHJA 2PCPA 3HA0A 4NM8L 4X7TB 4AMKH 4R26L 4KH2A 4RGND 3REWA 4G6FD 2XQYG 1H5BC 3ORJA 3TO4B 4RISH 3BJ91 4OBRA 1KTLA 5DJZA 4UNTA 3T3MF 2DRUA 1DLFL 2HG5A 3R06B 3V79C 4HH9A 4MVBD 4CU6A 4NZTL 3NIDE 1F8TL 3JZ7A 3RL1B 1NANI 3UTTB 3QCUH 2V5SA 1FVEA 1KNOB 2P5ED 4KK6D 4Y16A 3OGOE 3VI4E 3KLAB 4OBSA 4M43L 5DRWA 1Q9WA 2VZOA 4ZQKA 2ZCHL 5EPMA 4TSAL 5CD5D 3ZE1F 1DBAL 4POZD 1VERA 2ZNWA 2ITDB 3SY0A 3GSQA 3BW9A 3WLBA 3GJFB 2YD5A 4NFDA 3A67L 1C7TA 3KJ6H 3FB7A 4UT6L 1C16B 1AQDA 5FGCB 2YPKA 4XPBH 1XF1A 4JFDD 2F9BT 3VWKD 3ROLA 1B9ZA 5JQHC 2AABL 3KPSD 5FYLE 2J8UA 2HT4C 1T6VN 4O5LL 4WI8A 5AYQA 4FFZH 2DAVA 4BM7A 3EIFA 4EXPX 5DT1H 5D6CB 5T1LB 5EO0A 4V1DB 5TQ0L 4B7LA 1AKJA 1T1ZB 3MGTB 4O2FB 2QSVA 3QDJE 1BQHG 2DWEB 2HT3C 5GHWH 2X4UA 4ZO7A 3KPOB 4I48B 2FD6H 1GGTA 2Q7YB 5FM5O 4MDIB 5TQ2H 2EIZA 1V3JA 2WM0A 5CMAB 5ERWB 3RJDA 5I8EA 2NXZD 1FLTX 2NZIA 4NQXB 1I3UA 4XBPB 4U49A 5KANG 4WO4A 2CKBL 5JXAL 4XNQB 3IKCA 4N0FA 1HWGB 3FOLA 3BWAB 2IPTH 3MOAL 5DJCB 4JFOA 3CSGA 3OAZH 4PREB 4CVWA 4JB9H 1NAMA 3VFMA 5EU4B 3S36H 2HVKA 3NFSH 5DRXB 3VXSE 4GAGH 3CD4A 4L4JA 5GS1C 4PFEA 4PY8J 1EBAA 2DBLL 4YFEA 2B4CL 1PYWA 1DQTA 2DQJH 3IJYA 4FQHA 4W6XB 2DLFH 5GZND 2BSRB 3PXJA 2D31B 4R4FH 1ZT1A 5ALCH 2JB5L 3QEHB 4ISVA 1AXTL 3P0VH 1HEZA 4XC3H 3MA7B 2K7QA 4YZFF 2AGJL 1EEYB 5IB2B 3G04A 3ARBB 4JRXA 2C5DC 4LAQL 2DJUA 3M1BA 3N85L 2XZQH 1A7PH 2ARJQ 3KPTA 3V5DA 1GRWA 2XFXA 1HINH 1J0YA 3HC0A 3WLWC 5MENE 3ARFC 2X4PA 1ONQB 4XX1E 5HGAB 1S3KL 4WCYH 1AR1D 1NFIB 3UTPE 4IJ3C 1UH4A 4MX7A 4XPFH 4A6YH 1QSFD 3EZ8A 3RWEA 1U93A 3P9WB 3BPOB 2H32A 1NJ9A 1T5XA 3BP4A 4KPHL 3MJ8B 4OIBA 1EFQA 4JJ5B 1BBJB 2AKRA 4DTGH 4OD1H 4JFZL 3NCEB 5CWSA 2NX5B 1G0YR 3K3QA 2FJGA 5CJXA 1BECA 1NDGB 4OZFA 3EDKA 1A9EA 2V17L 4WW2B 4D0CA 1DZBA 1P1ZB 3ARUA 3VMNA 3MLSH 1KEMH 3WHE0 3VRIA 1XR8A 1ZLWH 3QUYC 4XP6H 5C6TH 4RAUB 4OI7A 4Y4HC 2P8MB 4R6UA 3B9KA 3MV8D 4C83B 4TTDD 4OLUH 3KR3H 3MFFB 1JPTL 2UUDH 2A83A 2VLRB 4NFCA 1IM9A 5I1DB 1P9MA 3BUYB 3DROA 4U2ZA 4JAMA 2P4AB 1R5WB 3TFKC 2RJMA 1YEHL 2AJSH 1IQDB 2EC8A 1KN4L 4DZ8B 5IEKB 5IFJA 4KK5C 3WIHH 1JGEA 4UMGA 4AT6B 3I6KA 1RFDL 1BVKB 4J3OC 2A2QT 1HCFX 3QNXA 1MCEA 1RZFL 3VD4A 4KXZI 2WBKA 1YN6B 4KVNL 5BMFH 3BZDA 4RNRB 3EO9L 2ATPA 5IVXB 4TVSa 3BPCB 4WTZG 1QLEH 2EE3A 5JW4R 5CLTA 5JO5B 2W9DH 3PL6B 2DWDB 1WZKA 1I8IA 1ZA6A 1GZPA 1N5AA 5I1AB 1S7TB 4POUB 1QR1B 2HFTA 4WWKA 4OM0L 1TENA 2FECI 3OKEB 1EEUA 3H6JA 3ARGC 1DBML 5C0RH 4L1HA 3MUGA 1FPTH 1ZMYA 2CO6B 1AQKL 8CGTA 3MJ6A 3VWJC 1MPAL 1A3QA 1YPZA 4PJFF 3QH3A 2DQCL 4Y8DC 3IFLL 1KJ2A 5I66A 3T0EC 1H8SA 2HN7B 2J3SA 2NW3B 4TSCH 4X98B 1NCBH 4PJXF 4CMHB 1XGUA 2BJMH 5I71B 4OZIB 4OSUL 4ZODA 1C5CH 5DK2B 2EDOA 4BFBD 1EZVX 3MCKB 5EOTB 1QUNA 4L29B 1HSAB 2IC2A 5I6XB 3L7EB 3WNPA 1MCBA 1Q0XH 4WEBL 3HZKB 4PJHE 4MS8D 3QWRA 1IGIL 1CGUA 4G5ZH 1INQA 3DVFA 5T3XL 1RJZB 2YBRB 4PJCB 1MFEH 3CC5B 1P2CA 1HHIA 3K81A 5IMMA 1NL0H 4LEOB 1BF8A 1OGAA 1UM5L 3TH2T 1O7VA 1M7DA 3UX9B 3QPQD 1T22A 3SO5A 3TF7C 3FO9A 4MNGE 3B2VL 2GFBB 5FHAH 3H9HA 3MBEC 3OXRA 4HEME 1F00I 3ES6A 2JIXB 4JDVA 4LSQL 1NUFA 2FEDD 1NKRA 4JHBA 5D7IE 1TVBA 3EZJB 1ZT7A 4N9GA 3I6GB 4LCCC 2MCPH 4P49A 1A7BA 6FABL 1ZE3C 3V7MA 3TV3H 1ZSDB 1UZ8A 3MACL 4DUWA 1J0KA 3MV7A 1JJUA 1QKZL 1VGKA 5ANMA 4NCC1 2G60H 4YBLC 4KHTL 5BO1H 4GH7B 3W0WD 5CBEA 1KTDA 1X5HA 4ONHB 3FQTA 1CR9L 1G6RH 1IGFH 1K4DB 3JUZA 2DOCA 1WISA 5HI3C 1WAAA 1ZHKA 4OFKA 2PCPB 1RHHA 4DWHA 3REWB 4YIQA 3ULVL 5IBTH 4KROB 2J6EH 4ZUTA 3G5VA 4M7ZC 5FUZL 3QIWD 4KDVA 1LO2L 4NHUA 5DJZB 4PV9A 3MXWH 4YNYB 2MQ0A 3BIBX 4JREC 5LGHL 2HG5B 3HNTH 2GSGA 4JCLA 4G43A 2Z8WC 4HH9B 3QUML 4IMLB 4YXLL 5C09E 4XVJL 1R3HA 1L7TL 3VGBA 1FVEB 2JELH 3F7QA 3I9GL 3UPAA 3MRQA 1F4XH 3PF2A 4WTXA 1WITA 4ODTH 2N7BA 5DRWB 1Q9WB 4U1GC 4XCNA 4JFPA 5JIHA 1F58L 3B9DA 1JIBA 3NTCH 2H9GA 4WGVB 3O6ML 3CLEL 4KV5F 4HJ0D 4MHHI 1LE5A 1IKNA 3VE0A 3BX7C 5LXGH 3SY0B 3G6JA 5SWZD 3GSQB 3WLBB 3U7WH 1KLFA 2Q3AA 3FB7B 1NCCL 5GJSH 1AQDB 4F37F 1RIHH 4BFIA 1YEGL 2YPKB 1Z0MA 4KVCH 5JOFB 5D7KE 1IAOA 3ROLB 1IAII 4XNMA 1QZ1A 1A1MA 4FFYL 3QUMB 5C0EA 5I15L 1U8LB 2Y7QA 4GFTB 5T3ZL 5DWUL 4LSSH 4HBCH 4PGDA 1OP9A 4KI5C 4S1SL 5AD0A 5EO0B 1QSED 5DFWH 2DMCA 3ZDXF 1QD0A 2X4UB 5D1ZC 4P46D 5B38A 3CUPA 4K94C 1EHLH 4Y0GA 2EIZB 2UYLA 4WWID 2XKNA 4E42A 5L7XH 5IJKA 2VLME 4LQFH 5I8EB 3VFWA 4WO4B 2CLRA 4PR5A 5M95B 3JWNC 1CXFA 4N0FB 3FOLB 2XTJB 3LPFA 1UVQA 3HZMA 2EYRB 2I60L 1R5VA 2GK2A 5T33H 4JFOB 2DJSA 1Y6NR 2BNQE 1T21A 2JJWA 1NAMB 3VFMB 2HVKB 2YUXA 4FNLL 1J88A 4L3EA 3NBNA 5JHDA 2YUVA 2P5WD 1PYWB 4JFFD 3RWDA 3KVQA 4L8SB 2VTFA 3GMOA 3IJYB 4FQHB 5F7UA 3GI9H 3S4SG 5EN2A 5L2KD 1XR9A 4XI5D 3IFOA 4K3EH 2ZCKL 3FRUA 3KS0H 5FYKL 4BFGA 3RKDD 3FMGH 1ZT1B 4HIEA 3L5JA 3KWWA 1CFQA 4P5TC 3WJJA 4ISVB 1QFWI 1D9KA 3H42H 3OJVC 2EDBA 3CZJA 2EYSA 4MJ5A 5C0BD 3G04B 1P7QA 5C9JA 5BOZG 3UJIL 5DZNA 2ZKHL 3M1BB 4FTVA 4JG1L 1OT1A 3V5DB 2XFXB 3HC0B 4MQ7A 1G84A 1X44A 1F3DJ 1SVZA 2X4PB 1M71A 4BQBA 1A47A 3MGOB 2LTQC 2VC2L 4EUPG 5SWSB 3F12A 4MX7B 4APQA 2B8OT 3I75A 1FO0H 4QRPE 4Y5YA 5GGTL 1U93B 3UTSE 3FB5B 1NJ9B 1T5XB 3BP4B 4R90H 4DFHA 4M48L 3BKMH 4FN0A 2AKRB 5D5MB 5HHOA 3QB7C 4XWOD 3WIIL 3D0LB 4BYHA 5CWSB 2Y6SD 4H1LG 3I84A 1H3TA 2Z31B 1IZJA 4KJWD 1RAMA 4LHQB 4OZFB 4FQXA 4Q9CA 2A6DA 4MXWL 4D0CB 1U8HA 4NQSA 2ESVE 2F53D 4ODXA 1XR8B 5J12B 2B2XH 1CIUA 2E5EA 3QXWA 4XWGL 2NY7H 3B9KB 4Z7WF 1NGQH 4Y89A 3VGAB 1BOGB 2A83B 2RQ8A 2AJVH 1IM9B 1LO4H 1CG9A 2I07B 3AREA 3MBXL 3TWCL 3DROB 4OCRH 4JAMB 3LD8C 4ZFOL 2R56L 2Z35A 5KOVC 1FE8H 3BIAX 3GEWB 2PYFA 4JFEA 5IFJB 1JGEB 3I6LD 4UIKH 3IDJB 1U2CA 4TOYL 5JUEL 2HWZH 2WUBL 3BP5A 2QSTA 4MCZA 5E0QA 2YUWA 1P53A 3CVIH 5IV2B 4KXZH 3B2UC 3QNXB 5DEZA 4P3CL 5GXBB 4FQPA 4HMEA 3MLPA 1CI5A 4QEGA 4ZPTB 1BJ8A 1TNNA 2Q6WA 1MCOL 4N0UE 1T89A 3ZT7A 1MFAL 3KGRA 3QJHB 3VJ6A 1ZA6B 1S9KC 4DKFL 4KC3B 1N5AB 4HW6A 4M62H 5SV3A 1A02N 1BFVL 2VDML 4RQQB 4A6YA 2K1MA 4WWKB 5C07A 3INUH 3HNVL 4ZFOB 1XIWD 2IFGA 5LGKA 3MUGB 3CZFA 2HT4D 3PGCA 5BVPL 5E8DL 1DQJA 1MFBL 3L3DA 5SX5H 1N59A 1YPZB 3QH3B 4JRYA 5C08A 4AEIL 3CXHJ 3WIFA 5FO8A 1MY5A 5JIKA 3CSBA 4Z8FL 4ZNCD 2HT3D 3JXAA 3CXHK 1XGYL 2LU4A 1KXVC 1U8JB 4Y16C 4P59H 4O00A 4TN9A 3T8XA 2C3XA 2CIIA 4HKZA 3REVA 4YDVA 5HDOA 5F3HB 1S5IL 1TIUA 2BVEA 1MCJA 4QNPF 2H45A 1HILA 2CPCA 4WHYH 4U6VH 2BNRA 4D9LL 2EIDA 5FYJH 2W92A 4PJAF 1U6AL 2ITCB 4GS7B 1E0OB 5GJTL 4PLKC 1INQB 2FRGP 1P7HL 3EOTH 3HPLA 3SJVD 4RGNE 4NQEB 1P2CB 1HHIB 5HGBA 5LVEA 2EZ0C 2LU3A 4TQEL 3WIHA 5JOEA 1I3RA 4LRNH 5C0GB 4JO4L 2A9ML 5IB3A 1M7DB 3BD4A 2RGSA 4G3YH 3VI4F 3FO9B 4FQLH 3NCJL 5I1GH 3KYMA 5CP3H 1U58A 3H9HB 1MOEA 3OXRB 3ES6B 4JDVB 3QXUA 1CZ8L 2P5EE 3CFEA 3CIQA 5J1AA 1U8KA 5AG9A 4OTXH 1AFVH 1ZT7B 2I26N 4N9GB 4YLQT 3MRRA 4LSUL 1UZ8B 1FAKT 4ZOAA 1IARB 1VGKB 3WLWD 1YEFL 3S5LA 5ANMB 3TPKA 4LLWA 3T0BA 3LRHA 3ARFD 2HRLA 1TPXB 3QWOA 4WUUA 5SWQA 5C0CE 1KTDB 2VJXA 3P0YH 1A7QL 3H7LA 4KY1H 2Y36L 3E8UH 4J23A 2NTSP 3QDME 4JFDE 4KUZH 4NT6A 3W9EA 4NQCD 5IROA 2WMPA 5IMLA 1JNHA 4FMFA 5AEAA 1RHHB 3KDMB 2QR0B 4YIQB 2VLKA 3KPSE 3H9YA 2X70A 1DUYB 2L7UA 2DLHA 4BH7B 4ZUTB 3G5VB 5B3JF 3VG0L 5B22A 4D3CL 4HSQA 4NHUB 4PV9B 1BGXH 3IS1X 2VLJE 2GSGB 4NQVA 4G43B 1T1YA 1AO7A 3U1SH 3GUTB 5IIEA 4P9HC 3NA9H 3BO8B 1VPOL 1FDLH 5C2BL 1R3HB 3QHFL 3O4OB 5C70A 4XPHH 3IAQA 4DOHB 1U91B 1JBJA 3QUYD 4YPJA 1DLHA 4HH8A 3WN5C 3L95B 3NVQA 4XCNB 1LP9A 4JFPB 2UY6A 3SQOL 1X6NA 4F3FA 1I7UA 2VSCA 2H9GB 5F9OL 1HHGB 2FH6A 2DQTL 1BBDL 1LE5B 3VE0B 3A6BH 1FGNL 3HPJA 3G6JB 3TFKD 1RMFH 2APXA 1E28B 5CEZH 4TRPL 3VXMA 3C8KA 1IAIH 5J1TC 5JMRA 1TCMA 1J10A 3IU3A 2OXGA 1IAOB 3GO1H 5DD0H 3V0AC 5BCAA 4XP5L 4XNMB 2A9NL 4TYUA 3U0TA 4MA8L 1CU4L 4NJAH 1A1MB 4YDJA 4Z7OF 2Y7QB 1FNEA 4KJPC 3QEGH 5IFAL 3JTSB 4FXKA 4G7VL 4PGDB 1YA5A 2XTLA 5TF0A 1J1PH 4PJGF 4XNYH 4ZAKB 1ZTXH 3GSNH 5JW4Q 3BWUC 4QRRD 5AD0B 4NN7B 5F9WC 3LDBC 1NGWA 4Q58C 1G6RA 4ELME 3VGGA 5B21A 1Q9KB 5T1MA 5B38B 3CUPB 3IDYC 3ARGD 4FQIH 4PY8I 4OF7A 1ZT4A 2RAMA 2D4DA 2XKNB 2I27N 3NOIA 3VFWB 2D7MA 4F7PA 2J6EA 2Z9TA 4JO1L 4PR5B 2AJUH 4KQ4L 5GRXG 3T0ED 1NFDB 5I0ZA 1LDPL 2XZCH 4F9PC 1UVQB 3HZMB 2RIKA 2RFXB 1Y18A 4WI3A 3UTTD 1R5VB 1CGTA 4X80H 1QSFE 3N9GH 1W8OA 5DZLA 1T21B 4ODVL 5B4MC 2ZNXA 4GUPB 1IAKA 3L7FA 5E2TL 1ORQA 5JHDB 2R0WL 2CR6A 3K2MC 5GRWA 3AM8A 2CJUL 3GMOB 2NNAB 3O9WA 4N8VB 2X2YA 5EN2B 1XR9B 1BFTA 4MWFA 3D69B 3IFOB 4HS8L 3WMSA 5F6HJ 3RHWF 1QFWH 4HIEB 4QHLA 1K4CB 3KWWB 3FT4A 1T1XB 5C86A 1D9KB 4RDQF 3K80A 1I1AA 1H0DB 2EYSB 5GGQH 4LEXL 1B2WL 1BJ1J 1P7QB 1A6UL 2BSSB 2EDXA 5C9JB 1KTKE 5EB9A 3ZYIA 4DW2H 1Y6KR 1Z5LA 3MV8E 3RP1A 3D39B 1KCRL 2UZXB 3MOBH 1MCWW 3RTQC 1V8HA 2WIMA 4MQ7B 4LSTL 4J3TA 4HFUL 3DX8A 2WIIA 3MBED 3GK8H 4X99A 1RZGA 3QIBA 4M93C 4KJYA 3IDIA 5F7FA 3MODH 3S36L 5T1LD 4U3CA 2EH8L 3I2CH 1MI5D 4I3SH 3F12B 4APQB 2O93L 1RJYA 1DQML 3I75B 3K1KC 4LKCA 2DD8L 5C92A 3QUXA 4Y5YB 4R3SB 1F4YL 4U6YA 5D72H 2UWEF 3UTOA 4DJMA 1UWXH 5DURD 3SDDA 3WD5L 5DDHB 1A0QL 5KSVA 1WV7T 4JPIA 5GS1B 5J6GA 4X9FA 2WUCL 4GRWF 5HYSB 4YEFA 4WIQA 1ACYL 4DUVA 1I1CA 1U8HB 3CLFH 4NO0B 4BZ1H 5IQ7H 4ODXB 4P5MA 4UT9L 4G9FA 1SEQH 3MSPA 4YDIH 2NLJA 3S8WA 2XA8L 2UZIL 1EA9C 4Z7UE 3OJDA 4Q9BA 1U3YA 4NWUL 1MWAL 1NMCC 2AJ3B 3AREB 1N4XH 4LKXA 1KG0A 3TJEH 4KTEL 2AERT 5E2VL 2B7DT 2VXQH 2G9HA 3P11H 4E41D 1GGUA 3ULUH 2I24N 3GM8A 2Y06L 2DTMH 4MCZB 1BJMA 3F65A 4M1GL 5I0DA 2QQNH 1F90H 3QHZL 4Z9KB 3SDXA 2I9TB 5HPOA 3RY6A 2VXUH 4HCRH 5FYKE 4URTB 2BVOA 4Z7NF 3U0WH 5E5RB 1TQBC 3ARVA 3VJ6B 1QFOA 3ZDYE 4WW1A 1NGPH 3BAEL 4HWEL 1GGCL 2VDKL 3HFMH 5B39A 1H9VA 3F8UB 4W6YB 1OP5H 4A6YB 5MEQA 5C07B 2L4OA 1NGZB 3S88H 4YDKH 2ED9A 4L1DA 5JDJA 2CIKA 1FO0A 4C54A 1KEGL 5DUPH 3CZFB 2BHZA 2FATL 3L3OB 3PGCB 4KI5D 5KTEH 1DQJB 1EHAA 1KIUA 1ZHLA 4I77L 2CK0H 3L3DB 1N59B 1JFQL 5FCUL 3FFCE 4JRYB 5C08B 3WIFB