4LSWA

Crystallization and structural analysis of 2-hydroxyacid dehydrogenase from ketogulonicigenium vulgare y25
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
318
structure length
318
Chain Sequence
MTKPEILQLGPYPAWDQEPLDAAFTVHRLFEADDRAAMLANVGDRIRAIATRGELGASRALIEACPNLELISVYGVGYDAVDLAACRERGIQVTNTPDVLTGDVADLGVAMMLAQSRGIIGAETWARSGKWAAEGLYPLKRRVFGRRAGVLGLGRIGFEVARRLAGFDMQISYSDIAPKSYAPDWTFVEDAVTLARDVDFLFVTLAASAATRHIVGRDVIEALGPEGMLINISRASNIDEEALIAALADGRLGSAALDVFEGEPNFDPRFRDLPNVLLQPHHASGTIETRKAMGQLLRDNLTAHFAGSPLLTPVVLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and structural analysis of 2-hydroxyacid dehydrogenase from Ketogulonicigenium vulgare.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords D-2-hydroxyacid dehydrogensase protein
total genus 110
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2013-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lswA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lswA01
3FSRA 2J6IA 4KDEA 5CFZA 3WBFA 4R54A 5COQA 5CEFA 5TIIA 3E18A 3ZNQA 1NR7A 3WTBA 6LDHA 5TT1A 4N5NA 4GSLA 3NUGA 5F3RA 3IC5A 1DRVA 1P44A 1LLUA 3PVZA 4ROSA 2VWGA 3ZI0A 2UYYA 1MLDA 4GX0A 1T2AA 4J2HA 3JYQA 2X1HA 4I9UA 2AG5A 3LC1O 2HRZA 1ADBA 2O7QA 4WPGA 1B3RA 5AXAA 2NU8A 4ND3A 1R4MB 5I7VA 2EJVA 2Y99A 2BGMA 2JCVA 3DOCA 4R3WA 3HDYA 1Z7BA 4CUZA 3K2BA 2AA3A 1WLYA 2O3QA 4KWHA 1H5QA 3VPHA 3SLGA 1NFFA 3DC2A 2HQ1A 1VSUA 2GZ1A 1DJNA 3I5MA 3TNLA 4BNUA 4JQCA 3ZGYA 1F14A 4R9SA 3LC7O 1BVUA 1X13A 4PZEA 2POQX 4CMKA 4ND4A 1BXGA 1H2HA 4YDRA 4FGWA 5BR7A 2HK7A 3PIIA 4XIYA 3QHAA 2FR8A 2C7VA 4BNXA 4RO0A 4J0FA 4NJMB 2ZB3A 4CR7A 4E2ZA 3GUYA 1YB1A 2DBQA 3FBTA 3G3EA 3BMCB 4IXTA 1QORA 4BKOA 2A9FA 4P8RA 3FD8A 5U9CA 5B37A 1N2SA 4B4VA 4D45A 4DPLA 3DDNA 3MOGA 2VUSA 4LK3A 4S3MA 2BD0A 4TRNA 5A3VA 5FF9A 5ITVA 1VC2A 4DRYA 3HB5X 4IS2A 3BZUA 4OOFA 3RJ9A 4B7UA 1IZ0A 2DKNA 2D4AA 2X23A 4XR4A 2JFHA 5G4KA 3U9LA 4A0SA 3UCFA 3JD4A 3RD5A 2DU8A 2RIRA 2VHWA 2W2KA 1QV7A 3N7UA 3E5RA 4JGBA 4RPKA 4J7UA 4XYGA 4XWYA 1UP4A 1XQ6A 2PD6A 2YJZA 2X5KO 3EVNA 1W8DA 4ILKA 4DLLA 2Y1CA 1RM3A 5L9AA 3LDHA 2IEDA 4CM5A 4DMLA 1ZBQA 1IOLA 1JU9A 4ALJA 2FPIA 4RVGA 4N7RA 2DQ4A 3W4KA 3WGOA 3VHRA 3RC9A 5TJ9A 2C82A 4CQLA 4PZCA 8ADHA 1P31A 3TL2A 1T24A 4LSWA 2NNLD 4J1TA 5A1TA 4A27A 4YVFA 5CP8A 5JE8A 3O26A 4H7PA 1YJ8A 3LQFA 2WE7A 2CVOA 4GL4A 1VKOA 2YYYA 3WMXA 1N1EA 3PHLA 4MO2A 3KM0A 4GWGA 4DIOA 5A9SA 4OH1A 2NVBA 4XYLA 4WCFB 1LDMA 5KOIA 2Y68A 3AY7A 2WWRA 3B6ZA 4E31A 5BSFA 3P19A 2Q1WA 3ZCXA 5EQFA 2D8AA 3S2FA 1DFGA 5BNTA 1CWUA 4XR9A 2Q1TA 5GMOA 2PZKA 1R12A 1MUUA 2CUKA 1Q2XA 1QR6A 2J5QA 2X0JA 4QO7A 4NBRA 5HA5A 4D3FA 4G5HA 3GEGA 4Z9YA 3CXRA 3LYLA 4OXKA 2CDBA 2CMDA 4YAJA 1X15A 3RQSA 1SCUA 1V3UA 1ENYA 4PG7A 1HT0A 1ZNQO 4I1IA 2FN7A 4IXWA 3UICA 2E6UX 1DB3A 3GF4A 2C5AA 3JQ7B 2O4CA 4BO4A 3KRTA 4UVEA 3AOGA 1QYXA 4EUEA 3ASVA 4FJ1A 5JCJA 3VOSA 1K6IA 2ZCVA 3W8FA 2CY0A 3GC6A 4RVHA 2IZ0A 1Z7EA 3ZH2A 3ROPA 4MDHA 3H4VA 2B4TO 3RUCA 1DC5A 1C0IA 1KC1A 2FR0A 1I33A 4DPKA 1V3VA 4FFNA 1WPQA 1N5DA 1GV1A 4JIGA 4TVBA 4JNKA 1E6WA 1FJHA 1LDEA 2G0TA 3C3XA 3LLSA 3QVOA 1Y9AA 1R4NA 4BUCA 3D4NA 3DOJA 4WOJA 4IDAA 3IMFA 3PLRA 5TRTA 1V35A 1LLQA 4HWKA 3V2UA 2ZTUA 2G82A 1T1RA 5EJ2A 1KEVA 3A28A 3W6ZA 1FDTA 1MP0A 3PJDA 5FI3A 3BMQB 5KJFA 2BFAA 4CQMA 3RKUA 4HX5A 3U5TA 3IAHA 2P91A 2YZ7A 4E5NA 4O5OA 1SEPA 1E3JA 4MVJH 4GWKA 1SZJG 1IY8A 1XELA 3PYXA 2D5CA 1IYZA 4DC1A 5JFOA 3ANMA 3H2ZA 1V0JA 1PQUA 4FFRA 5LC1A 4PZDA 1NWCA 4RLSA 1P74A 4L9RA 3E6AA 5GY7A 2VUUA 4NBUA 2VT2A 4KUEA 2OXIA 3LF1A 4KP7A 3I9LA 1I3LA 1Y5RA 3RFXA 3VKVA 3TN7A 1Y8QB 1YVEI 4CR8A 4NZ9A 2P9GA 3HWRA 4O59O 3UOGA 3VH1A 4YJHB 4G2NA 3QJ5A 4PLWA 4BNLA 1JKFA 1UXKA 1GCOA 4ALLA 1QP8A 2J3IA 4Y67A 3ITKA 1U7TA 4OMUA 3OETA 4UULA 2Y66A 1XLTA 4QT0A 2FR1A 5GZ3A 2ZTVA 1AUPA 3NDRA 1LEHA 1OFGA 4XA8A 3RUEA 3GMDA 2XOXA 4K26A 4N18A 5ES3A 1Y7TA 2HK9A 3WGQA 4MKRA 2PNFA 1CYDA 2IZZA 2VYVD 1XWFA 2HMSA 2I65A 4CV0A 3IL2A 3H9UA 1A71A 5FYDA 3DXFA 2Q45A 1WW8A 4BO1A 4XGNA 4CUKA 3E82A 4OL9A 3UUWA 2JD2A 4CMJA 5L40A 3DL2A 4PG6A 3PWKA 3LT1A 3W4IA 2X5OA 4EGFA 3DZFA 3DAGA 3E9QA 1WDLA 3GR6A 1GAEO 1NX6A 3TZHA 2A92A 1SO8A 3HADA 1GZ4A 2I67A 3DZKA 3ZWVA 2NTVA 5B4VA 2DUUA 3K6JA 1F0YA 4RQUA 2D1YA 3FHLA 3OEYA 4Q3BA 3VH3A 3BTOA 3QQPA 2EGHA 2X0RA 2ZCUA 4CM6A 2EG9A 2HUNA 4AJPA 4NI5A 1XR3A 5T6BA 3WB9A 3IP1A 2PH5A 4NMHA 1N8KA 5HM8A 1CEQA 3JYOA 4ZVVA 4CV2A 2UAGA 4XQCA 2YQ4A 4A26A 3RUAA 3GN1A 5JAZA 2OHXA 3QA9A 1GDHA 4IDCA 1KIFA 4Z3KA 4TRMA 3BHJA 3OHSX 4CM9D 1F8GA 2Y05A 1EMDA 3BMOB 1HSOA 4GVXA 4LRSB 4PLGA 4OM8A 3ZW9A 1SBYA 1LTHR 4UUMA 3OA0A 4IMRA 3ZWBA 4DL9A 1FK8A 1QV6A 4MVJP 3LK7A 4NFHA 4LGVA 1U28A 5DBFA 2JFFA 3HQ4O 1FDVA 4ALIA 1GEGA 4AJNA 1PGNA 3L4BC 1E3SA 1B15A 5KJ6A 1HL3A 1V3TA 5U4QA 2O3UA 3D4OA 4QO8A 2H1SA 4OJNA 5A5EA 1EUDA 1LI4A 2IE0A 1E1KA 1EFLA 3D64A 2PKQP 4I5GA 3M1AA 4RLHA 2O48X 2JL1A 4IJKA 4D0RA 2BKAA 1B7GO 1K5HA 2PFGA 3OEWA 2UUOA 1QYCA 3V1UA 2OORA 5TS3A 2DVMA 2O23A 4FCCA 1GUFA 3TOXA 3EYWA 2QRKA 1ADFA 4LW8A 1P1HA 4YJHA 1Q0QA 1AGNA 4CLDA 4K28A 4GKBA 4P4GA 1VM6A 2PGDA 4EEZA 4HADA 7ADHA 2UDPA 2AMFA 2FZEA 4UVIA 4J49A 3PZBA 4BNYA 3BMOA 4YAKA 5BQFA 4RVFA 1PS8A 3I9JA 1YBAA 4EDFA 3OQBA 1B8PA 5A06A 4B3HA 4B4WA 3PGXA 5A03A 5ADHA 3D1LA 2PD4A 1E7RA 2YFHA 3IDSA 3IKVA 3FWZA 4TZKA 2VRCD 3T4XA 1PIWA 4NR0A 4XKJA 1IB6A 1XDWA 3SJUA 1E3LA 1DBVO 5C7OO 4HY3A 1J0XO 5F5LA 1TXGA 4AJHA 4L0QA 4CM8B 2BI7A 3C1TA 1MX3A 3TZCA 5KJEA 1G0OA 4P38A 3AW9A 4MKXA 1JTVA 3JYPA 4ALKA 4P22A 1EDOA 3F3SA 2DTDA 3EMKA 4Q3AA 3WR5A 1HYGA 1PGQA 3RJ5A 2UUPA 1GFSA 4M1QA 4BNKA 1QMGA 1W73A 3UKOA 3AUTA 4PVDA 3VPFA 3L0DA 1T2FA 3WXBA 2VQ3A 4XCVA 1A7KA 2P68A 4HFMA 4J90A 2Q50A 4JROA 3K31A 1Z74A 2PWZA 1M6HA 1U4OA 3ZU4A 3L6EA 1U2GA 2ZJ0A 5KTKA 1N7GA 2DAPA 3T4EA 4E13A 5JO9A 3U09A 3UFXA 4WLUA 3KYCA 1BDBA 1ZEJA 4BGIA 1Q7CA 3PQFA 4E5MA 2ZYDA 3BTSA 4OQYA 4WJZA 1HDXA 1A7AA 5HTOA 4YTEA 1OC2A 2WYVA 1U3UA 3TZQA 5CHEA 1Z6ZA 1GUYA 3TWOA 5L7WA 3JQ7A 5L95A 3R3JA 1JVBA 2EKPA 5KJCA 4AJ2A 4TKLA 4OKNA 1DOHA 3OFSA 3ETEA 4CM3A 4CQLB 2NU9A 1T2DA 4L73A 4RF4A 5IDXA 3CZMA 3VC7A 4J7XA 4BKRA 4CMAA 5K9ZA 3U62A 3D5TA 3NKLA 4KWIA 1NVTA 1YL6A 4DIBA 4BO0A 4BS9A 1V8BA 3ZV3A 5ITWA 5L53A 4L4RA 1DIAA 3GVHA 1D7OA 4JBGA 5FWNA 1QSGA 3BTVA 1VL8A 2EKQA 3IIEA 3KEQA 2B4RO 3F5SA 1PJQA 2X6TA 4Q3NA 3H6KA 1S7CA 4BQRA 3GRPA 5ICSA 3KLMX 2CDAA 3ON5A 4MIYA 4WGGA 1Q0HA 3U3XA 5HWSA 2GDZA 2OUIA 3RUDA 1QLHA 4PLVA 2ILTA 2VHYA 4CLOB 3DZGA 2J5RA 5DOZA 1D4FA 5KVSA 2AEFA 3C7AA 4II3A 1UXIA 4IPTA 2PH3A 4KOAA 2E49A 3GDFA 4CLRA 2NLOA 3H8VA 1E7SA 2I3AA 4D7AA 5IN5A 3VZPA 1NHWA 2I66A 1I2BA 1ZK4A 4YAGA 1ISIA 1WMBA 2G76A 2YY7A 4PRKA 2B35A 2VOJA 4P4NA 5TSDA 4D3DA 4FB5A 5I7EA 3WLFA 4XGIA 4B3JA 1UXHA 4J43A 4YT4A 5TX7A 3GVXA 2BI8A 4M86A 4XD2A 3WDSA 2ZTMA 3ZN2A 4B79A 4CUJA 5TLSA 2EIHA 1UZMA 4IBOA 4PVCA 2FSVA 4FQ8A 2P5UA 4WLEA 3WX0A 3O8QB 3EY4A 4MVJI 2IXBA 2NUAA 2NV6A 4MVJM 4GLOA 3GZNA 5DT9A 5H81A 5L51A 4L75A 4IIUA 4MVJD 4WNIA 2UVDA 1R15A 3QVXA 4F6LA 4E32A 1YGYA 4ITUA 4UEOA 2V6GA 2EV9A 1K6XA 4F3YA 1LSUA 4KQXA 1PJCA 2HMVA 1R0LA 5DOVA 4DVJA 2VHVA 1P3DA 4P4LA 2C2YA 4RDHA 4WEQA 3ZNOA 5A05A 4XGKA 3Q6IA 5AYVA 5I9NA 1ZXLA 2JJYA 3OIFA 1PZFA 4Y9DA 2Y1OA 1LC0A 1R4MA 3ROMA 3JD2A 3RC7A 1X7HA 3VTFA 2O3JA 2CZCA 3GVCA 1Q7BA 4BNWA 4DUPA 1CF2O 3G0OA 2JHFA 3WWYA 1NVGA 4E30A 3TFQA 3V2HA 3O03A 3NV9A 4A73A 2PZLA 5F21A 4BNIA 4BMVA 4ZGWA 3ZWWA 1TT5A 4DQXA 1LA2A 2WSBA 4FC6A 5JAQA 3NEPX 3I1JA 3RKRA 4RF2A 4FFMA 2XAAA 4BNMA 1KYQA 1PJ2A 1U1IA 4NJMA 1PR9A 1XYGA 3CMCO 4GMFA 5TQVA 3S8MA 4KUGA 4PLHA 3LT4A 4RJTA 2IRWA 4YACA 1I10A 2Y67A 4I9NA 3RI3A 3D3EA 1KC3A 4MIEA 4CM4A 1HE4A 5MDHA 4Q9NA 2AQKA 3PLNA 3CKYA 4Y98A 4XQ9A 1SOVA 3MJTA 4K6CA 4M89A 4BKPA 4YJFA 2QRLA 1SMKA 3GVPA 4ZU3A 5B12A 1LQUA 4E6PA 4EZBA 3AFMA 1R4NB 1ZCJA 3AU8A 3P2YA 1FDWA 1GV0A 4ZQBA 4R4JA 3PHGA 4W7HA 3AI1A 4IDBA 3DHYA 1DIRA 4GX5A 2CNBA 1OZAA 4B3IA 4OAQA 3S1LA 3JQ8A 4PIVA 4D43A 2GERA 2CVZA 4FW8A 1M2WA 2VZ9A 4NDNE 3ICPA 3VAZA 3OA2A 5F1OA 4W99A 2AQ8A 4B8ZA 1EVIA 3SXPA 3H9QA 2V7PA 2YV3A 4NBWA 3I6QA 1ZMTA 4IGEA 5T57A 2C29D 5DN9A 1GR0A 4TVOA 5BSGA 2VHXA 1DLIA 3A06A 3RASA 1LDBA 2BELA 1QG6A 1RYEA 3B70A 4ZQFA 1MG0A 1BHSA 2P5YA 4J9VA 5AOVA 1XEAA 3F9IA 3OJEA 1DHRA 3CINA 1B0AA 5KCZA 1DAPA 1ZK3A 3FNHA 3JYLA 1DAOA 4ND1A 4TRJA 4DMMA 3K2EA 3MJEA 4X54A 4K1LA 3GVIA 1B8UA 1D8AA 1DC6A 5JDCA 1UAGA 5U1PA 1NTOA 1I3KA 4R51A 3JQDA 5TJHA 3WYBA 4YT5A 1NVMB 3MEQA 1EFKA 1W4ZA 4AICA 1H93A 3SLKA 1LSJA 3GPDG 2GN9A 4CMEA 1EBUA 2ZJ1A 1AN9A 2NU7A 1RYDA 3QWIA 3VDQA 4NU5A 3FNFA 4CODB 4YJGA 4GI2A 3WSWA 2RCYA 3DFZA 1QLJA 3BTUA 3PHIA 4JJFA 5DP2A 1EEHA 4A5OA 4YXFA 4R3NA 2X5JO 2HU2A 3ZWYA 4IQ8A 3PGJA 3QWFA 3G1TA 4I5DA 5IJZA 1GPDG 2BGLA 3G1UA 4FIZA 4B7XA 4XYMA 2VZ0A 1GYRA 1PU2A 1MFPA 1HRDA 1KETA 2NQTA 1RWBA 3GNTA 4HUJA 4RPLA 4J4TA 2FRDA 3GT0A 3GFBA 3LSYA 3WMWA 6ADHA 4ZQEA 1EZ4A 2BLLA 4XB2A 3LC2O 1HF3A 3GEDA 3HDHA 4FOSA 2IEBA 5JDIA 2Z95A 3WJAA 3D7LA 5ENDA 1E6EA 2FOIA 2RH8A 5EPOA 4TQGA 4WCFC 3CE6A 4XJSA 4IZHA 2WDZA 1S6YA 1VKNA 2LDBA 3DBVO 4O0LA 4RPHA 5L45A 3K96A 3G17A 3QY9A 4XDYA 3WGYA 4BV9A 1ULSA 4PG8A 1Z75A 1SNYA 4UUOA 4AL4A 2NM0A 4LVUA 1JQBA 1R37A 2PZMA 3RUFA 3WSVA 4BNJA 5B4UA 1VI2A 2DTEA 3WOHA 2X0NA 1TEHA 3ORFA 1TA4A 4AJEA 4Z0TA 3KETA 2JAHA 4JBIA 3SVTA 1KEWA 3K92A 2YUTA 2DM6A 1I2ZA 3FI9A 3JD3A 2XXJA 2FPGA 4IDEA 2V6FA 4S1VA 3Q1LA 5B4TA 1YONA 1YQXA 5EN4A 3STHA 3L4SO 2RBEA 4NK5A 1L7DA 5G0TA 4N54A 1YE3A 5TNXA 3UVEA 3EDMA 2YHIB 3VH4A 4F46A 3DAPA 1DDOA 2VWHA 4NG5A 5EINA 3IJPA 2B36A 3KXDA 2GCGA 5GZ6A 1PJLA 2CFCA 3WQSB 4XJTA 1EK6A 5I7FA 5KNLA 1T2CA 1NAHA 2I5PO 1C1DB 2QYTA 5JW6A 5L3ZA 1MC5A 1YKFA 3NT5A 4WOKA 3DEYX 3AM3A 4OIMA 2C7GA 1JWAB 1GU7A 4I5EA 1R66A 3HHPA 4MIOA 4DYDA 3PHHA 2Z1MA 3WBBA 4Z0HO 2VYND 3JQEA 1ENOA 4GPD1 1YDEA 4YT8A 5AQ1A 5DZSA 1R0KA 5KJ1A 2ZK7A 4FD3A 2I6TA 3EVTA 1GUZA 2W8ZA 1VL0A 3AI3A 1P1JA 3E5MA 1B16A 1ZKMA 3PPIA 1PGJA 4EBFA 5C5IA 3V5NA 4FFPA 4AG3A 2AW5A 5AVOA 4ONEA 4R5HA 5A9SB 5CDSA 4AJOA 2YV1A 2HDHA 3L9WA 1I3NA 3OMLA 4GMGA 1BGVA 1SB9A 5JXWA 2Y0DA 1E92A 1LRKA 4GX1A 5GZ1A 3RAJA 2E37A 4R5MA 2HMUA 3V1YA 1NPDA 1CQIA 3ASUA 4NNJA 5COBA 4KTVE 5T8KC 4YJGB 2O2YA 3JQGA 3KBOA 4OXYA 1LXCA 3C8MA 1AXGA 1VL6A 3WFJA 4DTIA 1A5ZA 1A72A 5JMPA 4IS3A 4OHUA 4WUVA 5G0WA 3FTPA 3NYWA 1UDBA 3PRJA 1UJMA 1MB4A 3Q11A 3G49A 3C85A 4AJ4A 2HKIA 3MWEB 3DBLA 2FP4A 2E4AA 1ENPA 1I2CA 2O2SA 3JQFC 7MDHA 1JW9B 1ONNA 4J9UE 4F6CA 1L7EA 4HFRA 3TJRA 3AOEC 1P33A 4R1NA 1ZSVA 2GNAA 4JN6B 3ZNNA 5LDGA 1P1FA 1PJ3A 1C0LA 3ZWNA 1O6ZA 1BW9A 1BSVA 3P7MA 1XHLA 4CL8A 5CDGA 1O8CA 1GTMA 1QYWA 3LT0A 5K0ZA 2Y1DA 4ZICA 1OBFO 3UW3A 4ND5A 3RU9A 1ZH8A 1UXGA 3QVWA 4ND2A 3IQDB 1L1FA 5BSEA 2RHCA 1PJTA 3QWAA 4IUYA 3W1VA 5F5NA 4CV1A 2QZZA 1BVRA 1Q1NA 3OJOA 3TZ6A 5DBGA 4IDFA 3WQQA 4MVJG 1H6AA 3P5SA 3SC4A 2VNSA 4LSMA 4YWJA 4Z6KA 2P9EA 4E5PA 3OJFA 3V8BA 3DTTA 2PKQO 2EF1A 3JQ9C 3BHIA 3QLJA 4H15A 4UVHA 3H9EO 4E2WA 4WECA 2JD0A 2VT3A 3FWNA 3N58A 4L4SA 1ZZEA 5ER6A 3OM9A 2DUWA 4FSHA 5BSHA 4BNNA 4CMCA 5L7TA 1XKQA 4PLFA 3RC1A 4BMSA 3KYDB 1CRWG 4M55A 1E77A 5L4SA 4MKZA 3BMCA 3ONEA 2B4QA 3ZWAA 4R01A 1ISFA 2P4QA 1I01A 1MXHA 2D2IA 1OC4A 4TWRA 1AHIA 2C0CA 4URFA 4LCEA 1K2WA 2ZQZA 3ZZNA 3KEOA 1AXEA 3JQ8B 1GY8A 1H6BA 3GY0A 3D4PA 3OICA 1HYEA 3Q2IA 4BNZA 4DQUA 2NVWA 1NYTA 1WNTA 1N9GB 1T25A 1NQOA 3DWFA 1ZK2A 2EWMA 1PQWA 4DIFA 1YWGO 3C7CB 2I3GA 2O3TA 1I8TA 1MA0A 3SEFA 5C7IO 4YBZA 5T5QA 2B0JA 3ST7A 4Q3DA 1PGPA 1LLCA 3D0OA 4YJDA 5L4LA 1E7MA 4JK3A 1T4BA 5JY6A 1GEEA 4IQ0A 3T7EA 4BNTA 4WK6A 4EYEA 4GGOA 3DHEA 4MP6A 1D1TA 1XIVA 1WWKA 3B1FA 3NT4A 4EJ0A 1ZSYA 3WLEA 3E8XA 3X2FA 3INRA 8LDHA 4GBJA 3PP8A 4MP8A 3GNSA 1NR1A 3F4LA 3W4JA 2HAEA 3AU9A 4QTZA 3OIDA 1CERA 4CLEA 1JVSA 2VZ8A 4HXYA 3DOOA 1YQGA 4J4BA 3B1KA 4CMHA 3F47A 4FFLA 1WVGA 2ZB7A 2WMDA 4Q3EA 1R6DA 1QXSA 4BO5A 5A4DA 3GG2A 1X0XA 3A1NA 3GA0A 3PFFA 3WQRA 2PV7A 1LBEA 4RORA 5K6AA 3PZRA 1ZIDA 2HO5A 1HLDA 1NM5A 2VOEA 4LN1A 5G4KB 2W2LD 4CR6A 4R1SA 4JXKA 3DBLB 3UAGA 1Q7GA 4PLPA 3VPXA 4Y6PA 3VVCA 3OSUA 1NP3A 3NGLA 4NU6A 5IDYA 1DLJA 1N9GA 2D59A 4G65A 2X9VA 3PK0A 5JAMA 4GGPA 5K6AC 4E12A 5EERA 4BNHA 4WLFA 3GRKA 3SJ7A 2C07A 4RL6A 2GR9A 3C24A 4ZD6A 4ZJUA 4R16A 1ISHA 3JQAD 3UXYA 3RWBA 5IFLA 4O63O 1I24A 2GPTA 1TT5B 1OI7A 5JCXA 1MXFA 4IGFA 3KSZO 1ZJZA 1M67A 3RIHA 1ZXBA 4ZRNA 3X2EA 4NFSA 4HNHA 2VYVA 2RHRA 4DPMA 1PL8A 5JYDA 1B2LA 4R41A 2HLPA 3C7DB 3H5RA 3GH3A 3GEMA 4EUHA 2EJWA 2OFPA 1LDGA 4W6ZA 4CMGA 3S2GA 4GH5A 1YBMA 5AXBA 1LUAA 5G2OA 2ZYGA 5CPFA 3RFVA 5CDYA 4CLOA 3IOYA 4YJFB 1IZ9A 2QQ5A 3TPCA 1UZLA 2AE2A 4FOOA 3ZWPA 4JJGA 3OQ1A 2D0IA 2DBZA 4MOWA 3FR8A 1GYQA 4RPGA 4ZQGA 5BT9A 4RPJA 5MGBA 4CQMD 4MVJE 1C1XA 5EESA 1Z45A 2EGGA 3L6DA 1KVRA 1LNQA 1PR3A 4MVJF 1WP4A 4L74A 3OP4A 1X1EA 3RBZA 1ZK1A 1CJCA 1OMOA 3H65A 4QX6A 4DWVA 4E5YA 1H0KA 4D79A 3ROKA 2FPPA 2VN8A 1U3WA 3GZ4A 4D46A 4W4TA 4BGVA 2G17A 2Q3EA 3QWBA 3CIFA 3I9MA 4JBHA 1LU9A 1EVYA 2EEZA 4KUHA 1KS9A 3JCZA 1Q0LA 5IZCC 3TF5A 1KBZA 1KVQA 4XEHA 3IKTA 1BG6A 5IN4A 4E5KA 1KVSA 2IZ1A 3DZJA 4YPOA 3I3OA 3IP3A 4DQVA 1CQJA 2P2SA 3ANNA 1BWSA 1SEVA 4Z9FA 4PG4A 2VRBA 4KDFA 1UDCA 4FFOA 2R00A 2GZ2A 5JNLA 1GD1O 3OECA 3FNEA 4M54A 1EK5A 4RDIA 1ARZA 3EHEA 2WYWA 3CEAA 3HG7A 2WD8A 3I9OA 3INTA 1P0CA 4TROA 2Y93A 1PJBA 2NWQA 4U6SA 1K89A 1M75A 2TMDA 5BNFA 3WNVA 1E3WA 3ZDFA 4KZPA 4RZHA 3DMTC 1PQPA 3AOEA 5IAAA 2V6BA 4NHEA 5IZ4A 1KVUA 1P9LA 3GAZA 3JQFA 4TZTA 1EQ2A 3D3WA 3HB4X 3KO8A 3VPGA 5JO0A 2W2KB 4FN4A 2QG4A 4BMNA 2BRUA 2YHIA 2ET6A 2NVUA 3BA1A 3BMQA 3JQBC 4NJOA 3KTDA 3B1JA 5ILGA 4GAEA 3VZQA 4WLNA 4CLHA 2X22A 5CDUA 4U6QA 1BDMA 1H9BA 2AHRA 3GZNB 5HS6A 3RUHA 3FNGA 4Z3DA 4ZHSA 1WZEA 5JC8A 2OO5A 2DFVA 4PN3A 3OJLA 4M87A 5IXYA 2Y1GA 3GHHA 4U0KA 4AJJA 5A02A 1KVTA 5T8KA 2GO1A 4OOEA 1GPJA 3CSDA 5KVQA 3DBRB 4DREA 3WGZA 3PWZA 5I9MA 1ISGA 2Y1FA 1DC3A 5HBRA 3WFIA 5KVCA 1IE3A 3I6IA 2C5EA 5CG1A 1DC4A 1P45A 3JTMA 2Q2QA 5JSFA 4UEKA 4A10A 1F06A 1GZ6A 2WYUA 4B4UA 4BHTA 3JQAB 4YR9A 2GF2A 3WJ7A 3CPSA 1A4UA 1AHHA 3O9ZA 1U9JA 3WGIA 5T64A 2VNAA 3DZBA 2C20A 3I9KA 2OL4A 4IMPA 5DULA 3H9GA 5THKA 3AY3A 5COAA 2HRBA 2YDXA 1XG5A 4WASA 5AXDA 1I32A 4WEOA 3F4BA 1C14A 1W0CA 1OOEA 4E33A 3HZZA 5THQA 5CAEA 2GN4A 1MV8A 1NQTA 4YT2A 2FHSA 1X14A 5JAIA 1VJ1A 3HFSA 5ILOA 4QXMA 3S2IA 1EQUA 5IDWA 1DO8A 3ADOA 3R1IA 4W9NC 1BXZA 2CDCA 3VKUA 3GAFA 3R6DA 1CETA 5FI5A 3LU1A 1RJWA 3DTYA 1UDAA 3V1TC 3NDJA 4E0BA 4W9NA 2YV2A 3Q9NA 2VTEA 3QVSA 2B5WA 2VYNA 1O95A 5JMWA 3M1LA 5DF1A 1N92A 3ETGA 3ZU3A 1PWZA 2SCUA 4AJLA 3VPSA 4NQZA 4YRAA 1ENZA 2B5VA 2G5CA 2GZ3A 2PTGA 4RVSA 4TKMA 1E1NA 3V2GA 3OBBA 4XYEA 4HBGA 5JS6A 1LLDA 3E03A 4FBGA 3VDRA 2WTBA 4GKVA 3RROA 3ABIA 3ICCA 1GZ3A 4QECA 1E1MA 3FBGA 3ULKA 2J8ZA 1VLLA 3GDOA 1Y81A 4MPDA 1B8VA 5A9TA 2O7SA 1YB5A 2OP0A 4WCDA 1EDZA 4YRBA 1B26A 2EW8A 1X7DA 1DJQA 1E3EA 3LZ6A 1IHYA 4OSPA 1C0KA 3KVOA 3UGKA 2BH9A 5H83A 1ZVMA 3BXXA 1GCUA 2DBRA 3PXXA 1O9BA 5JYEA 3NTRA 4I08A 5IDQA 2YW9A 1A9YA 3FRJA 1H6CA 3U0BA 1EUZA 2B69A 3IUSA 4XZ3A 4Q3CA 2J5KA 3EW7A 4A2CA 2PK3A 4YAEA 5L7YA 3S2EA 3H5AA 4BOYA 4EJMA 1E5LA 3WGHA 1YOVA 4PG5A 3Q2KA 1YBVA 2DT5A 1O5IA 1BXKA 5KVVA 1Y8RA 3NTOA 3JQBA 3IS3A 3KZVA 4XB1A 5DCYA 3PDJA 1YB4A 1ZSNA 1LDNA 3U49A 4PFJA 5ER9A 3AJRA 2JAPA 1ISMA 2WEKA 4G81A 1HZJA 1HEUA 1VPDA 5T67A 4CMEC 1N7HA 2JCYA 1J6UA 3AUAA 3CH6A 3OQ6A 3DMTA 3R3SA 2GRAA 1BW9B 2WM3A 1O94A 3DZIA 3QRWA 1DRWA 1DIBA 3F1KA 4ZQHA 3DR3A 5J23A 1JAYA 1F8FA 1Z82A 4J1QA 2C59A 3DBHA 1VJ0A 4YYZA 3JQ6A 4Y6SA 5A04A 5JCJD 1SAYA 2WD7B 4RVDA 2GUGA 3FR7A 1ULUA 2WD7A 4LVCA 3PFWO 1C0PA 1I30A 2DBVO 4E3ZA 3CMMA 2R00C 4PCVA 2QYSA 1IHXA 2UV8A 4H3VA 4J2OA 4IQGA 5F1PA 4E21A 1E5QA 4NH4A 4XRGA 1NFQA 3MJVA 4NFYA 3QW2A 1T1SA 3ZV4A 5EQDA 1PZEA 5IZCA 1RKXA 1XGKA 2HCTA 5DBIA 3ZWMA 4J7CA 1E7WA 3OH8A 2YHUA 4NBTA 5DDIP 4LMRA 3DFUA 1M6WA 2EKLA 1C1XB 4DXHA 3HE3A 3DO5A 2CF6A 1LX6A 4KMSA 4R1TA 9LDBA 4IJWA 2X7HA 1UAYA 1YRLA 3HNPA 1ZK0A 3GUCA 4CJXA 4O6VA 4OSOA 4J6FA 4WLOA 1H2BA 1C1DA 3M6IA 1SC6A 5CEJA 2Z1NA 3PHJA 3L9XA 3LLVA 1LRLA 1PWXA 1T4DA 4L4XA 1QYVA 4PLYA 1H9AA 2OBNA 2Q2VA 4IM7A 5BNIA 3TOZA 3AUUA 3BYZA 1YO6A 1EUCA 2JCXA 3HDJA 3WIDA 4HFJA 1NWHA 5DP1A 3EGOA 4CM7A 1GL3A 2GD1O 3GG9A 3DHNA 2IYOA 4BIIA 1BXGB 2OGUA 2DTXA 3OF2A 1K3TA 4R9RA 4CM9A 3VVBA 4FC7A 4BO3A 1ONPA 2X0IA 3MZ0A 3COSA 1LDYA 3DAFA 5C37A 4B7CA 2EHDA 1RM4A 4CM1A 4KTTE 3ZV5A 4BO2A 4EI2A 1X1TA 3TQHA 3GGGA 1UP6A 4AJ1A 1DHTA 3PJGA 5CEEA 1EE9A 1KY4A 4YRDA 2W98A 3O4RA 3VTZA 1X0VA 2BFOA 1EVJA 1U5AA 2QX7A 2X4GA 1GQYA 2R2GA 4Q39A 4QFDA 1U3VA 3QE3A 3MTJA 4RCVA 3EK2A 3BHMA 1AE1A 1JAXA 1Z73A 3TSCA 2VTDA 1I5RA 5DCWA 3TRIA 3WS7A 3EAGA 3HJAA 1PJ4A 3ZU2A 1H6DA 1X7GA 4CLXA 4DC0A 4AFNA 1C3VA 2AXQA 1G1AA 1KEUA 4FGSA 4RGBA 1YS4A 3VZSA 3WTCA 3K30A 5DNAA 4RQTA 5JY1A 1NPYA 1SOWA 2AE1A 4D44A 4E4YA 5EL0A 1JWBB 3PQEA 3ROQA 2EXXA 4J91A 3JQAA 2Q4EA 1GADO 5FEUA 1PX0A 2QIOA 4BQPA 1LJ8A 3AFNA 5L4NA 1ZW1A 3GGOA 2I99A 3G79A 1VSVA 1EE2A 3Q3CA 1RPNA 1I3MA 4UEJA 3NTQA 1T26A 4XIJA 3AI2A 1F17A 4FS3A 3UH1A 2GGSA 5IG2A 4ALNA 4HP8A 2NACA 2F00A 3RU7A 1IPEA 3RBXA 1ADCA 3EZLA 4E2XA 5LCXA 4UREA 3HN2A 3PTZA 1KY5A 1RM0A 3EC7A 3K73O 2W4QA 1G0NA 4JP3A 1Y8QA 5A9RA 1Y6JA 1G6KA 4EEXA 5TF4A 1B14A 2HJRA 4WNCA 1BMDA 3GLQA 3K8ZA 1HDYA 2X8LA 1J5PA 3RFTA 1FDSA 1ZUD1 3KYDA 2H63A 2YFQA 1MGOA 3RCBA 4BNFA 3A9WA 3HN7A 4BB5A 1MC4A 2IXAA 1WZIA 5JLAA 1EVZA 2AQHA 1PL7A 1XSEA 3AM5A 4I5FA 4BO7A 1B3BA 5IXSA 4JX8A 1H94A 2VCYA 3UN1A 3HDQA 4ZN6A 1BRMA 3PJFA 5F1KA 2H6EA 4XX0A 5HS4A 3JSAA 4OQZA 3PIDA 3D3WB 4A03A 4YEDA 1YL5A 4B8WA 3MJSA 5EIOA 3H2SA 3UF0A 4LMPA 1D3AA 3W6UA 1ZFNA 2OMEA 1D1SA 3F46A 4INAA 2GN6A 3PI7A 3NT2A 1GQQA 3LT2A 3OIGA 2DFDA 4NBVA 4UUPA 4BV8A 4D3SA 5JPIA 2GSDA 1NQ5A 5TGDA 3I23A 5G4LA 1DSSG 3Q0EA 2Q1UA 1M66A 3ZU5A 1RM5A 2ZKLA 4AJIA 3MWDB 3O38A 3FCOA 4J16A 1YDWA 4MJLA 1K0UA 3JQ9A 1GQ2A 3ZWXA 1LSSA 1TVEA 2EW2A 3C1AA 2DPHA 4BGEA 2BMAA 3ONDA 1ONOA 3DB2A 1HDOA 1E7QA 3DONA 4K9DA 4Y8VA 3E9NA 3GN2A 3GHYA 3U4DA 2O3RA 4Z0PA 2J3JA 4QFCA 4AVYA 1ZO8A 1O89A 2DC1A 5FFFA 5H82A 4BO8A 1ZJYA 3KYBA 1TLTA 2C54A 2VWPA 3I52A 4PLZA 2VRCA 3H9JA 1SB8A 3VZRA 4CM4B 2J3HA 1R16A 5I8ZA 4D0SA 3CUKA 3L77A 1HYHA 2RAFA 4GLLA 1PS0A 3PWSA 4JCOA 2A94A 3DMYA 3U4CA 3QIVA 4HV4A 1U5CA 1T2EA 1DIGA 1E3WB 1ZEMA 4BNGA 1P1IA 3F5QA 2A4KA 1WXDA 1XU9A 4IIVA 4DBZA 1DFHA 3AWDA 3ANLA 2Q49A 1GYPA 1YL7A 2O4UX 1PSDA 2JKVA 4KQWA 3SC6A 3P2OA 1U4SA 5G0SA 1FF9A 4IJUA 3FTNA 4FPXA 4II2A 3HFGA 3ZHXA 2O3SA 3ONFA 1HKUA 4WKGA 4D41A 1NAIA 1WDMA 4RF3A 3TDKA 4DBVO 3KLPX 4DA9A 2OP1A 5A5FA 1LC3A 4RV9A 4UAGA 4W7IA 1YXMA 4IZIA 1U7HA 2OZPA 3S55A 1UP7A 3A4VA 1HLPA 4L8VA 3MJCA 4IDDA 4YAIA 3W8EA 1DRUA 3NGXA 2BHLA 4R68A 3NDIA 1LSOA 2BFMA 4Z9XA 5G0UA 2Z5LA 4EITA 2PA3A 1QKIA 1NPTO 1A4IA 1I36A 1WAMA 1CIVA 1XQ1A 4HFNA 4IJVA 4BKQA 5ENVA 5LDHA 3H3FA 2EP5A 5B1YA 2BGKA 3KB6A 4XRRA 2WE8A 3K9QO 3TZKA 5I9LA 4U7WA 3M2PA 3ZWOA 2E48A 4LCJA 3PJEA 2CF5A 5TT0A 4PLTA 1KERA 3M2TA 3QSGA 3GNQA 3D5QA 5KWEA 1A27A 1E7YA 1HETA 3E1KA 5ICMA 1Y9EA 3KSDO 3MCVA 4E2YA 3GMSA 3KHUA 1QRRA 3GDGA 2X9NA 4DLAA 2P4HX 3RSHA 4AJKA 3ZHYA 1FXSA 1UZNA 2Q46A 4JLWA 2BFPA 3F1LA 1TI7A 4CV3A 4O1MA 1XCBA 4CPDA 2ZB8A 2XF8A 3PYLA 2JD1A 3ENNA 2G1UA 4W82A 4Y6RA 5EMHA 3NJ8A 4TSKA 4F45A 5JBIA 1U8XX 1YOVB 4EW6A 4C7KA 4IDGA 3MJ4A 2HJSA 1JDJA 3WWZA 1A9ZA 3BMNB 1W6UA 2LDXA 4CL3A 2XPCA 1YJQA 2NTNA 4LRTB 5AXCA 3W8DA 4B4OA 2Y0EA 1MFZA 1R0SA 2F1KA 3L4BA 1VE9A 2WJPA 3O8QA 4U8GA 3ZWCA 1P0FA 4LISA 2ZQYA 4J1NA 4HNGA 1PJSA 1JKIA 3NRCA 1NFRA 3L6OO 1HE3A 1TT7A 2HMWA 1KOLA 3ZHBA 3TL3A 1HE5A 3ITDA 3WG9A 1IPFA 1V9LA 2H5LA 4YCAA 1HSZA 2AG8A 3JD0A 3NJ4A 1PL6A 1VJTA 1Y1PA 1PS9A 3DBHB 3AM4A 4BVAA 1YQDA 2DPGA 1E1LA 2QRJA 4WLVA 1ADGA 1E0DA 1LQTA 2Q99A 3BIOA 1FMCA 2FMUA 3U4HA 1OAAA 2J3KA 2A35A 4L76A 3CTMA 3DQPA 3MTGA 2CD9A 3QWHA 4GQAA 4R1UA 2NVUB 4PRLA 4WCFA 1I0ZA 2YDYA 3E9MA 3F6YA 2QHXA 1HDZA 1NASA 2I76A 5JDIC 3ADPA 4M49A 4CMBA 2RH4A 3U4IA 3PDUA 4XQEA 2ZYAA 1ID1A 3JV7A 5I8WA 3BMNA 2CSUA 3DZHA 3JQGB 2ZTLA 2Y1EA 1HTBA 2ZIZA 1ISJA 4ALMA 4MP3A 4BO6A 4DLBA 2OOSA 2QZ9A 4ESOA 4BNVA 4CMIB 3H7AA 3B20A 3AUSA 1HDCA 5G0VA 4CMIA 1IL0A 3A14A 2JFGA 4J3FA 1WDKA 4QQRA 4OGWA 4D42A 3KOUA 2P9CA 4C4OA 2YQ5A 2PLAA 2QW8A 4YB8A 1MG5A 2FZWA 5CDTA 2B83A 4XQGA 3GOHA 3WYEA 2GLXA 4UVGA 4CLRB 4XDZA 2PD3A 4J1SA 1JA9A 3EZYA 1CDOA 1UUFA 2IDZA 5KKAA 9LDTA 2ZATA 3BAZA 5JC1A 3WGTA 4GVLA 1PGOA 4MVJA 3JD1A 3QVTA 5C7LO 3WGGA 4JJIA 3H3JA 4OKIA 3SBOA 5JDCC 3FPCA 4M8SA 2NSDA 4J4HA 1NNUA 3ZNPA 1M76A 3IJRA 1XA0A 2FSSA 3FN4A 1TB4A 3PYMA 3VH2A 2X86A 2GASA 2GYYA 5CG2A 2NADA 4DYVA 4TRRA 3LF2A 2PGJA 2X9GA 1P1KA 3KV3O 2E82A 3FF4A 3OJ0A 1HXHA 4ZRMA 3WNQA 1E3IA 2W2LA 3EUWA 4U0JA 1LRJA 2D5AA 2B37A 4BO9A 2O50A 4CQMB 4FJ2A 2FY8A 1ZMOA 1JKJA 1PEDA 4FR5A 5KIAA 5CPBA 3NX4A 4N5MA 1DPGA 4NK4A 2PY6A 3ZW8A 1JLLA 1HDRA 2AQIA 1XU7A 1JN0A 3FPLA 4DGSA 1U2DA 1J4AA 2V65A 2H9IA 4JP2A 3T7CA 1PZHA 3QV1A 3RC2A 1Y8RB 2OBYA 1HE2A 4QUKA 1PTJA 3I9NA 1V6AA 5KKCA 2NQ8A 2Q1SA 2PR2A 1SPXA 4BL5A 1O0SA 2IYPA 3SX2A 1K6JA 3H5NA 1NXQA 2D3TA 2Q2WA 3KSUA 1DFIA 4PLCA 4R69A 1EBFA 4OYRA 2C2XA 1PZGA 3JYNA 4J0EA 1UH5A 3TFOA 2Y0CA 1FDUA 4YQYA 3NAQA 1P1RA 1BTOA 3GPIA 4K6FA 4BB6A 2R6JA 4EUFA 1IULA 2Q4BA 2FWMX 1VRWA 3GQVA 2VWQA 4FJ0A 3GFGA 3E48A 1HDGO 2I9PA 3UCXA 2VUTA 1U3TA 3R0IA 3QP9A 1ML3A 1YH3A 2GN8A 4QSMA 4QEDA 5DCUA 3ZHZA 4I9HA 5TC4A 1UR5A 3I4FA 1U8FO 1WMAA 4GSKA 3RUIA 4BGUA 1F12A 3GGPA 1J49A 2PKRA 2VHZA 4FDAA 3HSKA 2TMGA 2AEMA 4NPCA 4XYBA 3N74A 3L07A 4H16A 4YA6A 1IUKA 3RBVA 3PEFA 3WICA 4RVUA 3ENKA 3IUPA 2ZB4A 5A3JA 3I4CA 2AEJA 2W90A 2HSDA 2HK8A 3AY6A 3CZRA 4RF5A 4RZIA 2IODA 2V6MA 1Y5MA 4BKUA 1N1GA 4U5QA 4C7JA 5HRUA 3DBRA 3JQCA 4OO3A 3WIEA 4NIMA 2PGLA 3KUXA 2CVQA 3I83A 1E6UA 3LVFO 4HKTA 1QYDA 3ETDA 2DLDA 2HMTA 1NBOA 4ZA2A 3KYCB 3K5PA 3AK4A 1DEHA 4TMFA 3Q9UA 4ID9A 2PZJA 3UCEA 3WYCA 3INGA 1NQAO 1KEPA 4UUNA 5I7SA 4YQZA 3HUDA 4A7PA 2EERA 4I8XA 1ORRA 4EJ6A 1HWYA 4WE3A 3MOIA 1NHGA 3C1OA 3PQDA 4IINA 3UHAA 3ZV6A 2NTJA 4GX2A 2X58A 1HZZA 2BF7A 1UXJA 5IF3A 4PGFA 3RVDA 4UVDA 2EP7A 1P77A 1DXYA 1DIHA 2XXBA 4OXNA 4CM8A 3GK3A 4IY1A 2JHGA 5C3MA 4MINA 2NU6A 4N5LA
chains in the Genus database with same CATH superfamily
3FSRA 5K0CA 2JGAA 1YZVA 2NU6B 1DC7A 3Q41A 1ZI8A 3WBFA 1JBEA 2WWFA 4RK6A 4EYSA 2DKFA 1CSEE 4MUHA 3ZNQA 4COOA 4Q34A 4N5NA 2PJUA 4C87A 4G1CA 1ORTA 3VC2A 3TLGA 1UM8A 1V8FA 5LQNA 3ABQB 2C92A 1EFRA 2IX9A 3K0SA 2FPXA 2IDMA 2H1OA 3HV2A 4EFMA 4H7EA 1D2AA 3W79A 2G1PA 2A0FA 2DPMA 2ZPAA 2VT7A 2XCLA 5IEBA 5KU7A 2OY0A 1DKLA 1UT6A 1XV5A 2V0CA 1C7RA 3LW7A 4I9UA 5PNTA 4CYMA 2ZRKA 2DPXA 3S1AB 5FJIA 2EFYA 4B6RA 3N0VA 3F6CA 2OFFA 1ZAKA 2QQFA 4AG5A 5IYZB 4U7FA 4ND3A 2NU8A 5E4FA 2R8BA 3IX7A 4IDQA 2QN7A 3KT0A 4G23A 3TMYA 3K16A 2C88A 2BGMA 3DD1A 2JCVA 4X91A 4XW2A 3WZLA 2JNWA 1FBNA 2CK3D 3PE4A 4CUZA 3PEVA 3A1UA 2CL5A 2O3QA 2CHEA 2WMYA 2QDXA 1YIAA 3SLGA 1NFFA 4QNRA 4F9FA 1ZISA 4MS4B 1YR8A 2HQ1A 3VJLA 3JPWA 4F5ZA 1NUPA 2INGX 1GT91 3NALA 4L5AA 3UT5B 4L5IA 4MGZR 3I5MA 3CN7A 5BVHA 4RVNA 3O2QB 1CUZA 3QUQA 5DHPA 1BVUA 2XAUA 2JRLA 2POQX 3UHFA 4BDTA 4UTXA 3SZOA 5IMSA 1CQZA 1M72A 3FH0A 4OQ4A 5K8LA 3RODA 3IAM1 5CNKA 3KSMA 2JLAA 3EVDA 4LYFA 1OXSC 3QHAA 4DMHA 4ARIA 2C7VA 3H19A 4JI8B 2NUTA 4NJMB 1D5CA 2FWRA 2DBQA 1FRFS 2IYAA 3R8FA 5FPHA 3Q0IA 1PK8A 2XGOA 2V45A 4BEWA 1N2CA 4CTKA 4ADSG 5BVGB 4P8RA 2P6PA 4RZXA 4FEGA 3GLUA 1TOAA 2G88A 4KK4A 4Q19A 1Z9BA 3S7TA 3DDNA 4IFBA 4X65B 4FNAA 4NU0A 2QAGB 2XB2A 2ONJA 1ZN9A 4JKYA 3VA7A 2YXBA 2QAGA 4WWHA 4F3KA 5A3VA 2ASVA 4C2BA 1MVOA 4EYKA 4IS2A 3BZUA 5EMKA 3GW8A 1BC5A 2HD4A 4HLDA 3I2FA 3RJ9A 1MORA 2O07A 3H18A 1WZUA 1PBNA 2D3WA 4KMRA 2UXBB 2FOLA 2X23A 3G2HA 4HCJA 4XR4A 4LTMA 1J24A 4YPVA 1PG0A 4X24A 4A0SA 1P0PA 1Y3CE 1ZH4A 3RD5A 4ESVA 1ZMXA 2DU8A 1ZDMA 3A4YA 3BDIA 4RULA 1CTQA 3GJZA 2FAXA 1MZVA 1NI5A 1DWUA 2NTYC 2EQ5A 2ZR7A 4XWYA 4XYGA 3ZHCA 2XD9A 3ZCSA 2PD6A 1XQ6A 2QBYB 4L57A 4DLLA 2Y1CA 5KC9A 1RM3A 2LCIA 4L95C 4CM5A 4DMLA 3MRXA 2H29A 2YWJA 3PDWA 4QHSA 2PS1A 4AQDA 1TQHA 1JU9A 2FPIA 4PRYA 4RVGA 1NJSA 3NU1A 1SVIA 4JGIA 4JZKA 2YWEA 2BFEB 3MAGA 4FLEA 4OIFA 3WGOA 3HGTA 4QOIA 1SCAA 1U7WA 1Q44A 2V3WA 2ZUDA 1T3TA 4RZ2A 5TJ9A 1LV8A 3L49A 3W78A 1CYEA 1T5DX 3UHPA 5DK6A 1QH1A 1T9HA 5IW8A 1E62A 1OLOA 5IUJC 1E20A 3EVCA 4HB2A 1ODLA 4K6MA 1RWOA 5BY2A 4KRXA 3FKJA 2C7BA 3PQ2A 4H7PA 3FROA 4A36A 1BVYF 4F4IA 1NNLA 1E4OA 1J1UA 3LQFA 2QUAA 4RK5A 5LM3A 5EP4A 4FI3F 1VDMA 3RTCA 4IGKA 3EGIA 4YCNA 2A59A 4MO2A 3KM0A 4GWGA 4BX3A 3FUWA 3C6XA 4MLDA 1NT2A 1VPWA 3IFSA 2D5LA 3WL6A 4ZYTA 3E81A 1O6BA 2WWRA 3G0IA 3TCXB 3ICEA 3GGCA 3H1BA 5BSFA 1BOOA 1NY6A 3CW9A 5BYBA 2OA0A 4JKIA 1O97D 2DUJA 2FYTA 3MTQA 2HEIA 2YIJA 4B9AA 1DKQA 1VMIA 2HWYA 3L0ZA 3M6AA 4HAIA 4ZOQI 2CUKA 1QR6A 2X0JA 5KYWB 5DW0A 1R9MA 1FYVA 4G5HA 4YRJA 3C0KA 3HI4A 1URPA 4TWIA 3LYLA 2RGNA 5C4IA 3QPWA 4PIPA 2CKDA 3BG5A 3FOBA 1X7YB 1TEXA 3S2ZA 1QFSA 1ENYA 4IKOA 2ZE8A 5EXSA 3ANXA 4TKUA 5B53A 3L7DA 2EQAA 3GF4A 2Q9UA 2L19A 1GTL1 2O4CA 2XWPA 3JR7A 3AOGA 4ER0A 4XASA 2B8JA 1QYXA 4CT4B 3DP9A 4EUEA 1SVKA 3ASVA 4FJ1A 3TINA 4TUYA 3ZE0B 4AO8A 1STOA 2RSLA 5CNJA 3WYNA 2ZCVA 4MGYR 1PT7A 4YY3B 1ESNA 1UJ2A 4L6CA 4MDHA 4P3YA 1VTKA 1BO6A 4GBED 1DC5A 1C0IA 1KC1A 3A6KA 5EJEA 1I33A 1H0RA 3KL4A 1R74A 1V3VA 3HVUA 4UAJA 1GV1A 3LUGA 1U9CA 2M1XA 4GR5A 1A9SA 4JL8A 1X3LA 2VSXA 5IBQA 3RLIA 1JVNA 3ZV7A 5F77A 1BGXT 4WKCA 4B1FA 2C1EA 4Y9UA 1TQ6A 3WWOA 2DLCX 3HBJA 2IQIA 1N0UA 3AIMA 3CR7A 3DG9A 2ECFA 1U0JA 3N5KA 3RRMA 1QAQA 1V35A 5AK5A 2ZTUA 3K6RA 1T1RA 1ZUHA 3E84A 1EG7A 3PV0A 2VJDA 1KEVA 3W6ZA 4F38A 3IVCA 5A5GA 3PJDA 1CZUA 4KSYA 5FI3A 1NDHA 5IKOA 4AX4A 5FL7D 1RABA 2HNKA 4QDXA 3IAHA 2ID9A 2OCLA 5AK4A 1T9ZA 2NXCA 1TM3E 2BC9A 1MPTA 1SEPA 1OU4A 1U9ZA 4O5OA 4XSVA 3L7YA 4MVJH 4LOHA 1KZHA 4Z1OA 4AKHA 1XELA 1ZX1A 3PYXA 1U0BB 3AY0A 2G5PA 1PQUA 1AO3A 2C4HA 2GZSA 2PKXA 3C3YA 4ZT6A 4DDHA 1QH8B 4RLSA 3SR4A 2RCNA 2HF8A 3U48A 3L7KA 5GY7A 3O92A 2VUUA 3K0CC 5K05A 2OXIA 3LKDA 3I9LA 4GYKA 1I3LA 1GPBA 2PX5A 4JENA 4HGPA 4PFSA 5ALWA 3TN7A 2AFHB 1EGHA 4NZ9A 2P9GA 3TSOA 3VH1A 4CR8A 5IF9A 2QVCA 1Z28A 3P0JA 5A4FS 3WVNA 3L6CA 1GRCA 1RSZA 3B5EA 3ITKA 4JP8A 4QU0A 3RH0A 2MYPA 2Q5HA 4OMUA 4QU8A 1XLTA 2W2VA 3F5FA 2G8NA 3R9IA 4JEUA 1SOUA 3QOYA 4FE3A 2Q5CA 1LEHA 4XA8A 2H2IA 1W9MA 4YP7A 3KWJA 3T1VA 1YHYA 1Y7TA 1HMYA 1GGFA 2PGOA 4HRXA 4IH1A 1WCIA 1V11A 1ZWKA 2R85A 1DEOA 4MKRA 4YCLA 4QRHA 2VYVD 3EISA 5BQ3A 1Q14A 3EXEA 1FOEB 2JA1A 3CLTC 3JAWA 5E1MA 3UAZA 1NVWQ 5EVJA 3WOVA 2ZIXB 4BB0A 1QV9A 1HFWA 1V95A 1UKAA 1WW8A 4A8JA 3LQ1A 1RHUA 4PRZA 4XGNA 4KDCA 4CUKA 3FUTA 3E82A 4TTPA 1GKUB 2IHJA 2MYUA 4DWOA 3S99A 4KPYA 4HVLA 3DDSA 3P27A 5IKXA 1CZLA 2PPLA 2YOFA 2IOHA 4B6JA 3AILA 4KQGA 4JYCA 3PC7A 3C3EA 3HYSA 4NOMA 1YJXA 2GWRA 4QBHA 3UB4A 4GRAA 2BZ0A 3T95A 3TPFA 5LP6F 1GZ5A 1QF9A 1CB7A 1JQ3A 1GAEO 1V48A 1YFZA 3GR6A 1B42A 3LX5A 4DQ0A 1M6EX 4LEIA 2VNJA 1VJ5A 2Y92A 1C8LA 3BCRA 3DZKA 1KK2A 2VBIA 4I4TA 1EVQA 1RXCA 2FUG1 5B4VA 4GXNA 5HGJA 1D1QA 2D1YA 1OA1A 1EFDN 3OEYA 3WLPA 4P7FA 2RJ3A 5C9ZA 2SECE 1EUQA 4WCVA 3QQPA 3SM3A 1CVLA 4G9BA 1TCAA 5E3HA 2IUYA 2EYQA 2UVQA 5HFJA 2HUNA 2ZS8A 3DAYA 3FLMA 4ZT4A 3IP1A 1C3LA 1CY7A 2P6NA 3CLSC 3K9LA 4CW7A 2XODA 5GONA 5HZMA 5KDOA 5IC5A 3R5SA 2JGIA 3RUAA 1YK1A 1FNBA 2VDJA 2W6JD 3A27A 4ZOAA 3TH5A 4E08A 1V8PA 1GDHA 3BWMA 3C6MA 3U81A 3C87A 4Z3KA 2RI6A 3UOAB 1R8SA 2GN0A 5KS2A 4FOPA 3I05A 1RWWA 3BMOB 2VDWB 3WRWA 4F92B 4D4HA 1MRZA 2WI8A 2WP8J 3A7EA 3ZE9A 1FW6A 3I01A 3HM9A 2RBKA 2R60A 3I6YA 3DQQA 1LH0A 1INLA 3BULA 4D4MA 3LK7A 4EB6A 4RS4A 1AN0A 3TR5A 1DT3A 4H17A 4BVFA 4HN4B 4EB3A 1OYYA 3PTLA 3E5NA 2ATCA 1FDVA 2IYNA 5IK2A 2WKQA 3UOWA 5CB4F 2Y1WA 3AR8A 4AJNA 1PGNA 4CIYA 3ZQKA 3G68A 4DANA 2HIAA 1EXDA 5LZ9A 4LQCA 4ZC8A 5JADA 4BVLA 1HL3A 5LA6F 5U4QA 4G86A 2VSOA 4KLNA 4EHKA 3KQPA 2H1SA 2YVLA 2ODEA 1E1CA 4XIIA 3RTBA 3NP7A 3G5MA 1ZRMA 2YWHA 2R0QC 4QIHA 1GPYA 1Z6YA 2X14A 4BFWA 2AMLA 3M1AA 1Y7IA 3FETA 1V7ZA 3W0LB 2DWUA 3WHPA 2REXB 4ZHQA 3K1JA 1K5HA 4H6VA 2KBEA 5GJBA 4CKWB 3EGCA 4NRDA 3NYQA 4REQB 4JJ8A 2W2NA 3HDTA 4MWZA 3MT7A 3V1UA 2OORA 1AK9A 3EODA 3QEMB 4UM7A 3SJAA 2DVMA 2ZE5A 1APBA 1EG2A 1EP3B 3TUIC 1B0UA 3ZDRA 4G1MB 1WEHA 3Q85A 4A1OA 2FMFA 2WC1A 5E9AA 3IALA 4YJHA 3M4ZA 1GVNB 4MWSA 1AGNA 3X2SA 4IIBA 4TV8B 5KTPA 4AS1A 1Q0ZA 2CE2X 2A5YB 4GYJA 4E07A 2VQSA 5IEJA 1VM6A 5CHYA 5K8IA 2CC2A 4EMUA 2XCSB 3MHTA 3ZE8A 1NIPA 4F72A 1WCXA 1GCAA 4YAKA 2OENG 1IVSA 2C9DA 1DJLA 2FF5A 2PAFA 1PZNA 1PWYE 1YBAA 3L01A 2ZWVA 4EG0A 4FDLA 1M6VB 4OP2A 3OQBA 1B8PA 1FX0A 2BFWA 2PSEA 1CLUA 1YDGA 4HC4A 3NBFA 5ADHA 5KYTA 5IJAA 1NA5A 1NIJA 2ZANA 4Q7MB 2PD4A 2E6KA 1E7RA 3TIGA 4XLLA 1U0NA 2C2ZA 3FPAA 1FFXA 3G9QA 2JKYA 3LO5A 4OQMA 5C35A 3UJNA 1XMOB 1OYVA 2B61A 1PIWA 1CP3A 1TFUA 3EVBA 3T5BA 4XVRA 4F56A 3HWWA 4M98A 4HWOA 3SJUA 4BFYA 2C9OA 5JSYA 1MQAA 4EK9A 1NNSA 4HY3A 3DYBA 3T7IA 2ZI9A 2IBTA 2PXAA 1TXGA 1QIMA 4L0QA 3TZCA 5KJEA 1D07A 1G0OA 1K6EA 4R71A 4YXWA 1ACJA 5EHIA 2XQIA 2FPRA 3F3SA 2DTDA 3EMKA 3QPBA 4GT1A 3UJAA 1PGQA 3QE9Y 1L8XA 2HWUA 2UUPA 1GFSA 4M1QA 1G5PA 3RJ5A 1QMGA 1W73A 3H9BA 4ND8B 4PTLA 3AUTA 5BV2P 4O1IA 2H4XA 2O2HA 4WOPA 1BEZA 1T2FA 4C0SA 2P68A 3VJKA 2O7RA 5LPNA 3EQ6A 4JBXA 1EEXB 4JROA 1L7BA 4FDVA 4NHOA 4PZ0A 3TYXA 4DR2B 3JPYA 1NXWA 2V5VA 1Z74A 4EW3A 1M6HA 1U4OA 3L1KA 4GRDA 3ZU4A 1TJNA 2D74A 1N2OA 1UOPA 3L6EA 3ZTYA 1TIKA 4AKTA 4ZC1A 1KOGA 3FMGA 3JRWA 3GUHA 5DX8A 1N7GA 1HH4A 3MGKA 4M3NA 1EQAA 4E13A 5JO9A 1KAEA 3M6LA 1SIOA 3UFXA 3U09A 2XCTB 5MFZA 3C5EA 5BXYA 1WRBA 2RFLA 1GNPA 4GZ5A 3WA7A 4BGIA 5H1YA 1P5RA 1KNXA 4H7HA 1PR6A 5A7GA 3PQFA 3QF4B 4ZGGA 3BTSA 3R5TA 4OQYA 4WJZA 1A7AA 2GAAA 1T8YA 1DV1A 3FNIA 3MWGA 1NYQA 1NKVA 4P9NA 3C8ZA 4ZDWA 3W2HA 4DV3B 2GF9A 3HXMA 1Z6ZA 1GUYA 1CEXA 1QO0D 2Q5OA 4GKJB 1NQVA 1XEXA 2EKPA 2R7LA 3EMBA 3BE6A 4NU8X 3NBAA 2QQEA 4TKLA 1DG3A 4X00A 4ZEWA 4AY3A 4CM3A 5KWVA 2GDJA 2NU9A 1AKNA 4RF4A 4Z9AA 3N6VA 3LY5A 4ZCPA 2ZZKA 3A1EA 1G59A 1CLEA 3O90A 4BZQA 4GKKB 4J7XA 4CMAA 1KS2A 4BLRA 4DIBA 4KWIA 1CJBA 1YL6A 2GOYA 1VMDA 5E4YA 2OZEA 4BO0A 1V8BA 3ZV3A 3KOWA 5ITWA 2HJVA 4AF7A 4B4WA 5L53A 4MYCA 4MKHA 4CF6A 8ATCA 2ACVA 1ND6A 1TZKA 1W5EA 5FWNA 1CJTC 1IN6A 3BTVA 2EKQA 1X38A 3DBOB 3GWZA 4KO3S 3F5SA 1VBNA 2I4IA 3GA5A 4UU8A 3H6KA 1S7CA 3U40A 4UM9D 3T1YB 1MR3F 4KWEA 6ABPA 3N2YA 5KDLA 4EY7A 2LPMA 4OBBA 3X1ZA 2EZTA 5JVDF 2GDZA 2OUIA 4IHJA 2OYCA 1VIMA 5GJVC 2C2OA 3KKMA 4PLVA 3L0SA 3PLAE 4UD2A 2J4CA 5DOZA 5IT0A 3OTWA 1FYFA 1U8UA 2AEFA 4II3A 1R6BX 1V9CA 4CGYA 4AD8A 1ADYA 1TPYA 2E49A 5T3UA 2DQKA 1RI4A 5J5VA 3PC2A 1E7SA 2I3AA 3HJGA 3O3NB 4M53A 2PX0A 4N03A 4PX9A 2I66A 4XSHA 5CLIA 1ZK4A 5EUBA 3VZPA 1SQFA 3IVAA 4MW0A 4LYHA 1XJCA 4OHFA 1D2RA 1WMBA 2ZTHA 5TSDA 2XMPA 2B35A 1QMPA 3W2EA 4D3DA 1U65A 1V45E 3QXGA 4FB5A 2QRVA 1GN8A 2CMKA 1JU3A 4B3JA 3STWA 1UXHA 3ZJ4A 1QR2A 1ZM7A 3BF8A 5TX7A 2BI8A 2GZRA 2ZR9A 3HKEA 1ULAA 1M34A 2ZTMA 4M86A 4F1JA 2EIHA 4RIEA 1S0UA 4PVCA 4UFOA 2V74B 2FSVA 1FPMA 4WAUA 3G02A 1CQPA 2PU7A 1QNFA 3EY4A 3H05A 3U7HB 1V96A 3BK1A 2NV6A 4RWZA 3QFHA 5CYPA 3FPFA 3V8QA 1M5RA 3GZNA 3K9CA 3QE4A 3DHVA 5DT9A 4IIUA 1IJKA 1JEAA 1PN3A 2FDRA 3Q72A 2XW6A 4WBSA 5DRYA 2F1HA 3NETA 5ERYA 5C7YA 5I5EA 2V6GA 4I9FA 2OSBA 2MSKA 3ABRB 4DQDA 2UXCB 4FR0A 1U0SY 4RA9B 3S81A 3D6NB 3DT8A 4JS0A 5F7OA 2HMVA 3V8NA 1W1UA 3LLMA 3KTFA 4ZZ2A 4B4KA 2C0PA 2VHVA 4P4LA 4RDHA 4WEQA 3R7FA 5IJWA 2AK3A 3WK9A 4ZO6A 2OBMA 3NHYA 4V1CB 4E46A 5G41A 1NUSA 5A05A 3ZXSA 4WV3A 1KKLA 1Y4DE 3KZ1E 3LE8A 5AYVA 4C4YA 2FFBA 4ZI7A 5A4JA 1LY1A 5JQGF 2OLEA 3ZDXB 1EAYA 3EC2A 4TLBA 4ZVKA 2PH7A 2BY4A 3PRYA 1Y3IA 3I6ZA 3F71A 3OHPA 3OPYB 1PZFA 4OJYA 4P35A 3PTAA 1Z6TA 2I6QA 1LC0A 4MW5A 4POAA 2HA3A 2CJWA 2I2AA 1TCUA 3JD2A 3TLMA 4HWPA 3CX7A 1NZDA 1X7HA 3L93A 3S3TA 5M5BA 2O3JA 3BSWA 1P9WA 2PUJA 5EJAA 2O7VA 1TADA 1U90A 2P65A 5JCOA 1D2NA 2P3LA 1XEWY 3TQIA 1QPZA 1LJLA 1WX1A 4ZCLA 2BJWA 2JHFA 5JD3A 4DBLC 1U2TA 2CZQA 2F59A 2W22A 3MC1A 2JI6A 5A5DA 2IE8A 3F9CA 4IOJA 3V2HA 2FEWB 3CZ9A 3GFQA 4BNIA 1CUFA 4FZJA 4BMVA 2CHFA 3W5HA 4D0LB 4OHPA 1W2GA 2FB9A 2ZJ7A 3CO5A 2ZR8A 2NZVG 2WYHA 3JASB 4X92A 1R0BA 4B43A 1WSAA 3HXPA 2Q5FA 2D5IA 2BHTA 4M0EA 3NIDB 3MS7A 2DWOA 4QM7A 3NEPX 4IKPA 4AN0A 3E7PA 4DMFA 2JJ2D 3JVEA 2XQKA 4FFMA 4OGKA 3RTDA 5AJUA 1K98A 4MI3A 2JVKA 4UHBA 5FPPA 1PJ2A 1EP2B 1U1IA 4M1SA 4NJMA 4MUIA 1PR9A 4S24A 1QKJA 1XYGA 2QTWB 4GMFA 2FWBA 3SHTA 5FWYB 2CHUA 4RJTA 2HJ9A 3OLQA 4YACA 1IPHA 1T36A 2HLNA 1H05A 2XCIA 2WV7A 3RI3A 1KC3A 1Z4QA 1SUPA 4AIRA 1WV1A 2XJ4A 2AQKA 4OMFG 3B6IA 3EHDA 4BKPA 1SOVA 1XL1A 1PJAA 3D6VA 1VLHA 1U02A 4DSAA 2WM2A 1PQYA 3RS2A 1TAQA 2DWQA 1M1YA 2YXNA 4E6PA 3DD5A 2W6IA 2Q8QA 4EZBA 3AFMA 2CXSA 3NC1C 1WDWB 3AFOA 3N2EA 4I3GA 1RNLA 1JYFA 5M3BA 1FVHA 1ZD8A 2G9RA 3AI1A 4IDBA 3V1MA 3VYTB 3BGVA 3LH5A 2IPOA 4B3IA 1OZAA 4XUGB 4OAQA 4WXMA 5LL6P 4D43A 4GUAA 1CQXA 3W9SA 4N6GA 5C34B 3BFKA 4OTZA 3MYRA 4CCAA 4B76A 2AQ8A 1FDRA 3AL0C 4TQAA 1WMEA 5EC8A 5EE3A 1JHYA 3PF9A 4PNEA 4IGEA 1XTVA 4JUAA 3DKVA 5FO1A 4MRVA 3ECSA 5BSGA 2VHXA 2QB5A 1VKRA 3LZDA 4RY2A 1LDBA 1NW3A 3AKYA 1P2BA 5IKMA 7YASA 4U4AA 5IHPA 4N5HX 2ZWPA 4LDRA 3F49S 1H69A 2JLCA 1XEAA 1TJ5A 1D4ZA 2JAUA 3JWGA 2H2DA 3AR7A 2PCLA 2X6RA 4KIFA 3FPBA 4UKDA 2QN8A 5CJJA 1DAPA 2OHIA 4QDZA 3DPUA 4ND1A 1RMTA 2J9FA 2PFKA 3BCHA 3ED5A 3K2EA 4TRJA 1F2UB 2XA2A 2J9FB 3AG6A 3EXFB 1I2DA 1A98A 2B1RA 2CCGA 4NS1A 4E11A 5LQCA 5C5CA 5U1PA 4U7GA 1W36B 5G1NA 5TJHA 1E3DA 3EZNA 4ARAA 5F9FA 1P73A 3S4YA 4CQNA 3FLBA 4RL4A 4UQLA 1H93A 2VHQA 5E7QA 1G8GA 3SLKA 3SQXA 3U7IA 3BILA 3LWNA 4H7IA 1G5TA 2RBGA 4TN1A 1BJRE 3COJA 3TVDA 4B3SB 1BX1A 2AZDA 1K2VN 2D2FA 2ZJ3A 3EF0A 3QWIA 1O57A 4IXMA 3ONVA 3O8DA 3VKFA 2OUKA 2RCYA 1D2GA 1QLJA 2NW6A 3PHIA 4G0UA 1P5FA 4A5OA 5DNUA 2Z8XA 2X5JO 5EIFA 3QWFA 1YA8A 3G1TA 4LV5B 3W5IA 4YQFA 1GPDG 3I64A 4PO1A 3NHLA 1MNAA 1A77A 1GYRA 1R6XA 2CHVA 4L0MA 4NENB 3I01M 3N2GB 4IUCS 3P4YA 3HY4A 4WXEA 2ORIA 3UA3A 2BFBB 2NQTA 3BREA 1RWBA 1UBGA 2AN1A 3GNTA 3ICOA 2Q5EA 4HUJA 4OFWA 4YP6A 4JC8A 1CNFA 3GUZA 1EJBA 4PFKA 2QR2A 2PT5A 3KFVA 3VAAA 1I1HA 4QGFA 3M6WA 1JA0A 1BWRA 4M9CA 5BVHB 4Y3UA 1L8QA 1IHUA 4FFWA 1T91A 2FOIA 1XROA 8AT1A 3N0RA 2GESA 3T1OA 2XYRA 2CK3A 4KE8A 2X4DA 4G0QA 4TQGA 3TSZA 1V5FA 4DB2A 3EOBI 1SG6A 4MYRA 2IITA 4IZHA 3ZHQA 3PGKA 1VKNA 5CT5A 5L45A 3KQUA 1QBGA 4JT2A 1FP6A 2PKWA 1Y4UA 4GD3Q 3CNOA 1BQ3A 2P2LA 3WGYA 4BV9A 1GSHA 2FVYA 1Z75A 4UBJA 4PG8A 4UUOA 3P2JA 4V0KA 2GCIA 4AL4A 3ORHA 4LVUA 3GD5A 3VZBA 3D31A 3VXKA 2AR9A 1GG5A 2OG2A 3SHWA 3WSVA 5B4UA 2B7LA 2DTEA 1EFVB 3EA0A 3PFKA 5C8YF 1YS1X 3SFTA 3E53A 5LMNB 2OWDA 4WBNA 4DA4A 3L79A 4AJEA 4V3BA 4OXRA 1TYDE 5TV2A 3A70A 4KXVA 1OGIA 2AGVA 2LCFA 1Z6AA 2P8SA 1YBFA 2JGRA 2P6OA 4MUYA 2O6LA 1UF9A 3FNQA 3G2KA 4PPNA 2G71A 1JZQA 4MRMB 1OA0A 4YRCA 5CLFA 3CS3A 4RJLA 5AW6A 3K05A 5F2EA 4CF3A 1DL5A 1YONA 1YQXA 2OT3B 1E5DA 4WT7A 3O4HA 4V0NA 3STHA 4ZDIA 3V80A 1S8NA 3BK7A 1KARA 1P0MA 3A6HA 3BJRA 5JWHA 3SC2A 4B09A 4D4IA 2HSZA 3EEFA 4MI6A 3EIXA 5KTRA 3L8FA 1KIAA 5ESXA 4RGVA 5TNXA 1G4HA 1K7EB 3UVEA 2YHIB 1IM8A 3OESA 3DAPA 1XZHA 4JELA 2OC9A 1U0TA 2R7KA 2VWHA 4NG5A 5EINA 5JXIA 3GJXC 1B23P 2HSGA 1IJEA 5F12A 2AFHA 5GZ6A 3VYUB 4O5AA 4PO3X 5HRAA 2ZU0C 3G5UA 4C3UA 3WQSB 4TUYB 3L2OB 4Q9LA 3WO1A 2N3ZA 2XB4A 4I0WB 4ZYWA 2PKYX 3G1WA 5D00A 4WZBB 4D5EA 1YKFA 2TYSB 4WOKA 3AM3A 4CIXA 5JWOA 2MYTA 4HRYA 1O03A 4OIMA 4KIJA 3I61A 1TC1A 1Z22A 3RSOA 3B53X 3EIEA 4BY9E 4FR2A 2YVUA 1RZRA 1ENOA 2I6UA 4Y0VA 1YDEA 2GNOA 2I6TA 1GUZA 3PQ5A 1VL0A 5KPJA 2BKXA 3E5MA 4H27A 4Q9AA 1A0OA 2FXVA 5D51S 4E2FA 4K0KB 2QRZA 3O2SB 4HPWA 3QPCA 5AVOA 4ONEA 4R5HA 3UWMA 1WUIS 2PUVA 4K9SA 5CDSA 3HJCA 1Z0UA 4AZVA 3HA5A 2CFTA 4LJSA 2G09A 2JFZA 2X8BA 4ZZIA 3OOJA 2XTMA 1II8B 1I3NA 4FVTA 4Q15A 1E92A 4GI1A 1GAWA 3EQ2A 2VA8A 3RREA 1K08A 1KDOA 2E4UA 4C7OA 1UBFA 3V1YA 1SZCA 2H2GA 3H5LA 3KOMA 4NNJA 3NM4A 5COBA 3RSLA 4Q37A 5T8KC 3QJYA 1X80A 2YRFA 3P9ZA 4KAFA 3B89A 2O2YA 2Z30A 3DDWA 2E1PA 4Z8YA 4ZVTA 1G20A 2CW5A 2H2HA 1QIEA 3EAFA 3OO1A 2MSEB 4QVGA 5CW1A 3IXQA 4ZAZA 5JMPA 3VR3D 1TNDA 2GZAA 3PL1A 3SBXA 1AQYA 2PMCA 3IIMA 2I71A 2AZMA 2GEFA 1QF7A 4HQLA 4F4UA 1FUKA 1LPAB 2BRUC 3TW4A 1Y6FA 2IYSA 3E23A 3OQIA 2J33A 3DBLA 1E96A 2E4AA 2FP4A 3Q7SA 1Z5VA 4ITVA 5K8TA 4LGMA 3V4PB 3JQFC 7MDHA 1JW9B 4PC3A 1ONNA 4J9UE 3U3JA 4DM4A 1YRWA 3DXZA 2C4NA 1OHHA 4LTDA 2VTBA 4LI3X 5K0GA 1E8NA 3FUVA 1ZSVA 3MLEA 1KYXA 4R1NA 2ZAOA 3X1YA 2GNAA 3ZK7A 5AESA 2WICA 2WVHA 2CBXA 2DEUA 5REQB 4PGHA 1BHJA 1KU0A 4NTZA 3UUGA 2GN2A 2ZWAA 1C0LA 2AOXA 2GPAA 1NC3A 4KDRA 4BV3A 2FPSA 4MO9A 1KMQA 1O8CA 1C7EA 1TA9A 5I9BA 2Q3MA 2GK7A 1NBME 3N87A 2Y1DA 4V38A 4Y7DA 1OBFO 4ZICA 1MQ8B 4BQIA 1P6QA 1EX6A 3RK0A 4YV0A 1R4AA 1ZH8A 1UXGA 2P0AA 5LYJF 3G2QA 1L1FA 3IQDB 4MQFB 3LBFA 2DB3A 2X3FA 3KQWA 4C9BA 1PJTA 3LTEA 3N28A 3QWAA 1H85A 4IUYA 4OFZA 2A3NA 3W1VA 4J29A 2QZZA 4CV1A 3GNLA 1A88A 1KPHA 5BPFA 2O19A 3OJOA 3OX1A 4QYIB 3TZ6A 3A1SA 1S2MA 3Q9SA 4Y1GA 5ESWA 3WQQA 3P5SA 3EG5A 5C4GB 1G7TA 3SC4A 1P7WA 5CYOA 5LNK6 3WRYA 4OP1A 4CN8A 5LD2B 1X80B 1R6UA 2P9EA 4E5PA 4PX5A 2WB2A 2AJBA 3CM0A 1AGPA 3DTTA 2PKQO 1Q0UA 1T3HA 1ELOA 1DDGA 1RAHA 4UBNA 2NO5A 3EZ9A 1J7JA 2JD0A 1FNCA 2ODNA 2VT3A 4BX9A 3JATA 5ER6A 1A9PA 1FC0A 1REQA 5FPKA 1OI4A 5JRJA 4CG0A 3WK7A 5EMJA 3ZEAA 1JBQA 5CM9C 1E77A 2PWPA 5CCDA 1BMFA 4V0SA 1VGVA 4A92A 2C7RA 1AZWA 3PPXA 4XE5A 2ADOA 4NMWA 1EA5A 4L5CA 5H3HA 4RSHA 3B1WA 2P9YA 1E0SA 3HJHA 4EO9A 5LWQA 4KR9A 3ZZNA 4KVZA 5CVUA 3FYUC 1AXEA 1ZI9A 3JQ8B 1GY8A 3LVQE 3TZBA 1FFAA 2ZP1A 3V7WA 3W5VA 1XHFA 3C48A 3STTA 2EAUA 5JS7A 3RV3A 1N9GB 1T25A 1ZK2A 3IJEB 1UMKA 1BEEA 4A0HA 1PQWA 1SXGA 3BIJA 1N6OA 3C7CB 4G5QA 4XVUA 3SEFA 2DJIA 4G9GA 1E98A 4CIWA 2H7CA 4ARSA 2C8LA 4DGQA 3ND6A 3DOHA 4Y6LA 5DNEA 3U19A 5L4LA 1E7MA 3OPVA 4D4JA 3CLTD 5JY6A 1RYBA 1GEEA 1OV4A 1UJ4A 3R23A 3T7EA 3RT1A 5FLKA 3TVYA 4KMMA 3W5SA 4MV4A 3OLYA 4N39A 1XPOA 2GAIA 1D1TA 3GAMA 1RJFA 3B1FA 3R4VA 1XCPA 3MJDA 1ZSYA 3PUJA 3E8XA 3X2FA 4HLUA 2BGIA 3FTQA 4GBJA 4IZOA 3PP8A 3R0VA 4JYMA 3NMUF 1JJBA 5ITZA 4FSDA 1SVUA 3W4JA 2HAEA 3Q7RA 1ZN7A 4ZFNA 2FZGA 3JARA 3O94A 4CLEA 3P9KA 4E88A 4ZEVA 1FUUA 3DOOA 1ZCFA 2XKJE 1AHNA 2K7FA 4FFLA 4KV7A 1WVGA 1W2HA 2QROA 2Y0BA 4NDZA 3A10A 2BHRA 1KJWA 4MA5A 5T6MA 4YMHA 3GG2A 4G0MA 2OZLB 3T9EA 3WBJA 1C8KA 4MQEB 2FMTA 1RADA 1LBEA 5K6AA 3PZRA 1YMQA 4UM8B 3AEUB 1AGRA 3HJUA 4C6TB 2VOEA 2OCBA 1P75A 2H18A 3HRIA 5ULLA 5G4KB 4F21A 2QRMA 5D3QA 2VQFB 3MFQA 2QMZA 4QG7A 4C5AA 4JXKA 2GBCA 3DBLB 2VTKA 1IC6A 3GLHA 4Z8XA 1Q7GA 2AV6A 4WOBA 5MN6A 2J5BA 2UYCA 1JP7A 5F2OA 1NP3A 5FNVA 2QWXA 5K09A 2IYQA 5IDYA 1N9GA 3PE3A 2OHJA 3QEJA 2JF0A 2X9VA 2HC9A 3MUFA 2Z1DA 3NQ41 4R98A 1OBVA 5CXSA 1TQ2A 1FP2A 4IW3B 5ICEA 3ER9A 4BNHA 1GUAA 4ARZA 1GPKA 1Z34A 3GROA 4WLFA 4R1MA 4UD6A 1LS6A 1OXVA 3SJ7A 1OTXA 2I91A 1KSGA 4RL6A 1QUEA 2R8RA 4ZJUA 4R16A 1X9HA 3AF2A 3MMSA 3NI2A 4HH1A 4HAOA 2IYFA 5FBKA 1I6MA 4AUKA 4O63O 1DS6A 1GXSA 1W49A 3JASA 5KUTA 1XVTA 2CMFA 4EBBA 4Z7NB 1UDWA 2XVMA 2CL7X 3MJFA 1V1RA 4MQFA 1D4AA 1GRNA 4DCPA 4E5UA 3M4YA 5AI6A 1UK7A 3KSZO 1ZJZA 3FRHA 1D2HA 3Q0TA 1G9SA 2HSEA 4W5QA 4NFSA 2PAAA 5C8DA 4HNHA 1FX1A 3EQ9A 5E1DA 3GI1A 4JYZA 3I0MA 3IA7A 4K9LA 2RH5A 2G04A 4S12A 3O74A 5B3JA 1LVUA 4ZOEA 1ZINA 4DPMA 4R41A 1KH3A 3WK8A 1RLUA 3LCJA 5CVTA 3EPHA 1XKTA 3CWCA 5BSUA 3H5RA 4EUHA 3GEMA 2OFPA 4JLBA 4OMDA 4BVEA 3DPIA 3WNDA 3DULA 1HURA 4YRQA 2XZTA 5HF5A 2ZYGA 5CPFA 4J0DA 4RHEA 2IHYA 3RFUA 4CE6A 2HZBA 2HU5A 3COYA 3TPCA 1JAHA 1UZLA 3RARA 1GN9A 1ZKDA 3FYHA 3KJZA 5H3LA 4LXHA 1M1YB 2ZUEA 1G8YA 1XAIA 4ZQGA 3TB6A 5FL7A 1I5EA 2X0KA 4B4DA 3U0VA 3IQWA 3P9PA 3U56A 1WXQA 1X1EA 3D3QA 1U8YA 1G16A 3B51X 2O7NA 3H65A 5LDDC 3D81A 3CZCA 4D79A 5A6SB 4FGJA 3DE5X 3ORYA 1A9XB 4KRYA 5AIBA 4W4TA 4BGVA 3U1VA 2WZDA 3E27A 4Q6WA 3G2JA 4EFKA 3QU2A 2ZRHA 3ACDA 4KUHA 1L3IA 2QPTA 3JCZA 3WGJA 3TF5A 2V9PA 1QHIA 1FPQA 2ZWOA 1AHPA 2BAGA 4H59A 4L8LA 1TFRA 1PWHA 4Q6BA 3CG0A 1KVSA 2ZBFA 2FHPA 2P2YA 4G07A 1A5SB 1ECJA 3P71T 1NZFA 2RGEA 2A57A 4R2HA 4X90A 3ANNA 1DBSA 1BWSA 1M34E 4Z9FA 4DJDC 1ISPA 1MH9A 4KIWA 2Q9BA 2VRBA 4F91B 1UDCA 4RS3A 3X1XA 4FFOA 4QUEA 5LP6C 1W4CA 1IZZA 3EIOA 3OECA 3AHGA 4PTYA 1GZ7A 3FNEA 4E15A 1KAGA 4M4SA 2Q1YA 3K09A 3HS3A 4GXTA 4UMFA 3G6WA 4LWOA 4PAQA 1S2DA 5DM60 2WIFA 3E3LA 3I5XA 1UT8A 4QJ3A 4UNIA 5TMEA 2PX3A 3EHEA 3CEAA 3HG7A 2V3CC 3INTA 1QGYA 5FV4A 1KA9H 4XEUA 4YMSA 3R0XA 4QEKA 2XQJA 2VP5A 1SQ5A 1M75A 2TMDA 4HZUA 4L02A 4V1CA 3ZGVA 4HZUB 5FUBA 4YQEA 4KZPA 4RZHA 3REQA 2Q2NA 3FPSA 4DM7A 3KVYA 4D8YA 5IAAA 4AM8A 1RQXA 2YXPX 4NHEA 3GAZA 5L6LB 3HB7A 3KO8A 3BZBA 3VPGA 4ED9A 3IQGX 5BWBA 5KYXA 2W2KB 3P2EA 3DLHA 2ZIAA 4IVQA 2QTGA 3EUEA 3LFHA 5T3YA 2FFAA 1RJGA 4EG8A 2LCQA 3QEKA 4MWOA 1F6WA 1WHTB 1E9AA 4WLNA 2X22A 4ZVSA 4U6QA 4Y1RB 1DC8A 3BM5A 3BXOA 3WLHA 5TS2A 3GZNB 2JIBA 2JIZA 3L7BA 5HS6A 2L2QA 3NXKA 2GSWA 4NDAA 3RUHA 1ZLXA 3B36A 3ZVKA 3AINA 1IG0A 2Y1GA 3GHHA 1GVHA 5HZHA 1Q3TA 2ZS7A 3ACBA 2I8AA 1IH8A 1GPJA 1F8XA 1Y4AE 3CSDA 3DB1A 1VCHA 2EFJA 4MJ7A 4AS2A 4OHMA 3U9TA 2EFHB 4YX9A 1H0SA 1RZVA 3USES 3FPGA 1GTZA 3PWZA 5GIPE 5HUQA 2Z2IA 5KVCA 3FVQA 3TLZA 4G84A 2C5EA 5EHZA 2HXYA 3LNTA 3ESDA 4PAWA 4UU0A 2OM6A 3W5BA 1P45A 4BKMA 2Q2QA 3D8BA 2CWDA 4A10A 1F06A 5AVYA 1QTNA 1Q2UA 1X9IA 1J0AA 3JQAB 3Q3HA 4OHVA 1L7PA 1XF9A 3B2EA 3WJ7A 4DG5A 2PE5A 1RZ3A 1V7CA 2B78A 3A1WA 5KNCD 1X7ZA 1U8CB 4D8XA 4RTKA 4BLSA 3WGIA 3AESB 5ABPA 2XY4A 2C20A 1JH9A 1ONSA 3K72B 1SKMA 5DULA 1PYDA 4YI5A 3AF3A 3LBYA 3MW8A 3BGIA 3EGXB 3RYCB 3DO6A 4GPZA 3U4QB 5TMPA 1CF4A 3IAS1 3LO8A 1JXAA 1W0CA 4OU5A 1JIXA 3KZXA 4ZPJA 2G9NA 3SJCA 4UDNA 1Y1KE 3E7DA 3TQRA 5K03A 1MV8A 2GRJA 1XN1A 2FHSA 1X14A 5HFAA 2BI4A 4UM9B 5C5EA 3HFSA 3SS9X 5KSZA 5DXAA 1Y37A 4L28A 5ILOA 3K4HA 3OLXA 2PBZA 3MXTA 4QXMA 5LQDA 1FUYB 3S2IA 2FFQA 3WB0A 4C21A 1DQSA 1EQUA 1Q84A 1UPAA 3