4LSWA

Crystallization and structural analysis of 2-hydroxyacid dehydrogenase from ketogulonicigenium vulgare y25
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
318
structure length
318
Chain Sequence
MTKPEILQLGPYPAWDQEPLDAAFTVHRLFEADDRAAMLANVGDRIRAIATRGELGASRALIEACPNLELISVYGVGYDAVDLAACRERGIQVTNTPDVLTGDVADLGVAMMLAQSRGIIGAETWARSGKWAAEGLYPLKRRVFGRRAGVLGLGRIGFEVARRLAGFDMQISYSDIAPKSYAPDWTFVEDAVTLARDVDFLFVTLAASAATRHIVGRDVIEALGPEGMLINISRASNIDEEALIAALADGRLGSAALDVFEGEPNFDPRFRDLPNVLLQPHHASGTIETRKAMGQLLRDNLTAHFAGSPLLTPVVLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-2-hydroxyacid dehydrogensase protein
publication title Crystallization and structural analysis of 2-hydroxyacid dehydrogenase from Ketogulonicigenium vulgare.
pubmed doi rcsb
molecule tags Hydrolase
total genus 110
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2013-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lswA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lswA01
4YWJA 3DOOA 3GGPA 1TB4A 3U49A 4EYEA 3JQBC 1DIAA 4BGEA 2YZ7A 4ONEA 3C7DB 1JKJA 2YHIB 2O3SA 5EIOA 4F45A 1MC4A 3FBGA 1M2WA 3WNQA 1QYXA 3JD2A 3GNQA 4LMRA 3CMCO 5COAA 3BTOA 2Y68A 3ETDA 2GZ2A 4LISA 2TMGA 2O3JA 3GOHA 2W2LA 4YT8A 3PJGA 1QORA 3UAGA 1EK5A 2AW5A 3HN2A 2HKIA 3A1NA 2RH8A 4E5KA 1I3NA 1GCUA 4CPDA 1SMKA 3U4IA 4Y8VA 4Y6SA 4CM4B 3F3SA 1QV7A 3BIOA 1HDZA 4XGKA 4MJLA 1FDVA 1X1TA 5JBIA 2IEBA 3EVTA 2ZTMA 1CJCA 3RROA 4AJ1A 3VZQA 1JN0A 2JFFA 4FIZA 1F14A 5GMOA 3TWOA 3DHNA 3F5SA 4IDCA 1K6JA 2W2LD 3BA1A 4G2NA 3MOGA 4RDHA 4WNIA 3QWFA 1HL3A 2NTJA 1DDOA 3ZGYA 2Y0CA 1TT5A 2Q1UA 3D64A 3H9JA 4AJNA 5KIAA 2ZB7A 4DYVA 1SZJG 3BMCA 4YJHA 1E77A 2B69A 1BDMA 1JVBA 2JD1A 4ALMA 3CE6A 4Z0HO 3L0DA 4BUCA 1GAEO 1GY8A 1ZK4A 3GEGA 2P9CA 4J91A 4EBFA 3GA0A 4Q3AA 1E1MA 1P1HA 3ADPA 3CTMA 1GZ4A 1HE4A 1FDUA 4WCFB 3WB9A 4ZHSA 5K6AC 3ICCA 3AM4A 2NVUA 4FPXA 4AJHA 1AHIA 1MV8A 3QV1A 2HK9A 1N1EA 3H6KA 4E2XA 1LA2A 3EHEA 5ENDA 1QSGA 4BV9A 3OA0A 1BRMA 5HBRA 1M67A 3DMTA 1E6WA 3JYLA 3VKUA 1A9ZA 3IS3A 3BTSA 4E3ZA 1U4SA 1D7OA 1WXDA 2YFHA 1KEPA 3FCOA 4LVUA 4RDIA 4E12A 4QEDA 1ONNA 3WGTA 1TXGA 1BMDA 2PGLA 2YHIA 2ZB8A 4WECA 1R66A 3DFZA 3VH4A 1LLQA 3I9MA 3V2GA 3T4XA 3OSUA 1WVGA 4ILKA 5F5LA 2EHDA 3L9WA 3K73O 3GNTA 1LU9A 1A4UA 4P4NA 1C3VA 3A28A 5L7TA 3ROQA 1OI7A 2DBZA 1IYZA 2DFDA 2UDPA 3KEQA 2CZCA 1X1EA 1YKFA 2NU6A 3LF2A 3PJDA 4E2ZA 4KUGA 4IDDA 3UICA 1XYGA 4N54A 3GGOA 1PQPA 4WLEA 4Q3NA 3JQBA 5J23A 2G76A 1EQUA 3AU8A 3PEFA 4BO9A 4CMBA 4CM4A 1E5QA 4UVDA 5C7IO 5LDGA 4QSMA 3IP3A 5G0WA 2D2IA 1N92A 3JYOA 3TNLA 2BGMA 4CLOB 4FFMA 3TL3A 1PGOA 1X0VA 3CIFA 1DO8A 1LDYA 1EMDA 1GUFA 2EJWA 4EJMA 5JMWA 4E6PA 4I5DA 3DBRB 3PFWO 3QLJA 1B8PA 1M76A 1KYQA 3D1LA 2Q4EA 3PYLA 1ONOA 4JJFA 4U7WA 1E3EA 4NJOA 3S2EA 5THKA 1GADO 3EK2A 2WWRA 1T4BA 2E4AA 2HLPA 2PGJA 3M1LA 3ZU4A 4ALLA 3IJRA 3KBOA 4B4WA 3GVXA 3OQBA 4FS3A 3UH1A 5F1PA 3RVDA 2PZLA 1EVJA 3E1KA 4CQMB 2OMEA 1FK8A 4WJZA 4P22A 1Y6JA 3JQ7B 2GDZA 1ZXLA 5EJ2A 2C07A 3M6IA 3U09A 2QRJA 1DRVA 4WCFA 4D44A 3K31A 8LDHA 4PG5A 3D4NA 3DTTA 3NTRA 4OH1A 2Q99A 4XRGA 3F5QA 2JCVA 3PK0A 4MVJF 4N5MA 4CMCA 4I5GA 5IZ4A 1HRDA 1EDOA 1H6DA 3E6AA 3GHYA 2A94A 3PZBA 4O6VA 4IJVA 2DLDA 3QVWA 4TRRA 5KVSA 1ISMA 2O3QA 3TFQA 3KYBA 4NBRA 2Q45A 2X6TA 2VQ3A 1V35A 5U1PA 2HJRA 4GKBA 2D1YA 2NM0A 4M49A 1T26A 2VNSA 3AOEC 2FR8A 4MKZA 4KTVE 5JE8A 1MFZA 1E6UA 1YOVB 4IJUA 4OYRA 5K6AA 5ILOA 2WYUA 3ENNA 2QQ5A 1TI7A 4Y98A 4GMGA 2TMDA 1CETA 3GNSA 3OIDA 4IIVA 3UCFA 5T64A 4GX0A 2DFVA 4WEQA 5FI3A 4RZHA 1M75A 2X23A 4M8SA 4BNKA 3H5NA 2Q1WA 4MP3A 3VHRA 4R1SA 4OJNA 4CQLB 4KQXA 2Q3EA 1E3WB 3H2ZA 1PWZA 3ICPA 4PG8A 4YJFB 5FYDA 5JPIA 2WD8A 1MGOA 3LF1A 4KP7A 2IXAA 1JWBB 1DAPA 1XQ6A 2CSUA 4FD3A 3F1LA 4R1UA 3U9LA 3ZV4A 1NFRA 2FHSA 2WMDA 4PLPA 4W9NC 4HUJA 4Z9YA 5ICMA 2ZTUA 1AHHA 1G1AA 2XF8A 4CM8B 5C5IA 3SEFA 3RFVA 2YFQA 1YDEA 2AQ8A 4YAEA 4CLOA 3ZN2A 1YQXA 3BTVA 5A5FA 3DC2A 4BO0A 1UAGA 2W2KB 2BLLA 4BKPA 4Z0PA 2OL4A 3ANLA 1NQOA 1PX0A 3ETGA 3PWZA 4IPTA 1CRWG 1RWBA 3DBRA 2CVOA 2VHXA 4AL4A 1Z73A 2HMTA 3FHLA 4B4OA 4DUPA 4ZA2A 4GSKA 4BGVA 3NEPX 4J1QA 5GZ3A 5ER9A 1JWAB 4YT5A 1SB8A 1VJ0A 3WQSB 5AQ1A 5CPBA 5BSGA 4BKQA 5CAEA 1DFIA 3B1JA 1U4OA 2BFMA 4BNYA 1VPDA 4R51A 3DZHA 3JCZA 5CDSA 3RCBA 4CQMA 3OQ1A 1UXKA 4IDAA 3JQ7A 4B8ZA 2DQ4A 3HADA 3I6IA 5A9TA 4EEZA 3G79A 3ZWWA 2EIHA 4TVBA 1Q7BA 3ONEA 3VPFA 4M89A 3PGXA 1AXEA 1DC4A 4S3MA 4NK5A 2YQ4A 3JYNA 4YRAA 1XWFA 1I30A 5I9LA 1XR3A 3MJ4A 4XYGA 5H83A 1BXKA 1VLLA 3KYCB 2P4HX 3ZDFA 3GVCA 3AM5A 4AICA 3O8QB 1BXGB 1GYQA 1BG6A 1EDZA 1Z6ZA 2WE7A 4J3FA 3MTGA 2X9NA 5TT1A 1LLUA 3RASA 3L4SO 3KTDA 1LJ8A 4DLBA 4EUFA 1YB4A 4GL4A 5L3ZA 3N58A 2E82A 1H6CA 3PQEA 4R01A 5LDHA 2BRUA 1YOVA 4U5QA 3GDOA 4DXHA 3SC6A 4XIJA 3B70A 1OFGA 4D41A 2BF7A 3AJRA 2B36A 4YJGB 3FNEA 4DRYA 1K0UA 3RFXA 4BNXA 4XEHA 1T2AA 3S8MA 3ZWPA 2NU8A 4CQLA 1LC0A 2ZQYA 1J6UA 3RC2A 1E3WA 1LNQA 1WLYA 5AVOA 4QFDA 4M87A 3A4VA 1P0CA 4ZU3A 3JQ8B 5JAIA 4YJFA 3PDUA 5DOZA 1KEWA 4IQGA 5JS6A 2CF6A 2FMUA 2OXIA 3WGQA 5L45A 2EKPA 4OXYA 3LC2O 4BIIA 1U1IA 1YQDA 4LK3A 1ZSVA 4CM8A 3HQ4O 1I2BA 3LLVA 3B6ZA 2OBNA 4J2HA 3LYLA 4XQEA 2JHGA 4IBOA 2EF1A 4GLOA 5G2OA 3MJVA 2W2KA 1WW8A 4LCEA 3ZW9A 2CDBA 4QT0A 2X8LA 4MINA 5HWSA 3ZWYA 4LCJA 1Y8RB 2NU9A 2OO5A 3GEMA 4ND1A 4PZDA 2BHLA 4A0SA 1JKIA 4TRNA 3ST7A 3NT4A 3CKYA 4KZPA 1KOLA 4NHEA 4DIFA 1YE3A 2FPPA 3HDJA 2GZ1A 4FSHA 4UVHA 5IDXA 3RBZA 1DIGA 1EFKA 4FC6A 4J2OA 1H2BA 2HK7A 1WNTA 2Y0DA 1P1IA 2UAGA 3NJ4A 5I7VA 4EI2A 1ULSA 4W9NA 3NRCA 4HBGA 1VL6A 3L6EA 4W7HA 2Z1NA 4BNFA 1B3BA 1LSJA 4BV8A 4WLVA 4MVJI 4BNJA 2C20A 4B79A 4B7CA 3PI7A 4OXKA 4BQPA 4D0RA 1BHSA 1H2HA 4DBZA 3QWAA 4GMFA 4FQ8A 4GWKA 3RUFA 1K6XA 1NWCA 4XB1A 4BO4A 1VJTA 2C7GA 4XR9A 4S1VA 5IXYA 4RVFA 3D3WB 1SNYA 3KYCA 1E1NA 5CG2A 2BMAA 3O8QA 1BXGA 4DLAA 3K96A 2H5LA 4R4JA 3SJUA 3PWSA 1WDMA 1U3UA 4BO1A 1RM0A 4Z9FA 4R1NA 4QXMA 3TJRA 2E48A 1UXHA 4CUJA 2OZPA 1Q0LA 3H3FA 4L76A 1YL6A 4ZGWA 1LXCA 3ZWBA 1UZNA 4R5HA 3WWYA 4RF3A 4A2CA 2VYVA 4KOAA 2P9GA 1H9BA 1HWYA 5F21A 3QQPA 2AMFA 3QE3A 4RPJA 1O8CA 3L6OO 4YJGA 5EQDA 4E31A 4HV4A 3OIGA 2VT3A 5BSHA 2I76A 1N7GA 1YJQA 3ZWMA 2PZJA 4BNMA 3SLKA 3ZU3A 3DBLB 4ESOA 1GZ6A 1LRKA 4W82A 4CUKA 5C37A 1SC6A 3QJ5A 1UXGA 3JQ8A 1ZUD1 1HYEA 3ORFA 3K8ZA 3WX0A 1O94A 3ETEA 1AGNA 1MLDA 1PZFA 3F9IA 3GN2A 4WCDA 1IL0A 1MX3A 1R12A 2VYVD 1IPFA 1H6AA 4A73A 4TKLA 2ZATA 4BO5A 2HUNA 5IFLA 5JY6A 3QY9A 3VH1A 5TF4A 1W6UA 1E7SA 2ZCVA 4L4SA 2GSDA 2PH3A 3PXXA 2AA3A 1U2GA 1LDMA 5DF1A 4BMNA 3FRJA 3AWDA 2C82A 4E5PA 2PR2A 1T2CA 1VSUA 3PYXA 1ADBA 3HN7A 3D3EA 1Y8RA 3EYWA 2C7VA 5I8WA 3ENKA 3EMKA 4B3HA 2E37A 3AUUA 5THQA 3KVOA 4XYBA 2Y1DA 4IGFA 1GEEA 5COBA 4WLOA 2X0IA 2LDBA 3FSRA 4TQGA 4WUVA 2PZMA 3ZV5A 1ISHA 2NACA 1BSVA 5CDYA 4OMUA 1G0OA 1HLDA 2I67A 1LDNA 3JV7A 3MWEB 4LRSB 4AG3A 1U5CA 2DBQA 3WTBA 1LI4A 1PZGA 3OJ0A 1NQ5A 4LGVA 5F1KA 3U3XA 2PZKA 3IMFA 3K92A 4Z0TA 1ZIDA 1IB6A 4E5MA 3W8FA 4EZBA 1GQQA 2PKQP 4CR6A 3C85A 3D3WA 1Q0HA 4RLSA 2DUWA 1I36A 3GEDA 5G0SA 4EGFA 2WM3A 3GDFA 1ADCA 3KSZO 4GBJA 4KUEA 1Y5MA 4BO2A 5B4TA 1C0PA 1E3JA 2EP5A 5U9CA 1LX6A 3ZH2A 2Z5LA 5A5EA 4A7PA 2B5VA 4L73A 1ZCJA 1A5ZA 3FN4A 2YV2A 5DCUA 1DRWA 2Y66A 2P4QA 3JQ6A 2Q50A 1DFHA 4D3FA 1T4DA 3G3EA 2J3KA 2I65A 2W8ZA 3I5MA 1LTHR 4IZIA 2BFPA 3ZWCA 4JNKA 4E5YA 5TGDA 3DBLA 4HFRA 4FJ0A 3RJ9A 2NTNA 3E5RA 2DAPA 2Y05A 1E6EA 2EJVA 4DQUA 4FC7A 3VPHA 2VHYA 5JYEA 5KTKA 4J9UE 3H7AA 1P44A 3NDIA 3WS7A 3WWZA 4RL6A 2ET6A 3VZRA 4NI5A 1N8KA 4FB5A 3KO8A 3L4BC 3VC7A 3SXPA 4IUYA 3MZ0A 1GYPA 2YV3A 4L8VA 1B26A 4TROA 1B8VA 3Q0EA 3RJ5A 4RZIA 3RUCA 3SJ7A 3V2HA 1NFFA 2D8AA 2QYSA 3MJSA 4QTZA 3C1AA 1QKIA 4ZQGA 1SO8A 4EDFA 4OXNA 4M1QA 1SB9A 2QYTA 1GPDG 1V0JA 3QW2A 4PLCA 4E32A 4ID9A 5EESA 4BGUA 3A9WA 2P5UA 3I9OA 2VOEA 4XR4A 1KVTA 4NJMB 5C7OO 4HWKA 1R0SA 4MKRA 4AJOA 5DT9A 1ZNQO 4FOOA 1ORRA 4M86A 4D46A 3CEAA 2QX7A 3T7EA 4MIYA 4Q9NA 4DLLA 4RPKA 1M6WA 1TT7A 4I08A 4YRDA 3MJEA 1L7DA 2O23A 4C4OA 4E30A 3P19A 3Q11A 3ZNNA 1T2FA 3PIIA 1K89A 1IE3A 4FGSA 4XYLA 3IC5A 4ALKA 4DYDA 4A5OA 1RJWA 1UAYA 4LVCA 1PZEA 2O2SA 6ADHA 5FFFA 1E3IA 3NJ8A 5IZCC 2ZQZA 4K26A 3AFNA 3ROPA 2EP7A 1EEHA 3L6DA 1VE9A 5AYVA 2GN8A 1JTVA 1RM3A 2H1SA 5I8ZA 1O9BA 2O48X 4PLFA 1P1RA 1GL3A 4CV1A 4F6LA 1XSEA 2EV9A 2D59A 4TMFA 1X13A 1HSOA 3GRPA 4Q39A 2YY7A 4HNHA 1PJ2A 4GI2A 3DO5A 4P8RA 1JQBA 4GH5A 3ABIA 4CODB 5CFZA 4KDFA 4MVJA 2CMDA 1EBUA 1XLTA 4JP3A 1ZSYA 3I9NA 1ZK0A 1N5DA 4XQCA 4RPGA 3RUDA 3WBFA 4RVSA 2NUAA 1GUYA 4IZHA 1HKUA 1R4MB 3ZHXA 1A4IA 4OKNA 1MP0A 5G0VA 1DC5A 1R0KA 4XYEA 1YBAA 1UR5A 1RYDA 2I5PO 3I3OA 2NU7A 1I0ZA 5G0UA 4DIBA 3Q2KA 1I3MA 1S6YA 4LW8A 2EG9A 3GVIA 3NT5A 4MVJD 9LDTA 3AW9A 5TS3A 2Q2VA 3GLQA 4PVDA 4GVLA 1I33A 1NQTA 3QP9A 3C7AA 1B15A 1BWSA 3DBVO 4CMEA 3GRKA 4XZ3A 1PIWA 2VT2A 2DTEA 1I5RA 2VUUA 4AJEA 4CM6A 1O6ZA 1KY5A 1V3VA 2R2GA 1GUZA 1PJ3A 2RHRA 1A27A 1Y5RA 2BH9A 3AUTA 2F1KA 2PFGA 4A03A 4CM9A 2GN9A 2HRBA 4HX5A 2RHCA 3PQFA 2VOJA 4NJMA 3HUDA 4BNWA 3UUWA 2GUGA 3UFXA 1ENZA 2GLXA 4YR9A 3OHSX 3DB2A 1PJCA 1X7DA 4PCVA 2V6MA 4NG5A 2DPHA 3TOXA 4CMKA 3EY4A 3G49A 5TLSA 2BKAA 2CVZA 2E6UX 3E8XA 2PGDA 4II3A 4B3JA 1C0IA 3WQQA 2FPGA 2QRLA 2VZ0A 4CM9D 2EWMA 3NKLA 4IMRA 2PK3A 2HO5A 1P77A 4MVJH 4O1MA 4PRKA 1CYDA 4OHUA 4UAGA 4PLZA 2VWQA 3OM9A 2I3GA 3C8MA 3OIFA 5EL0A 4ZQHA 2WJPA 1J49A 3GDGA 4R54A 3JSAA 2EERA 3PLNA 4Q3BA 2LDXA 5DBGA 4IY1A 4R69A 2GGSA 1FXSA 2YHUA 1G0NA 3ASVA 3CMMA 4XQGA 3UGKA 5L4LA 1LRJA 4I5EA 1LLCA 3R1IA 3I9KA 5BR7A 1T1RA 3WMXA 1QG6A 1TEHA 3PQDA 1YGYA 1UUFA 2FR0A 2PKRA 2CDAA 3E03A 3N7UA 4P4LA 3JYQA 3JD4A 1RM4A 3AM3A 2ZYGA 4NPCA 3WNVA 3WYCA 4I8XA 5CEJA 2W90A 3IIEA 4WASA 3I83A 1R4MA 3CXRA 2GZ3A 1N1GA 1SCUA 2WEKA 3E48A 4MKXA 4BKRA 2OP0A 3AFMA 4NMHA 3RIHA 1YO6A 2D5AA 4WOKA 2DM6A 2P2SA 4LN1A 1Q7CA 1HT0A 1Y81A 4WE3A 5JDIC 5JAZA 1PZHA 1Y9AA 4J43A 1XGKA 1DRUA 1AE1A 4WLNA 4NFYA 2UVDA 3VZPA 5KWEA 4ZN6A 1PGJA 3DTYA 5JSFA 3K2BA 2VHZA 1N7HA 5DBIA 4F6CA 1SPXA 4PN3A 1NBOA 3OJLA 3GMSA 3AY6A 3EVNA 4DPLA 5L40A 2VUSA 4J90A 3W1VA 1K5HA 4NU5A 3BMQB 3GPIA 3TFOA 4XB2A 4ZD6A 4J49A 3VZSA 2VHVA 3B20A 1Y1PA 1XG5A 4YT2A 1C0KA 3QWBA 5BSEA 3DMYA 4H15A 2AHRA 4K9DA 2VUTA 2X86A 3DFUA 4I5FA 4RF4A 2YW9A 4TZTA 3U62A 3GZ4A 3HFGA 4WLUA 3GK3A 1NWHA 1NQAO 3R3JA 2BD0A 1P31A 1LQUA 1PJ4A 2X0NA 3S2GA 4TZKA 3RC1A 3FI9A 1E7RA 2J5RA 2QG4A 3E9NA 5TNXA 1HYHA 4NBWA 3KM0A 5JC1A 4Z6KA 4B4UA 4IJKA 3PLRA 3X2FA 3OMLA 4PRLA 2ZJ1A 3VPSA 3TZKA 4O59O 3UVEA 3IKVA 3LDHA 2BELA 2X0RA 4R3NA 3UF0A 1EFLA 2B4RO 2Q4BA 3TZHA 1XU9A 3S1LA 2AG5A 4YRBA 1FJHA 5T67A 1Y7TA 2GPTA 2OHXA 4U6SA 1U3WA 2X5KO 3GAZA 3KETA 2C0CA 4OAQA 1NFQA 1YRLA 1NVGA 1Z45A 1J4AA 3D4PA 4JXKA 2AEMA 3TRIA 2G82A 3ZHYA 2RIRA 5JLAA 5JO9A 4YA6A 4HNGA 4BNZA 1F06A 1K2WA 1OOEA 5KNLA 1MG5A 3RWBA 2H9IA 3DOJA 1MG0A 3NAQA 2B37A 2HSDA 3P5SA 2B5WA 3U4HA 3R0IA 1CIVA 5JAQA 1NASA 1P1JA 2DTXA 5JDCC 4CL8A 3F4LA 1X14A 5L95A 1BVUA 2GASA 4GSLA 2YDXA 1FDWA 3W8EA 4YJDA 3S55A 1DIBA 1SOWA 4XKJA 4CMIB 2YJZA 4FFNA 2AXQA 1XKQA 5IXSA 4BL5A 1KIFA 5DN9A 4YT4A 1B7GO 4WGGA 9LDBA 4TRJA 3NUGA 5GZ1A 4WK6A 3UKOA 1LSSA 3BMQA 3NT2A 4C7JA 3LQFA 5LC1A 4DVJA 4W4TA 5K9ZA 3TSCA 4RLHA 3Q6IA 5JDIA 1H9AA 3CSDA 2Q1SA 3PYMA 2ZYAA 2X1HA 1YDWA 1NHGA 3G0OA 4UUOA 2VWHA 3OJOA 1V3TA 4XWYA 4EUEA 2ZYDA 3VDRA 4BNIA 1HDRA 2Y1FA 3VTFA 3RUIA 3PGJA 4KWIA 3MWDB 4J0FA 3RBXA 1S7CA 1DPGA 2OP1A 4YEDA 3WOHA 4QUKA 4OQYA 4CQMD 5I9MA 3I9LA 1GDHA 1Z82A 3L9XA 3C1TA 3MEQA 5IDWA 4DBVO 3C24A 1QYWA 3ZHBA 1FF9A 2AE1A 3C3XA 4ND2A 4O63O 5TIIA 1FDSA 1D3AA 1E3SA 1YL7A 2RAFA 3ZV3A 2DBRA 4AJ4A 3F4BA 4KWHA 4PZEA 5CPFA 1WMBA 1E7MA 1E3LA 4IDFA 3K6JA 5A4DA 3QIVA 4BO6A 2D4AA 4GX5A 4NQZA 1T1SA 4H7PA 4JGBA 1WZIA 4TVOA 4DPMA 2CDCA 4N5LA 1H0KA 2GN6A 3RU7A 2OUIA 4IMPA 4J7CA 1IPEA 1HDGO 2VCYA 1BDBA 4PZCA 3V8BA 4A27A 1N2SA 5HS4A 3AOEA 3W4IA 2BFOA 5A02A 3PP8A 1YH3A 3UXYA 1LDGA 3NGXA 3DAGA 1U7HA 4L74A 2WSBA 3X2EA 3EW7A 3TPCA 1JLLA 3INGA 4JROA 4FGWA 4KTTE 3WQRA 3NDRA 4J1SA 1B8UA 5A05A 4PIVA 3RUAA 4CL3A 3GZNB 5TC4A 4N7RA 2NVWA 2HMVA 4GX1A 1F8FA 3PHGA 2B35A 5CDGA 1WAMA 3H2SA 3KHUA 3PPIA 4Z3DA 2PA3A 4R1TA 2DVMA 4Y6RA 4LSMA 3PHJA 1A72A 4D43A 2AQIA 5BNTA 4JN6B 1UDCA 1PJLA 3ZWOA 4NNJA 4CMIA 2F00A 1LRLA 4XGNA 3GH3A 4Y9DA 1EK6A 4YVFA 4XIYA 8ADHA 5TSDA 1GQYA 2GNAA 3FNHA 2UYYA 3SBOA 4J0EA 3N74A 2HQ1A 4U0KA 5T57A 3WSWA 4ND3A 4YPOA 2DU8A 3LLSA 2DPGA 4GQAA 1NM5A 3COSA 5HA5A 1C0LA 4HFMA 4JLWA 4NBTA 4AJLA 2PWZA 1QYVA 4R9RA 2JD0A 5MGBA 3GVPA 3H9UA 4CJXA 4OOEA 2CD9A 1PWXA 1QR6A 3ZZNA 1DFGA 2O3UA 4XX0A 1RKXA 3UW3A 3F6YA 3K9QO 5JAMA 1SEVA 2XXJA 1CEQA 4Q3CA 4E5NA 2EW2A 2ZB3A 3KLPX 4NR0A 1UJMA 4NU6A 3WYBA 2X4GA 3RUHA 4OGWA 4AJPA 4R5MA 1TLTA 3QVXA 5TJ9A 1T2EA 4IQ0A 1EUZA 2IRWA 2EKQA 4B8WA 3FTPA 1I32A 3JYPA 1DBVO 1VC2A 1P1KA 2WE8A 1JKFA 2HMSA 4XCVA 4CMGA 3WFIA 1I01A 4BNVA 1B3RA 1A71A 4J6FA 1MC5A 3WG9A 4WOJA 2GRAA 4O0LA 2ILTA 5ITWA 2NTVA 2Z95A 1PL7A 2FOIA 4DIOA 4RV9A 4N18A 3F1KA 1I3KA 2QZ9A 4JQCA 4GX2A 2R6JA 1ZMTA 3STHA 3NYWA 1K3TA 1QLHA 2PY6A 4J4TA 1RM5A 3WYEA 5L9AA 4FFRA 2W98A 2C2XA 3MJCA 4IGEA 4LSWA 3KLMX 5KJCA 4ZVVA 2VN8A 3QHAA 4CV0A 2NQ8A 2O3RA 3OFSA 3V5NA 2EXXA 1NAHA 2JFGA 3GN1A 4R68A 3GFGA 1O0SA 1GEGA 1C1XB 1PS9A 1U8XX 2AEFA 2V7PA 2Y1EA 4BO8A 4GAEA 4IIUA 1DJQA 3JQFC 2IE0A 3GY0A 1AUPA 2IXBA 1KY4A 1OZAA 1Z7BA 3GZNA 1D1TA 4RO0A 4J1NA 4DPKA 4E2WA 4NDNE 3WR5A 4KUHA 4PG6A 4BVAA 2X5JO 3LC1O 2ZB4A 4XA8A 2BI8A 3QSGA 4JBGA 4DMLA 4DL9A 1UZMA 1UXIA 1ENOA 4GGOA 2JCYA 1U3TA 3O4RA 4XYMA 2ZKLA 1ONPA 1Q0QA 1QP8A 2O50A 1V6AA 3KSUA 3ZW8A 1ZJYA 5ER6A 1EVZA 4D3DA 2X9VA 4FBGA 1DB3A 1I2CA 1M6HA 2FRDA 3P2OA 4M55A 1YVEI 4RPHA 2Y1OA 1Y9EA 1C1DB 3DEYX 1IULA 4CM1A 4I9NA 2JKVA 5IN5A 1OAAA 2V6GA 5AXCA 3F46A 4JJIA 2GR9A 2PD4A 4XJTA 5BNIA 3V2UA 2PD3A 1I2ZA 3BAZA 4IXWA 4C7KA 4BHTA 3GQVA 1E7QA 4OL9A 3FWNA 4MDHA 4BGIA 1PR9A 3TN7A 4FOSA 4EJ0A 3HSKA 2PTGA 5DDIP 2Y1CA 4RVGA 2A35A 3D7LA 3GVHA 3P2YA 3ADOA 4JK3A 4LMPA 4XDYA 5DP2A 5AXDA 2FWMX 3NTOA 1YS4A 4MIEA 5KJ1A 2QHXA 3FF4A 1ZXBA 3O26A 3RKUA 3IP1A 3M2TA 3HZZA 3RAJA 3G1TA 5H81A 3HB5X 1AN9A 3ZV6A 5CDUA 5KJ6A 2X22A 1IZ9A 4XRRA 5HS6A 5JFOA 2WDZA 4K6FA 2XOXA 4ZJUA 3S2IA 1DLJA 1H5QA 1WPQA 2V6BA 1UXJA 3DL2A 1JAXA 3ZNQA 1QMGA 4DQXA 1EZ4A 5AXBA 2IODA 4UREA 5I9NA 1N9GB 1UZLA 3FPCA 4IJWA 3Q3CA 3GFBA 3O9ZA 1NVMB 3I4FA 3DONA 7ADHA 2OGUA 1E5LA 5DOVA 5KVQA 5JXWA 4WPGA 1OC4A 2AG8A 3GT0A 3OH8A 2JD2A 1U3VA 4R41A 3BXXA 3SVTA 1X15A 4KQWA 1C1XA 4NFSA 2AQHA 3VH2A 3D0OA 3L07A 4DC1A 4YAIA 4MIOA 3U5TA 4URFA 4H3VA 4JX8A 1NPTO 1GTMA 1LSOA 4MOWA 4E0BA 3PDJA 2FY8A 3OF2A 3IDSA 2XXBA 1NVTA 1ISFA 3H3JA 4RQTA 4J7XA 4PVCA 2ZTVA 5I7FA 1ENPA 1KS9A 4W6ZA 1KVUA 1ZK1A 3BZUA 1WDKA 3HDQA 4ZQBA 3TQHA 4E21A 4QX6A 5CDTA 1U28A 2QW8A 1A7AA 3D5TA 3FNGA 5ICSA 2Z1MA 4OIMA 4OSPA 2I3AA 1PGNA 1GV0A 1HE5A 2B4TO 5CEEA 2HK8A 2HRZA 5ITVA 4FN4A 4HKTA 2IZ0A 3BHIA 5BQFA 3EZLA 3PFFA 4BNTA 3DHEA 2QRKA 3R3SA 4PG7A 4YAGA 4D0SA 5JC8A 3IL2A 1C1DA 2PV7A 2UV8A 2ZTLA 1LBEA 1X7GA 3I4CA 2Q46A 2OOSA 4MVJG 3IOYA 4JP2A 3U4DA 2BI7A 3D5QA 3DBHB 4ND4A 1HDYA 1VI2A 1YQGA 1P3DA 4XGIA 1HDCA 2GCGA 3FNFA 3MTJA 4Q3DA 1JA9A 1J5PA 1B2LA 3H9GA 3V1UA 3F47A 4NK4A 4YYZA 1X7HA 2PH5A 1O5IA 4J16A 1ZK3A 4UULA 4CLRB 4Z3KA 3WICA 2J3IA 4WLFA 4INAA 1I3LA 2DTDA 2DKNA 1FDTA 3ON5A 1XHLA 1GPJA 3ZWVA 1B16A 3VOSA 1A7KA 2FSSA 1DOHA 4L4RA 2C5AA 5TT0A 1DHTA 5JCJA 1I8TA 4LRTB 1SOVA 3JQAB 4CR8A 4J7UA 1ARZA 3WTCA 3T4EA 1ZMOA 1G6KA 1WDLA 4IS2A 4UVEA 4DTIA 1CDOA 2VWPA 1YWGO 3IJPA 1N9GA 1VSVA 2FN7A 1DSSG 1WMAA 3KOUA 5TJHA 4EITA 3AY7A 2WD7B 1U2DA 5DBFA 5CG1A 1KVRA 3O03A 3JTMA 4AJKA 3AU9A 1HEUA 3GUYA 5EERA 3KXDA 1XIVA 1VM6A 4UEJA 1MXFA 4IM7A 3W6UA 1BVRA 3ASUA 1CWUA 4FFOA 5JCJD 2HCTA 3FR8A 4I9HA 4BNNA 4GKVA 5A1TA 2BGKA 3LT0A 1PGPA 4G81A 3WGHA 3SX2A 5DULA 5C7LO 3HE3A 1NAIA 1YL5A 4RCVA 1OC2A 2VTEA 3BYZA 4ITUA 3PJEA 4ZQFA 2XAAA 3WJAA 2Y1GA 1VL0A 2ZK7A 3ROKA 2C2YA 3U4CA 4WCFC 3WLEA 3ZU5A 2POQX 2A4KA 2Y93A 3QA9A 3INRA 2JJYA 2Q2WA 1D8AA 2SCUA 4IQ8A 3JQ9C 3L4BA 4EJ6A 1QLJA 2VHWA 4CMJA 3PTZA 4BKUA 2BGLA 2X7HA 4YAJA 5BNFA 3B1KA 4UUNA 5C3MA 1J0XO 3RUEA 3OETA 3RD5A 4ZRNA 2V65A 1GZ3A 2VWGA 1DIHA 5EMHA 1V9LA 3NX4A 1M66A 4W99A 1W73A 3FBTA 1AXGA 5T8KC 3AI3A 4QO7A 2ZJ0A 4ND5A 3DBHA 5BT9A 3TZCA 3WGOA 1JVSA 4WEOA 2NV6A 4JBHA 4BB6A 5L53A 2E49A 2HAEA 3KYDB 4PFJA 4Q3EA 4BNGA 1PEDA 4CLRA 2Y0EA 1LLDA 2O3TA 1KETA 5I7SA 2FSVA 2J3HA 5KVCA 1P45A 4B7XA 1P9LA 3Q9NA 1NR1A 3H9QA 2HU2A 1PJBA 1HE2A 1UH5A 3DR3A 2O7QA 5A3VA 3AUAA 5F1OA 3JQAA 1NHWA 1ZVMA 3HNPA 1DAOA 2JAHA 4DA9A 1D1SA 3ZU2A 3OJEA 1HE3A 3VPGA 5IZCA 6LDHA 2WYVA 4UUPA 4BO7A 2G1UA 3ZCXA 4RGBA 2WD7A 3DDNA 2UUPA 2CY0A 4BOYA 4CMAA 2VRBA 2EKLA 5F5NA 4D7AA 5JY1A 3RBVA 1LEHA 4I9UA 1YBMA 1E7WA 4XD2A 4NZ9A 5ILGA 3TZ6A 4ZICA 2I99A 1UDAA 1XEAA 1YJ8A 2D0IA 2JFHA 3SC4A 3EZYA 3GGGA 3DAPA 4CM7A 3DXFA 3VTZA 5TQVA 1IZ0A 3JQAD 3K5PA 4CV2A 1PTJA 2IZZA 4J9VA 2NSDA 1GYRA 1EUDA 1F8GA 2R00C 3LT1A 4CM5A 1KC3A 1VRWA 2OORA 3IUSA 3IAHA 4IINA 1PGQA 5HTOA 1YBVA 3K2EA 3OJFA 1NNUA 3HDYA 1ZBQA 1GD1O 5KKAA 2X5OA 1ADGA 4DMMA 3DZBA 3BMOB 3TOZA 3W4KA 3GC6A 1UDBA 1TA4A 4BNHA 3RSHA 2PKQO 3WGZA 5CP8A 5FWNA 1JU9A 5JW6A 1NTOA 2VYNA 3AOGA 3CZRA 1XELA 2JHFA 2HJSA 4MVJP 3H5RA 2FPIA 1Y8QB 3BHJA 2VZ8A 4I1IA 3WIEA 3WXBA 4IDEA 4K28A 4P4GA 1IUKA 2NNLD 3PHLA 4CV3A 2IZ1A 4ZRMA 4R9SA 4PLVA 1DJNA 4O5OA 3WLFA 4EEXA 3I23A 3DZJA 3PJFA 3EAGA 4YQZA 3VVCA 1WWKA 3WGYA 5IJZA 3NTQA 1XU7A 1K6IA 3RQSA 3HJAA 4PLTA 4RVDA 1KEVA 4G65A 1F0YA 3E9MA 1R6DA 3NV9A 4MO2A 4FR5A 4G5HA 3JQ9A 5G4KB 1YB5A 5AOVA 2I9PA 3KYDA 1EUCA 2VYND 4ZQEA 4CR7A 3UCEA 1KC1A 3ZNOA 1JW9B 3U0BA 1IHXA 2V6FA 4W7IA 1H94A 3DHYA 3L77A 1O95A 3V1YA 3WFJA 4X54A 4AVYA 3E82A 1HZZA 2UUOA 3DQPA 1YXMA 3ONFA 3UCXA 1Q2XA 2X0JA 4U8GA 5ES3A 4Y6PA 1T2DA 4BMSA 1MUUA 4OKIA 1UP4A 5T5QA 1NX6A 2Q2QA 5T8KA 4RVUA 3OECA 3TZQA 1RPNA 2W4QA 2HMUA 3JD1A 3DZKA 3Q2IA 1HETA 1YONA 3HWRA 4HY3A 3VDQA 3G17A 4L9RA 4ALNA 1E1KA 3EUWA 3QWIA 3Q9UA 1L1FA 4JCOA 3WIDA 3ROMA 3E5MA 2YUTA 2J8ZA 2YDYA 1ZW1A 4A10A 4J4HA 1Q7GA 3ANMA 3R6DA 1SAYA 5I7EA 3QVOA 2AEJA 4CM3A 3GMDA 3LC7O 5FF9A 4XQ9A 3WDSA 5A03A 5EINA 5IDYA 2OBYA 5COQA 4IDGA 1F17A 3UOGA 3JQCA 1UP7A 4MPDA 1JAYA 3RC7A 5DP1A 4BNUA 3ZWXA 5A9RA 3QVSA 2C59A 1NXQA 4FCCA 3BTUA 1MFPA 3ONDA 3I1JA 2YQ5A 1HDOA 3BMOA 5B37A 2EW8A 4J1TA 2A92A 1W8DA 3GHHA 3A14A 2FP4A 3AI2A 3HFSA 1IHYA 1VKNA 2BFAA 1ISGA 2EGHA 3FTNA 3LVFO 4QFCA 4PG4A 1W4ZA 1ISJA 3PZRA 1BTOA 4RQUA 4UVIA 4QQRA 1KBZA 3ZWNA 5BSFA 4GPD1 2B83A 1Y8QA 4CLDA 2NQTA 2A9FA 3PIDA 3P7MA 2R00A 4OOFA 2IYOA 4PLWA 2EEZA 3AUSA 2H6EA 4NFHA 5JYDA 5KKCA 1LDBA 1SEPA 5MDHA 2GO1A 1PJQA 1Z7EA 3W6ZA 4FDAA 1X0XA 3WJ7A 4K1LA 3AY3A 4YXFA 3I52A 4BMVA 3JD0A 3VAZA 2PLAA 5G0TA 4R16A 3H65A 5A04A 1KEUA 1EBFA 1I24A 4DQVA 7MDHA 5G4KA 2I6TA 2Y67A 1DHRA 1R15A 3C7CB 2CNBA 4KDEA 4UVGA 1SBYA 4CLHA 3UHAA 2DC1A 4A26A 3ITDA 1KVQA 2OFPA 5TX7A 2G0TA 4EW6A 3VPXA 2P68A 4TKMA 3WSVA 4DGSA 2GF2A 1GQ2A 3ITKA 2CUKA 2DUUA 1QXSA 4YTEA 2Y99A 1PS8A 3ZWAA 4U6QA 4HP8A 3I6QA 5CHEA 5KCZA 4YQYA 3FWZA 3GPDG 5ADHA 2B0JA 3PWKA 2HMWA 2CFCA 3JD3A 1LQTA 4XDZA 3RU9A 5HM8A 3RI3A 4BKOA 2FZWA 2Q49A 4CLEA 5A9SB 1KERA 5IAAA 1P74A 1HSZA 3EDMA 4D42A 3KEOA 3GUCA 5GZ6A 5L4NA 1LDEA 1ZEJA 4RVHA 2IEDA 5FI5A 2DBVO 4YBZA 1WP4A 4AJ2A 4Z9XA 1U5AA 4UUMA 2NVBA 4L0QA 3RFTA 4GLLA 3OICA 4E4YA 3OEWA 3CINA 2G5CA 4R3WA 2IDZA 2VTDA 3OBBA 4NBVA 5L7WA 5L4SA 3H8VA 3PHHA 4TWRA 1Z75A 4OM8A 5K0ZA 5B4VA 1HF3A 3QWHA 4FJ2A 3QRWA 4YAKA 3LU1A 4ALIA 2Q1TA 3FD8A 3ULKA 3AK4A 4PGFA 1HZJA 1UP6A 3PRJA 3JQDA 1IY8A 1ENYA 1NPYA 3JQGB 2QIOA 3WMWA 1PR3A 4N5NA 1PS0A 2D3TA 1H93A 2WTBA 2NWQA 4B7UA 4MP6A 4WKGA 4YDRA 2C5EA 2RCYA 3JQEA 1EQ2A 1QRRA 3K30A 1VKOA 2O4UX 4MVJE 3OEYA 2PD6A 4DC0A 1BW9B 1H6BA 4OSOA 3HDHA 5JDCA 1Q1NA 4RPLA 1PU2A 1XCBA 5U4QA 4CUZA 1WZEA 3AI1A 4QO8A 4BS9A 1E1LA 3OP4A 5JCXA 3VVBA 1BGVA 3HG7A 3LT4A 2C29D 4PLGA 4II2A 3I9JA 1W0CA 3IKTA 2J5KA 3M2PA 3WGIA 2AQKA 1RYEA 2YYYA 2WYWA 1ID1A 1LSUA 1GU7A 3IQDB 1P33A 5LCXA 1L7EA 3MOIA 1C14A 3CZMA 4B3IA 1ML3A 3W4JA 1GR0A 1B14A 1DXYA 3EGOA 3GAFA 1U8FO 2J6IA 1VL8A 2J3JA 4FW8A 2NLOA 5H82A 3DZIA 1JDJA 2X9GA 5KVVA 3O38A 5IG2A 1R37A 3WBBA 1ZJZA 1HDXA 1DC3A 3KZVA 5A3JA 1P1FA 3DZGA 4JJGA 1EVYA 2VNAA 3RKRA 4D79A 5JNLA 1DLIA 3VH3A 1B0AA 3TDKA 5A9SA 2NADA 4MVJM 2VZ9A 5DZSA 5L7YA 3SLGA 5JMPA 1ADFA 4XJSA 2B4QA 4MP8A 4IXTA 4QECA 4IS3A 4DREA 1D4FA 5IDQA 5G4LA 1XQ1A 5IF3A 3EC7A 1LUAA 3DWFA 3TF5A 4RF2A 3HHPA 5IN4A 4RF5A 4F3YA 3V1TC 2C54A 4GGPA 3C1OA 1R0LA 3BMNB 3GG9A 3H4VA 5F3RA 3VKVA 1R4NB 1PSDA 5GY7A 4IDBA 1FMCA 1ZZEA 1YB1A 4BB5A 1ZEMA 4J4BA 4HFJA 4NIMA 5B12A 4BQRA 3KV3O 4YB8A 2P5YA 4Y67A 4D3SA 4CLXA 4AJJA 3RC9A 3ANNA 3A06A 3JQGA 1ZH8A 4U0JA 1ULUA 4H16A 2HDHA 5CEFA 3LK7A 5A06A 5FEUA 2FZEA 4AJIA 2EGGA 4L4XA 3GG2A 5EPOA 2RH4A 1DEHA 3W8DA 3CPSA 3H9EO 1ZFNA 1BW9A 3CUKA 2VRCA 1I10A 3ZNPA 1OBFO 4GWGA 4RORA 4YCAA 2DT5A 3OA2A 4ALJA 3TL2A 2J5QA 2AE2A 3NDJA 1NR7A 1A9YA 3H5AA 4FFPA 1U7TA 2O2YA 4P38A 1EVIA 1PL6A 5KJEA 4F46A 5TRTA 2PNFA 4RJTA 1QV6A 3KB6A 3LT2A 2IYPA 3DAFA 2ZCUA 2VRCD 3WGGA 4B4VA 4BO3A 2P91A 5EQFA 3DOCA 2GYYA 2JAPA 1CQJA 2YV1A 1BXZA 3MCVA 1IOLA 1QYDA 4K6CA 4NBUA 3E9QA 4AFNA 4BNLA 1CQIA 4JIGA 1T24A 4DWVA 1PL8A 3OQ6A 3ZHZA 5B1YA 1XDWA 3T7CA 1KVSA 2JCXA 5B4UA 1QYCA 3IUPA 1E0DA 1Z74A 3GR6A 3KSDO 3Q1LA 4PLHA 1HYGA 1MA0A 3CH6A 3B1FA 4WNCA 3HB4X 1VJ1A 4GVXA 2FR1A 3E18A 3INTA 4M54A 1OMOA 5L51A 5KOIA 1CERA 3KRTA 5ENVA 5DNAA 5KJFA 5JO0A 3G1UA 4CMEC 2X58A 4FFLA 1DIRA 1GCOA 2ZIZA 4ROSA 3QVTA 2QZZA 4TSKA 1LC3A 1NP3A 1TVEA 3DZFA 1O89A 3BMNA 2GN4A 2GERA 5DCWA 5AXAA 1R4NA 1PQUA 1ZK2A 4E2YA 4L75A 3M1AA 4PLYA 4CMHA 1NYTA 1PQWA 2I66A 1E7YA 2CF5A 2GD1O 2RBEA 5HRUA 1TT5B 1EE2A 3GF4A 4JBIA 3BMCB 1MB4A 2O4CA 4YJHB 3LSYA 3BHMA 2H63A 3JQFA 4TRMA 3DMTC 3PHIA 4HXYA 1PJTA 4YACA 4EUHA 1V3UA 3PVZA 4FJ1A 4HFNA 1ZO8A 3S2FA 1HTBA 1ISIA 1MXHA 1XA0A 1F12A 1P0FA 3FPLA 1R16A 3KUXA 4KMSA 3ZI0A 1CF2O 2G17A 4UEOA 2XPCA 1PJSA 4E33A 1DC6A 1GFSA 1NPDA 2D5CA 4OO3A 4HADA 5T6BA 2NVUB 3D4OA 1ZKMA 3LZ6A 3FR7A 1HXHA 3NGLA 2P9EA 2O7SA 1E92A 1GV1A 1T25A 1EE9A 3UN1A 4NH4A 2JL1A 1ZSNA 4UEKA 4D45A 2CVQA 5DCYA 4E13A 1V8BA 5EN4A 1HLPA 3MJTA 4OQZA 1U9JA
chains in the Genus database with same CATH superfamily
4H1TA 4IQFA 2CVFA 3DOOA 3NBMA 1TB4A 2C9OA 4M0EA 2IPMA 2ZUBA 3BH0A 4OAOA 4ZI7F 2JVKA 1JQ3A 3QKSA 5IM5A 3K09A 5EXXA 4YCSA 3DZCA 3SHQA 1QHXA 1NV8A 4F45A 3UC5A 4B87A 4D0NA 2AFIA 3BQ9A 2GAFA 1OY1A 1TF5A 2ABWA 4PX2A 3SE0A 3WNQA 4A8JA 5FTMA 5D3KA 1N5KA 3FNQA 4JAVC 1UJBA 3BTOA 3FSEA 2VHQA 4JASB 1YA8A 5BR8B 1KXZA 3O92A 3ETDA 1UC9A 1VLJA 2BSAA 3SZGA 2B21A 1T3HA 2O3JA 4HUQB 3Q40A 3TD9A 4IF6A 1Z6YA 2W2LA 4Z86A 3GRZA 3UAGA 1QCYA 2VG8A 3QPDA 1TZCA 3HN2A 2H4ZA 2HKIA 2FQ1A 2OAQ1 3B5IA 3IEUA 4NCIA 3WGUA 2J31A 1I3NA 3QPBA 4CPDA 2ACWA 3E53A 1MOPA 5EZSA 3HABA 1YTUA 2XIQA 1VLQA 4Y8VA 4JYCA 4DJTA 1TM3E 1V2HE 3F3SA 5B2ZA 3HKEB 3LUGA 5LLTA 1Z56C 4OHCA 2J3DA 2IKSA 1NZFA 4G5FA 2HSEA 2EWWA 4YP1A 3U3DA 3IV6A 3UAVA 2O59A 2IEBA 2BVNA 3FDZB 3WP0A 1I4TD 4RZ3A 1O4VA 2ZTMA 3F3MA 4O25A 2VSNA 3IVMA 2GAJA 5LQRA 4YRPA 1JN0A 1KR5A 4BV3A 1PT6A 2GHTA 2Q29A 2ZJFA 5GMOA 3GA5A 1B4DA 3TWOA 1YB7A 1M7BA 3TM5A 5ALPA 4TVSA 2FWJA 4IDCA 5KOHB 1BX0A 2L42A 3E35A 3R3VA 2GVDC 5E9QA 3WV4A 1M2OA 3C3MA 3B36A 1XQXA 3IHKA 3K5HA 3OQIA 1J5EB 4AXXA 2IELA 2CW5A 3WMEA 3T5MA 3JASA 3OOYA 1H8ED 3C3CA 4WZAE 2Y0CA 1TT5A 3D64A 2JH3A 4GI3A 5D3MA 1VKRA 4QYSA 1X70A 3JPWA 1GUAA 2ZRBA 3A10A 4YJHA 5H5JA 5HGXA 4ZYVA 2I22A 1JVBA 4ALMA 4Z0HO 4ZDKA 1K7FB 2ZPTX 1TTHA 4EG3A 2OHVA 3ISVA 1FVOA 4M0DA 3GEGA 2FI1A 2ODBA 2YZKA 3ED5A 1WHTB 4M22A 1Y1LA 2XRFA 4G56A 1U2RA 3ZDDA 4JMLA 3KZNA 1QH1A 3ADPA 5A7HA 1GZ4A 1HE4A 4WCFB 4ZHSA 4YRSA 4GP6A 1HEYA 3AM4A 1LZKA 1IXRC 3BUSA 1QANA 1EWRA 2WJ4A 4BP9A 3CB4A 4X7BA 3THWB 1DPFA 1AHIA 1PK7A 1MV8A 2H2FA 3EQ2A 4FYKA 4PFSA 3FVQA 3HM9A 3FHTA 3C48A 1C9EA 4R40A 1N1EA 2KS6A 3H6KA 3FUTA 3EMDA 4KAAA 2H07A 3DWIA 4RSRA 1QSGA 5ENDA 1ZD3A 5BN4A 1GXSA 2J6BA 5F73A 2PRJA 4MDFA 1BRMA 1DINA 5HBRA 2WJAA 1E6WA 1E9BA 3IS3A 3L43A 3BTSA 3Q3IA 4L1KA 3VKUA 4LQ4A 3B1WA 3LBAA 1HV8A 1U1FA 1U4SA 2E89A 1L5LA 3TIIA 1Z4KA 1HDIA 1AB6A 2HSWA 2INGX 2OLKA 1G20B 4LVUA 1GAWA 4RDIA 5EJ6A 5IANA 3RLIA 2HLNA 3FPFA 1C41A 4J0JA 4N4AA 4NABA 1D2RA 5DYTA 3WLNA 1O58A 2VXBA 3ND5A 3F73A 2CEKA 1BMDA 4O33A 3TX2A 4MTCA 1RPJA 3DEFA 1NMEA 2GYVA 5JZOA 4KLRA 3I9MA 3N2LA 4AZSA 3C74A 3DS8A 3EBOA 1GZUA 1UPBA 1GZ5A 3ZJ5A 4EARA 1L7OA 1DT3A 1YZHA 3DVLA 3TSOA 3JQRA 3K73O 4HO1X 4I1PA 1FU7A 4MKFA 3WGMA 1R7RA 1W88B 1Z6QA 2PTHA 1C3VA 2PVPA 5L7TA 3H11A 1OI7A 2CLSA 1IYZA 2YVQA 1QJ4A 2UDPA 1M0EA 2BZGA 2CZCA 1K9SA 2NU6A 3ZKWB 4XE5A 2IS2A 1NJ6A 2VPXA 5IBQA 3L3BA 4KUGA 1IFXA 5H1YA 5F9FA 3GGOA 2OQRA 1TA9A 2AI2A 5IT9A 4Q3NA 3JQBA 5J23A 1XZAA 3T38A 3UTDA 2G76A 4IVQA 1S9DA 3PEFA 3VO8A 4CMBA 3RJZA 3F74A 1ZNZA 1E8DA 1KJJA 1CY1A 5BSTA 3REQA 1LPBB 2XWJI 3HP7A 1UFQA 3ESYA 5G0WA 3JYOA 1KPGA 1GTSA 3B8HA 4RK6A 3TNLA 4HZIA 2Q3BA 2YYSA 1FLVA 1I13A 1S3IA 1RJFA 2VJYA 4CG2A 2JAUA 1W2GA 2FN3A 1DQYA 2LCQA 1KARA 1N0IA 4AUMA 1FQKA 1X0VA 3CIFA 3IALA 4FYJA 4E70A 3ZDQA 3R0VA 1FSSA 4DS3A 3I6YA 4C0BA 2XWBF 2ZULA 4FYPA 1V37A 1VIYA 3OOEA 4L5CA 5CVDA 3WMGA 4GMXA 3KKLA 1A7JA 1DBSA 1E3DA 2HGSA 3DOHA 1WXHA 2Q0SA 4OP3A 1PFQA 5DFAA 4CXMA 1VA4A 1M76A 1UMKA 1XLUA 3GLSA 2Q4EA 4JQSA 1ONOA 4OHOA 2FEMA 3F5DA 3LM8A 5THKA 5LQJA 2J9FA 3EVBA 3EK2A 3S29A 3DPIA 2QDXA 5HKBA 2HLPA 3BXFA 2JVJA 3WA7A 3KUKA 3KBOA 4B4WA 2BGTA 4DABA 4FZJA 5EIXA 4N48A 3W9UA 3KZMA 5KC9A 1K27A 3V3TA 3PD7A 3UH1A 1XDDA 5B6JA 5CNIA 4Q4CA 4DFDA 3E1KA 3E61A 1UM9A 1NZDA 1VI6A 2ZDQA 1SUAA 2JBWA 1WE2A 2FLWA 2C07A 3M6IA 1MRNA 1DRVA 4D44A 3PC3A 2BMVA 1YVDA 3U4QA 4N3NA 2WAMA 3DTTA 2QMOA 3O9MA 2WU1A 1PZNA 1NUSA 3OX1A 4OH1A 1YASA 5I9IA 3IVAA 1N0HA 1SG9A 3PB3A 5BN1A 3PK0A 2ZRGA 4KAJA 2GTHA 3MTIA 4CMCA 5EZ6B 1EDOA 4BAUA 4O6VA 5KZMB 1QIGA 1ILEA 1J2UA 5TMEA 2DLDA 3QVWA 3EH2A 1ISMA 3KYBA 3RIGA 3R44A 4PXSA 2XUOA 3L7DA 3QPCA 1WU8A 1RVDA 2X4LA 2J6HA 4KG7A 1WCYA 2CV2A 4ZV7A 1T26A 2QX9A 3AOEC 4MKZA 3ZQ4A 4AF7A 1XMPA 4H17A 4BQSA 2BWJA 3GLHE 1WEKA 1KYWA 2GKGA 1J23A 2ZW9A 1A96A 1EZZA 4D9FA 4IJUA 1M1YA 4XOIA 4CCWA 3OTOB 3ENNA 3A6JA 5FR2A 4UQOA 2QV0A 4YMGA 5FNVF 2TMDA 2B1RA 2WFMA 1E1RA 3K53A 4RMIA 3ZE0B 3I5XA 521PA 1VCIA 3IT3A 4BFWA 2DT8A 2Q1WA 4RKRA 2IOHA 4RGQA 4MWOA 4OJNA 1W19A 2W6NA 2Q3EA 4OQXA 1BDJA 3H2ZA 3N8NA 2E5WA 3EA0A 1LV7A 2V96A 3KZ1E 5DBEX 3ICPA 4ERXA 5K8TA 4RY9A 3KDSE 4X41A 3SQWA 3NHSA 1JE1A 5KTOA 5FULA 4BNDB 1YS9A 2JPDA 1KJZA 3LF1A 1IXKA 2W6QA 4M0MA 3MD0A 1TW3A 2IS1A 1Z0KA 1D4OA 4B6RA 2YWBA 2YHBA 3U9LA 2E5LB 4J03A 4LOLA 4QKQA 4M46A 2WMDA 2R84A 4Z9YA 3L04A 5ICMA 1VIMA 3N8GA 5JH7F 5C5IA 1AHHA 1G1AA 1S2IA 1E9SA 4OH7A 3KOZA 4RNDB 4U6NA 5EPUA 4TS9A 1JU4A 3STYA 5K3EA 3HI6A 3IQHX 4PXYA 3E1GA 4J0QA 1WCXA 3K9GA 2OL4A 5J2UB 4TS1A 3OQNA 2BMFA 1GRRA 1PX0A 3LOUA 5KQGA 3AHFA 1KFBB 3ECAA 5JH7A 3DBRA 2RI6A 4HX9A 4LOAA 5EJ4A 4I3HA 4H1VA 1QFSA 4AL4A 1Z73A 2ICAA 1MB9A 1A8UA 3UWDA 1H5NA 4ZA2A 4NCHA 5B57C 2FPPB 2XA9A 2Z9DA 4UQPA 5JSZA 3L8MA 5ER9A 3L0ZA 4YT5A 4GP7A 3LDUA 1JFVA 3QEOA 2VJLA 1E89A 5ESDA 2EQBA 5E4JA 2QE7D 4BKQA 5BSGA 1WXQA 4JI5B 1S8OA 2OAP1 1MPXA 4HNAA 4EA6A 1KQFA 5CDSA 2C5SA 3DZHA 3RCBA 4AKGA 4ENPA 1C9NA 2WF5A 2I80A 4JVOA 2FPRA 3HADA 1TGYA 1WCIB 1TKBA 2YYAA 4J0GA 3TLGB 4R7ZA 3RO7A 5ICFA 4B3XA 3L1KA 4UEQA 4ER6A 2FETA 4HVCA 3AFIA 3FZGA 3BB1A 4M89A 5IEBA 1RKQA 5C53B 4OV6B 1AXEA 3NTXA 5AJYA 2ECFA 2FQWA 3GWZA 4K9LA 2OE2A 1L4FA 2BEWB 2DCMA 1F0KA 3JYNA 1P18A 4V0KA 5F35A 4F4JA 3THXA 2G3YA 1JGTA 2C4TA 4ZZIA 3AV3A 3CW2A 3ZHTA 1VLLA 1E0SA 1U8EA 1Y7HA 1PUXA 1EDZA 4G5RA 1DZ3A 1QDUA 5B6PA 3FX2A 5GONB 3MTGA 4J6EA 1TQ2A 3RASA 2V7VA 4IR7A 3L4SO 1N6LA 4KO2S 3ZEIA 4DLBA 2I0FA 3ZJ4A 1ORVA 3I3SR 2Z08A 3LUHA 4BWVA 4CFSA 5L3ZA 4V39A 5LJIA 4MRNA 1K7CA 1H6CA 3VDXA 2R47A 1YOVA 1GPLA 3A9VA 4WZZA 1V7PC 2K7FA 4GQBA 3SC6A 1JXOA 2NXCA 4XIJA 4D41A 2IH4A 5AW6A 4YJGB 4HXFB 3FNEA 4DRYA 3AEUA 4BNXA 4XEHA 5IUNC 2OCKA 4NQRA 3E9RA 4FBLA 3VAYA 4DV7B 1AV7A 2HADA 1LC0A 2ZQYA 5IKOA 1J39A 1OE0A 2I33A 3EEFA 5FL7A 4UTPA 5AVOA 3OQHA 1NUUA 4QFDA 4PX9A 1UKAA 1JDVA 3A4VA 1ITZA 2QZJA 5E1MA 2F1JA 3PDUA 2W42A 1WX1A 1E2IA 1SUBA 2O1SA 3MT8A 3SYMA 3FMVA 4FHEA 4HSGA 3VYUB 3WGQA 1XZBA 1ZRNA 1NOJA 1G7RA 1GRVA 5EP4A 5DK6A 3VR0A 4A36A 2WVJA 3O3OB 2O2IA 3NCHA 1U1IA 2Y6UA 3WZ2A 3BJMA 3HKCB 1ZSVA 3A3NA 3IHWA 4PIMA 5GGYA 2WJVA 4BIMA 3UA4A 3SM3A 3D8NA 1FPMA 1K86A 2YBEA 1F5SA 2VK8A 5F9MA 4J2HA 4QPZA 2JHGA 3PUHA 5G2OA 1KI6B 2IEYA 2BKLA 5K51A 5KNDH 1WW8A 2X8BA 3PFGA 4PW0A 2ZIEA 4WK2B 1EFRD 5HWSA 2OB1A 4MINA 4UASA 4LTDA 3VUFA 1EA7A 4MGKR 1BA3A 1G8YA 4PZDA 2GB4A 5CM8B 2OR3A 5AHRA 3ST7A 4TRNA 3BJEA 1N1DA 3I64A 4KZPA 3VU8A 2YOFA 4CZ2A 2C3YA 1QIIA 4FC6A 2QUIA 4KRYA 1CJVC 1H2BA 4PE5B 5ERYA 5I7VA 4FUQA 5AIAA 3NBQA 1T2NA 3H1PA 1ULSA 4JL8A 2PLFA 4W9NA 2JANA 4HBGA 2GXAA 1KBQA 2Z1NA 1NVBA 3WLPA 4B85A 1XVTA 1L9XA 1QE0A 1MO4A 1J21A 1PT8A 3PNVA 4PYOA 1V1JA 2HJWA 3DUWA 2BFDB 3AZQA 4B79A 3EW9A 4B7CA 4MR9A 4BQPA 4D0RA 1L7AA 1V41E 4JJZA 1JDTA 2TECE 3LUAA 3WGNA 3A7EA 4QG3A 4FQ8A 2FW7A 3L46A 1XLVA 2C7GA 2B1IA 3FFTA 3T52A 2QLJA 3MJHA 4RVFA 5M3BA 2O2JA 3D3WB 5EXSA 4TWBA 3ZIAD 4JI7B 4HK4A 5KWVA 2RMKA 3WK8A 4X44A 2BMAA 3T7KA 5CYFA 5FI1B 4ZEXA 5JWHA 5H59A 1G291 1DXQA 1PN3A 4R4JA 4DY6A 1IRXA 2ETVA 2DB3A 3ZTWA 1WDMA 1J8FA 1U3UA 1RM0A 2W2TA 2ZBFA 3N59A 3TD6A 4C9BA 3E4CA 3SDBA 2P0AA 3Q3EA 4P7GA 3TJRA 1GTJ1 2E48A 3N0VA 3AVWA 1UXHA 3A2KA 5KOJB 2ADOA 3PNLA 1QVWA 3H3FA 1P9RA 3PENA 3CX8A 2UUCB 4ZGWA 1FRQA 4FNAA 3SS7X 1P5HA 4LJSA 3QMMA 3IFSA 4A23A 1QMPA 3MPOA 5F21A 2AMFA 4RPJA 2IX3A 1O8CA 3L6OO 4NC9A 1BMTA 7AT1A 1RABA 4QNNA 4JJAA 5IM4A 2ZJBA 1XPOA 4KGDA 5D51S 1FFBA 1YJQA 3ZWMA 5CR9A 2HN9A 2RI1A 1P4RA 3DBLB 3LBFA 4WK4B 4ESOA 1IBMB 1WB5A 4WN9B 1OXKB 4ZT2A 1DKNA 4ZXPA 4XWKA 1PG0A 3FWKA 5LMCA 3WVNA 1L5WA 3QJ5A 2RAVA 3JQ8A 1R1DA 5IARA 1HYEA 2J9ZB 4ZI7A 2JF0A 1DC8A 2ACEA 4O2AB 3K8ZA 3WX0A 1TEVA 3ETEA 1Q1GA 1DO2A 5JCOC 4UTZA 1HDEA 4WCDA 4YHHB 1O0BA 1F20A 1R12A 1TPZA 1EKXA 4I1SA 1IUNA 1XCPA 1P5RA 2HUNA 2QL6A 3TZEA 2D06A 5KYWB 4BB0A 1EBBA 1QFJA 2H1LA 4WT7A 1T6ZA 1YZ3A 5I9TA 2GSDA 2RG1A 5DF1A 1SVNA 4BMNA 3AWDA 2PR2A 4C87A 1S8AA 4RACA 1XL0A 3DWEX 1O96B 1NVFA 4S04A 1JMKC 1Y8RA 4AB1A 2HPVA 5AJUA 2ID9A 3IERA 4IHKA 3BT7A 5I8WA 1ZHHA 1BJKA 1XZIA 2E21A 2G40A 3TSWA 4BZWA 3NI2A 5BR1A 2E37A 3B6IA 3CJQA 2Y1DA 1TU0A 3TW8B 1NJGA 1JBEA 1O94D 2FPOA 2I62A 2F4NA 3IDZA 4UDOA 2C2BA 2HIGA 2HTEA 3DF7A 2RHGB 4WLOA 2WTUA 1EFVA 2HLDA 2LDBA 2VJOA 3NWBA 4TQGA 4WUVA 5FOQA 4CKBB 5IJAA 1I4OA 3GDHA 3IRUA 2D3WA 5JRDS 4YMLA 3QBDA 5LL6P 2G6TA 1LDNA 3RWOA 3JV7A 3MWEB 4LRSB 4KV9A 4NXMB 1D6MA 4S12A 2DBQA 5FI0B 3UMJA 4ADSG 3K6SB 1UK8A 3NHZA 3PITA 5KYVA 2V7GA 1MGPA 4JUFA 2FEWB 3GO4A 1PZGA 3GZTB 3L8GA 3OJ0A 4UAVA 5F1KA 1GDDA 1KH1A 3C6MA 4KLCA 3U3XA 3AILA 2HWWA 1HURA 3IMFA 5MHTA 1ZGHA 4JJ4A 2IP2A 4EZBA 4JXZA 1BYUA 3M81A 4KXLA 1XLTC 2BAGA 2ZE6A 2RKOA 5HIMA 1RWQA 2XAUA 2DUWA 2OWDA 1UKYA 1EIZA 5G0SA 4LXTA 4TYYA 2WM3A 1YDHA 4GBJA 1X7ZB 4OXRA 4LNAA 1NRIA 4DBLE 2GEVA 4J29A 4XDHA 4BO2A 1C0PA 3R5SA 3ORSA 1XQWA 4GOXA 2XSZA 2PS9A 3DKVA 4ENTA 5LP6B 2QRPA 4A7PA 4S05A 2GHQA 4L73A 1ZCJA 3S0JA 4AY5A 1F2TA 3ZZUA 4QYXA 4H4EA 2H5JA 3FN4A 1DRWA 1L1EA 5FO1A 2C96A 1BJTA 2RKWA 3EIQA 4TV9F 5H9WA 3CLSC 3NWEA 4B76A 2GBLC 5FWYB 3KJHA 2VO1A 3G3EA 2J3KA 2QDKA 2I65A 2I4NA 2W8ZA 3H4MA 2J59A 1CLUA 2CJPA 2ZT7A 4KW7A 4YCNA 2BFPA 1TZ2A 2HIHA 3I2HA 4HGZA 4E5YA 3EG9A 3RJ9A 1S1MA 4EYGA 5FX2A 2EL7A 4DIEA 1T0IA 4I19A 1G1MA 1NXVA 3IP5A 4G1BA 5TGZA 1QG4A 2P62A 4KE9A 5E0OA 3U2QA 2Q6IA 1DAKA 3H7AA 1P44A 4XJXA 1QF7A 4GZ6A 4DRZA 3T5DA 2VJPA 1DDIA 2ET6A 3OMXA 1FW6A 2F59A 2H3HA 3P2IA 3GRRA 4AO8A 4QJIA 5DWVA 4UXHA 1MABB 1MN6A 1CXZA 2B2CA 4NOKA 1UOQA 4QHYA 3SXPA 4L8VA 3EXHA 3KQTA 4TROA 3V34A 1OILA 1R8YA 1XMJA 1CJKC 1WSWA 5IKEA 3DVRX 3OCZA 1PWEA 2ZRMA 3V2HA 4N5IX 1YZGA 2H5EA 4Y9TA 4QTZA 1GA4A 2OOKA 3C1AA 1Z2DA 1VLZA 4RKYA 3AYZB 1Q50A 1RCTE 1Z7GA 4UOZA 3IPYA 4PYQA 1XQVA 2B6NA 3BF8A 3ET4A 4I4CA 4L51A 1YV9A 4LHZA 2ZETA 3JQQA 4GIBA 4ID9A 1SQ6A 3A9WA 4X63A 1T35A 1RXEA 3MWLA 3R0JA 1ESZA 2Z3VA 3ETHA 2CUTA 1RAIA 1W4CA 2QP3A 2VOEA 3B2QA 3EZNA 4GPIB 4NJMB 5P21A 2BEKA 4COOA 4HWKA 3HN6A 4YI5A 4MKRA 1XMOB 1ZNQO 5F64A 1X2BA 1UBCA 1W1UA 1Z26A 3FNRA 5EIWA 3QNUA 4QTXA 1RMTA 5IJXA 1B42A 2GPAA 3NIGB 1ZGCA 4TMYA 4L6AA 4LJ8A 2N3ZA 2N9UA 1P3Y1 4RANA 4RPKA 3AKYA 4LVOA 4I08A 1UINA 3OJXA 2JI7A 3GIWA 5CLJA 3H2GA 1EP2B 3JAKB 3UMMA 4HN2A 1T2FA 4NZMA 1J8QA 1IE3A 4FGSA 4XYLA 1FUEA 1Y8CA 4LQDA 3T41A 3ZDXB 4A5OA 1NW7A 1UAYA 3LG2A 1HE1C 5FFFA 2X13A 1PZXA 4ASUA 1WZUA 3ZE2B 4J94A 2ZWIA 4D02A 2EFJA 3V97A 2WVHA 1NULA 4GNKA 4D9EA 4KXVA 1TMYA 3ILVA 2R79A 3CKKA 2O48X 2AXPA 5LIRA 1T9DA 1UPAA 1GL3A 1U98A 4IZ6A 3DMHA 1IVNA 1PFUA 2YY6A 2D59A 1DWOA 5HEKA 3GX1A 3GRPA 4CTKA 4KK3A 2ZI9A 1RLUA 2ZIFA 4HNHA 4PZYA 1Z4JA 2LTAA 2H1IA 1TRHA 3I05A 5DNDA 1XTRA 3FCSB 1KYTA 2V4UA 4PPYA 1PTJC 5J5CA 5DYNA 2BGJA 3T8YA 3I2JA 3VZDA 4EQ6A 2CMDA 5ALWA 3QHPA 5ILQA 1QTNA 4QQ8A 4JP3A 5CBPA 3I9NA 2OORC 5AW2A 2Q62A 1N5DA 3RUDA 2AS0A 4PZPA 2HJVA 2NUAA 3MGGA 4IZHA 3S2SA 4ZYZA 1R4MB 2VHTA 3CY6A 4J16C 3FPBA 4M98A 4JB3A 3WL8A 3NEAA 1UKZA 4OKNA 4TN5A 3FHJA 1MP0A 4HNVA 1L5YA 2XKJE 4HH3C 2SHKA 3MLAA 4KN6A 3T35A 1UR5A 1QF6A 4J3NA 2HTFA 1V8OA 4DIBA 1SKUA 4KHPB 3Q2KA 2Z56A 1I3MA 2A4MA 1S6YA 2XNKA 1R9NA 1V7CA 5FNVA 4MI1A 3FUWA 1QTQA 1GGKA 4YNBA 3SFTA 3NT5A 4MVJD 9LDTA 2V9PA 3GJYA 4FD2A 3W6PA 3AFGA 5TS3A 2PAFA 4PVDA 1AQYA 2A9PA 1QH0A 3QTBA 4DNQA 1ZUNA 2PUFA 1RS0A 4XWOA 1BWSA 4XZ3A 2WKSA 4CM6A 5H3CA 1VSBA 2DHDA 2ZI6A 3ZOKA 1V3VA 2R2GA 1ZH0A 4QFMA 1GUZA 2XODA 3BKWA 5ALTA 1Y5RA 4A03A 1KDRA 2PFGA 2IWHA 3QLTA 4LWZA 2VTBB 2JFBA 1UQUA 1RJDA 1AHNA 1S01A 4BNWA 2R1VB 4URXR 3OPYI 2GUGA 1U8ZA 4D96A 1TQ8A 3AIKA 3GFQA 4Y0NA 5D8DA 1W4RA 4ZQCB 1GGJA 4D25A 4XWAA 4M1SA 1X7DA 1O95C 3SF8A 2V6MA 2DPHA 1IXYA 2GXSA 1TEXA 5TLSA 2BFBB 1HZZC 1ZH6A 5FBWB 1CNFA 2I4RA 2RK3A 2EOAA 4G1MB 2PIAA 4KL8S 3UTCA 2BUCA 4IHAA 5K3SA 2JLUA 1WTAA 4R2XA 3BIFA 16PKA 1P4JA 1GNSA 5AK5A 5KYUA 4IMRA 4EA8A 4BFSA 3UBMA 1AVTA 1H4QA 2HO5A 4O1MA 3V4ZA 2XXAA 4L0DA 4UAGA 2AFHB 1DBWA 4PHTA 4TXNA 4B45A 1LPMA 3NBKA 3TDNA 1H0SA 2ROQA 4KR0A 3QVLA 1Q77A 2D0OB 2X5XA 4M21A 5EL0A 4ZQHA 2WJPA 1J49A 3GDGA 3G8DA 1VKHA 3MG9A 3PLNA 5IMBA 1CUBA 4QU9A 1W5BA 2G08A 2VXYA 3PIRA 4CQJA 2WB2A 4ZT6A 3UWSA 2GGSA 3JVUA 1VI5A 1G0NA 2YHUA 3ASVA 2CVHA 4IGIA 4R98A 4LY0A 1WULS 1NXWA 5PNTA 1T1RA 3WA6A 1QG6A 1TEHA 3KOWA 1TAUA 1UBUS 1ZHFA 4Z5XA 3ZCQA 2PKRA 3E03A 4P4LA 1T15A 4PO8A 1L0BA 2BM8A 3JYQA 3VVMA 3MUOA 2ONYA 2ZYGA 1KYYA 4L7VA 3WYCA 4TXMA 5CXUA 3EPLA 3IIEA 4BLPA 1OI3A 2WT9A 3WSTA 2ODAA 4JFAA 1CRZA 4ETWA 5J5VA 2W6OA 1SCUA 1QCCA 2BBOA 3T7AA 3DBOB 3E48A 4X84A 1PWYE 2OP0A 3HUTA 1YO6A 2HSGA 1E2FA 4PPFA 5K8CA 1FFYA 1C9YA 3QENA 3S2YA 2ZSUA 3N7TA 3IOCA 4WE3A 2IITA 5JAZA 2I91A 1FLAA 1OIVA 2VQSA 3BFPA 3HP1A 1C9MA 4X3CA 4LXIA 4LHYA 5JNSA 4NYJQ 4QLAA 4DMHA 2H11A 4YMWA 4NFYA 2UVDA 4N41A 2VQFB 1DNPA 4KPFC 4ZN6A 3JALA 4EABA 1KTVA 1TCVA 1U9YA 4Y9UA 2O8EB 3RHSA 4F6CA 2OKGA 2DEUA 3GLIE 4NMXB 3UMCA 4I2VA 4B09A 1N2EA 3A4IA 1GLGA 4POOA 3GMSA 3AY6A 4DPLA 4MB6A 4B4DA 5A4IS 5L40A 3CVOA 4D9IA 1ODIA 5K0LA 2B4AA 2BL4A 2IPNA 1FP4A 2RIPA 2XUZA 3LECA 1JQKA 4RKFA 4XB2A 3I4LA 3NTUA 5LMZA 4S1TA 3DVAA 2WB4A 3K0CC 4AMYA 3S5UA 3NJRA 5F3WB 3AERB 4IIGA 2QTFA 3E3OA 5EVCA 1OAKA 3O4FA 1NN1A 2A78A 2JIBA 3DYBA 3N2GA 1X74A 4YT2A 4M1OA 5ELXA 3U1TA 5LMUB 1DRJA 4GG1A 4L9SA 4M1EA 4YROA 4FKBA 2PJRA 4W1PA 3Q88A 2CNOA 3B9QA 2IYUA 4G26A 5EFOA 2NV2B 1P6UA 3JVDA 2AC2A 4BLVA 5C4MA 1U1DA 5AUOB 5JS2A 2PUDA 3MTQA 3R3JA 1U04A 1UBEA 1G3QA 2WSMA 3FOAA 3CNHA 1U63A 3NRJA 2K2WA 2V74B 2BGUA 3BJIC 3S2GA 2YINC 4OMFG 3UAOA 3HB0A 3RC1A 2H2IA 2L19A 3KSMA 3L0PA 2P3OA 3AF1A 3FI9A 4UFNA 3UQZA 5JAOA 2WIKA 2QN8A 3GH1A 4BRSA 4Z6KA 5JC1A 2XCLA 2RARA 3EJ6A 4WZAB 1LQ2A 3ML1A 2QJWA 4PRLA 3V8MA 4LWOA 3CO5A 1VRVA 3VPSA 3FYUA 1DBRA 4O4LF 4UM8B 5KDLA 3MXOA 3TZKA 2C95A 1ZI9A 3IKVA 4J8PA 1NKVA 2X0RA 1FP6A 1T9GS 2Q4BA 2FEAA 2Q8NA 2I4MA 2LXNA 5T67A 4DKXA 2OHXA 4LE0A 3VBEA 4DAEA 2X5KO 3GAZA 4L95C 4EHNA 1SUWA 4OAQA 4QXOA 4MMZB 1YRLA 2ZRIA 2HHCA 4ZI3A 3D4PA 2HA6A 3A05A 4RHXA 2MINB 3DULA 4EG8A 2O8FB 3ZHYA 4BCDA 2QAIA 4I9FA 5JO9A 2AJBA 4W9MC 1JLLB 1OOEA 3IOBA 5EIHA 1E1RD 4D56A 3HFRA 1B73A 2QTMA 2P30A 2Z2XA 3R5KA 2HSDA 4F9TA 1NM5C 2V4ZA 1SD1A 4BN4A 2COKA 2VXCA 3GI1A 2CUNA 2FPMA 1NT2A 2H2HA 2RJOA 2Z5GA 3ID6C 4IP0A 4Q1CA 3UOAB 3WYAA 3LQYA 3WHIA 1PT9A 3W2IA 1NASA 3FIJA 3NASA 2R8OA 1BCRA 1QHHA 2DFLA 5I4BA 3CH5A 1KMCA 2XITA 3BSSA 1ISRA 1KBOA 1YHNA 2DHRA 2EU8A 2FQXA 4P81A 1E98A 5D1HA 3ZHCA 3DJYA 4YUVA 2HO4A 5IXSA 4S1WA 1DJOA 4BX0A 1B7GO 4WGGA 2HYIC 3ORQA 4OEHA 4WBNF 5A1JA 1TJPB 1XI2A 4NENB 1X9IA 4D1YA 3OLZA 5BMVB 4LDNA 1FVHA 3D6AA 2Q3MA 4F6RA 4JP1A 4AQ7A 2PT5A 5H68A 1W85B 2JFNA 3LQFA 4W4TA 3F6RA 4WSOA 3S81A 2PYZA 1EFAA 1Y3IA 2JARA 2QJTA 1ZMRA 4ZC8A 1QGED 3IAS6 2C2HA 4Q1EA 1SXGA 2ZYAA 2X1HA 3QE9Y 1FSPA 4G86A 1BH6A 2MOKA 1NHGA 1SWWA 4NU8X 1KNQA 3OJOA 4XWYA 2MMGA 5FOTA 4BNIA 1LW7A 2Y1FA 4HX2A 2DPXA 3FYHA 3IQXA 2H06A 3CLRD 4PNPA 5DGHA 5FUBA 3RUIA 3MWDB 4J0FA 1SUIA 3RBXA 3N2ZB 4AWAA 1DPGA 3WOHA 2C2KA 1SKYB 1UMBB 2C2OA 2ZRAA 3CX4A 3KFXA 3PPVA 4I3FA 4QASA 1KE1A 3H05A 3I9LA 2ORIA 3FMFA 2CXSA 1Z82A 4I7EA 4X91A 3GLVA 4D82A 4YCCA 5I3ZA 3MEQA 4IRXA 4DBVO 3ZHBA 3FB4A 1MVOA 1K8YB 5A4KA 5EEGA 4EB0A 3LWBA 4MRMA 4O63O 5I01A 1O3YA 4IGAA 3Q7PA 1PFVA 4LMBA 1YL7A 2RAFA 1CTQA 4D2IA 3TMYA 4UE6A 2DBRA 4F1KA 5CAEA 1IAQA 2W2MA 3F4BA 4R8SA 2PVCA 2WZDA 4FHDA 1WMBA 2ID7A 1ZCFA 4IXDA 3ILYA 4ND8B 1JG1A 1YD7A 3TO5A 3OPYA 1WCWA 4ZMSA 1MD9A 1JDPA 2D4AA 2IPOA 2OCAA 2OVFA 4NQZA 1XDZA 4O8ZA 3EQ8A 4RIHA 4Q1DA 2PZEA 4X20A 1KMNA 4F7DA 2CDCA 2P1ZA 2I2CA 4N5LA 5EAIA 2ZP1A 2C00A 4OUDA 1JAIA 5FFNA 4AMGA 4X92A 5DM1A 3T1TA 4JI2B 1HDGO 4PZCA 4A27A 1NA5A 1N2SA 5DU2A 1ZCZA 1FTGA 4LYYA 4E2FA 5A02A 4YS6A 4WKOA 3PP8A 4GZ5A 3TKLA 3GCGA 3UXYA 3NGXA 5KWSA 4KN9S 1U7HA 1KEEB 1VE5A 4L74A 3X2EA 5ITZA 3MTBA 4PN7A 4UHEA 1VMAA 1T6NA 4TGLA 1CUZA 4FGWA 4JROA 2I78A 1Y3HA 1FU4A 1R5NA 4RE6A 3WQRA 5AH0A 1EHYA 1BNCA 1B8UA 2WF7A 4M83A 4B4KA 3NATA 4R8RA 4V0SA 2UZ3A 3GZNB 1T2UA 5TC4A 4EVRA 2VDWA 1GOTA 2DKOA 4N7RA 1M7HA 1ZVVA 2XRMA 4GX1A 2HYDA 1F8FA 3DUFB 4DLPA 5CDGA 3N2KB 4RMHA 1FUKA 1HO3A 1YACA 3HA5A 4K6MA 2H54A 4TV9A 2RHOA 3WP1B 4RTPA 3NNSA 4Y6RA 4LSMA 4IJQA 3T7JA 2GF0A 1A72A 4G84A 2XT6A 1RAHA 5LMNB 4G1VA 5BNTA 4GZMA 2PQ0A 1UDCA 1PJLA 2AFIE 2WA2A 4NNJA 1EFPA 4B43A 1E20A 5FPYA 4CMIA 2F00A 1LRLA 4XGNA 1IM5A 4JODA 3PICA 1BYIA 3W5HA 2Q0QA 1QPBA 2PL9A 8ADHA 4LEIA 2FUEA 4KR7A 2XJ9A 1GQYA 2BLNA 4DMRA 2GNAA 4L0MA 3FNHA 3IESA 1IONA 4ZJPA 5EJ5A 4U0KA 1XZGA 2AX3A 2WWFA 5T57A 1W4LA 4CEJB 4M0UA 4YPOA 2DPGA 2XYRA 3GLUA 5HA5A 3DLHA 4JLWA 3KFVA 4A16A 4A8HA 4AJLA 5CFQA 5L3SA 1N2XA 1MBZA 5MGBA 4ENSA 1JFSA 4UHKA 2C1XA 2CNKA 1PTKA 3GVPA 1KRHA 3HCNA 4CJXA 2YN4A 1PWXA 1P17A 1VP9A 4MR7A 1H05A 1RI5A 4DMUB 5E2IA 1YS2X 1WXFA 1XLWA 3PKZA 3RTBA 4Q3CA 4E5NA 2VKTA 1UMCA 1KDYA 1M0SA 3KLPX 1G8PA 1KXJA 3RUHA 3ZLUA 1WXXA 2QNBA 4IIYA 4LX8A 2WQ6A 2ZM6B 4AKHA 2QTVA 1ORHA 4PGGA 2IRWA 4OA8A 2FEXA 3VZBA 4B8WA 1XDGA 5DLEA 2XCSB 2VNIA 1OXMA 1T5DX 3KJIA 4G25A 1RU3A 2CLFB 3HZHA 4B3DA 1B6RA 1A71A 1XAGA 3G2HA 1MC5A 1BMQA 2C5GA 3A1UA 3EBLA 4QAJA 2P40A 1JHMA 1T1EA 4K2HA 3ER8A 5TDHA 3FLBA 3LKBA 4FHGA 3EOAI 1XA4A 1U7ZA 3AF4A 3RNLA 2P6RA 1KHHA 3F1KA 2ZS7A 1UBKS 3FMGA 4IVRA 4GX2A 2R9VA 1ZMTA 2OK7A 2ERYA 3STHA 4Z9AA 1H65A 2NZ8A 1K3TA 4F8JA 5HOQA 1NXTA 2WZBA 1CHDA 2C9ZA 1AT1A 1JUDA 3ZPXA 1W1IA 3WC4A 2C2XA 1QHGA 3MJCA 2Q3JA 4C4SA 1QR2A 5FORA 2YHSA 3AVXA 2AFRA 1ZM3A 4ZVVA 3QHAA 4CV0A 1QUFA 1EWKA 2HQBA 2IIVA 5KJCA 4WK0B 1RACA 2IIPA 2Q3CA 821PA 2V5VA 3HKDA 3TLYA 1VDZA 2JIPA 3GN1A 4JLKA 4R68A 3TW6A 1O97D 2QNIA 1GEGA 1PS9A 1U8XX 2ODPA 2RGDA 5B58T 3SG0A 4BWFB 3LDAA 3E70C 4I4TB 4QDKA 4ER7A 4PAMA 1Z7BA 5J4VA 3H87A 1K5DA 2VNJA 3K4QA 2XNDA 4FR0A 4Y2RA 2IEIA 5CVUA 2ACKA 2QLLA 4HRYA 3RB8A 4KUHA 1LFDB 5LA6F 3WR5A 2O05A 3FNIA 4BVAA 3FHCB 2ZB4A 4NSNA 3P2JA 3QSGA 1XD8A 3TRHA 2JGIA 4WY8A 4FTWA 4O8CA 1UZMA 3QG5A 1ENOA 1EPUA 1LS6A 3INYA 3TLZA 3UK7A 4F38A 4TTRA 4XVUA 3EVFA 1QFYA 4ABTA 4ARZA 3LZCA 3NO4A 4H08A 4QELA 1QH8B 4R8LA 8AT1A 3G2IA 4L8YA 4AQDA 2W6MA 4I8IA 4XYMA 4CQNA 1JEYA 2NTYC 3DLPX 1Y80A 2OXCA 2ZKLA 2HOQA 1XKXA 1Q0QA 2JZCA 3GRFA 3L05A 1EU1A 2AR7A 2O50A 1NYLA 3KSUA 1KPIA 4Q1BA 3RTAA 3VRHA 4KFTA 5ER6A 2NOAA 4S2UA 4HJXA 4LOJA 2GCOA 2X9VA 4Y1GA 2ECQA 1M6HA 2XLCA 4FBGA 2FRDA 4DJJA 3LUCA 4EOGA 4LFAB 2Y1OA 4N03A 3RODA 4DJEC 2XDYA 1IULA 1AKUA 4I9NA 1A4XA 1P4GA 2PN1A 2RCNA 4K6HA 2JIZA 5AXCA 4QTYA 4EHAA 1BXRA 4JJIA 3U4GA 4KEAA 2PEZA 4KQKA 1R0RE 1ZM2A 3BAZA 3UV3A 1U0OC 3Q7RA 2ZE7A 1G5HA 3HJGA 3QLUA 3QUTA 4MQFA 4FVTA 3TMKA 4C7KA 2O8BA 4K9KA 1FUYB 4OL9A 2O2EA 4BGIA 1Z07A 1IOZA 2WLSA 1PR9A 1T1JA 3QI2A 1V1MA 4ZANA 1S02A 1QV9A 4FOSA 3TN7A 4EJ0A 3HSKA 1M2KA 1PLJA 2QGFA 3P2YA 3OTIA 2OBMA 4JK3A 3ADOA 5KS2A 3HB1A 3I42A 4BUJA 1ECPA 2R66A 2E5FA 5C3UA 5LKAA 1CT9A 4NESA 1YS4A 4FEAA 2CJWA 1VBKA 4KRGA 1AM4D 2ZWMA 1L4BA 4ESEA 4X94A 3UPDA 3IP1A 4BDSA 1X9HA 4Q1AA 2FGKA 1I1QB 3RAJA 5DSXA 5SZJA 4UNQA 2OT3B 1AN9A 3HB5X 4WNAB 3RVKA 3RS2A 5JSQA 5KJ6A 2QJFA 4HS9A 2E0IA 2IW3A 4M0CA 1XN1A 2C5BA 5JFOA 3KQUA 1A69A 1U6JA 4UMEA 3U37A 4OP2A 3V7YA 3KSRA 1RFGE 4KBYA 3PD1A 4KXNA 4PSDA 1JAXA 2BT4A 3LHKA 4TQUS 5D00A 4UREA 1UZLA 4JBYA 3F97A 3VAAA 5E6UA 4BP8A 2DGDA 2J9XB 3GFBA 2FWIA 4FDTA 4MS1A 4D5GA 1RZRA 1NVMB 3DONA 1CUHA 1THGA 3KSBC 3DAHA 1Z13A 4RQAA 2J3QA 3AMVA 1WIWA 3O5AA 5BWLA 5KVQA 4QUBA 1W96A 4WPGA 1N5JA 4N6NA 5BWMA 4DDVA 1P6QA 2AG8A 1GNTA 1MB3A 2H1HA 3GT0A 3M9XA 3OH8A 4KWCA 4YMIA 4LC1A 5IUKC 5BRJA 5BV8A 3CLUC 2IHBA 3K8QA 4QC2A