4LSWA

Crystallization and structural analysis of 2-hydroxyacid dehydrogenase from ketogulonicigenium vulgare y25
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
318
structure length
318
Chain Sequence
b'MTKPEILQLGPYPAWDQEPLDAAFTVHRLFEADDRAAMLANVGDRIRAIATRGELGASRALIEACPNLELISVYGVGYDAVDLAACRERGIQVTNTPDVLTGDVADLGVAMMLAQSRGIIGAETWARSGKWAAEGLYPLKRRVFGRRAGVLGLGRIGFEVARRLAGFDMQISYSDIAPKSYAPDWTFVEDAVTLARDVDFLFVTLAASAATRHIVGRDVIEALGPEGMLINISRASNIDEEALIAALADGRLGSAALDVFEGEPNFDPRFRDLPNVLLQPHHASGTIETRKAMGQLLRDNLTAHFAGSPLLTPVVLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-2-hydroxyacid dehydrogensase protein
publication title Crystallization and structural analysis of 2-hydroxyacid dehydrogenase from Ketogulonicigenium vulgare.
pubmed doi rcsb
molecule tags Hydrolase
total genus 110
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2013-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lswA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lswA01
1Z7EA 2NTJA 3QWAA 1V35A 2C0CA 3H3FA 1EUCA 2XXBA 3I9MA 5IZCA 4UEJA 4AJEA 2V7PA 4ZD6A 1Y8RA 3TF5A 1PS0A 1YBMA 2JAHA 4Q3CA 5LCXA 5EL0A 5GZ1A 2CVQA 5DZSA 2O23A 3E6AA 1IB6A 1ZK2A 2O2YA 2WM3A 3ITKA 5ENDA 5JXWA 3ZH2A 3ZV6A 1X0VA 3AI1A 3RUDA 2NTNA 4GSKA 3R1IA 1KETA 1H2BA 3WTBA 2ZYGA 4GPD1 2PA3A 5HS4A 1R0SA 5ICMA 2G1UA 3G49A 3OJFA 4FFLA 4WEOA 5KNLA 4TRMA 1LLUA 2RIRA 3IUSA 3TSCA 3C1TA 2NADA 4MKRA 1ISGA 3HN2A 4YA6A 4OQYA 2FY8A 1M67A 1P1HA 1A4IA 2NM0A 2ZQZA 1VL0A 2Q2QA 2FSVA 3NGXA 3V1YA 5C7LO 1Y9AA 4MP6A 2QRLA 1L7EA 4NQZA 2CY0A 5G4LA 2Y1FA 4W6ZA 2DAPA 3OJEA 8LDHA 2BGKA 2HMUA 3PGJA 2W98A 4BO1A 3NTRA 4OXYA 4IZIA 4JGBA 1DC6A 4QO8A 2HK8A 2Z1NA 3FCOA 3OICA 3FBGA 4RDIA 4RV9A 4XGKA 4PLWA 3IDSA 1EZ4A 2O3QA 1F14A 5KTKA 2V6GA 1H6BA 1T2DA 3BMNA 1UAYA 3D7LA 4OJNA 4CUJA 2WEKA 3Q2IA 4MVJI 1DEHA 3DHEA 3L4SO 1PSDA 3UHAA 5I7SA 2NSDA 4ZRNA 5T64A 3DHNA 1PZFA 5L4SA 1A7AA 3HNPA 4YAJA 5ADHA 1OOEA 1VRWA 2AQKA 4HWKA 3HJAA 5L4NA 5H81A 1ZK0A 4C7KA 4BKOA 2A4KA 3ANMA 3D3WA 4M89A 1L1FA 1ISMA 4CM6A 4D0RA 5C3MA 4NBVA 4P4LA 2TMDA 4YT5A 5IF3A 5CDGA 1ADCA 1OC2A 1W8DA 2ZB7A 3JSAA 3B1JA 1MG5A 3U9LA 5K9ZA 1HYEA 3H3JA 4PCVA 1PQPA 5F1OA 4E32A 3VVBA 1E7QA 3ZGYA 1B26A 4MJLA 2DPGA 5JPIA 4NK5A 3FD8A 4TWRA 3W8FA 4FPXA 1FDSA 4JNKA 4AICA 2CFCA 4N54A 4FS3A 5T5QA 1MLDA 5CFZA 4WCFB 4U6SA 4BO8A 3HWRA 2C5EA 3L9XA 1OBFO 4URFA 1PGPA 3L0DA 2BI8A 4H15A 5A05A 3H65A 1ADBA 3PI7A 1N9GB 4XX0A 5JY1A 3K92A 4CV1A 2I99A 2HMVA 1GUFA 4OYRA 3LLSA 4MVJP 1XYGA 1YOVA 4AJIA 2NV6A 3RI3A 1YS4A 2JFGA 3BTSA 1KVSA 3H9JA 1R6DA 5FFFA 3ZZNA 4B3JA 3K31A 2XOXA 4J7UA 2W2KA 2ZB4A 4DREA 2C59A 1CIVA 4Y6SA 2FZEA 3OECA 1ZCJA 3QJ5A 3C7DB 1QYCA 3WGTA 4GH5A 2EW2A 4L73A 2CUKA 4B7XA 4E2YA 1O6ZA 1SBYA 1PJ4A 3KLPX 2IXBA 4ND2A 2R00A 1KS9A 3DDNA 1G0NA 4D42A 2VTDA 3GVCA 2QYSA 5CHEA 1JKJA 4KMSA 4EYEA 5KJFA 4AJLA 1U2GA 3G0OA 3W4IA 3KLMX 2EGGA 3TWOA 1ZMOA 4KUHA 3HHPA 2X22A 1N1GA 3RBXA 3W8DA 3RQSA 1BVUA 1NFFA 1UJMA 3NJ8A 4R68A 3ZHBA 2PY6A 2ILTA 4E30A 3K6JA 5I9NA 5COBA 1C1DA 1N7HA 2FPIA 5T67A 1YO6A 1I36A 3K8ZA 2GLXA 3S8MA 3CZRA 1HWYA 1R4MB 5BSHA 3DFZA 1ISJA 3VTFA 4R16A 1U8FO 3RBVA 3CINA 5TT1A 3NRCA 4LRTB 3FPCA 4HFNA 4WUVA 3HB4X 5I7EA 4TZTA 1E3SA 3DOOA 4PLZA 4ZQEA 3WBFA 1LRLA 4ZGWA 5G4KA 3AY7A 5JE8A 1KIFA 3WX0A 5TJHA 3KSZO 3PHIA 3OFSA 2P9GA 2PR2A 3I83A 5EMHA 1QKIA 1Y9EA 4IJVA 4AG3A 3AUAA 4CMBA 2EV9A 1C14A 1O95A 3EK2A 3WWZA 4CLHA 1GCUA 1WMAA 4QEDA 1EDZA 3FR8A 4FCCA 4RVHA 1E7MA 3ZHYA 4XRGA 3C3XA 4NK4A 1X7GA 2CDAA 1Z6ZA 4I9HA 4JX8A 4RVGA 2NACA 2C7VA 3OJ0A 2WYWA 1GYQA 2ZJ1A 3OHSX 5FWNA 3FN4A 1T2EA 4YAKA 1JAYA 1WP4A 2RBEA 5DOVA 4YT4A 1I30A 4WKGA 3ZI0A 4PG5A 3GQVA 2IRWA 3GRKA 4OQZA 3ZNNA 1SEPA 4UEOA 1MX3A 1PGQA 2P4HX 2JKVA 7MDHA 2GN8A 2WD7B 4LMPA 3GVPA 2WYVA 2FN7A 4KTTE 2FMUA 3INTA 4CLRB 1SO8A 1P33A 2IZZA 1LA2A 1EFLA 3B6ZA 3EYWA 2HSDA 3PIDA 3ICPA 1E0DA 4BMNA 4J1SA 4ZICA 3OM9A 2VWPA 2X9GA 3FHLA 2E6UX 1XIVA 4FC7A 1HDXA 1RYEA 4RVDA 2J5KA 1VM6A 3TL3A 1R15A 4E5KA 3PJEA 4E2ZA 1U3WA 4CV2A 2Q46A 1GYPA 1HZJA 4RF3A 3OEWA 1YB5A 3D4PA 3QVTA 4WLVA 5ER6A 2PKRA 4J43A 3WGOA 5TF4A 4CLEA 4QFCA 3S55A 4DIBA 3LC7O 3GF4A 1JLLA 4EJMA 3DMTC 3KSUA 4G65A 1NAHA 1NP3A 3CPSA 5LDHA 3QLJA 3MOIA 5DT9A 4M54A 1BXGB 4LW8A 5A3VA 1NM5A 1X13A 1Z82A 2PV7A 5FYDA 2DTXA 2IEDA 4ALIA 4BKQA 4GVLA 3ROKA 3ZWMA 3Q3CA 1N92A 4CMJA 5L40A 1IUKA 1QYDA 1PU2A 1A7KA 3WG9A 3I9KA 5IG2A 3RIHA 1XQ1A 2OGUA 4QXMA 2FR0A 2EERA 1KC3A 1Y8QA 2B4TO 1C0PA 3JQGB 4Z0PA 5K6AA 4GLLA 4BNGA 3R3SA 1T25A 3D5QA 3GNSA 3PK0A 3ROQA 3P7MA 5ER9A 4KDEA 4WJZA 4Z0TA 5C7OO 3VTZA 4CLOB 5IN5A 2X0JA 3GMDA 4DQVA 4JBHA 3ZWXA 2HJRA 1ENYA 1I3NA 3WGYA 1UDAA 3UOGA 2YQ4A 3DR3A 2PD4A 1OFGA 5L7WA 1WW8A 2YHUA 8ADHA 4WCDA 1LSJA 1PJTA 1VE9A 2D5CA 2X6TA 5HA5A 3JCZA 2Q1SA 3PDUA 4IDAA 2NU9A 3FNEA 3MWDB 4W7HA 3IP3A 4NPCA 4JQCA 3K9QO 2GN4A 5G2OA 5H83A 3TPCA 1IZ0A 3ZU5A 4BNJA 4CM4B 4E2XA 4U6QA 1SZJG 1PR3A 2O3JA 1H6CA 2E4AA 1NPTO 3F5SA 3GG2A 4G5HA 1AUPA 1U3TA 3OQBA 1B2LA 3P2YA 4A0SA 4CM3A 3VZRA 2XF8A 4FQ8A 2LDBA 3K2EA 5B4TA 2D4AA 5JC8A 2P5YA 1DFIA 2HK7A 4N18A 4HNGA 4INAA 4A2CA 4HP8A 1M6HA 3PLRA 3LC2O 1WNTA 1LLDA 2HUNA 3KYCA 1P1KA 3BIOA 2C7GA 3H8VA 1Q7BA 1JU9A 4BNVA 1DIGA 4U0JA 1U3UA 1DAOA 3F46A 3AOGA 4MINA 3F4BA 4D3SA 1ZW1A 1HEUA 3O26A 1JAXA 3PHLA 2O2SA 3MOGA 2PGJA 2X58A 4CMCA 3DAPA 2Y93A 2C2YA 1S6YA 5JO9A 3ZCXA 4AJNA 1TI7A 1PIWA 4PLGA 1R16A 3I5MA 5G0VA 4RPKA 5AOVA 5BQFA 3OJLA 2VHYA 1TEHA 1ZEMA 1UXIA 2Q2VA 2YZ7A 4L0QA 2W4QA 3I52A 3QWBA 2AE2A 3KVOA 3E18A 3E9QA 1UDCA 1ISFA 1MC4A 1VSUA 4XQCA 3V8BA 4KTVE 2DT5A 4N5MA 4L4XA 5EJ2A 2A9FA 4B4WA 3QRWA 3L9WA 2IDZA 4TMFA 1NPDA 4KDFA 3DQPA 3GRPA 2D3TA 2IYOA 1I3KA 1PGJA 2BMAA 1CDOA 4F46A 3PEFA 2VQ3A 2JD1A 2NQTA 1GD1O 1KERA 4DUPA 4FOOA 3E8XA 4A73A 2NU8A 3QP9A 2X7HA 2VHWA 1DHRA 3ORFA 3DZHA 2VHXA 3IAHA 2X23A 2DLDA 1WWKA 3PGXA 5FF9A 3KXDA 5C37A 5JW6A 3HDHA 2ZK7A 4F6CA 3ITDA 1E5QA 2Y0CA 4J9VA 3GGPA 3UICA 2OBYA 3TZKA 5JDCA 1KYQA 1UXGA 3VKUA 4RVFA 4TRJA 4EEZA 3TRIA 1D7OA 3CH6A 4AJKA 3ZWAA 4X54A 3PYLA 3DFUA 2PZLA 3UH1A 4EBFA 4AJHA 4ALMA 1BGVA 1RM3A 2J6IA 3UN1A 3W1VA 5IZCC 1ZK4A 3HN7A 2YV2A 2EP5A 3MJSA 3KHUA 3O8QB 2NU6A 1MXHA 3DEYX 4D46A 1DDOA 3TOZA 2BFPA 3ZHZA 1DC4A 1DB3A 2G76A 1U4SA 2VWHA 3JQFC 1VPDA 1OAAA 2QRJA 3T7EA 3T4XA 2FOIA 1CRWG 4Z0HO 1P0FA 3GVHA 4AJPA 1FXSA 3S2GA 3DBLB 3CSDA 1M75A 4HV4A 4GGPA 3D3EA 4LSMA 1A5ZA 4Q39A 3KO8A 1N9GA 4ND1A 5L95A 1X1EA 4FOSA 2Y1GA 4J6FA 4J91A 2O48X 4DGSA 2I76A 3KRTA 2C07A 4BKUA 3WICA 4OMUA 3JV7A 3JYOA 3W6UA 1R4NB 4NBTA 2ZATA 3VH2A 4B7CA 4WLEA 1YQGA 2VOEA 3DXFA 2F1KA 4J1NA 4QQRA 2AEFA 5JSFA 1PQUA 4PIVA 2GNAA 4OOEA 4TVOA 3RFXA 5DBFA 3WGIA 3GZNA 3ULKA 3N7UA 3DBHA 4R01A 2E37A 3AUSA 4PLYA 1JWBB 2X4GA 1HE3A 3HG7A 1D8AA 4GBJA 3OIDA 3CUKA 1BMDA 2B0JA 2NNLD 4GX0A 4XA8A 4GQAA 3BAZA 3ONFA 3RU9A 4PVDA 4R1UA 1FDUA 1D1SA 4G2NA 3RROA 3UKOA 3FNFA 2GERA 2P91A 4ZQHA 5EQFA 4AJ2A 3QA9A 2HO5A 5TNXA 2OP1A 1XQ6A 1YB4A 3ASVA 4BO0A 2DTDA 4WLOA 2B35A 1MFZA 2CD9A 2GCGA 3EDMA 1DAPA 1OMOA 3WB9A 3WS7A 1YQXA 4GL4A 1H6AA 4GVXA 1X14A 1CQJA 3IJRA 3ZNOA 1UDBA 2JFHA 1O8CA 4YXFA 4DMMA 1JVSA 5AXDA 2EG9A 2RAFA 1OC4A 1PR9A 2AQ8A 4H16A 5KVQA 1GQYA 2QZ9A 1NFQA 1MGOA 1VJ1A 3OBBA 4MVJA 4NJMB 3TZCA 4BO4A 1E92A 1R4MA 4XQEA 3KEOA 1KBZA 4J4BA 4O1MA 4DXHA 4WEQA 2Q2WA 3EY4A 4ZQBA 2NWQA 1K89A 2JCXA 1LDBA 4XYEA 4IBOA 3W6ZA 3Q6IA 1QV7A 1U2DA 4R51A 4IDCA 1TXGA 3U4HA 4J2HA 1ENZA 2I3GA 1DHTA 4IM7A 2B83A 1XKQA 5ICSA 5COAA 5BSGA 1SC6A 2AXQA 4IDFA 3FRJA 1D1TA 4RO0A 4RORA 3S2FA 1NQTA 2QYTA 3PLNA 2O3RA 3WDSA 2VOJA 1Y5RA 3C85A 5JFOA 1LTHR 1ISHA 2O7QA 2HQ1A 3F9IA 2Y68A 3KSDO 1H5QA 1PJ2A 3OMLA 1RM5A 4GLOA 2GDZA 4HNHA 2B4RO 1BXKA 4YT2A 2R00C 3PP8A 3K30A 4YRBA 3AOEA 5BSFA 2CNBA 3AUTA 3EUWA 3OP4A 2VZ9A 4QSMA 5HM8A 5I7VA 1GFSA 4OKIA 1E7SA 2RH4A 3PHHA 1HT0A 3NDJA 2NUAA 2J3HA 3ETDA 5KCZA 2E49A 1GEEA 3VPXA 4CLRA 5IDQA 3JYLA 1PWXA 3AI3A 3DB2A 1WDMA 5HS6A 5TLSA 1F8GA 1N2SA 1ZKMA 3VZQA 2OP0A 4K9DA 3RCBA 5A03A 4XCVA 1LI4A 2AG5A 3K5PA 5B37A 1GTMA 5A3JA 4I8XA 4WE3A 3DC2A 2IE0A 1VLLA 1ADFA 1DOHA 3EVNA 3GR6A 1IY8A 5CDSA 3IL2A 4HUJA 4WASA 3ZWOA 3GAZA 3DBRB 2X9VA 1BXZA 3ZWNA 4YEDA 2EEZA 3WNQA 3PZRA 1JDJA 2EGHA 1UH5A 4W9NA 2GO1A 4WOJA 4EJ0A 1EVJA 4MKXA 4MP3A 1J0XO 1E7RA 3AY6A 1SOVA 3DL2A 3JD1A 3MTJA 4RF5A 3GEMA 3G1TA 4RPHA 5TS3A 3DTYA 2GZ2A 2DTEA 1PGOA 4BKRA 1CERA 1B3RA 1IE3A 2IYPA 3KOUA 4UAGA 1OZAA 4AJJA 1TLTA 4Z3DA 1ZSVA 2P9CA 4WNIA 2ZB8A 4W82A 4DBVO 1YWGO 5CEFA 2VYVA 3I6IA 2ZCUA 4NZ9A 4XZ3A 4EUFA 3BTOA 4BUCA 5EIOA 1HL3A 3SJUA 4RF2A 3ZWBA 3UXYA 4IPTA 5EERA 3JQGA 4WLNA 1EE2A 3NAQA 1WDKA 5G0TA 2X5KO 2PTGA 3V1TC 4MVJE 3JQAB 3C24A 4A10A 4EZBA 4CLOA 2FZWA 3ZNPA 3U4CA 2YDYA 2YHIB 3WMWA 1T4BA 3WQRA 2ZKLA 3KYBA 4OH1A 4BKPA 3NGLA 3D1LA 3MJTA 3F1KA 1A9ZA 1NX6A 3R6DA 4ALJA 3GOHA 5BR7A 1QV6A 4CMEA 2D5AA 2I5PO 1V3UA 3U4IA 3GHYA 2UVDA 3RUFA 1HE5A 2B36A 4XYLA 3LT1A 1KVTA 4FJ2A 1PL6A 2FRDA 3EZLA 1H2HA 4CM4A 2J3KA 3JQBA 1XEAA 3ANNA 3HB5X 4RCVA 2J3IA 3ZV5A 3EC7A 1NASA 4B79A 1H9BA 1EEHA 2ZTVA 5AXBA 3U0BA 5F5LA 2PH5A 4LISA 2B69A 1LDYA 4P8RA 4NR0A 5DBGA 5AQ1A 2OZPA 1M2WA 1NBOA 4BNUA 4PRKA 1EDOA 4MVJD 2IZ1A 3EZYA 2ZJ0A 2V6MA 5A9RA 1NHGA 3ETGA 3EW7A 1FDWA 1MUUA 1KY5A 4NFHA 3E9MA 1DXYA 3L77A 3ST7A 3HZZA 2Q99A 4BVAA 4E31A 1DRWA 1PJQA 4II3A 3JD2A 4RVSA 2BF7A 4FDAA 1ZJZA 1XU7A 3FBTA 3JQ8B 1T1RA 4JIGA 5KVVA 3I9LA 3VPGA 5JAIA 1DRVA 2FHSA 1P1FA 3ANLA 4PLFA 4CL3A 1R66A 4RQTA 3L07A 1YB1A 3I9NA 5ILGA 3TNLA 1I10A 4BL5A 4BO6A 4OXNA 5IDWA 3GGGA 1F8FA 2C54A 3CMMA 4AJOA 5KOIA 4GMGA 1B0AA 5K6AC 2Y05A 1QLHA 1UXHA 1ZIDA 2D8AA 3SXPA 3U5TA 1LRJA 1ZH8A 4YJFB 2XPCA 3AJRA 3CZMA 4ALKA 3ROPA 1P31A 5TX7A 4FR5A 4FN4A 1BDBA 3HE3A 3BHIA 4ZQFA 1CF2O 1KEWA 2DQ4A 1YGYA 4XYBA 3I23A 4LRSB 4BGVA 3C8MA 5A9SA 4YJDA 1YBAA 4P38A 2NTVA 3LLVA 2OBNA 4LVCA 3G79A 2DBVO 4MVJF 4OAQA 4MDHA 4YAEA 3GDGA 3V5NA 3GVIA 4CMKA 4KQXA 1I2ZA 1NQ5A 4PG8A 5IN4A 3I9JA 2WYUA 2GUGA 2GGSA 5TT0A 3OA2A 3IJPA 2Q1WA 3QVOA 1C0IA 4ROSA 3RWBA 4IY1A 2GD1O 1GUZA 3PWZA 3GN2A 3CMCO 3WFIA 3UFXA 3GT0A 2DKNA 4NFSA 1U28A 4A7PA 3Q11A 4RVUA 3IMFA 5AXAA 4MKZA 4WOKA 4IDEA 4KZPA 1TA4A 5IDYA 2ZIZA 1LEHA 3ZV4A 4E4YA 2NQ8A 3NX4A 3HFGA 2EKLA 5GMOA 4QO7A 1BTOA 5CDUA 1P1RA 3M2TA 3O8QA 1M76A 4CM9A 1T2AA 1V9LA 2A92A 3NT2A 4J49A 1LSUA 3BMOB 3HQ4O 5IJZA 1NWCA 4YDRA 5I9MA 2AQHA 1EUDA 1KEPA 1Q7CA 1R0KA 1ZXLA 1K5HA 4YTEA 3DBLA 2RHRA 1HYHA 4R3NA 3H6KA 4BMVA 3SVTA 2RH8A 1DO8A 4XKJA 1BVRA 4KWHA 1PX0A 1J6UA 1I8TA 1DSSG 4CMIB 3GN1A 3LF2A 1AE1A 2J3JA 4YVFA 2PZKA 2VYVD 4B7UA 1XWFA 1PL8A 1B14A 1SPXA 4M87A 3SBOA 2OUIA 1W4ZA 3BMQB 5DCWA 1JTVA 4L76A 2QW8A 4TQGA 3WXBA 4S3MA 1HETA 4O59O 2Y67A 4W7IA 2C82A 1BW9B 1T26A 4RPJA 2YYYA 1ULSA 3RUAA 1V8BA 2Y0EA 5JAQA 3WWYA 1LLCA 2NVUB 2DUUA 1XDWA 3H5AA 5JMPA 3H9UA 4RPLA 4BNTA 9LDBA 1Z45A 3NT4A 3I3OA 4YRDA 4B3HA 3S2EA 4OOFA 2W90A 1O0SA 3IS3A 4MVJH 2V6FA 3TN7A 2DFVA 3ZNQA 4IQGA 5L53A 4PFJA 2RHCA 4EEXA 5TJ9A 5JDCC 1E7YA 4NNJA 4O63O 1ZBQA 4O5OA 2PFGA 3GNTA 2DVMA 4IIUA 3OA0A 4UVIA 3L6EA 3GC6A 5MGBA 3H9GA 5BNFA 5A5EA 2G82A 1YDWA 4N7RA 5L7YA 1DBVO 2OO5A 1ZK1A 1MA0A 3DZKA 1JWAB 3R3JA 2JHFA 5A9TA 5JYDA 1U8XX 1MC5A 3EMKA 3LK7A 2X5JO 4BNMA 5F3RA 1LDEA 2ET6A 2OXIA 1GEGA 3BXXA 4J7CA 4ND4A 1UP4A 2BHLA 4XEHA 4BB6A 3AW9A 3LSYA 2A94A 4NJMA 1QSGA 3TZ6A 2UAGA 3DZGA 4PG7A 3LT2A 4OXKA 1ID1A 1ARZA 2AA3A 1TVEA 2VT3A 4XYMA 3SEFA 5L45A 4BO3A 3EVTA 3K96A 1I3LA 3IP1A 3Q1LA 4EITA 2DBZA 1NQOA 5LC1A 4CR8A 1FF9A 3TZQA 2P9EA 4KUEA 2EKQA 1GY8A 1UZMA 5JNLA 1CYDA 1EBFA 1IL0A 3KZVA 4UUNA 1H9AA 2EW8A 3BMNB 2GZ3A 4DQXA 4MIEA 1NTOA 3LU1A 3RKUA 1P74A 4R1NA 1HZZA 4B4VA 4E5PA 2FR1A 1QR6A 5A4DA 5JAZA 1H6DA 1ZSYA 2CSUA 3R0IA 5HWSA 4IDBA 4CM8A 4YAGA 4NJOA 5ES3A 5T57A 2EXXA 1SB9A 2WE8A 2IEBA 1X0XA 3QV1A 4CV0A 1V6AA 3BZUA 3D3WB 4N5NA 4XJSA 3M1LA 4YWJA 1I2BA 4I9UA 1XHLA 1NWHA 2Q4BA 3PJFA 4FW8A 4RJTA 3QVWA 2EJWA 4J1QA 1E3WA 3TOXA 1P1JA 4ESOA 1YQDA 4AL4A 1ORRA 1Z7BA 3DOCA 4AVYA 2X0RA 5CEJA 4OO3A 2WE7A 5COQA 2EF1A 3MEQA 5KIAA 1RJWA 3DWFA 3NDRA 4DC0A 3LYLA 4XGNA 5BT9A 1LQTA 3UF0A 1K0UA 4OKNA 3VZSA 5L9AA 4RZIA 3T4EA 2O3TA 3RKRA 1CQIA 2VZ8A 4QFDA 1MXFA 4UULA 1E6EA 5EPOA 1E1KA 3H4VA 3LDHA 5T8KA 1EQUA 3GUYA 4PZDA 4Z3KA 1YOVB 4LMRA 2H5LA 3HDQA 4KUGA 3FF4A 1PJCA 5KVSA 2B37A 1ZFNA 4CM9D 3JQ7B 3ADPA 4XQ9A 5F1PA 2ZB3A 4CLDA 2EWMA 1EQ2A 3LT4A 3WGHA 2ZYDA 1BG6A 3COSA 1KC1A 6LDHA 2W2KB 3A9WA 1YBVA 1HSZA 4JROA 1P45A 3BA1A 2H6EA 1HDGO 1AXEA 2HRBA 2Q45A 4GI2A 2VNAA 1LSOA 3ZWYA 1KVRA 1QORA 3E5MA 1Y1PA 1E6WA 1UP6A 4GKBA 1TT5B 4YJHB 2C5AA 4G81A 4GSLA 4FJ0A 5C5IA 3G17A 3WYBA 4K28A 1DLIA 2I67A 4R54A 5DN9A 4NMHA 1B8UA 3BMCB 1E6UA 1P0CA 3ZWCA 3B1FA 2HK9A 1O5IA 2BFOA 4K26A 3UW3A 5A04A 4LGVA 4CMHA 1EFKA 4HFJA 1LU9A 3CE6A 1DJQA 1QXSA 3JQAA 5TSDA 2D0IA 2W8ZA 3B20A 3RAJA 4MPDA 4BNYA 3PTZA 4U7WA 5CDTA 2G5CA 2YHIA 2R2GA 4IDDA 1N1EA 1JQBA 3AOEC 4CPDA 5CG2A 3CXRA 5I7FA 1D4FA 4OL9A 2DM6A 1DLJA 1E3LA 1QLJA 1Z73A 3ZU3A 5AXCA 1GPJA 1Z75A 2HKIA 2Y0DA 3DOJA 1XLTA 5THKA 3FWNA 4XDYA 1PEDA 3PPIA 5IXSA 3WQQA 1JN0A 3BYZA 4Y9DA 1G0OA 3DMTA 4CLXA 4BO7A 5FEUA 4M1QA 2LDXA 4CQMB 4WCFA 1GQ2A 1AHHA 1NFRA 2AW5A 2IODA 2X8LA 5G4KB 1QYXA 3GDOA 4BHTA 1C0LA 4PGFA 2BD0A 4YQYA 3LT0A 5B4VA 3KB6A 3PHGA 4NU6A 1Y7TA 4R4JA 4E2WA 1PGNA 1GPDG 4W9NC 1E1MA 4AJ1A 5A1TA 5G0SA 3FPLA 3WQSB 3F47A 3WYEA 3ON5A 4E6PA 4BNFA 2HMTA 3AU9A 4YACA 4JLWA 3SC6A 4DLLA 1JA9A 4XIYA 1TB4A 2X86A 4XDZA 3PIIA 2C2XA 3JQ8A 2X0NA 3RVDA 4YQZA 2B4QA 1LSSA 4TKLA 5FI5A 1DC5A 1U5CA 3DBVO 1NPYA 2OOSA 1BRMA 4KWIA 4CUKA 1K6IA 3C1AA 4R5HA 4RLSA 3OH8A 2QZZA 3TDKA 5F21A 1PJBA 4ND5A 5AVOA 2O3UA 2BFAA 1KVUA 2FPPA 3GA0A 3DZIA 3RC9A 3WGGA 5GZ3A 4PLCA 1YDEA 2HJSA 1IYZA 4YJFA 5IZ4A 4IXTA 5U9CA 2NVBA 1RKXA 2AE1A 3N74A 1UUFA 4D7AA 1GAEO 3IKVA 3MCVA 4FSHA 4JN6B 2BGMA 4P22A 3FTPA 5F5NA 2RCYA 3IUPA 3SC4A 2OHXA 4CMEC 4DTIA 4PG6A 4UUOA 1HLDA 3VKVA 4HXYA 1GADO 4RF4A 5JC1A 2HCTA 3C1OA 3D4NA 5DOZA 3LZ6A 1QYWA 3BHMA 4UUPA 1NR1A 3MJEA 4IMRA 4JJGA 3TL2A 3JQBC 3O38A 2HMWA 3DZJA 3DZFA 4FFOA 4CMAA 2D1YA 4LCEA 4CMGA 1F12A 2VZ0A 1RPNA 2W2LA 2DFDA 4B8WA 4RQUA 3EHEA 4J16A 1MP0A 5L3ZA 3GVXA 3INRA 4EDFA 3RBZA 4XQGA 1UZLA 5BNIA 4HKTA 4BNNA 2ZTUA 4DPMA 3S1LA 3VH3A 2X1HA 1W73A 2Y1CA 4IGEA 3ROMA 3IOYA 1Y8QB 2PGLA 4TSKA 4FB5A 1ZK3A 4M49A 4NHEA 2P68A 1ZVMA 1YL7A 4PZEA 4DL9A 1EMDA 1PWZA 3RUHA 5JYEA 3PDJA 3BMOA 4J4TA 1MG0A 1QP8A 1P3DA 1VKOA 2NVWA 3D4OA 3DMYA 3MJVA 4J2OA 4NBRA 3RUCA 3X2FA 4YPOA 1QYVA 3JD0A 2PKQO 4QUKA 4ZVVA 3PWSA 3OIGA 4J3FA 1UAGA 3GK3A 3JQ9A 4RLHA 1LX6A 3KETA 2ZQYA 1WXDA 2WJPA 2B5WA 3KBOA 3A4VA 2E48A 1WZIA 4IDGA 3GAFA 4NG5A 4BOYA 1GZ6A 3VPSA 3A14A 1SEVA 1C1XB 2UV8A 1Z74A 2HMSA 1HDZA 4JJFA 4JP2A 4DPKA 2JJYA 1LDMA 1X15A 4I1IA 1E3EA 3QWIA 2Q4EA 1LBEA 3KEQA 2WD7A 1IPEA 1LRKA 3JQAD 1NVTA 1B16A 4CODB 4IXWA 2BKAA 4I9NA 1BW9A 3DAGA 5KJ1A 4K6CA 1CWUA 3I9OA 2DU8A 3B1KA 5CG1A 3AM4A 3NDIA 2XAAA 1Y6JA 2NVUA 4GKVA 4BQRA 4BQPA 4U8GA 4A26A 2YUTA 3KTDA 1XU9A 4WLUA 4BV9A 4OIMA 2YY7A 3ETEA 3PYXA 5T6BA 4F45A 1LJ8A 1FK8A 5LDGA 4TROA 3JQDA 3KYCB 4L4RA 1HRDA 2ZCVA 2PZMA 1XGKA 1IZ9A 4MIOA 3JD3A 4DRYA 4F6LA 5F1KA 4PVCA 4J90A 3WNVA 3AM5A 3W4JA 3O4RA 2CDCA 2DBRA 3L6OO 3VDQA 3VZPA 4ZJUA 4IIVA 5TC4A 4BS9A 1QMGA 3AM3A 1N8KA 2OFPA 3JQFA 4EGFA 2R6JA 3F1LA 1SNYA 4QX6A 3WR5A 1U4OA 2PWZA 4Q9NA 4CR7A 1BXGA 4QECA 2FP4A 3PHJA 2NLOA 4FJ1A 1JVBA 2C20A 1HXHA 2X5OA 3PRJA 5KWEA 2VN8A 3WOHA 1ENOA 1LC3A 1Q0LA 2PK3A 4KQWA 3RC1A 4JP3A 1PS9A 3NTOA 4B4OA 2JD2A 3V2UA 2VT2A 3GPDG 3LF1A 5G0WA 3F3SA 5BSEA 4IGFA 4DIOA 1VJ0A 2Q1TA 2QRKA 4YYZA 2JD0A 4E5YA 1H0KA 3VVCA 2P4QA 5C7IO 4PRLA 1YH3A 4R1SA 4LN1A 1O9BA 3ZWVA 3DZBA 1DC3A 1T24A 4DBZA 1O94A 3GEGA 1A4UA 4M55A 4Z9YA 5JCXA 1ZNQO 4D45A 1LC0A 5DCYA 4C4OA 3AI2A 4JCOA 3I6QA 4I5EA 5JDIA 1T4DA 1GQQA 3OJOA 3OQ1A 3QSGA 4DIFA 2G0TA 2JAPA 4XGIA 2YFHA 3UAGA 3U09A 5HTOA 2YJZA 4K6FA 4GGOA 5CPFA 5JBIA 4UVEA 1LXCA 1LLQA 2VWGA 4TVBA 2BH9A 3DTTA 1LQUA 2GN9A 3PXXA 5CP8A 2AEMA 3A06A 3PFWO 4LSWA 3CIFA 4IUYA 2QG4A 4R9RA 3O9ZA 1H93A 3H5RA 4DLAA 1IHYA 1ZMTA 4ZA2A 3HDYA 1XSEA 4L9RA 5EESA 1SCUA 3RD5A 3WFJA 1A71A 3T7CA 1C3VA 3OETA 2I65A 4M86A 1ONNA 3DONA 5KJ6A 5ILOA 3O03A 1FDTA 2UDPA 3AWDA 4BNKA 4FFRA 4JBIA 1HTBA 1I24A 1T2FA 1K6XA 3H9QA 4Y98A 5I8ZA 4E5NA 2W2LD 4XR4A 1WDLA 1PZHA 1ZO8A 1V0JA 3OIFA 3QW2A 2PKQP 3KYDB 3MTGA 3V2GA 5BNTA 5B12A 3AUUA 3MJCA 4FC6A 1B8PA 1E77A 2HAEA 1M6WA 3P2OA 1P77A 1EK6A 1Q0QA 4HX5A 5EQDA 2BGLA 1A27A 4R5MA 2EP7A 5DBIA 4IQ8A 2WWRA 3H7AA 1VL8A 2CMDA 3QE3A 3PWKA 3JQ7A 1WAMA 2YDXA 3D64A 1W0CA 5L4LA 1RWBA 3L4BA 4FIZA 3GUCA 2O4UX 4NDNE 4OSOA 1ONOA 1Y81A 4CV3A 3GZNB 4JBGA 3VAZA 4NIMA 1GUYA 3DBHB 3I4FA 4LK3A 2D2IA 2Q3EA 4DA9A 2EKPA 4M8SA 4IJUA 1R12A 4RL6A 2ZTMA 4A27A 3AFMA 3AFNA 1Q1NA 1TT5A 1PS8A 1I33A 4Q3NA 4YJHA 1V3TA 3NV9A 4OSPA 1Q0HA 1YE3A 4WPGA 3L6DA 3NEPX 4BNWA 3BMCA 3RC2A 5JCJA 4BIIA 2FWMX 4ZRMA 3IC5A 2VHZA 4Y6PA 3WSWA 1Q2XA 2DC1A 1AGNA 2J8ZA 3ZWWA 1IOLA 4N5LA 1EBUA 1VI2A 1HDOA 5EINA 2AEJA 3JYNA 3M6IA 3P19A 4YJGB 4XB1A 4D43A 4E21A 4B8ZA 1B7GO 3GMSA 4PLHA 4IINA 3U4DA 1NR7A 1N7GA 3OSUA 4JJIA 1K6JA 1B15A 4FGSA 1DJNA 1PZGA 4YB8A 5L51A 4BGIA 1VC2A 2JCYA 4E33A 3TZHA 4R41A 4CL8A 3DAFA 3GH3A 4GX5A 1MV8A 4BGEA 3CTMA 1NAIA 1YXMA 4ZQGA 3RUEA 3ZDFA 2YV1A 2H63A 3U62A 4RDHA 3VC7A 3BTVA 5CPBA 3OEYA 4Z6KA 4D79A 1CEQA 4NU5A 3WGQA 3G3EA 1T2CA 1I2CA 5DP1A 1ZEJA 4EJ6A 1E5LA 3PVZA 4CQMA 2QX7A 3ONEA 4ITUA 5T8KC 2X0IA 3EGOA 3JTMA 1K3TA 4XWYA 3GDFA 3WTCA 4PG4A 1ZJYA 4BGUA 1HKUA 3SX2A 5JS6A 3UGKA 3HUDA 3H2SA 3ZWPA 2G17A 2V65A 5JAMA 3ZW9A 4U5QA 3RJ9A 5ENVA 2J5QA 2DBQA 3G1UA 2I6TA 3WBBA 2JCVA 1ISIA 4RZHA 1SB8A 4TRNA 4CQLB 4YT8A 1R4NA 1YJQA 3H5NA 2PLAA 1PQWA 4NH4A 4ONEA 1MB4A 2VUTA 2EJVA 4W99A 3GPIA 2Z5LA 3JQ6A 4ALNA 5JMWA 3FTNA 3MZ0A 1AHIA 2Y1DA 1PJLA 4R69A 2GASA 4YR9A 3RASA 4IMPA 3GY0A 2YFQA 3NTQA 2YW9A 1PJSA 5THQA 4IJWA 4XIJA 1GV0A 5KVCA 1BSVA 4Q3BA 5IAAA 4BO9A 1U9JA 4LVUA 5JLAA 4NBUA 5CEEA 2WDZA 1DIRA 2EIHA 5IXYA 1SOWA 1EVZA 4GWKA 1H94A 4YBZA 1HDYA 4HFMA 2CVZA 4ALLA 3VHRA 4PLPA 2O3SA 1EVYA 3PYMA 4OHUA 2AQIA 3INGA 3NKLA 3B70A 4J9UE 3DO5A 1U1IA 4CR6A 2PH3A 3IKTA 1HF3A 1Y8RB 4NBWA 1HSOA 1VKNA 3K73O 2CVOA 3IQDB 4GMFA 5KJEA 5TGDA 3X2EA 1LDNA 1GV1A 4I5DA 4QTZA 1ADGA 1C0KA 4Q3AA 1NVMB 1SMKA 1I5RA 4XD2A 4IS2A 1MFPA 5G0UA 4BO2A 2I66A 2ZTLA 3HADA 4TZKA 1JKIA 1DPGA 3E48A 5U4QA 3A1NA 4DC1A 4CM5A 4DPLA 1U5AA 1IHXA 4A5OA 1NHWA 4L74A 4UVGA 4ID9A 3PZBA 2I9PA 4FFNA 5TQVA 4E13A 4IS3A 4L75A 1ONPA 3TFOA 3CEAA 4D41A 4GX2A 4WLFA 2J5RA 4WCFC 5ITVA 4HY3A 2P5UA 1HE4A 2PD6A 4DWVA 2Y1OA 1AXGA 5DCUA 4YRAA 1DRUA 4HADA 4P4GA 4FBGA 1IPFA 4L4SA 3VPHA 2FSSA 3E9NA 3FNHA 1FMCA 2DUWA 1GDHA 4DYVA 7ADHA 3AU8A 1SAYA 3NYWA 1PL7A 1UP7A 2Q50A 3WSVA 1ML3A 3JYQA 4IZHA 5A06A 1GYRA 3NT5A 3VOSA 1E7WA 4EW6A 2Z1MA 4Z9XA 1U7HA 5IDXA 4UVDA 1JKFA 1A72A 2XXJA 4DLBA 4S1VA 5CDYA 3GZ4A 3RJ5A 3WLEA 5CAEA 4I5GA 1YVEI 4E0BA 3W4KA 1GU7A 3I4CA 4E3ZA 4O6VA 4J1TA 4EUHA 3E82A 3GG9A 1X1TA 4CM7A 5DF1A 1KVQA 1C1XA 5JCJD 1G6KA 3QIVA 3F6YA 4DQUA 2Y1EA 2JFFA 2VYNA 1EK5A 1X7HA 1XR3A 5H82A 3GEDA 4XYGA 3H9EO 3M1AA 4CJXA 3MJ4A 5U1PA 4WECA 5FI3A 4BNIA 3PQFA 1B3BA 3FR7A 3V1UA 4WNCA 1BHSA 3A28A 2JHGA 3I1JA 3UCFA 4OGWA 1UR5A 3CKYA 4GX1A 2AMFA 1WMBA 3C7CB 5KKAA 3P5SA 2CDBA 3N58A 1PJ3A 2HU2A 4BNZA 4PLVA 4D44A 1WLYA 2NU7A 2BI7A 2OL4A 4ILKA 9LDTA 3LVFO 1K2WA 4HFRA 3STHA 3TFQA 2YV3A 1QG6A 4J0EA 1F17A 1B8VA 3ONDA 5B1YA 3AY3A 4I5FA 1J5PA 3ZU2A 3WYCA 1ENPA 3S2IA 2GYYA 3DBRA 1EVIA 3ICCA 1NNUA 2UUPA 1BWSA 3UCEA 4KP7A 4CQMD 2GSDA 4PZCA 4D3DA 1UXKA 4ND3A 1U3VA 2GRAA 4MIYA 1ZUD1 4DYDA 2VUSA 3UUWA 3GGOA 3FWZA 4CUZA 4F3YA 1E1LA 2Z95A 3ENNA 2I3AA 3MWEB 3Q0EA 1LUAA 2O50A 3PFFA 1CJCA 4E12A 5GY7A 2GZ1A 5DULA 1GR0A 3NJ4A 3QWHA 2Q49A 4UUMA 4NI5A 1M66A 2PZJA 2CF6A 3JQEA 4MP8A 1U7TA 3WMXA 1RYDA 1DFHA 4FFMA 1HE2A 3WLFA 3ZV3A 3JQ9C 3H2ZA 2AHRA 4NFYA 1GZ4A 2VHVA 5A9SB 3GHHA 2VRCA 1LNQA 1YJ8A 3IIEA 4Z9FA 3U49A 4YAIA 1P9LA 3ABIA 2O7SA 3HDJA 4BNLA 4R9SA 2H1SA 3SLGA 4MVJM 2BELA 5GZ6A 2VTEA 1ULUA 4BNHA 1VL6A 1C1DB 3ASUA 5EN4A 4TKMA 5DNAA 4UVHA 1ZXBA 1OI7A 3D5TA 3ZHXA 5B4UA 1RM0A 1GL3A 4DMLA 3OQ6A 3V2HA 1EE9A 4GAEA 3ADOA 3BTUA 3D0OA 4HBGA 4DVJA 4EI2A 1P44A 3QHAA 2BLLA 2DPHA 1HDCA 4A03A 2SCUA 1FDVA 3PJDA 3Q9NA 4R1TA 1XELA 2IXAA 5AYVA 5HBRA 3VPFA 4BMSA 4PN3A 4ZN6A 2BRUA 2VCYA 1L7DA 3VH1A 1Q7GA 3GFGA 4UEKA 4Y67A 2FR8A 4JXKA 5IFLA 1GCOA 4Q3DA 5TIIA 2GR9A 4BNXA 5JY6A 3JD4A 4J7XA 5TRTA 4YCAA 4RGBA 4B4UA 1KEUA 1E1NA 4I08A 1AN9A 3PQDA 1F0YA 1HYGA 1A9YA 2C29D 2VNSA 1TT7A 1WVGA 3ZN2A 2GN6A 5MDHA 1E3IA 1NXQA 1PTJA 3GNQA 4XR9A 1FJHA 4E5MA 4OM8A 4MO2A 4D0SA 2JL1A 3KYDA 1XCBA 4TRRA 1DIAA 1NQAO 1NVGA 3GLQA 2ZYAA 3SLKA 4C7JA 4JK3A 3ZW8A 3WJAA 4J0FA 4K1LA 1X7DA 2A35A 1JW9B 5JO0A 5DP2A 3UCXA 3WJ7A 4O0LA 1YL6A 6ADHA 3HFSA 3RUIA 2D59A 4XJTA 4ZU3A 4RPGA 2VUUA 3WIDA 4II2A 4R3WA 5KJCA 5DDIP 5L7TA 2WMDA 2PNFA 4EUEA 5KKCA 3FNGA 1XA0A 4XB2A 3VDRA 1XG5A 1I32A 4BV8A 1WPQA 1YL5A 4Y6RA 5ITWA 5JDIC 1RM4A 4WGGA 1F06A 4FFPA 2P2SA 2UUOA 3QVSA 2WTBA 2Q1UA 4FD3A 4WK6A 4PLTA 3W8EA 4IJKA 1P1IA 3PQEA 1BDMA 1IULA 1Y5MA 3AK4A 3BHJA 5I8WA 3KUXA 2VYND 4W4TA 1I3MA 2CF5A 2UYYA 1HDRA 1V3VA 5J23A 4D3FA 3TJRA 4AJ4A 1J4AA 2QHXA 3UVEA 5A5FA 2IZ0A 3RFVA 1O89A 2PD3A 2HRZA 1GZ3A 2OMEA 3RSHA 2F00A 3K2BA 4Y8VA 3EAGA 1CETA 1N5DA 2AG8A 1PZEA 3OF2A 3RU7A 3QWFA 3KM0A 4CM1A 4YJGA 5HRUA 4MOWA 2VWQA 3C7AA 1R37A 1WZEA 4Q3EA 1ZZEA 4QT0A 1R0LA 2GF2A 2Y99A 3NUGA 1W6UA 2YQ5A 5A02A 1KOLA 3HSKA 3PJGA 4H7PA 4ZHSA 2WD8A 3JQCA 3U3XA 3WGZA 1J49A 3F4LA 4LCJA 3SJ7A 3LQFA 4H3VA 3QQPA 1T1SA 1UZNA 1LDGA 3ENKA 1DIBA 2V6BA 1YONA 1QRRA 1I01A 4L8VA 2GPTA 2H9IA 3FI9A 2POQX 3E5RA 3VH4A 1VSVA 1EUZA 3FSRA 4MVJG 2QIOA 2WSBA 1D3AA 2QQ5A 2FPGA 3RC7A 3E03A 3LC1O 3GFBA 3M2PA 4IQ0A 2HDHA 1NYTA 5K0ZA 2BFMA 4BO5A 1DFGA 3QY9A 2E82A 4B3IA 4CMIA 2O4CA 1VJTA 3L4BC 4BB5A 3E1KA 3F5QA 5I9LA 2X9NA 3RFTA 2HLPA 1KY4A 4CQLA 4AFNA 1HLPA 4KOAA 2CZCA 3Q9UA 1S7CA 2OORA 4UREA 4CM8B 2PGDA 2EHDA 3BMQA 1DIHA 2VRCD 3Q2KA 2VRBA 1YRLA 3WIEA 1E3JA 3TQHA 3DHYA 2TMGA 4XRRA 1UXJA 3ZU4A 3JYPA 4U0KA 1E3WB 1ZSNA 4FGWA 4GWGA 4J4HA 1KEVA 3KV3O 3QVXA 1G1AA 1I0ZA 2B5VA 2Y66A 4P4NA 1YKFA
chains in the Genus database with same CATH superfamily
3NM4A 4I4CA 3IHTA 2C0CA 3H3FA 3I9MA 2XXBA 3KPWA 4E5DA 5IHPA 5IZCA 1Z13A 5MGNA 1JMYA 4LGYA 3U6BA 3TQFA 3RSFA 2GYUA 4YP7A 4JBLA 3E0XA 3PF8A 4AJEA 3EMBA 3VNUA 4AC9A 1SQFA 2V7PA 4AQ7A 4TXHA 2EEPA 3OD1A 1ZM2A 4CFSA 1C30A 1XQXA 1Y8RA 2BL4A 4PRZA 5EOVA 2VVTA 2AD5A 4Q3CA 1SU7A 1E2HA 4ZAGA 2HMAA 2A6PA 5ICEA 4BVKA 2O2YA 2QYOA 4HEHA 2ZS9A 4I7EA 4P3YA 3ZDAA 1L5VA 3CRQA 1D1QA 5H9VA 3ZH2A 5DSTA 3ZV6A 4ZMBA 4TYYA 1FP4A 2AG1A 3RUDA 3T5DA 2BGGA 3CT4A 4Z7JA 3FPSA 3C3MA 4JZYA 1V4BA 3KOWA 2O2EA 1V7CA 4GPD1 3ZCQA 1BX0A 1C7QA 4Z99A 4N0EA 2DHQA 1JFLA 1MGPA 2UYGA 1QOZA 3NHMA 2N47A 3ZY6A 1L9XA 2PQ2A 4FFLA 5ICMA 3M5PA 2CB9A 1OR8A 5LQSA 1Y1KE 3L3BA 3R20A 1IQ0A 5I48A 1G66A 4R8MA 1JHAA 3EISA 1ISGA 1YBFA 3HN2A 4P2BA 2FY8A 3WYNA 1P1HA 2ZIXA 3QEJA 2ZQZA 1Z5OA 2BFNA 1J20A 1VL0A 2VZEA 3JWHA 2R44A 4B6OA 2FSVA 4K9KA 5FLYA 1AC5A 3L4KA 2JH3A 1N2EA 2XVYA 1EAMA 2DLNA 4XB6B 1WB5A 1VJGA 1Z4JA 2B0CA 5CNKA 5KKNB 2CY0A 5G4LA 2Y1FA 1G20B 4OUDB 3CX7A 1T3SA 2MSKA 1JECA 2QI9F 1KDYA 2P2YA 3PGJA 5FLKA 3TUZC 3U7FB 3SE0A 3VR0A 1G21E 1QS0A 3DEKA 1GUDA 2QAGA 4ZCSA 1WHTA 3OZFA 2CFSA 4DT1A 5CFNA 1XZNA 3OICA 7AT1A 4P7KA 2ZB2A 5J2UA 4RDIA 2Z3ZA 3OE1A 2O3QA 4JI0B 4XWOA 4LMBA 4ZVKA 1YTLA 5G3ZA 5T6MA 3THYA 3ZD7A 1K0FA 2MMGA 5CLFA 5KTMA 3I2KA 2ZJ4A 3IE2A 4IIJA 3EJ6A 3N70A 1CUFA 1ODTC 3IEKA 4KQEA 4MVJI 1C7ZA 3KT6A 3M34A 4FLFA 2XMDA 1JEQB 1TK3A 2GCOB 2R6ZA 3DHNA 3N2NA 3GW8A 4LNUA 2ODQA 2PBRA 5C35A 4QJBA 4WZAA 1VRWA 4PFKA 2AQKA 4HWKA 3NOXA 4B6RA 5I4IA 5L4NA 1Q20A 4W7SA 4MDFA 1N5IA 2A4KA 3ANMA 4M89A 4BKOA 1E2MA 1ISMA 1URPA 1H2EA 5C3MA 3ZTYA 4G8BA 1DG1G 1KJYA 2TMDA 3M6LA 3GRUA 1HDEA 1R0WA 4O8CA 4E1VA 4TZ6A 3EVFA 1W8DA 3JSAA 1I2DA 3BDAA 4CCYB 1MG5A 3U9LA 1AA6A 1CZUA 3AHFA 3G5UA 4YJ3B 3OF3A 4ZT2A 2AN9A 1PQPA 5KTOA 1B6SA 2ZBFA 4GP9A 1EWVA 2ZXEA 1V47A 3MMXA 1A1SA 1ORVA 2XVXA 4YAOA 3MLAA 4NK5A 1XMSA 2JC3A 2OXFA 4FPXA 3X1JA 3DXXA 3H2YA 1U04A 4JNKA 3VU9A 4AICA 3BWVA 4DJFC 1Z07A 8GPBA 4N54A 3P2KA 4FS3A 4WA8A 2NZ2A 3EODA 5IKEA 1CR0A 3FNIA 3K94A 4CEHB 4U6SA 2ZZMA 3QKIA 2C5EA 3O9MA 1XDSA 4URFA 3PT9A 1PGPA 2ID7A 2BDTA 2BI8A 2WAXA 3DAHA 1N0UA 3AF5A 2F64A 3IUBA 3MSCA 4UE2A 3PI7A 1QIKA 1QHYA 2M9MA 4YH1A 1BYIA 1OTXA 5JG7A 3ZOKA 3WMEA 3BL8A 1YUMA 3NHPA 2Z2KA 2MYUA 4EHKA 1RBYA 3QYFA 4FMDF 1ZXXA 4TLMB 4BLUA 2L18A 1GNVA 3LLSA 2QW0X 1U0BB 2NV6A 2W9XA 3RI3A 2Z4TA 3Q3JB 3UMFA 2BHNA 5DISB 5B1SA 3DD1A 1USUA 2WF7A 1AT1A 2PLNA 2WWFA 4JKOA 3ADDA 1AKTA 1Q2UA 1UJ4A 1ZRHA 2ZROA 3FH0A 4HDSA 1S2IA 1JDNA 1H2WA 4V24A 3AR8A 3K31A 2XOXA 1U0OC 3G13A 2ZB4A 4J7UA 4LECA 1GNLA 4HMOA 4P80A 4J0QA 4DADA 4BCBA 1CIVA 2ZSAA 4EFNA 3AYZB 2EQ5A 1ZCJA 4IIHA 4BC1A 3GARA 1EVQA 1PBNA 4GICA 4HC4A 2E4XA 4I0WB 2D1TA 3RBAA 3WGTA 4D9CA 5LNK6 3QEAZ 2EW2A 3DEJA 2CUKA 4YLGA 2AL7A 2QTNA 5EUQB 1USVA 1Q3TA 3KLPX 4H7EA 1C80A 3CWCA 2NUTA 4L5IA 4EG6A 4E70A 4MI3A 5KTRA 5LA6A 3MRSA 1ONSA 4RZSA 5HX7A 3MHPA 4OKSA 1CD5A 3IILA 4HQFA 3BA6A 3HXMA 2VTDA 1VCOA 3GVCA 2BFEA 3WIBA 5DX1A 1JKJA 4WH0A 2A5YB 3JQQA 2JK0A 2RFLA 2YXEA 5KJFA 1DJOA 1U2GA 3LX6A 4JODA 1SG9A 1D2AA 3HCBA 4FDVA 3QEKA 2CZQA 1CBUA 3DWGA 4QUHA 3VI3B 5HGJA 2CXXA 1BGWA 3AHHA 4NECA 3THWB 5CFRA 3T6KA 5WRFA 4HAYA 1NW6A 1TK2A 2OV2A 3C2QA 3RQSA 3JRWA 3IEIA 2Y0PA 3NJ8A 3VR6D 3ZJYA 1CY2A 4HLCA 5IAKA 3ZHBA 5K3EA 1AV7A 5JH7A 1ZG3A 3HFJA 3G1WA 5DI9A 1LPBB 3LWBA 5AK5A 1N7HA 4LYDA 2JFXA 1JDTA 1FXUA 1RI5A 4YIHA 1I36A 3S8MA 4D8WA 4YP5A 4BFCA 1YNSA 2ODEA 3DFZA 3DCNA 1XTKA 1MX9A 3VTFA 1T5SA 4AU1A 3SQOA 4R16A 4ZVUA 1E5VA 1PP4A 1NQWA 2DF8A 4WUVA 1N2CE 2J4DA 4YJ2A 5DM60 5I7EA 3WKDA 4TZTA 5HIIA 1E3SA 2NTEA 2AFHA 5LQUA 3DOOA 1U90A 1LWOA 1V48A 2EX4A 3P9SA 4QQ8A 3VNBA 3BXHA 3PXDA 4NS4A 3EVCA 1PRYA 5TJHA 2FFBA 3A6KA 1E9SA 1WE2A 3KSZO 4P32A 2WWGA 3BMXA 4B74A 1DQZA 3OFSA 2CFRA 1JG2A 2PR2A 4I55B 5IAGA 4QDUA 1VYUA 1Z47A 3EK2A 2JAUA 3ECAA 3JWJA 4KV7A 2A5JA 1FMJA 2X2OA 3AEUB 1LY1A 1V1MA 1C8LA 2JLQA 4RHFA 2QJWA 5IW8A 3RO7A 3R3XA 4E1AA 4GPTA 1E7MA 2JJ8A 3ZHYA 4BVLA 3C3XA 4XRGA 4OLAA 4BMCA 2BR4A 3K0CC 4C7MA 2C88A 4AY6A 4I9HA 4JX8A 5FR2A 4X8MA 3ER8A 5SYNA 1MVNA 1AK9A 1RRKA 2B6HA 5J58A 1QWOA 1L8AA 3DBOB 3O8LA 4Q05A 2WYWA 1ZM7A 4QA9A 4EY8A 5AVTA 2WI8A 1KA9H 2PRKA 4IF4A 1O9HA 1JAYA 1Z88A 2BISA 2EYUA 4NWIA 2ZRPA 3DCYA 4MRSA 1FP2A 2LKDA 4WVLA 4UXHA 3FXAA 3I32A 1FDIA 1SH7A 5EI5A 3IERA 1XKXA 2HX1A 3RIMA 2YC2C 1TVKB 3HO6A 4MWOA 3SAJA 3GDHA 3HVIA 4H4EA 1BE0A 2HA2A 2ZUDA 3GGJA 3RRXA 1T2VA 1FW8A 1NW8A 4G5OA 4LMPA 4YFYA 1VFNA 1DUVG 2FN7A 2E6KA 2OKGA 1OUMA 1SO8A 1J00A 2AVDA 4BZPA 5LMUB 2OCBA 3AP1A 1LA2A 1T9HA 4OI0A 5IH7A 1TU4A 5AHOA 1VI5A 4O0MA 3P4YA 3F90A 2ZJFA 4J1SA 2COKA 4KFSA 1MB2A 1T9DA 2X9GA 1JBQA 1YVDA 3HJUA 3WZMA 2REQA 2X2FA 4JLOA 2Q07A 2Q62A 1HDXA 1R0YA 1RYEA 1EFAA 3A1VA 5IBCA 3FSEA 4F6RB 3PJEA 1B41A 3V33A 4O29A 2Q46A 4J2TA 4PICA 1NI4A 2JGLA 4B9AA 3OEWA 4QYWA 4ZZ1A 3QMWA 5JZOA 3D4PA 4C08A 3O7WA 3QVTA 2O20A 3PR1A 5ER6A 3ZE2B 4J43A 1O0CA 2YNMA 1MJGA 4DIBA 3LC7O 1IBLB 1F2DA 1LJUA 2ZYIA 3DMTC 2ATXA 4EJMA 3A1DA 5EIFA 2AMJA 5B1HA 4RTKA 3OLWA 1OH8A 5L3QB 1E4EB 1NAHA 1NP3A 4KIJA 5LDHA 3MOIA 2BW0A 4UXIA 5EGSA 3AVYA 4M54A 2Q3FA 3KQSA 4ND7A 4HVTA 4C9BA 3JVIA 1FW6A 4DJJA 3L92A 3UAWA 3FTQA 1JEEA 1XRJA 3HSYA 1IRXA 4GE3A 4LYGA 2QP9X 2PV7A 4RABA 5E7IA 2O5CA 1OBHA 1XZLA 3B9QA 1U0JA 2IEDA 3EQ6A 1D2MA 1CLEA 5DM4A 5F23A 3PUJA 3ROKA 1YI1A 3ZWMA 3Q3CA 3DHVA 1XXHA 1N92A 2AVNA 5FTJA 4CMJA 5CFMA 5L40A 3UPUA 3CO5A 1PU2A 1XPUA 2WA1A 3QBVA 2PQ0A 2XBUA 4C07A 3I9KA 3ZZ0A 3RIHA 3PPWA 2HF8A 4REOA 4QXMA 2EJBA 2OZLA 3ZDRA 1ZOSA 1QIMA 3RS9A 1IBSA 1KC3A 4DSOA 2QL5A 4HXGA 3TFWA 1RHUA 5LP6F 4XGRA 1PKXA 5HUHA 3DFKA 5JYBA 5K6AA 2JBHA 5JJKA 1G9SA 3R3SA 1RJGA 2O5VA 3PK0A 3IVMA 4GR5A 1H22A 1R0CA 4EKIA 5C7OO 2X76A 3W5UA 1LZLA 4DQVA 5K0FA 1J8QA 4WHMA 1I3NA 5AUPB 4CEJB 3WGYA 3FPBA 3K0AA 1UBJS 2PD4A 2X2PA 3QENA 1OFGA 2IIVA 1BEUB 1A04A 2XYGA 3BQNB 1WW8A 2BBTA 4JWTA 3RRMA 1C9MA 4F86A 2QLLA 8ADHA 1OAOC 2H2WA 1AM4D 4WCDA 1H0RA 3T9CA 1K7XB 2NW6A 5HA5A 2B1IA 3JCZA 4HAXA 4L3WA 4GHWA 4HT3B 2Q1SA 4W7HA 1ZOPA 4EMBA 5F73A 3IP3A 4NRDA 4F2WA 1NJ6A 2Z5GA 2GN4A 4JQCA 5H83A 3DAOA 1KJZA 3IAEA 4Q9DA 1Z4MA 4F1JA 1VB3A 1PR3A 3FKJA 1QKKA 2BTQB 1S9HA 4UNQA 1H6CA 2QROA 3FUUA 2E4AA 1W7AA 2EX1A 3L46A 3LO8A 1GKIA 1T91A 3O4VA 1U3TA 2QR2A 3CF0A 3P2YA 1Y7PA 4G5HA 1J33A 5FTNA 5B6IA 2CKDA 4FQ8A 3VZRA 4FNMA 4WL0A 4P4SB 4EFLA 4IICA 3KTOA 4JJ7A 5JC8A 1LWNA 4MRVA 2HLNA 4GT1A 3W1WA 3KXIA 4F4JA 2Q0QA 4A2CA 1V5WA 1NX9A 3O74A 2QLNA 4GFDA 3RS4A 5BQXA 4HCJA 2QD5A 1LLDA 1ACMA 4LC0A 1WOMA 2Y0BA 4PN7A 5A5DA 3BIOA 3IAS1 4NTZA 4QYMA 3WMGA 1FUEA 1GVNB 1OFIA 1M6VA 2P35A 3ELYA 1W46A 1PEYA 2O0LA 1PFGA 3UWDA 2F2TA 3C8UA 1PK8A 3ZGVA 1DCTA 3AOGA 1GSOA 4DDUA 2H8GA 1ZW1A 1HEUA 2VO1A 4UCFA 3LD9A 5IYZF 2C2ZA 1I1HA 4JGGA 3V3TA 2X58A 1OWOA 4OUKX 2C2GA 1XJ5A 2I91A 4K0KB 4AKSA 2EU8A 2GHTA 3TX6A 3DMRA 5JAOA 3U1VA 5G1PA 2COUA 1PE0A 5D6NA 2C2MA 4RIEA 3GJQA 2QTLA 4WY2A 4BMDA 1KSGA 4UDNA 3OJLA 3EF1A 4Q4DA 3D1VA 4B3FX 2H1WA 4N3GA 2VJMB 3RVJA 2YZ7A 1KZ9A 4FONA 5K8VA 2NX2A 2VDQB 3EDOA 4Q6BA 4QUJA 3KVOA 4RK7A 2E4UA 2GX6A 4RDCA 3GJSA 4ND6A 5M29A 3E9QA 3QXCA 4TMZA 3AXSA 3V8BA 2AYYA 4PC6A 4Q0MA 3UJ3X 4CFYA 2Q28A 1ZNXA 3K0HA 1JH9A 1U80A 3JASB 3PNOA 4X44A 4TUYA 3IR5A 5EJ2A 2CDNA 2A9FA 5CK5A 3L9WA 5E6RA 1UZUA 1Z36A 1EH5A 2CXNA 1NPDA 2AYXA 1AQYA 2EYQA 3A70A 3DQPA 3GRPA 3GT3A 4KDFA 5GJCA 3MCUA 4CYMA 1MZPA 1ZU4A 1CDOA 4FGLA 1PUJA 2W22A 3PEFA 4I1UA 1V11A 2ONCA 5IJ0B 4CEIB 2NQTA 1Q44A 1OY1A 4H08A 4OU4A 5EIAA 2WNSA 3E8XA 2P2GA 3MT9A 4C7BA 2GJSA 2B4YA 1HT2E 2K2WA 2X7HA 2JGMA 3AR4A 1DHRA 3ORFA 4Z2YA 2VHXA 4Q03A 2BDUA 3IAHA 3IPAA 5FF9A 5HBGA 3KXDA 5AM4A 2QXTA 1QFMA 3U6KA 2FW0A 1IJKA 2OENG 3ITDA 2VF4X 4JQYA 4C0JA 1E5QA 3ILHA 1GGKA 2HA0A 5GTDA 3J81k 5AP9A 4EG5A 3H2GA 4MVXA 2KBFA 1QFSA 1SQGA 3N2YA 1DCMA 3VKUA 1ZS9A 1XAJA 4RVFA 4TM8A 5HM6A 4L5JA 1XU4A 4QTUB 2FB9A 3TRIA 2ZJ5A 4AJKA 3ZWAA 4XLLA 3LLUA 4GI1A 2A1UB 3PYLA 2PZLA 5JNVA 3EGCA 2OLKA 2NO4A 4XM2A 1RPZA 4KQ9A 2ZRKA 4FX2A 3Q8LA 2B30A 2HPVA 4M8IA 3HP1A 3MJSA 4LZWA 5LB2A 4AXBA 5DYIA 3DEYX 4LGCA 3TBHA 1NSTA 2OOKA 4L8LA 3QXHA 4XLTA 4TMFA 3ZX4A 1N78A 2G76A 4PGGA 1GZ7A 4RJ2A 5AKHA 2HQBA 1WHSA 5DCLA 1DEAA 4IHJA 2FOIA 1CRWG 4Z0HO 1Q0UA 5CT6A 1G5RA 2VJDA 3DBLB 2F1IA 4Y7DA 5LQJA 1YGPA 4NZPA 2X1MA 4R1PA 5DTIA 5SYAA 2AWOA 2X7JA 2IOYA 3PE4A 1PSWA 3QBDA 4ZOLA 2BBOA 4LSMA 4MV1A 4DNFA 1R9JA 5JQGA 4XFDA 5E2BA 4UTXA 1IZ8A 5G1OA 4ZYVA 1CVIA 4J6FA 3VR2D 3DVLA 3MS4A 2O48X 2I76A 2IT1A 2HZ7A 2C07A 2QLFA 4KODA 4LHYA 2RKBA 3T4PA 3HJBA 1E5DA 4OMUA 3B3QA 2IYFA 2JFQA 3W6UA 5EJ4A 1SCIA 1R4NB 2P9QA 2WHYA 2ZATA 3VH2A 2P69A 4N1AA 4WLEA 4UD6A 2VOEA 3CLSD 4ZCRA 4TX1A 1FXWA 4J1NA 2AEFA 3TL6A 1NE2A 2W2MA 2WG0A 2X8JA 3R6GA 4Q4HB 1W25A 5HKKA 3CWZA 3F3YA 4KJZA 4D02A 5IDVA 1FFGA 1KEZA 1UBOS 3V7WA 4B0OA 3N7UA 1II0A 4MICA 1ACLA 2E37A 3FHCB 2J9FA 2JJQA 1MV5A 2PVSA 3CX6A 1UC5B 5C80A 4BLRA 2YJNA 4P7BA 1NI5A 3OKFA 1TCUA 1BU8A 2BFCA 4NOLA 2IH4A 3R7LA 1BMDA 4B3CA 2EOAA 1KZ4A 2F9FA 4EB6A 3ONFA 1IOWA 1S2OA 3RU9A 1C41A 3UKOA 2WNHA 3N75A 5CT9A 3SD7A 3QSYA 2QPOA 3C15C 1Y8ZA 3WLPA 1FA9A 1XVTA 4OA8A 4X85A 2HO5A 4GP7A 1QB7A 3DMFA 2O06A 1YB4A 1AURA 4JJ6A 1OHHD 4GMHA 4BO0A 2DTDA 1M6EX 2ACWA 3E9YA 4US1R 4K8OA 5I8PA 3FTDA 4DCMA 2WSSA 3HBMA 5GONF 4Z1OA 1U7WA 4GL4A 5PNTA 3G5TA 3DTVB 3UJ7A 3F74A 4BX3A 4XWAA 1SVOA 5HPYB 1CQJA 3IJRA 1M72A 2JGDB 5DLQC 1QMPA 4D8XA 3Q3VA 2A3NA 3GIDA 4QREA 3AKCA 5DN6D 1CNEA 1A8HA 1EXVA 1PR9A 4GC5A 4HAUA 4O2AA 1MNQA 5KVQA 1GQYA 4CXMA 1Z3IX 2XJ4A 4F5DA 2FG5A 1VJ1A 3OBBA 4MVJA 3VR1A 4NJMB 3CJRA 4KPYA 2YJ6A 3NHJA 3NRJA 1IOZA 4V2UA 4U63A 4XD7D 4ZVTA 1JIUA 1JTFA 3B85A 4PINA 2IYEA 1J8VA 2CLDX 3BIJA 2QRVA 4RCYA 4NYJR 2YMLA 3TLKA 3OO0A 4DXHA 3EGDA 4XPIB 1YZGA 2FF5A 3OZVA 3AIKA 2DUJA 4ZP1A 1V16A 3IMCA 3QFTA 4EW1A 2J09A 1LDBA 5KAMA 2C57A 2W8BA 4KNWA 3TBKA 4BFVA 5JZVA 3E9CA 3QVLA 4MW9A 3C3CA 3ZTWA 2RJ3A 1NE7A 4O4HF 2OYSA 3DEIA 3AUYA 4V3CA 2YIDA 5LLDA 4R51A 3OUUA 1KPIA 4TL7A 4J2HA 4LY0A 2I3GA 2B83A 5BOSB 1QGOA 1XKQA 4KHZA 4M0KA 3O31A 1CCWA 1IBRA 3NHSA 4XM1A 3RVPA 5BSGA 4KXWA 4YPVA 2ISQA 3HCEA 5JJLA 1SQ0A 1WDWB 2AXEA 1HLFA 4MUFA 2J0QA 4AN0A 1RR6A 2O3RA 3LYHA 5F2EA 1JEYA 2VOJA 1AF4A 1T0BA 2G5GX 2VK8A 3E3LA 3FTCA 2HM7A 3PTLA 3ETNA 5CAEB 1DDIA 2J1LA 2V7EA 4OHKA 5EA2A 3SOZA 2O8FB 2ZSHA 3T5MA 1JT9A 2WKQA 2FEKA 1I4DD 3KSDO 4K81B 2YWJA 4BLVA 4CG0A 1KQGA 3VR3A 4NCJA 1JHMA 1O5TA 3BZBA 1RM5A 4GLOA 1FRQA 2BFWA 3DF7A 2ZI9A 5DASA 1BXKA 2R00C 4CCWA 5CIYA 5AKIA 1POWA 1TJ4A 2BVNA 2OBFA 1GFSA 3K5IA 3U3OA 1NLZA 3KB8A 4DQLA 4ETWA 5I7VA 1E7SA 4UTOA 1I2AA 1EWRA 3G7NA 4I4LA 3KLOA 4XUEA 2SHKA 4AO8A 2NUAA 2J3HA 1PCXA 3GL9A 4K7JA 5KCZA 3QX8A 4HZIA 3B6KA 1AY0A 3GFRA 4L7QA 1KYIA 3RT9A 4WKOA 5IDQA 3JYLA 1O7JA 2ZDHA 1QWSA 2ZWMA 3LHSA 1F8GA 3OG9A 1WD7A 1ZKMA 2OP0A 1VGVA 5FBWB 3RCBA 2DR2A 1W44A 1NXTA 3ESAA 1LI4A 1C1HA 2AG5A 1RZRD 1NOKA 1HEIA 3BK2A 2OT3B 4DUYB 3DC2A 1GU0A 5BSKA 1ADFA 1DOHA 4LF6B 3M5WA 2A59A 1MW9X 2PT7A 3WJ1A 1IY8A 4MGEA 5IVDA 4MARA 1EI9A 3IL2A 2JIOA 4NONA 3GWZA 1Q57A 3O3NB 1ULHA 4UPVA 2X9VA 5EQTA 4FT4A 4K03A 3VHXB 3ZQKA 1X42A 2IHVA 3K9FC 1HH4A 2RB5A 1QTIA 3OCUA 2UVQA 4YEDA 3PZRA 4WXMA 1JDJA 1NF9A 2EGHA 3P96A 4W9NA 4B2PA 4WOJA 4EJ0A 4URWR 1F0NA 1H3NA 1BC5A 2RHGB 1U81A 4N5IX 3AIMA 1E7RA 4MP3A 2I1WA 5A7GA 1IWOA 1NDHA 3MXOA 3UYLA 4JJ8A 4RPHA 1JDBC 3DTYA 1N6NA 4C0WA 2J48A 2MSDB 5D2CA 4ZJPA 2I54A 5DTQA 1GPNA 3EGVA 5EJEA 2JI9A 3JQRA 3FDJA 3P9NA 4QXQA 2QL6A 2ENUA 3CW8X 1ZD8A 1YWGO 4HN9A 3Q3IA 5CMLA 3VNAA 4EABA 2J0SA 4XZ3A 3LWZA 4HDNA 5JNSA 3UGJA 2CBGA 1W59A 2XNJA 4CMBA 4F60A 2W42A 4L3VA 3JQGA 3NAQA 3WYAA 2SKCA 2WICA 2X5KO 3K6KA 2PTGA 4RSGA 5BQOA 4YRGA 2YW2A 3H8JA 1L5HB 4A15A 4FZ3A 3OFKA 3C24A 1UPFA 2ZI5A 1GZ5A 3ESDA 2IOFK 4QASA 4XUGB 4B6QA 3ZNPA 5FLEX 4YJ3F 4IDNA 3BD9A 1QVRA 5ECDA 4C0KA 4POOA 1T4BA 1ZJ4A 2GTHA 4OH1A 1I14A 3MJTA 3F1KA 1A9ZA 1CUYA 3W9UA 1H1LA 1LCIA 3AKDA 4CMEA 4FFWA 4MPTA 1ZIOA 2CLEB 3IPRA 1Y42X 2VYFA 3C3KA 5ERGB 3GHYA 2MSCB 5KYUA 2AZXA 2NUPA 2XUQA 5K3OA 1XRPA 5C46F 1HE5A 2IOQA 4XYLA 4Y6GB 2ONKA 1KU6A 3TSAA 1RHMA 1KP3A 2R8BA 3L5OA 1R8YA 2IUFA 1PL6A 4PAWA 2AIRA 3EZLA 1VTKA 5EJAA 5F12A 3T8YA 3TXAA 5BOVA 4CM4A 2J3KA 3HB5X 3WK4A 2D7DA 1M6YA 3DOUA 2GCEA 1H1TA 3EC7A 5DO9A 4Z1MD 4HI0E 3WBKA 4A16A 2Z3VA 2RI6A 3U0BA 4DLKA 1F20A 5DGIA 3WKCA 1SCAA 2HC9A 3LXXA 2B69A 3ETLA 4HGZA 1LDYA 3L7MA 1DX4A 4YMTA 5TPWB 2DRIA 1QCDA 2PLFA 3T5GA 5C1PA 4WKPA 3OOSA 1H1DA 1M2WA 1EHYA 1F8YA 1PW7A 2V5VA 3L1KA 4R3UC 3OQOA 3LHFA 5IKMA 3A9TA 4KE9A 1VL2A 4L5YA 2QMOA 1NHGA 4OMCA 4Q4JA 1T3GA 2QLTA 3ETGA 4LVOA 3VTKA 1LF5A 3AUXA 5JXGA 1NN0A 1Z7YA 4WESB 3R7NA 1J0DA 3LUGA 5J4LA 3CF2A 3E9MA 3VKWA 4E31A 1B0UA 4MUAA 1P4AA 3AEYA 2QOEA 1NM5C 1ECPA 3H13A 3EXHA 1Q6YA 4LF4B 1XTSA 1PFKA 3AESB 3JQ8B 3JRNA 2QM3A 4JIGA 4DXDA 2YOHA 3DE7X 1PR5A 1M54A 3HCWA 4RSRA 3KSMA 3ANLA 1YASA 7YASA 1FJGB 5FADA 2OD7A 3WFZA 1GA4A 3K4PA 5L3SB 5LYJF 2PL5A 5AVKA 1YB1A 4P08A 4G8DA 4BO6A 1I10A 5IDWA 1VKRA 4TV9B 5JWRA 4I2VA 3UJCA 1AXRA 1G8JA 3ZZTA 1F8FA 1G5TA 1FRFS 2OB1A 4RD4A 4AF6A 3TVYA 2GXQA 2CCGA 2DP4E 1AH2A 2Y05A 3PQ5A 4U9IS 1JYSA 3S4YA 1BQ4A 1UXHA 1NVWQ 3TM4A 4DIUA 3W0LB 3SXPA 5IT4A 5IBPA 3U5TA 3MUOA 1XP8A 4DQDA 1DP4A 1MJNA 3BSFA 3OEED 3ZGZA 2XPCA 4C89A 1W88B 4WY5A 4EUNA 5TX7A 3AETB 5FUVA 1BDBA 5KB3A 1PQ4A 4IJQA 4ZQFA 2EIXA 4HS4A 3E9ZA 3I23A 4XYBA 3I1FA 4B33A 2X0KA 3C8MA 1AGPA 4QE3A 4NEGA 4YJDA 3X1DA 3CX8A 1YBAA 4M7WA 2OCDA 1G5HA 1PJAA 3QBEA 3TMAA 1IN1A 3O1LA 3WHPA 2DBVO 4OAQA 3HDVA 2R1VA 4D4IA 2QTRA 3GDGA 3KLBA 5KWJA 2W5UA 2A9KA 3RC8A 1QH9A 4N9WA 1ITZA 5FWAA 2WFLB 3I9JA 4AY5A 2VFAA 2A9OA 2GVDC 2GUGA 2WYUA 4FLEA 3OA2A 4G4JA 4OJQA 1L7MA 4U2DA 1QFJA 4ROSA 2O0KA 1H5NA 2PKYX 4G4SO 2C4MA 1JLRA 4KBGA 1JXQA 1AKWA 1XN4A 4TYQA 3FE2A 1CHNA 1JJFA 1AD2A 1H2FA 3VO1A 4LFBB 2N75A 2C3UA 1U28A 3JVEA 3OKCA 3OOWA 4OL0A 1Q17A 3Q11A 3H1PA 3HR8A 3IOMA 4QNMA 4RMGA 4UARA 3MHTA 5AXAA 3HYLA 2C04A 4HTAA 1SC3A 4V0MA 3H16A 4KZPA 4WOKA 4YFVA 5IDYA 1LEHA 2BZSA 2NQ8A 3H04A 5EHGA 5SY9A 1KMHB 3GPBA 5GMOA 4KAAA 1W9MA 4ZYWA 3GYGA 4D4MA 4M0FA 1ZW6A 2GWRA 4NE9A 1KWKA 3SHTA 1M76A 3B8EA 5DNEA 1FS5A 1MO6A 1T2AA 1V9LA 2OEPA 3DC7A 3HYTA 5JWHA 4QPZA 1A97A 4BV2A 3I01A 4XCQA 1GQFA 1LSUA 3NIBA 4N9QA 521PA 1YUBA 3MJRA 1EUDA 3PD0A 1Q7CA 1R0KA 1WR8A 3VSEA 2XYPA 1S8OA 1UM9B 4P81A 4ZOBA 4BMVA 3QKTA 3SVTA 2GVZC 5ARDA 4OATA 4E6EA 4C0HA 1KK2A 1PFYA 2BMDA 2QF7A 4QPJC 5HILA 2QK4A 3O8BA 5E1OA 4UAJA 1UXOA 3RF7A 2D4HA 2JGNA 5G53C 4HB4A 1WO8A 1XWFA 1PL8A 3X1WA 1KO8A 4JLBA 5JFGA 4JI6B 1WXIA 1G60A 1IY9A 1HT3A 1NKSA 1W4ZA 3B12A 3HLTA 3UNXA 3O84A 3GLIA 1TTHA 1GTJ1 1JTVA 2GJKA 2VBIA 4TQGA 3QLUA 3WXBA 1IVSA 4S3MA 5JS2A 4F92B 3O8RA 2G1PA 1ND5A 4UUBA 1Q22A 3E5NA 4LF7B 1WQ3A 5C8YA 5FYQA 4ACBA 1BW9B 3UGTA 2AZTA 1ISPA 3NHLA 3RT1A 2HXYA 2WWYA 3KXLA 1V8BA 3N8GA 4YDHB 5JAQA 3WWYA 3AUJB 4I9GA 5AVZA 4OMDA 2NVUB 2DUUA 1E6MA 3H5AA 5HMMA 4DLSA 2PANA 3QLVC 2Q6KA 4PPYA 4N7JA 4TKVB 1CY4A 1EG2A 3KUDA 2B1JA 9LDBA 2O1SA 1BE8A 3RAFC 2FFRA 2PO7A 4RZ3A 4MVJH 4O4JA 3PQ3A 5ILQA 1L4FA 3RS0A 3TN7A 1RWVA 3A8TA 1X7XB 1ZMRA 1FJ2A 3A9SA 3BHNA 4IQGA 3UUGA 4EEXA 4RULA 1Q1AA 5TJ9A 5JDCC 4NNJA 1WSAA 1QK3A 4O5OA 3W2HA 5H1YA 1TUEA 2VPZA 1TF7A 1EE1A 3QHPA 2Q0XA 4CL2A 3Q85A 4S05A 3N9IA 1NVXQ 2JASA 3HKCA 2BY4A 2FOXA 2INGX 3NYRA 3OCXA 3OA0A 3B5JA 4UVIA 1P29A 5B30A 4I19A 2G82A 1JG4A 5L7YA 3MINB 2OO5A 3VXKA 1MA0A 2FWRA 5DX8A 1GPYA 1MC5A 1ZPDA 2HJGA 3BXPA 3EMKA 3N28A 4OLHA 1PG0A 5F3RA 1ZONA 3RAGA 3UAZA 1KJJA 3IAAA 3T3PB 2GI4A 2ID8A 4I14A 4J7CA 4NBSA 3FB4A 5LWQA 4XEHA 2I2BA 5CT4A 2AI1A 4M0CA 3V8MA 3H2JA 1YMQA 2CEKA 3ZUPA 4ZYUA 2C98A 3WB0A 1YZLA 3TZ6A 3GDWA 1FMFA 2EDAA 3CRNA 4F85A 4HAWA 4BTLA 3C5CA 3FNQA 1N36B 3K9LA 4LJSA 1QPBA 4JY7A 2P5SA 5TF0A 3W6NA 2Z5FA 2VK1A 3R5XA 5LC1A 2HCJB 2P9EA 5HKBA 1MJFA 2EKQA 3SQDA 2JFOA 1GY8A 1P61B 2E5FA 2AFIA 1OBOA 3M3DA 5JNLA 5KTYA 1CYDA 2FSUA 1ZJWA 2ZZNA 4Q1AA 1TF5A 5LLTA 4R8VA 2F1HA 4L95C 3F71A 4UUNA 1IPHA 1NMEA 1RQXA 4EPVA 4J03A 4QATA 1EFVA 3USZA 3DOEA 3LU1A 3ZLBA 1MENA 4TTSA 5B2FA 5C4IA 3DE1X 5C5CA 1EFHA 1B4DA 1P74A 1HZZA 1N2CB 1XQVA 3OJWA 2FR1A 1QR6A 4GC9A 5JAZA 2NQ2C 4K3UA 1DKNA 1U11A 1WOYA 2ROQA 6GPBA 4IDBA 2GFQA 2I4TA 2XZTA 4INPA 4ZC8A 4CM8A 5EP2A 3W2FA 3WLLA 1Q5PA 1CNFA 1X0XA 5ERYA 4BLPA 4CV0A 2AKYA 3D3WB 3Q7EA 2P78A 3LIIA 3DCJA 4B35A 4OTZA 1UIRA 1XVIA 5ISMA 2ZAOA 1R6VA 1QOPB 2VF2A 4HLUC 4URZR 3MQ4A 1DI0A 4MO9A 2J30A 4AMUA 3SK0A 1IJBA 5EAIA 5EKXA 4HEJA 2RH5A 2VJAA 3CZQA 1T36A 2VDPB 3IQWA 1ORRA 1Z7BA 2ISCA 2J87A 4AVYA 5SYMA 5EG5A 2X0RA 1MIHA 1XMOB 5FNVF 5CEJA 4A8JA 2WE7A 1LBSA 2EF1A 2V9ZA 3QX9A 1R10A 4MYRA 5ALUA 4G1VA 5HEKA 1FFXB 4W5QA 3PTAA 3OQPA 1EJ6A 4R2IA 4DC0A 1V5IA 4ETIA 5L9AA 2HPHA 4RZIA 1L5NA 2O3TA 4QBTA 5AUOB 1A9QA 2AOTB 2YCLA 1T8WA 4OLFA 2EVWX 2WYHA 1ZGAA 1TZBA 3C74A 1OZFA 1YI8A 3JARB 4AROA 4IXDA 4YHHB 3LDHA 1YK1A 3KJHA 4PNZA 4D99A 3EGWA 2OCYC 2AX3A 1ORDA 2Q6IA 1L5RA 4X71A 3WV4A 2H5LA 5E8JA 4PEVA 3FF4A 3L7CA 4G4IA 5JAUA 1Q12A 2B37A 3B2NA 1J2TA 2CXUA 3HB7A 3N6VA 3ADPA 2I4MA 5EE1A 4XQ9A 3W9SA 1KF0A 2Q5LA 3SJBA 4ZYLA 2QUHA 5JJBA 1BG6A 1OT3A 3KKZA 1N3LA 3AL0C 3COSA 4JVLA 1M2VB 2C1ZA 2PTHA 2YJ3A 3A9WA 4FD2A 1YBVA 4JROA 2ZRQA 5CT5A 1UPAA 4H35A 2R6CA 4JB3A 4MI9A 1RRMA 2G1AA 1KJNA 4OBBA 2MYNA 1AXEA 1KWGA 2HRBA 3OFVA 1EUYA 3OIUA 3EIWA 1PJ8A 1UEJA 4MKFA 4GI2A 4JLAA 1LSOA 3S5UA 3PC3A 3FRHA 3E5MA 3ORYA 3FWHA 4RVOA 4ESEA 5LQKA 4EZIA 4GKBA 2EJTA 3RYTC 4EHFA 4Q4LA 4MS3B 3OWHA 3GPCA 3TKAA 5C5IA 2CL6X 1YB2A 1T9KA 4IW3B 4K28A 5J1TB 4INJA 4RQBA 4B4DA 4F9FA 2V7GA 3I34X 4GMXA 2VP0A 3BMCB 2XW6A 1V45E 1LPAB 1O5IA 2DWPA 2HK9A 2V3WA 2XA9A 4GP6A 4LGVA 5A04A 4CMHA 1EFKA 2IHTA 4BZZA 2C3MA 4Y2SA 2P40A 1EVLA 1QXSA 5BRAA 4XSGA 1I7LA 1TYZA 4UZFA 2VAXA 2ZYRA 1YZTA 5AOAA 3VJRA 5NLLA 5FTWA 1I4OA 3PTZA 2FPWA 3AFOA 2G5CA 1RIIA 2YHIA 2XNKA 1JQBA 4ZXPA 5CG2A 3CXRA 5KQMA 1JU3A 5D85A 1L4BA 1KYXA 1QLJA 2R4UA 5AM5A 4F38A 5DXAA 2OO3A 2BGRA 1KQ3A 1Z75A 4GBMA 3NZEA 2VQDA 1KFEB 4R0NA 3VR5A 4NAUA 5BWLA 2FPOA 3PFBA 2A5LA 3AB8A 2QTWB 4C0AC 1IN5A 4BVFA 2DWOA 1XLTA 1BN6A 2IP4A 4BWVA 4NPAA 3I6MA 4GS5A 1HL7A 4TWBA 4XDYA 2UZ1A 3J7TA 1PEDA 1XMJA 4CKCB 3WQQA 3SVLA 3BYZA 1QIFA 3BEDA 3D02A 3T1OA 4EHDA 1GDTA 2XT6A 1ZL2A 1BCRA 5EHZA 1C1YA 2J6BA 2LDXA 5FEUA 4O25A 4ZMRA 1AHHA 1NFRA 4PV7A 2UZ4A 2DULA 2J3EA 3KJNA 2QEQA 1QYXA 3FI0A 3A6DA 1JDBB 2KW5A 1H4TA 1ODSA 2BD0A 2XI4A 3PCRB 3V4SA 3WKEA 4AYXA 2QRZA 3ROXA 2NMVA 1XI2A 1OLOA 3C87A 4Q16A 5B4VA 3PHGA 4NU6A 5J43A 1NXOA 3IJ5A 1K66A 1KEEA 4C0QC 4R4JA 2YWGA 4MQ5A 2WPNA 3K9WA 4E2WA 2MSNA 1PGNA 1OCEA 5LSAA 5ESXA 3S3TA 3MAGA 4GXQA 1DBQA 2F8MA 2LWIA 3R4CA 2MU1A 4IR7A 4B84A 3F47A 1RNLA 4JASB 1CXZA 4IDQA 2OECA 1TMGE 2W58A 3S2ZA 4QGSA 4M22A 3SC6A 3F2VA 4NLLA 3NQ41 4CG1A 1MU0A 3WLRA 2C4VA 4PSUA 5A0VA 1SXIA 2C2XA 1GUAA 4HH0A 4TYWA 3KU4A 1Q0SA 3NBUA 3OE7A 1KO4A 2ZAMA 4BQQA 2OZVA 1K7FB 4MPJA 3FKSA 2FYTA 2FSGA 4IX1A 3SJCA 1BRMA 1XZPA 4XFJA 3T9FA 4JB2A 3V00A 2IEIA 4R5HA 4RLSA 2XCOA 3OH8A 2QZZA 3BF8A 3TDKA 5INTA 3WNZA 3WNDA 4D8YA 5K3CA 3WLNA 4D6YA 3ZXXA 2FPPA 4GI5A 3DDUA 3DZIA 1F5SA 1KP2A 5C3UA 1YDEA 2HJSA 5JW6A 1IYZA 5K8LA 2UZIR 4YJFA 1L3CA 1XPJA 2A0UA 2XCRB 3JZMA 3N74A 4M0EA 4WDRA 3O1IC 5SZJA 1CV2A 3CTPA 2RHOA 1RLTA 3A4YA 3AF2A 3B3JA 4DTIA 1KI8A 3GEEA 4FSHA 4JBYA 4JN6B 1E69A 3FTPA 4BEJA 1Y6GA 2CNWD 2XAUA 1DOZA 5DNUA 5EUMA 1EA5A 2OWEA 4HDCA 4PXAA 4PG6A 4BYGA 1E3QA 1DQPA 4UUOA 2WF5A 2ZRBA 3A9UA 4EQ6B 1JX6A 3O0TA 3R44A 3RIXA 3CUEF 2HCTA 2VC2B 3C1OA 3D4NA 5DOZA 1K68A 4DN6A 1X1SA 1ZAKA 3ESQA 5DNVA