4LSWA

Crystallization and structural analysis of 2-hydroxyacid dehydrogenase from ketogulonicigenium vulgare y25
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
318
structure length
318
Chain Sequence
MTKPEILQLGPYPAWDQEPLDAAFTVHRLFEADDRAAMLANVGDRIRAIATRGELGASRALIEACPNLELISVYGVGYDAVDLAACRERGIQVTNTPDVLTGDVADLGVAMMLAQSRGIIGAETWARSGKWAAEGLYPLKRRVFGRRAGVLGLGRIGFEVARRLAGFDMQISYSDIAPKSYAPDWTFVEDAVTLARDVDFLFVTLAASAATRHIVGRDVIEALGPEGMLINISRASNIDEEALIAALADGRLGSAALDVFEGEPNFDPRFRDLPNVLLQPHHASGTIETRKAMGQLLRDNLTAHFAGSPLLTPVVLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-2-hydroxyacid dehydrogensase protein
publication title Crystallization and structural analysis of 2-hydroxyacid dehydrogenase from Ketogulonicigenium vulgare.
pubmed doi rcsb
molecule tags Hydrolase
total genus 110
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2013-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lswA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lswA01
4W4TA 3E6AA 4M49A 4A0SA 1GQYA 1WDKA 4FOOA 3GEMA 3OQBA 4PG4A 3LC2O 1PZFA 5F1PA 2HLPA 2AQIA 1LA2A 4YXFA 5CEJA 3UICA 1U4OA 1AN9A 3F6YA 3WGQA 4G2NA 3WWYA 3TOXA 3MJVA 4PLZA 2DBZA 3WBBA 5JC8A 3GT0A 2WE8A 1NYTA 2ZJ1A 1I33A 5FI3A 3RJ5A 1DO8A 2OBYA 2C82A 4RPGA 3ICPA 5DNAA 4O5OA 2O23A 4MKZA 3VKVA 4JROA 4CMAA 1BSVA 3VZRA 2X5JO 3RUIA 5TS3A 3IJRA 2VRCA 1XCBA 2Z1NA 2RH8A 1LDBA 4PZEA 5L7YA 6ADHA 9LDBA 5H82A 3WGHA 3OMLA 1KERA 3BHJA 4XQGA 1VJ0A 4BGUA 1ISJA 1NBOA 2FMUA 1Y7TA 2H9IA 3QVXA 2C0CA 1XDWA 1IUKA 4MIYA 5EN4A 3RAJA 1HETA 1RKXA 3H5RA 5EQFA 1BRMA 1WNTA 4WEOA 2PH5A 3INRA 2O7QA 4Z9YA 3VHRA 1JA9A 5BSFA 3FI9A 4XCVA 3WOHA 1Y5MA 5KVVA 1QP8A 1D7OA 2Q4EA 1BGVA 2QRJA 1YDEA 1PQUA 2I5PO 2AG8A 3VVBA 2A4KA 2YUTA 3OECA 3OEYA 5JPIA 3PLNA 4LVCA 3AUUA 3HADA 1HE4A 2C20A 4IS3A 4WCDA 3WYCA 4GGPA 1ULUA 1O95A 2EP7A 4BO9A 3PIIA 1CQJA 3Q3CA 4E2ZA 1IULA 4MVJA 5CG1A 4L73A 2I6TA 3IUPA 3GPDG 1GCOA 2OL4A 2PNFA 4D0RA 3DMTA 2JAPA 1PJTA 4PZCA 5L4SA 2JD2A 4FFMA 4LISA 4QXMA 2J6IA 2VNSA 3D64A 3L77A 2JJYA 1Q1NA 1BXGA 1TA4A 3JQ8B 3NT5A 4DXHA 1R6DA 2Y67A 3LYLA 4BGVA 2GSDA 4NZ9A 1PZGA 3FCOA 1HSOA 1IHXA 4FGSA 2QQ5A 4QSMA 3EYWA 3FBGA 4XB1A 2LDXA 3DC2A 3RBXA 4WNCA 1DXYA 2PKQO 2Q4BA 4YQZA 3HDYA 1ISIA 5KCZA 1S7CA 1KVQA 4EUEA 2X4GA 3C7CB 4E21A 3JQ8A 3GUCA 4U8GA 1HRDA 1NQAO 1PJCA 4J4HA 5EL0A 2EP5A 4B4UA 1P31A 5JO9A 3EVNA 3K8ZA 4HP8A 4XIYA 4EUHA 4IJKA 4KZPA 4RPHA 1DLIA 4IGFA 2PGJA 4Z3DA 3W6ZA 5CEEA 1MGOA 5JC1A 2ZCUA 1R37A 3VH4A 3A9WA 1SNYA 1DIHA 4QO7A 5COAA 1WZIA 4PN3A 1U3UA 4FS3A 1F0YA 3Q6IA 2Y1FA 2CUKA 1LTHR 3OETA 3S2EA 3HWRA 4DWVA 1ZO8A 3NEPX 2PV7A 3TOZA 1UDBA 1W0CA 4BO0A 2ILTA 1R12A 3A1NA 2NNLD 4IBOA 4RGBA 3ENKA 5TJ9A 2NACA 1GCUA 4CMIB 5COBA 4NFYA 4KWHA 1DFHA 1EVYA 4JK3A 1YRLA 4I9HA 3RWBA 1E3EA 4AJHA 1SEVA 4ZU3A 4M89A 1LBEA 3ZV5A 4QTZA 3NYWA 3WG9A 1LDMA 1EZ4A 2DBQA 4JJGA 4UUOA 4BIIA 2PFGA 2J5QA 3BYZA 4CMIA 3JQGB 3MJTA 5A1TA 4J4BA 1H93A 4KOAA 1ZSNA 1DEHA 1HYHA 2B0JA 4J2OA 1N8KA 4YRBA 4EI2A 1EUDA 2X5OA 2W98A 2IEBA 4MIEA 3JQ6A 4GKBA 4YT8A 1I32A 2P91A 4TZKA 1XSEA 1EMDA 2FHSA 1C0PA 1LLCA 5TT1A 1XQ1A 2HJSA 1V35A 1R4MA 3D4PA 3RUDA 2XXJA 5I7VA 4Q3CA 2FPGA 2IODA 2W8ZA 3NJ4A 5F21A 3V1TC 1WVGA 5IXYA 4OL9A 5A4DA 1C0IA 2AW5A 1EE2A 2E82A 2VCYA 5U4QA 4IDCA 1P1FA 1OOEA 3ZHZA 3GOHA 2DU8A 3WSVA 2PA3A 1PJSA 1K6JA 3PHIA 3HSKA 5C3MA 4DPKA 1HE2A 3VH1A 5ENDA 3ORFA 3RUEA 5U9CA 3KTDA 3VOSA 3IUSA 1T4BA 2VWPA 3RKRA 3B1JA 4Z0PA 4QQRA 4WASA 3DHNA 4XDYA 4CM5A 4R54A 4EEXA 1IZ0A 3PYMA 5A02A 2HMWA 3U0BA 5H83A 3PZBA 4IY1A 4PLFA 3GMSA 5C5IA 2AE2A 1Q2XA 3CZMA 4MIOA 1ZZEA 1MG0A 2C07A 2JL1A 1N1EA 3DBVO 3ZN2A 3DHYA 4IJWA 3AU8A 2X9GA 2NM0A 4CLHA 3T4EA 4WEQA 3ZDFA 2AEMA 2PTGA 1WDLA 3JQDA 4K1LA 4CLDA 3OSUA 5CDTA 2GUGA 3C24A 1GEGA 1UH5A 5MGBA 1B2LA 4FBGA 1U5CA 3RBZA 1MXHA 5ICMA 3C8MA 5K0ZA 4CLOB 3B1KA 4II2A 3KYBA 4BMSA 1GV1A 4IQGA 4FFLA 1I0ZA 3I9MA 1I01A 3FR8A 3V8BA 3H2ZA 3DMYA 1BVUA 3V1UA 1B3BA 5CDUA 3DZBA 3ONDA 3QRWA 4AJOA 2C59A 4IIUA 2H6EA 3GNTA 1ZIDA 3KO8A 1E1NA 4YT5A 4OAQA 3VZPA 3JQ9C 2VWHA 4GBJA 3BMOB 1DIAA 4J7UA 3BHIA 5I9LA 2EHDA 4JCOA 4CJXA 2YFQA 4BNZA 2NQTA 1ULSA 3L6EA 1YQDA 4GLOA 1ZK1A 5IZCC 3HJAA 4IMPA 3MJCA 3ZU4A 1D3AA 3Q9UA 4HFRA 2HMVA 5LC1A 1A27A 2IZZA 1LSJA 3GVHA 2G76A 2HU2A 1L1FA 2X86A 3W8EA 1LUAA 2CY0A 4Q3EA 1T26A 2O2SA 2DLDA 2D3TA 3HB5X 3WX0A 4BNUA 3DBRB 3VTFA 4ZQFA 1ISHA 3G49A 2EJWA 5CAEA 1LQUA 1Y8QB 3JQFC 4R69A 1UXIA 3H5AA 3LT1A 2X22A 2XOXA 3QLJA 4XKJA 4XIJA 4TMFA 4DBZA 4CM8B 3WJAA 3DBRA 4PRKA 1QORA 1ZBQA 1E6WA 2PD3A 4PLWA 1GZ6A 1Y8QA 2CVQA 4U0KA 4RDIA 1GAEO 1I5RA 1HDRA 4IZHA 2Y1GA 3JQCA 2VZ9A 4TKLA 4ZQEA 5I8WA 3SVTA 5KNLA 1HYGA 5IF3A 2Y68A 4M87A 4CM9A 5JDIC 2NTJA 1HE3A 4CM8A 3RC7A 2ZIZA 3H9QA 1U5AA 4Y6PA 3QP9A 1CWUA 5T6BA 1TB4A 3DZKA 2VHYA 3H8VA 1WXDA 4DQXA 3PHJA 3K2EA 5G2OA 1PJ3A 4KUHA 2SCUA 3BMCA 3OH8A 3PZRA 3WICA 5AXBA 4IDBA 1G0OA 2VQ3A 2Q50A 4J4TA 4CMBA 5FYDA 3ZV6A 1U9JA 4OSPA 1EE9A 1NQTA 2ZB3A 2IE0A 3GQVA 3INTA 3ZWVA 1EK6A 3JQEA 2VYND 4R51A 3TQHA 5ITWA 1IOLA 4UEJA 3ENNA 5K6AA 2A35A 2BGMA 2DT5A 2X6TA 3HDJA 1AUPA 4BQRA 3F47A 4RVUA 1IE3A 2Y1CA 4F45A 3DTTA 5A5EA 2Z95A 1M67A 2PZKA 2X0JA 4DYDA 3DL2A 4N5MA 1ZMTA 1UXGA 1OAAA 4M8SA 3GUYA 1E3IA 4CQMA 5CPFA 1IY8A 2DPHA 2GZ3A 5IDQA 2R6JA 5CDYA 3D1LA 4DIFA 4Z0TA 3Q2IA 4QX6A 3RU7A 4CM4B 8ADHA 4ZQGA 3TN7A 1ZJZA 3QWHA 4PG8A 4XX0A 3KYCA 5DBIA 3WQRA 3C7AA 4J7CA 1Z73A 3LF2A 4GMGA 4IDDA 1KIFA 3E03A 3ETEA 3LU1A 3OA0A 4Y9DA 2CFCA 2CDCA 2PGDA 3DBHB 5G0UA 4LN1A 1XGKA 4NDNE 4L4RA 4NFSA 3E82A 4CM4A 2A9FA 4MVJF 1ZXBA 4GWKA 2YHIA 4NHEA 4BVAA 3I23A 1H6BA 1LRLA 2X23A 3FTNA 4MVJP 5IZCA 3D3WB 2EKQA 4CLEA 2C2YA 4O0LA 4TVOA 2WMDA 3DAPA 4DLBA 4YVFA 2JCYA 1ID1A 2AG5A 3OM9A 4FJ0A 1QR6A 4I1IA 3RASA 2O3SA 3JYPA 3OIGA 4U7WA 5AYVA 4BNJA 3FBTA 5L51A 4W7HA 4YPOA 2C29D 1Q7GA 3WQSB 4NQZA 1WWKA 2W90A 1YO6A 3UUWA 2HMSA 1XWFA 1DAPA 2IZ0A 4OKIA 2JAHA 4RVGA 4WOJA 2ET6A 4LMRA 3U9LA 4XJTA 2JCVA 4EGFA 1PEDA 3RC2A 2Y1DA 2D8AA 1HE5A 4BHTA 4UVDA 3K2BA 1JQBA 3LC7O 3ASVA 1R0SA 1NFFA 1PGNA 3DZIA 2BLLA 4R1TA 4UEKA 5JDIA 4LK3A 4CL3A 1UAGA 3AM5A 5GZ6A 2GN6A 3BHMA 3AFMA 3HUDA 3STHA 1PS0A 1PGQA 3OJFA 4BGIA 5ILOA 3UVEA 3NDIA 2OP1A 3DZFA 2EKLA 3PHGA 4O6VA 4OXKA 4XYMA 4DMMA 1NASA 2NVUA 1DIBA 4HX5A 5HS6A 4AFNA 4JBIA 1P44A 3S8MA 1P1IA 5JE8A 3V2GA 5TIIA 1EQUA 2O50A 1AHIA 5JAQA 3GFGA 4AJJA 2AXQA 3WYBA 4AJIA 1YXMA 2FR0A 3WGIA 1I3NA 4W6ZA 3ROKA 2Y1OA 4A27A 1LX6A 3HFSA 4BNKA 2WEKA 4HFMA 1YB4A 1H9BA 2VWGA 3OBBA 2IXBA 2GD1O 2BI8A 3WFIA 4CMKA 3MJ4A 1R15A 1VJTA 4HFJA 5TNXA 4O1MA 1VL0A 2YQ4A 3S2FA 3ZWWA 1MG5A 4L9RA 3ST7A 1B0AA 5L53A 2ZYDA 2WWRA 1RWBA 2VNAA 4JJIA 4O59O 4CM1A 1QYVA 1ZNQO 5HWSA 3TZKA 2V6MA 5DBGA 1YWGO 2FRDA 4ALNA 3KM0A 1UXJA 4P4NA 3WIEA 4XR9A 5DZSA 2DAPA 3LDHA 5LDGA 4YDRA 5MDHA 1PU2A 2VZ0A 1OMOA 4CPDA 5KKCA 3IJPA 2GNAA 1LLUA 2VHXA 1B26A 4YEDA 2Q1TA 4OOFA 3I1JA 4CV3A 1A7KA 3GA0A 4XGNA 3S1LA 4N54A 1H2BA 1JAXA 3KETA 1R0KA 1VE9A 3NAQA 2VOJA 2GPTA 2CVZA 4WE3A 1BXKA 4GSKA 2HQ1A 1X0XA 2JFGA 3NTQA 4P4GA 4H3VA 3UGKA 2E6UX 2NADA 4F3YA 4I8XA 3GVXA 5DOZA 4B4OA 4BO4A 2ZB7A 4A26A 3SJUA 4BO3A 3I5MA 4GKVA 1IHYA 3K31A 4OYRA 4BNIA 1X7GA 3CKYA 4HY3A 5EMHA 1LEHA 1A9YA 1P45A 3DDNA 4FJ1A 4DL9A 2W2LD 5F5NA 3WNQA 4R68A 4B3HA 1ISMA 1M75A 1GUFA 3ETGA 2VWQA 2NU7A 3GGGA 3HE3A 4YQYA 4XYLA 4CMHA 3AK4A 3NGXA 1KVRA 2DC1A 5ENVA 4PCVA 1UUFA 1O8CA 1JKFA 3DAFA 4LW8A 4EITA 1A71A 3UCXA 3GDGA 4IUYA 4KWIA 3ON5A 4IM7A 5KJCA 5L7TA 2P4QA 3E9NA 2QX7A 1KEPA 3GGPA 1PZEA 5EESA 1VL8A 2J5KA 2WJPA 3KLPX 4CLXA 3N74A 5JFOA 3D5TA 1CDOA 4GVXA 2Z1MA 4IMRA 1L7EA 2O2YA 5A9SB 1P0CA 4Q3BA 2YDYA 4NI5A 4D42A 3TZQA 2PD6A 3B20A 2D2IA 3UF0A 1WDMA 4NNJA 1OC4A 3G17A 2OOSA 4ALJA 2RHCA 4PGFA 1E7MA 5JY1A 5A04A 4J0EA 3TZ6A 2ZTLA 3GAZA 4MVJE 2OFPA 5A9TA 2FP4A 3WIDA 3CH6A 3F1KA 4RPJA 1RYDA 2C54A 1FDSA 1U28A 4AJNA 1RM0A 3MJSA 3M1AA 3GEGA 4RF5A 2VTDA 4BNMA 5B37A 5HA5A 5EIOA 4ZRMA 1OFGA 2PD4A 4OGWA 4C7KA 4E32A 1HF3A 3PRJA 4N18A 3X2FA 4HFNA 4YBZA 3RUFA 1MC4A 3UW3A 3IDSA 1EVJA 3F4LA 3KSDO 4KQXA 5ITVA 5KIAA 1PIWA 5L3ZA 4YWJA 3GHHA 4A5OA 1I3LA 2NSDA 4P38A 4E5KA 4XA8A 3HQ4O 1LDYA 3NV9A 4CL8A 1PJQA 2O4UX 3S55A 4ZVVA 3CEAA 3ZW8A 4IQ8A 4TVBA 1UDCA 4J1QA 1CIVA 1DDOA 4R01A 4B7CA 3VPHA 2HUNA 1LRKA 3H9JA 3UN1A 3E5RA 3WJ7A 5JYEA 2NU8A 1D8AA 2HMUA 4TRMA 2ZQZA 2CSUA 1H2HA 5T67A 3DEYX 4CMCA 1NHGA 2EJVA 2H1SA 3FF4A 1Y1PA 2AHRA 4ID9A 3QIVA 4WK6A 1PL7A 4FPXA 3UAGA 4AVYA 1JU9A 3VC7A 1PJ4A 1CETA 4L4SA 1T4DA 4EJ6A 4MKRA 3TL3A 5IG2A 2I99A 3Q2KA 3K6JA 4BV8A 1P1RA 4MP8A 1B15A 1VLLA 1FMCA 4B4VA 4UVIA 2E37A 4D3DA 5KWEA 3JCZA 5L40A 3UCEA 1NPDA 3UCFA 3BTUA 1YH3A 5TSDA 2EV9A 1EUZA 2EXXA 5TX7A 5KJ6A 1H9AA 3EZYA 4BB5A 1GPDG 1T2CA 5I7EA 4FCCA 4NBTA 1X1TA 3IKVA 2GN9A 4D45A 4IJVA 2HK9A 2BKAA 2F00A 2O48X 3NGLA 3AY6A 4LGVA 1J4AA 2F1KA 1Z6ZA 1C0KA 2A94A 4DMLA 1LDNA 3SBOA 1GU7A 4CQLB 4HNGA 3M2PA 4MOWA 1DLJA 1T2FA 1ZVMA 3Q1LA 1O94A 3HNPA 3AY7A 3PHLA 4XYBA 4ND4A 3I4CA 3NJ8A 2OORA 1DRWA 1XHLA 1G1AA 5DBFA 1LRJA 2QIOA 4RQUA 1QLHA 3C85A 3FNHA 3WFJA 4II3A 4PLGA 2I3AA 3FNEA 4QFCA 3WMWA 1MP0A 1Y5RA 1GYQA 2BMAA 4NU6A 3PXXA 4ND5A 3GG9A 4JBGA 4WLOA 1DAOA 4E5YA 1FJHA 3EVTA 1F8GA 4FFNA 3SJ7A 3TJRA 1BXZA 2VN8A 1ENZA 1LSOA 2EGHA 1JWAB 1DRUA 1DIRA 1QYDA 2BELA 3L4BC 5FI5A 3PVZA 4OKNA 3ZNNA 4L75A 1YKFA 1NPTO 2VYNA 4UVEA 2GDZA 4DUPA 4IGEA 4CUJA 4KDEA 3RJ9A 4JIGA 1E7WA 3ZHBA 2GYYA 2JKVA 1VKNA 4J1TA 4TKMA 4RVSA 5T64A 3AOGA 2RCYA 2BFOA 4WLUA 4E2YA 3VKUA 3ZGYA 4PLHA 2IXAA 1Q0QA 4B79A 4NBWA 1V3TA 3MJEA 5C7IO 1TVEA 7MDHA 1SBYA 4NJMB 4U0JA 1NNUA 2QRKA 4LCJA 3RC1A 5A3VA 3GN1A 4RPLA 1E7RA 1W6UA 1NAIA 4MO2A 2C5AA 3AFNA 4J7XA 3IIEA 4IQ0A 4Y6SA 4D7AA 4OHUA 3D4NA 1O6ZA 4Z9XA 4LSMA 3HHPA 5F5LA 4XRGA 4TRJA 4MVJM 1U8FO 1GL3A 1HDOA 1K0UA 3GRPA 4XYEA 4NJMA 5CHEA 3ZV4A 4PLVA 4FIZA 1HLDA 2BI7A 3AW9A 4KTTE 4XWYA 3ITDA 3INGA 1ORRA 2GZ1A 3JQGA 4XR4A 1QXSA 3ULKA 1FDUA 2FN7A 4BKRA 4N5LA 2AMFA 1KYQA 1NQOA 3EDMA 5GMOA 4BUCA 3U5TA 1LSUA 4GQAA 4I08A 2P9CA 4ND1A 5A03A 2DPGA 3GF4A 1GY8A 1HDCA 3DO5A 4KTVE 1BDBA 3KV3O 1A7AA 4E0BA 4Z0HO 3OQ1A 5DCWA 1FDVA 3UXYA 1BWSA 1E5QA 1T1RA 3Q9NA 5U1PA 1YE3A 4FC6A 2UUOA 4WGGA 5EERA 1VM6A 1CERA 3DHEA 3I4FA 5JCJD 1E92A 1G0NA 1EBUA 2X8LA 4ZA2A 5ER9A 1SOWA 3DBLB 3ABIA 3IC5A 3O26A 2QYSA 4BQPA 3H3JA 3DZGA 2AA3A 4YT2A 5K6AC 3IMFA 1DBVO 4YAJA 3RUHA 3BIOA 1CYDA 2P5UA 2Y05A 3RSHA 3P2YA 2PR2A 1KBZA 4FJ2A 1MX3A 4RVHA 4NBVA 4CMGA 3MOIA 2ZK7A 3MTGA 3EY4A 2OMEA 3WGTA 4FD3A 2YV1A 4Q3AA 3L6OO 5AQ1A 5B1YA 5K9ZA 2OUIA 3OEWA 2YDXA 3VZQA 3PYXA 2VHZA 4IPTA 2YY7A 4M54A 3CXRA 1UP6A 1XU9A 1V3VA 1LQTA 3W8DA 2VUSA 2NTNA 5A5FA 3UHAA 1VPDA 2AQ8A 4EEZA 5BT9A 2EF1A 3O9ZA 4DIBA 4U6SA 2P68A 3AY3A 3L4BA 1G6KA 3VVCA 3JYLA 3NRCA 1I10A 2DFVA 1T24A 2FWMX 4CMEC 5HBRA 4P8RA 1A72A 1ZKMA 4J6FA 4MP6A 1X0VA 3A14A 4YTEA 5AXCA 4CLOA 3IS3A 5JYDA 1GV0A 1E7YA 1F06A 2W2KB 1GDHA 2WD7B 3OIFA 4B3JA 5BNIA 4OSOA 2ZYAA 4BO2A 3DQPA 3BMNB 1EFLA 2WTBA 2J3KA 3PJEA 4R5MA 2DTDA 3NX4A 4WLVA 2J3HA 1Z7EA 4GI2A 1PGPA 3JD3A 1PSDA 4DYVA 2W2KA 2X5KO 2GF2A 3BMOA 5LCXA 4UVGA 3IQDB 1J0XO 2GN8A 3I3OA 1DFGA 1R66A 2HK8A 3I9OA 1QLJA 4A10A 2JFHA 4F6CA 5EINA 1U3VA 3G1TA 4RCVA 4D44A 1YL7A 2HK7A 4IZIA 4KP7A 5FF9A 2FY8A 1AHHA 3B1FA 4X54A 3QE3A 3W8FA 4F46A 1ZK4A 4GGOA 1MXFA 4IXWA 1Y8RB 1Z75A 2EG9A 4C4OA 1NR7A 1ZSYA 3RFXA 1N2SA 3GDFA 4WLNA 3O4RA 1LXCA 4ZICA 5EQDA 3OA2A 5J23A 1HTBA 3U62A 2B4TO 2DQ4A 4UUNA 4E30A 4L8VA 3I9NA 4W7IA 3WB9A 3ZCXA 3ZWXA 1AGNA 1UP7A 3ZWAA 2YV3A 4BV9A 3KEOA 3KYDB 5JAMA 3JSAA 3RBVA 1LJ8A 1JDJA 2TMGA 1B7GO 3FSRA 4MPDA 1X13A 1GYRA 2NLOA 3ZV3A 3EC7A 3QA9A 5AVOA 2W2LA 3AOEC 3H7AA 2YZ7A 1Q7BA 2GASA 3JYNA 3LT4A 3HB4X 1IL0A 3FPCA 4R4JA 1KOLA 1ZW1A 3ZHXA 2BGLA 3GDOA 4CM7A 1UZLA 2FR8A 3KYDA 4QT0A 5B4TA 4XB2A 2NQ8A 1KEUA 3P2OA 1WLYA 3W4KA 4Z6KA 3WS7A 4XEHA 5C37A 1I36A 2OXIA 2D5AA 1SZJG 1RYEA 3N58A 1HZJA 3F5SA 4YB8A 5THKA 4MJLA 4F6LA 5BSHA 1HDGO 3ZU2A 1GQ2A 3NT2A 1KVUA 2FZWA 3R1IA 4P22A 3LVFO 4PLPA 3ITKA 3H4VA 3QW2A 1ZK3A 2DUWA 2O3TA 3DXFA 1ZUD1 1O89A 4BNLA 3DAGA 1PS9A 1D1TA 2I65A 5KVQA 1LC3A 3ANLA 1ONOA 1ENYA 3EW7A 4IS2A 3RKUA 2BHLA 4LRTB 3RI3A 1UAYA 2VT3A 1GTMA 5T5QA 4J49A 4CMEA 3L0DA 3OJOA 2R2GA 4ZJUA 2EIHA 1EFKA 3SC6A 2D1YA 4FW8A 2DUUA 2PWZA 3CPSA 4NR0A 4NU5A 4WPGA 3TRIA 3FTPA 3BTVA 4NFHA 3S2GA 5CFZA 3ZH2A 1DPGA 1JVBA 2EEZA 2HMTA 4YCAA 5BR7A 4RVDA 5IDYA 2O3UA 3VZSA 3Q11A 2VUTA 4I5FA 4R3NA 2NU9A 1PJLA 4YAEA 3VH3A 2DM6A 3QHAA 3W4IA 5EPOA 1GD1O 4GH5A 4PZDA 4R1NA 3GRKA 2IEDA 3TL2A 3DBHA 1RJWA 3BA1A 4AL4A 1WMAA 4FC7A 4OQYA 1NVTA 3WBFA 1TT5B 8LDHA 2NV6A 2RH4A 4NG5A 5TC4A 1NFRA 1XLTA 4RDHA 4DREA 1WMBA 2I66A 1N7GA 1H5QA 3D3WA 1R16A 5TGDA 4JLWA 4KUEA 3T7EA 4E6PA 4I9NA 2P9GA 5DCYA 2VHWA 4BB6A 3TF5A 4MVJI 3FN4A 1TT5A 1X15A 3AWDA 4AJEA 4YJGB 1AXEA 1M2WA 1DJNA 4MP3A 4JBHA 2I76A 4YT4A 4WKGA 2J5RA 4J90A 3G79A 4ILKA 2RAFA 4MVJH 2Q2VA 4E31A 1QKIA 2UUPA 1GFSA 1ENPA 4EJ0A 1XELA 2GCGA 2C7VA 3FPLA 2OGUA 2O7SA 3ASUA 3NKLA 1NX6A 3CINA 4EJMA 1I2ZA 4MKXA 4FB5A 3PP8A 1CQIA 2YYYA 4WLEA 2OHXA 3LLVA 1E1LA 3WDSA 5I9MA 3DFZA 4DA9A 3RU9A 4PVCA 4Z9FA 5JAIA 4RZHA 1F8FA 2GR9A 1I30A 2CZCA 2E4AA 2J3IA 4L76A 4BKQA 1T2EA 1ZEJA 2V6BA 2GRAA 3GVPA 3COSA 3AOEA 1DIGA 5COQA 3H6KA 3DWFA 4EBFA 1U3WA 2J3JA 1Z82A 1K2WA 1RM4A 1SMKA 1N92A 2PY6A 1W8DA 1OZAA 5DDIP 5C7LO 3CMMA 3PFFA 1B14A 3ZNPA 1HDXA 1UP4A 4NIMA 4E2XA 1JWBB 3W4JA 1KEVA 3OHSX 2CF5A 2QYTA 5B4VA 5JLAA 3X2EA 3CZRA 1QG6A 1WW8A 4OQZA 1P33A 4RJTA 1YONA 3BTSA 4TQGA 3ADOA 1FF9A 1K89A 1U4SA 2C2XA 1ISFA 1PWXA 2CMDA 3MCVA 1HWYA 4GL4A 2VTEA 5I9NA 5G4LA 4UVHA 3K96A 4U5QA 1SAYA 3AI1A 2NVWA 1MB4A 3GPIA 2H5LA 4OMUA 1BW9B 3AUSA 4IJUA 4AJPA 1UXKA 5EJ2A 3JD4A 2GGSA 1D1SA 2EGGA 1LLDA 1LDGA 3GK3A 4AICA 3H9UA 3D0OA 5TLSA 2FZEA 4K6CA 4CR6A 5JBIA 1ADGA 1LI4A 5AOVA 3HN2A 3WTBA 1EEHA 4DBVO 1TEHA 3NTOA 4WLFA 1BW9A 3KEQA 2FPPA 1AXGA 2WYVA 3WSWA 5F1KA 4BKPA 4DC0A 1DC3A 1SEPA 2CDBA 3GY0A 1RM3A 3ZWBA 1XA0A 2HCTA 3H9GA 3KBOA 3MTJA 1U7TA 1YVEI 3PGJA 4IDFA 1PX0A 2E49A 4UULA 4KUGA 1GZ3A 2HKIA 1BG6A 4OXYA 2X9VA 4WCFC 4AG3A 1E77A 4Y8VA 3DFUA 3R6DA 4RF4A 3JQ7B 3WLEA 4OXNA 4IIVA 4Q9NA 1KC3A 3EGOA 2RBEA 4TZTA 3U09A 2NWQA 5B4UA 5GY7A 4RLSA 1MV8A 4PG6A 5L45A 3KSUA 1C1DB 1UZNA 2B36A 3JQ7A 3TSCA 4UAGA 4R16A 3K9QO 3OP4A 4KQWA 2ZJ0A 2PKRA 2ZB8A 2AE1A 3NT4A 4W9NC 1MUUA 1SB9A 2PH3A 1QRRA 3MZ0A 1Y9EA 1K3TA 1YDWA 4JX8A 2NU6A 4IINA 1HYEA 1DC4A 2OP0A 1LNQA 1Y9AA 3JV7A 3HDHA 4E13A 4RF2A 1C1DA 1Q7CA 5HM8A 4CLRB 3FWNA 1E1MA 1O9BA 5JMPA 4CV0A 5I8ZA 5JXWA 4NH4A 2FPIA 1M6HA 4RZIA 4OJNA 4EUFA 5GZ3A 4PIVA 4M86A 2JHFA 3PI7A 1ADCA 4WOKA 3E8XA 3L07A 1SO8A 5IZ4A 3RIHA 2Y0CA 3H2SA 3A06A 1Z45A 1C1XB 3PK0A 1NP3A 4YRAA 4CLRA 1I8TA 1P74A 3EAGA 4R1UA 2PZMA 1XU7A 3CIFA 4GLLA 1X7HA 4E2WA 3JYOA 5A9SA 3RROA 3WYEA 1DHTA 1HLPA 4DIOA 4GX2A 2P2SA 3AM4A 1C1XA 3P7MA 2HAEA 3JD2A 4HUJA 1WAMA 2CVOA 1XKQA 4K9DA 4ALLA 1NTOA 1ZK2A 3PQDA 3PYLA 3ZWCA 4DTIA 4EZBA 2BFAA 3MOGA 2XPCA 1X7DA 1XYGA 1EVIA 2POQX 3OF2A 4XGIA 3WR5A 5JCJA 3GNQA 3TFQA 1I2CA 4R9SA 5HRUA 1IB6A 3GN2A 3PQFA 1E3JA 5H81A 1LLQA 3V5NA 3RD5A 3RQSA 3GNSA 1HL3A 3I6IA 5DT9A 2GERA 5KKAA 2D5CA 4YA6A 2V7PA 1RM5A 4AJKA 2H63A 4WCFB 1SOVA 1DC5A 1DFIA 1ZK0A 4DPLA 4BS9A 5IJZA 2B5VA 2WYUA 3AI2A 5G0SA 2RHRA 1QMGA 1E0DA 4RPKA 1F14A 3CUKA 5BNFA 3QWBA 1N9GB 1ADBA 1QYWA 4TRNA 1PJ2A 2V65A 3NDJA 2BFMA 2DBVO 3OJLA 4GAEA 5DOVA 4WCFA 3AJRA 3OIDA 2P9EA 5G0VA 1E3LA 4HV4A 1YB1A 1TLTA 3I83A 1VI2A 2JD1A 4J2HA 4J1SA 4B8WA 4E5PA 1N9GA 4OM8A 1PQWA 4NBUA 4D79A 3JYQA 4J43A 1SPXA 4GWGA 4E12A 4FFOA 2Q46A 4RORA 2JFFA 4QEDA 3SLGA 1FK8A 4W9NA 1HKUA 1UZMA 2PZLA 3KLMX 4EYEA 4FR5A 3JD0A 5JDCC 1FDWA 4J9UE 3IL2A 2AQKA 2AQHA 2WM3A 4ZN6A 1FDTA 4OH1A 4Q3DA 1TXGA 2VUUA 3GVCA 2QW8A 4RF3A 1NR1A 3K73O 3FRJA 2Y0EA 3F46A 1ZFNA 3L9WA 3D3EA 3TZCA 4CODB 2Y0DA 3E48A 3T7CA 3I9JA 4P4LA 3M6IA 1EBFA 3NUGA 3B6ZA 3ANMA 1YL6A 3LT0A 3BZUA 1O0SA 1EK5A 1I24A 4YYZA 2X58A 4YJFB 4LCEA 5AXAA 4RV9A 3R3JA 3S2IA 1BXGB 1QSGA 4J0FA 1NQ5A 1GADO 2GZ2A 3FWZA 3WGZA 1K6XA 3LC1O 1JAYA 4OOEA 3ZWNA 4ITUA 2IYOA 1T1SA 2X9NA 1XEAA 3E9QA 1XG5A 4I5DA 1OBFO 1VKOA 3U4CA 3ADPA 3GVIA 1DJQA 1E7QA 5BSEA 1NVMB 2B37A 2JHGA 5TJHA 1VSUA 2Q99A 4CQLA 2OZPA 4YJFA 2WSBA 3C7DB 3V2HA 2FR1A 1V3UA 2QHXA 4M55A 1DOHA 3BMQB 3HFGA 2QZ9A 1IPFA 4G81A 1EUCA 4XYGA 3RUAA 1MC5A 4NK4A 2G0TA 4YACA 1ZCJA 3QWAA 4RL6A 3UFXA 5GZ1A 3O38A 4H15A 4HKTA 1E6EA 3EMKA 2VT2A 3ZW9A 2B35A 3UKOA 4FDAA 2HJRA 3WLFA 4BKOA 4GPD1 2VHVA 4DVJA 4R5HA 5L4NA 3BMQA 4PG7A 2EW2A 1ZMOA 3KXDA 3IKTA 1U8XX 4HWKA 1GR0A 2YQ5A 4YAIA 1O5IA 3JQAD 3SEFA 4CV2A 1U7HA 2HO5A 3FR7A 4FGWA 5FEUA 4I5EA 1JKIA 1Z74A 1E5LA 3LT2A 2VYVD 3RFTA 4YRDA 1DHRA 2A92A 3T4XA 5IXSA 1P3DA 2GN4A 2DTXA 1E3WB 3GZ4A 1DB3A 2IYPA 3DOJA 4GSLA 4XD2A 5G4KB 4HNHA 3JD1A 3WXBA 4E5MA 4ZGWA 4C7JA 3IOYA 2WD8A 4UUPA 2I67A 5AXDA 2AEJA 2QG4A 1PL6A 2Z5LA 4ND3A 4E33A 5KJFA 3G1UA 1HDZA 1U2GA 4GVLA 4CR8A 1A5ZA 4ZQBA 1IYZA 1SB8A 3E18A 5IN5A 1L7DA 3PWKA 1E3WA 1E6UA 2LDBA 5G4KA 1YL5A 1T25A 4ESOA 3ICCA 3ROQA 3V1YA 3ZNQA 4NK5A 3PJDA 3B70A 5TQVA 4MVJG 2OBNA 4BNTA 4AJLA 1W73A 5L9AA 3PIDA 4QECA 4R1SA 4B3IA 3D5QA 2C7GA 4WNIA 4J3FA 5DP1A 1H6DA 1I3KA 1R4MB 2D4AA 3G3EA 2R00C 4AJ4A 2Q1UA 3VPXA 1EVZA 5JDCA 2G1UA 1KVTA 1WP4A 1JKJA 1C3VA 2B4QA 1LDEA 2EWMA 2NUAA 3RVDA 2P5YA 4TROA 5THQA 1PQPA 3QY9A 1X14A 2G5CA 3C1TA 1B3RA 5IFLA 1JVSA 3FD8A 4KMSA 4RO0A 1DSSG 4PLTA 2I9PA 2O3JA 3U4DA 5L4LA 3KRTA 4JJFA 5CDSA 1GPJA 3OJ0A 3N7UA 4G65A 4XDZA 1N1GA 1U2DA 4XGKA 5KVSA 5HTOA 4BO7A 5KOIA 2ZB4A 1ZXLA 4K6FA 3HG7A 4D41A 1J49A 3IP1A 4LSWA 4TSKA 5TRTA 1RPNA 4GMFA 3VPFA 1CF2O 5DULA 2Q1WA 1NFQA 4UUMA 1NWHA 3DBLA 3H3FA 4W99A 4U6QA 3DOCA 1PR9A 4XQ9A 4R9RA 4IDEA 4INAA 4L4XA 3V2UA 4J16A 3L9XA 1MLDA 3F1LA 4I5GA 5BQFA 5I7SA 5ICSA 3FNFA 2HRZA 3TFOA 3E5MA 4Q3NA 1TI7A 5FWNA 5G0WA 5ILGA 3PDJA 3TPCA 5JO0A 1DC6A 3WGGA 2O4CA 5F3RA 3R3SA 2DVMA 1P0FA 4YAKA 1M66A 4RVFA 9LDTA 4TRRA 4BOYA 1AE1A 2VRCD 4WUVA 4HADA 4I9UA 1KS9A 4ALIA 3PWSA 3ZNOA 3P5SA 7ADHA 4YAGA 5B12A 2X7HA 1PR3A 2ZQYA 1MFZA 3SC4A 3KB6A 3AUAA 4D3FA 1B8PA 1E7SA 5JY6A 2P4HX 3O03A 1KEWA 4K26A 2RIRA 5JMWA 2GO1A 5C7OO 3GAFA 3MWDB 1HEUA 4DGSA 1K5HA 2XF8A 3HZZA 1ZJYA 1YBAA 2WD7A 1SC6A 4GX5A 1V9LA 3QWIA 1LU9A 1YS4A 1Z7BA 4MDHA 2EKPA 3OJEA 1GZ4A 3MWEB 3DZHA 1VSVA 2UVDA 3UH1A 3M2TA 3BMNA 1LSSA 1P1KA 5HS4A 4M1QA 2J8ZA 3HDQA 4XJSA 2BFPA 3ZWMA 3PTZA 2X0RA 3TDKA 2Q1SA 5KJ1A 1SCUA 3LQFA 1UR5A 3AU9A 1JLLA 2G17A 2ZYGA 3WGYA 4MVJD 3O8QB 2OO5A 2QRLA 4FOSA 3L4SO 4A7PA 1PWZA 4ZQHA 1T2DA 4IXTA 3SX2A 3WGOA 1H94A 3ZU3A 2R00A 4OO3A 5BNTA 2FOIA 2DBRA 1EQ2A 1YOVB 4RQTA 2BD0A 4Y6RA 1E1KA 4NPCA 3EUWA 4FFRA 3BAZA 3W6UA 3LZ6A 4BNVA 3O8QA 3CMCO 1VRWA 2G82A 3DZJA 1Y8RA 3TZHA 1TT7A 4BKUA 1NPYA 1KETA 3VAZA 5JS6A 1GQQA 4BMVA 1R4NB 3P19A 4J1NA 1QYCA 1YBVA 1YOVA 3PWZA 1V8BA 2IRWA 2Q45A 5T57A 4OIMA 5IN4A 3BMCB 2B69A 2WDZA 2YV2A 3PGXA 4J91A 5A06A 3GG2A 4YJHB 4DRYA 1Q0LA 3DB2A 1A9ZA 4W82A 3JQBC 1LC0A 1R4NA 3LK7A 4HBGA 1A4UA 2B4RO 4FSHA 1ENOA 3ZZNA 4XZ3A 3QV1A 3PJFA 3DONA 3RC9A 4IDGA 3H5NA 4QO8A 2CNBA 3ANNA 4K28A 1HZZA 2AEFA 3BTOA 1JW9B 1MA0A 4YJHA 1NVGA 4NJOA 3WTCA 4JN6B 3DR3A 3GFBA 3VDQA 3I9KA 1V6AA 3VDRA 4R3WA 1P1HA 3SLKA 4ZHSA 2EW8A 2FSSA 5CPBA 5CG2A 4CQMB 4URFA 3C1AA 3DOOA 4E4YA 1ARZA 2BH9A 1BTOA 3LLSA 3GEDA 2V6FA 4MINA 4N5NA 3AUTA 3GLQA 3K92A 3KYCB 3LF1A 3VPGA 4EDFA 3VPSA 5CP8A 4BO1A 1OI7A 1NHWA 4L0QA 4B7XA 3F9IA 1KY5A 3FNGA 3I52A 4IDAA 1EDOA 2BRUA 1YQGA 3U3XA 1B8VA 3WWZA 4CR7A 4DQUA 4ZD6A 2ZTVA 4UEOA 4DC1A 5I7FA 1UXHA 4D46A 5CEFA 2YHIB 2XAAA 1BHSA 1OC2A 3ZI0A 3A4VA 5ES3A 5KJEA 3CTMA 1Y81A 4B4WA 2D0IA 1GYPA 4BNXA 2YJZA 1GUYA 3JQ9A 3GC6A 3I9LA 3PEFA 4GX1A 3QWFA 3OQ6A 3U4IA 1HSZA 2PZJA 5T8KC 4BGEA 5A3JA 2UV8A 1J5PA 3MEQA 4B7UA 4CM6A 2W4QA 5L7WA 3WNVA 2DFDA 4R41A 3LSYA 4J9VA 1YJ8A 2EERA 1YBMA 3QVOA 3PHHA 1DRVA 1PL8A 3UOGA 1BMDA 3GR6A 3Q0EA 3QQPA 4A03A 4CMJA 4DLAA 5IDWA 4CV1A 1MFPA 5DF1A 5DCUA 5JW6A 1N7HA 2E48A 4YJGA 4FFPA 1UJMA 3W1VA 3JQFA 5DP2A 3C1OA 3QJ5A 4BNNA 2NVBA 4XQCA 4D3SA 1ZEMA 3PFWO 1B8UA 3H65A 3QVWA 5A9RA 4H7PA 1IZ9A 1WZEA 3M1LA 4LMPA 2Q2WA 1W4ZA 1YQXA 3I6QA 3TWOA 2Y99A 3OFSA 2JCXA 3GHYA 2Y66A 4PVDA 4O63O 4ND2A 1YGYA 4XRRA 3ONFA 4A2CA 4ZRNA 4B8ZA 2IZ1A 1XR3A 4FN4A 4L74A 1H6AA 6LDHA 3GGOA 1IPEA 3AI3A 4PRLA 2CF6A 2NVUB 5L95A 2Q49A 1PGJA 1PTJA 5G0TA 2VZ8A 2YFHA 5TT0A 3KSZO 3EK2A 3F4BA 5JCXA 1FXSA 1YB5A 3JQBA 4JQCA 1U1IA 1UDAA 5FFFA 2FSVA 4H16A 3KUXA 4EW6A 5BSGA 3JTMA 2UYYA 1CJCA 3PLRA 3ETDA 3L6DA 4QUKA 4LVUA 4D0SA 2B5WA 4JGBA 5ER6A 2JD0A 2TMDA 1M76A 3CSDA 4RLHA 1JN0A 4G5HA 4GX0A 1VC2A 2WYWA 2HSDA 4KDFA 1YJQA 1HXHA 5KVCA 1JTVA 3DTYA 4E5NA 1H0KA 2PLAA 1ONNA 4NMHA 3C3XA 4UREA 3ZHYA 2X1HA 2PK3A 2QZZA 1S6YA 3GZNB 4ALKA 1CRWG 5ADHA 4TWRA 3SXPA 1B16A 4JNKA 4CM3A 5A05A 3VTZA 1ADFA 1ZH8A 3E1KA 1ZSVA 4PLCA 3QVTA 5IDXA 4WJZA 3D4OA 3IP3A 4S3MA 4S1VA 1P77A 3WQQA 3GZNA 3KOUA 1VJ1A 1Y6JA 1C14A 3BXXA 2ZATA 3EZLA 1BVRA 3D7LA 3ZWPA 2ZKLA 4A73A 3TNLA 4BNFA 1K6IA 4BNYA 2IDZA 1NXQA 1P9LA 3GMDA 5CDGA 2WE7A 2UDPA 4XQEA 3CE6A 5IAAA 2D59A 4HXYA 1PGOA 1GUZA 3JQAB 4YJDA 4LRSB 1R0LA 1NM5A 2GLXA 2V6GA 1ML3A 4DPMA 2XXBA 3AM3A 1H6CA 1I3MA 2ZTMA 3A28A 3H9EO 4ALMA 2PKQP 4N7RA 5T8KA 2O3RA 3IAHA 1BDMA 2Y93A 2VOEA 3G0OA 1GEEA 3PDUA 5F1OA 1ONPA 4ONEA 1CEQA 3NTRA 3JQAA 2HRBA 1T2AA 3U49A 3PPIA 5KTKA 1EDZA 4NBRA 2ZCVA 1PS8A 4CM9D 2VYVA 4DQVA 3EHEA 1X1EA 2ZTUA 3KVOA 1V0JA 4AJ1A 4BL5A 4BO8A 1ISGA 2BF7A 3PJGA 3F5QA 2Q3EA 3GH3A 4BO6A 5TF4A 2DKNA 2Q2QA 1KC1A 2UAGA 2YHUA 4E3ZA 4JP2A 1F17A 1HT0A 3WMXA 1D4FA 5DN9A 4Q39A 3NDRA 1KY4A 1QV7A 2YW9A 3R0IA 4JXKA 1PJBA 4QFDA 2CD9A 3ZWYA 4DLLA 2PGLA 4PLYA 2X0IA 1QV6A 4YR9A 4BNGA 3VH2A 4PFJA 1I2BA 4CUKA 4WECA 2BGKA 1WPQA 2CDAA 3ROMA 1Q0HA 3K30A 4D43A 4Y67A 1M6WA 3DMTC 3ROPA 1XQ6A 3RCBA 1HDYA 1PZHA 1KVSA 3HN7A 3F3SA 3KZVA 4BO5A 3ONEA 2HDHA 4BMNA 4CQMD 2NTVA 2C5EA 1C0LA 4Y98A 1VL6A 1A4IA 3K5PA 1J6UA 2Y1EA 4PG5A 4Z3KA 1NWCA 1E3SA 2O3QA 4JP3A 1NAHA 3PQEA 4CUZA 5JSFA 5JNLA 3FHLA 1QYXA 4FQ8A 3KHUA 4BNHA 2B83A 5LDHA 1F12A 1XIVA 1P1JA 3OICA 3ZWOA 3ZU5A 3QVSA 3U4HA 5JAZA 1N5DA 3RUCA 4ROSA 2X0NA 3RFVA 3E9MA 4BNWA 2DTEA 1U3TA 3QSGA 4AJ2A 2I3GA 2VRBA
chains in the Genus database with same CATH superfamily
2WPDA 5CD9A 5GM1A 2V4MA 1JHOA 1ST2A 3IFSA 4URVR 2ID4A 5FO0A 1MBZA 7YASA 4YCMA 3AGQA 1MZVA 4FIDA 1QTRA 1PJZA 4XPIA 1SRRA 1MAWA 5B3AA 1FL9A 5BR8B 4F3KA 4YMLA 2IS4A 2XYGA 1XJWA 4EO4A 5C8YF 2AQIA 1M34A 2BLNA 3TCXB 3WRYA 5J2UB 4URHA 2XEXA 5HZGA 3TOXA 1CUIA 3MJVA 4PLZA 1TPZA 3GT0A 3KQMA 2QMYA 3HJGA 4ARIA 3WAJA 3NC4A 1NYTA 1P72A 1TL7C 1VRVA 2QSUA 4CKBA 4C4XA 3RG8A 2Q4OA 5F9HA 3AR4A 5H5JA 4O5OA 4HLUC 4RXMA 3RREA 2OHFA 4KQMA 4IL5A 2VRNA 3U61B 2WB4A 2QRQA 3PGA1 2G9VA 3QMPA 3TKYA 3TR0A 3QIAA 2YWEA 2ZITA 5LQDA 2PBLA 5JEDA 4MNTA 3FNQA 3T9DA 1XCBA 2Z1NA 4CQNA 5BW8A 1BEZA 4PZEA 6ADHA 1BU8A 4XQGA 2ONZA 3HJHA 1CP2A 2B2NA 4O4IF 3OPYB 4RNDB 1DAFA 1NBOA 2FMUA 1NYQA 4HO1X 3UJPA 1Y7TA 2GI4A 4R2KA 4H17A 5JSQA 4RMIA 2OHOA 3VYVA 4OYHA 1SXJB 5IJ9B 1IUKA 2G0AA 2W22A 4DCPA 5A5VA 1FDOA 4AF7A 3H5RA 3ZY3A 5EQFA 1RIIA 2CJWB 4AB1A 1V8OA 2QNIA 4Q7KA 5ITZA 1C8KA 5BSFA 3MFYA 5ALKA 4P3KA 3BMXA 4WBNF 2VTBB 4XCVA 1Y5MA 5KVVA 1SIBE 3B13B 4Y9UA 1GGVA 1V4BA 2B7BA 3I53A 5FIUA 1CQWA 2QZJA 2YUTA 3W9UA 3OEYA 3PLNA 4LVCA 2Q5IA 3AUUA 3DAOA 2OG1A 3EGXA 4OQFA 3NHLA 3R44A 2C20A 4IS3A 2IQIA 2KW5A 1G4UR 1VIMA 4C6TA 1V41E 1YT5A 4N7MA 1IRIA 2N3ZA 1PQ4A 4L73A 3IUPA 3GPDG 4QOIA 5KQLA 5BYAA 1W47A 2J9FB 2RBKA 4FVTA 4ZAYA 1J9GA 4ARSA 4OBWA 4ZK6A 5L4SA 4FFMA 2MSKA 4LXTA 3DLTA 2Z3WA 4HQNA 4QXMA 3RHSA 2E2WA 5B1EA 2FSGA 3L77A 5JD6A 2B7LA 5EZ5A 1RT9A 4Y1GA 2BY4A 3U31A 4DIMA 4ARZB 3TIIA 4BGVA 2OAGA 4NZ9A 1PZGA 1H2FA 4QSMA 4BV2A 5FTWA 2BZGA 3EASA 1L4UA 2FWIA 1W25A 3RBXA 4N3GA 3QVJA 1QGZA 4X84A 2Y3IA 1JL3A 1TYBE 4L5AA 4WFIA 4X7BA 5CIQA 1E2HA 4NARA 2XHEA 1KVQA 4XASA 4EUEA 2VHUA 1U1CA 1VLMA 2HCBA 3MW8A 4I8IA 3GUCA 3S68A 1HH4A 3T4PA 2UUAB 1PJCA 1QBKC 4Q9LA 5EL0A 1JR2A 2EP5A 4HRVA 5JO9A 1L3CA 2XH8A 2V59A 1Z36A 2JPDA 2ORVA 2AFHB 4IV5A 4JJ4A 2YH2A 4DJEC 1SVLA 3PDHA 3D6NB 3GJ7A 4IFIA 2PTHA 3STTA 4LFCB 3W6ZA 3CLTC 2B9EA 5EHXA 1FCJA 1U0EA 3P1JA 5DYGA 1JG4A 3O83A 3U37A 4D0NA 5ED0A 5H1YA 3VH4A 6REQB 4CIVA 4M8KA 1SNYA 3O1HB 4IYJA 4EQ6B 4PN3A 3R3WA 4BFCA 2FEMA 4K7JA 1W4LA 1BCRB 3BCSA 2I33A 3PXUA 4RV4A 2XOKA 1DTWB 2CUKA 2OEPA 3E7DA 1XP8A 3OETA 3QQ5A 4OF4A 4D9HA 1ZR4A 1UFRA 5GGXA 3AHCA 2R8PA 4D9MA 3TOZA 1YRAA 3N0RA 4G1CA 4B43A 3ZDCA 2HPHA 4G9GA 5SV2A 3I58A 3SQNA 4IFTA 2NNLD 4Q3KA 2NACA 2X9LA 4MWSA 4CMIB 5COBA 1W2HA 2YWDA 3B1WA 3R7NA 1VE6A 1CNMA 2H11A 3ND8A 3WISA 4C4YA 3IJEB 2HHJA 4MPPA 4Q48A 4JODA 2AFIB 1YSCA 2II6A 1OKKA 4QKQA 3SKXA 1KAEA 3RWBA 1E3EA 3GPBA 5SY6A 1SEVA 4X1IA 1EUDB 4BMCA 1VHQA 1H4SA 3SEZA 1Q1QA 2GFIA 4M89A 2BBSA 4RTOA 2FNAA 5JI2E 1TUGA 1USWA 2AJTA 3ITNA 1VPTA 3A1VA 1LDMA 2FI1A 4UUOA 4BFYA 3BYZA 3H16A 3G0CA 3RK1A 5A1TA 5LN1A 4RHEA 1CDEA 1H93A 1ZMRA 1ZSNA 1HYHA 3DS8A 1C30B 1UBSB 1JLRA 3G5TA 4R0VA 3NZEA 4YRBA 2JFQA 1M10A 1NUTA 1UWCA 2HX1A 3EEFA 4LK2A 1BDIA 2X5OA 4MI1A 2OBMA 2A5JA 1W59A 2ZDQA 3X43A 4YT8A 2SHKA 1MW8X 3BKWA 2P91A 1H4TA 1XEXB 4GW3A 4BWGA 1UPTA 2FHSA 2HWXA 4XIGS 5CM9C 5AVQA 3HYTA 1KMMA 3Q4GA 4U2KA 2BH2A 1W6RA 3KVVA 1Z2CA 3RUDA 2XXJA 2NO9A 1Y34E 2ZAIA 3E05A 2FPGA 3TIFA 3PCTA 2IODA 3DJFA 3NJ4A 2HRQA 3VR6D 1I1QB 3KS9A 2NO1A 4OL9A 5A4DA 1JSZA 3DFKA 4KLAA 2UZ4A 4RDXA 1C0IA 3NHWA 4WZBB 1CR6A 2VCYA 3TFWA 2M32A 3DF9A 1JFSA 4IDCA 1YASA 1KI8A 1JG7A 1OOEA 5CNIA 1H69A 2PPLA 2WP8J 3GOHA 2OFWA 4IAOA 4TTQA 3WKDA 3WSVA 4Z54A 1KE2A 2FUCA 3PHIA 4IHJA 2P30A 1Q95A 1TTTA 2CUTA 5CXUA 3LRPA 3DUFB 5DX1A 3B51X 2BGJA 1L4NA 3F98A 1JA0A 1GL9B 1NQUA 1S2GA 1YQQA 1UJ2A 4H0NA 1K7EB 2H54A 5BN5B 4BEJA 1P1BA 4ENTA 5U9CA 1FQWA 3PEWA 1Y4SA 2VWPA 3RKRA 1AKMA 2AMLA 1X7ZB 5CVEA 3B1YA 4ZVMA 3AV0B 3FAKA 4OA8A 4TKVB 4BMXA 4IQFA 4XDYA 1SCDA 4CM5A 3EYAA 1N25A 4R54A 1N2OA 5A02A 4DC9A 4ZI3A 3PZBA 4D8XA 4CF3A 5FHRA 3KFLA 1CUJA 2PX0A 2Y1WA 4MIOA 2XUPA 2NSHA 1NF2A 1QQ6A 2C07A 3O4IA 1JHYA 2JLZA 3NM4A 4EARA 4MXDA 3HWWA 4RFLA 4QOJA 2ORED 2VQ6A 2X9GA 3KPWA 3G9QA 5AHKA 3KYIB 2IZ7A 4GEKA 1JYSA 4A23A 1H1DA 2A1IA 4K1LA 1R4ZA 3VHXA 2QF7A 1PEAA 1DWOA 1BEEA 3DR5A 4G0MA 3T41A 2BRUC 5AW8A 2UXCB 5TQ0A 2R85A 4CLOB 5HPYB 5M29A 2B21A 1K86A 1K4YA 2WWXA 3R74A 3COPA 3VZBA 3QJYA 4BMSA 3SXJA 4HVCA 3B9PA 2CHGA 3ZC3A 4RIEA 4K8OA 1B3BA 1YU9A 2TS1A 3QRWA 3M4XA 3ZWDA 4BTEA 2BMEA 2EJUA 5E2IA 4K87A 2QN8A 1KZYC 3BA6A 3KO8A 1E1NA 2A5YB 3D8SA 5LJIA 1F5SA 1CQPA 4H60A 3JQ9C 1V7ZA 1DIAA 2H85A 4AJ9A 5I9LA 1CB0A 2EHDA 1Z2EA 2YFQA 3MMXA 4IUDS 4JCOA 1N2CA 3VO9A 4OHZA 4B47A 5CT9A 4BNZA 2QU7A 1DG3A 4GLOA 1XQWA 2BC9A 3UB2A 3EQZA 1W0KD 1LCIA 2VO1A 3MJCA 4P31A 1VQ1A 4HFRA 3M33A 3DMFA 5LC1A 1A27A 2V9CA 1LSJA 3FMPB 4TV9B 1NG9A 1JU4A 2J85A 4LWZA 3LXUX 3UO8B 2OYSA 4OK3A 4LQCA 3MWEA 4QPDA 1AZLA 1JEDA 2NSJA 3C5CA 3K0FA 1LUAA 1NSTA 2PKYX 3KOZA 3WL3A 2GZDA 5ARCA 4Q3EA 2I7XA 1CV2A 1VI5A 1O9GA 2P6NA 1GGHA 2D3TA 5A7FA 3WLQA 1N6HA 3DBRB 1T8PA 3NRJA 4FGZA 3VTFA 5B7NA 3FTQA 5B58T 1QPGA 3BQ9A 5D5QA 3IPCA 2BFEB 1Z5NA 1Y8QB 3G0DA 1QJCA 1KJQA 1UXIA 1DJPA 1WCIB 2GZSA 1F2VA 3H5AA 4Q24A 4YMTA 3RVPA 2V96A 5JAHA 2WUDA 2XOXA 3F73A 3QLJA 1T13A 3QFCA 1Z56C 4XKJA 1Y3AA 4XIJA 1FQKA 1JHQA 2FQYA 1PT5A 3TNJA 2LCIA 1NW8A 3QYPA 4PZLA 3T7DA 3WDLA 1D0SA 1JB9A 1SA0B 3TX2A 1HY3A 1WMDA 2GZMA 3DEIA 1RJ9B 1CBUA 2AOTA 3CWZA 3MLEA 3PV0A 4C4SA 2PD3A 2FMKA 2P9HA 3QUAA 4JVSB 4U0KA 1KKMA 2KYRA 1SBQA 2R4QA 4C7OA 4FINA 4BJ5A 1AXRA 5DNUA 5KNLA 1VYHA 1FYVA 2WJAA 1P75A 2Y68A 1TNDA 3T3IA 3KVNA 2FN8A 4COOA 3LWZA 1CWUA 2QI9F 3C8ZA 2PS0A 5T6BA 1TB4A 5JH7B 2W42A 1WXDA 4U3JA 2PXXA 3PHJA 4JLNA 4B3SB 3QY0A 3UNXA 1PJ3A 2I6QA 3O2JA 3PZRA 5JQGA 1MHTA 1P5ZB 2VQ3A 1COZA 3IAM6 4I1VA 3ZKWA 2ZJ8A 3ESAA 4J0QA 3RIEA 3FUWA 2VUHB 1QO0A 1VE7A 2RG7A 3BRWD 3P94A 3INTA 5JZMA 3K8QA 2RI6A 2PGNA 3B6JA 4FYYA 2J41A 1MEEA 5CRIA 4R51A 3S5JA 2FWJA 1U6IA 3IMEA 3QKRA 3FHJA 3ENNA 4UEJA 1CDDA 2Y1KA 1KA9H 2BGMA 2FKNA 2A7QA 2X6TA 3MD9A 3DLHA 3AERA 2GCNA 3RVSA 1IE3A 4F45A 4LXXA 1S89A 1QP7A 1TU3A 3DTTA 4R31A 5A5EA 2X0JA 3ACDA 2OVBA 3CF4G 3AL2A 4DYDA 1DCTA 2R47A 4HPWA 4NOJA 3MMSA 1OVMA 4UMDA 1OAAA 4ACBA 4E1AA 4M8SA 4XWOA 4M1EA 4AKGA 3B3GA 1JAIA 1E3IA 2PX3A 2AR0A 2QN7A 1U0HC 3VJMA 3CEMA 3WGLA 2FQQA 4CQMA 4Z4HA 1WTCA 1YZKA 2GZ3A 2J33A 3D7NA 3PFHA 3RFUA 1IEQA 1R9JA 5L6LB 2EC5A 3DKPA 1EVKA 4H27A 2HU7A 3Q2IA 4L0MA 4QX6A 4Z0TA 3RU7A 4FOPA 1ZJZA 2XRMA 3GCDA 1P0MA 2JAWA 4I9GA 3AVPA 4UE3S 4XX0A 5DBIA 3VZDA 3WQRA 4J7CA 4TLLB 4F6RA 2I2AA 5CR9A 1J2RA 1KIFA 2KS6A 1R9NA 3OA0A 1VSBA 4NQRA 4OJKA 1JNYA 2CFCA 4BGDA 1PSZA 1XXHA 5DJ5A 2JLYA 1GO2A 2FFHA 5DGCA 4LN1A 1H1LB 1TJNA 1XGKA 4KXXA 3LT5A 3HU2A 3E82A 2AJBA 5H02A 1BS1A 4QIHA 1ZXBA 4TV8F 4BVAA 2FXVA 3KUDA 5D2CA 4ZKEA 3RIMA 1LRLA 2X23A 5JHHB 2JJ1A 1VPVA 5T64A 1MRNA 4EB8A 4LOJA 3OLZA 4PGMA 3BK2A 4QDUA 4TVOA 3D6UA 4YRZA 2G9QA 4DLBA 4YVFA 3CRW1 3ABRB 1MTZA 1PR4A 2P2YA 3CZPA 3FHOA 1KIMA 4B6PA 1AHNA 2AG5A 2AOVA 3V8QA 1P2GA 2ECQA 1JFLA 4UBMA 2WAXA 4ZXPA 1A9SA 1L7BA 2WIGA 3P9CA 2QXTA 4LDZA 2O3SA 2DQZA 2YWFA 2X1VA 1KJWA 2OT3B 3W2HA 1QC5A 3TZLA 5L51A 1K88A 3T9AA 1Z35A 3CNHA 1P8JA 4V0KA 3UUEA 1E1YA 2CJXA 1Q7GA 3WQSB 4EHIA 2IKQA 4IH4A 3UUWA 3SY8A 3R9IA 4A1OA 4ZEMA 3CRRA 3CLUD 5EIFA 4OKIA 4F04A 4B2IA 2GCOB 2OSBA 1S2LA 2WT4A 4WOJA 2FWPA 1CQIB 3SVZA 2EFCB 4IOLA 2NV0A 3U9LA 3QX3A 2P65A 2XVZA 3KKMA 4MGEA 1RKVA 2JCVA 3H1EA 1E99A 1GNRA 1DKLA 1ZUIA 3FDZB 1EESA 1PEDA 4NS4A 5EMJA 2Y1DA 3V46A 2ERYA 4FB4A 5DU2A 2YMLA 6CHYA 3ICEA 1A9PA 1BMFD 3MTIA 2XE6A 5AVZA 1HGXA 5C5CA 1EFVB 3NHZA 3G2KA 3F3KA 2D4HA 3CBQA 1ICEA 3DB1A 2C4UA 1PGNA 1RHJA 3AO0B 3L0IB 4JP1A 3I9FA 5BSRA 4S05A 4DZZA 1I4TD 4D0LB 1USVA 4TUYA 4K5QA 1UAGA 3F5DA 4HWRA 2CMKA 1OZGA 2GN6A 2W6JD 3HUDA 4PYIA 4WDQA 1NF9A 1IPHA 1PS0A 2WWVD 3PSHA 3FTDA 2MWMA 4BGIA 1A8SA 2EZ8A 3DZFA 1UC8A 2NPIA 4EMUA 1RC0A 4NOLA 1J22A 2OLKA 1FMLA 1DIBA 2E87A 1SC3A 2PUHA 2XGGA 4FHFA 1H2RS 4AFNA 4UHHA 4JBIA 4DA6A 4DMHA 5BR1A 2Z43A 2VP3A 5TIIA 3Q8MA 4KEAA 3A3YA 1AHIA 2QGFA 2F4VB 3OURA 5B36A 1W19A 3H75A 5AHWA 1M1YE 5HCUA 3LC0A 1TAGA 3NB0A 4AO8A 2FR0A 2IBTA 4M6WA 3ZJUA 3LQ4A 2MSWA 1I3NA 3FYSA 2OZLB 4W6ZA 5DSZA 4DARA 3EZ2A 5A7GA 1RVDA 3ND9A 1QH8A 3A1WA 5K20A 2VWGA 2WTAA 1KHTA 1GGEA 3ZOZA 2XDYA 1ZGGA 1YMUA 3WMEA 1VJTA 4OUDA 4LX8A 5LLSA 4A9AA 4KAAA 1E58A 1Y80A 3W8RA 3OZAA 4RE6A 5AQEA 1MG5A 2PUGA 3OQIB 3ST7A 3TIXB 1ELOA 2D1RA 2ZYDA 3ELYA 3HVJA 3W9BA 1DZ3A 5EJGA 4V3CA 3V80A 5DHUA 1QYVA 3R23A 1ZNQO 1LY1A 4HHEA 3ROXA 3PQ5A 3TZKA 3V32A 5HWSA 5L3SB 5L3QB 1EFAA 4Q21A 1Q5PA 3QEJA 1ZITA 4RJ2A 1CYEA 3LYHA 3DVAB 3LK6A 3DFMA 3WIEA 4MCHA 2Q3LA 5DZSA 5LDGA 1KDZA 4X1YA 1EWVA 3HB0A 1CCWA 4D99A 4ZYLA 2GARA 1JF8A 1Q6YA 2VZ0A 3A6LA 4AY2A 1CRPA 2ATCA 5AI6A 4W5RA 4L78A 3N8KA 2GNAA 1E89A 2IH4A 4LHYA 4YEDA 1EIWA 1O5OA 1TZJA 3MLAA 2Q1TA 3GDHA 3EGEA 2A4MA 4XH9B 3TW8B 3I1JA 1G8SA 3SQDA 3JAWA 3DLBA 4N54A 1MN6A 1U7OA 2JBAA 4RL4A 5F7ZA 3A1EA 4JWKA 5DEIA 1EDDA 1CJTC 1VE9A 3SI7A 1Y1QA 1STOA 1TIKA 1M6VB 3NOQA 2EHJA 3I2IA 4GSKA 2XYVA 4NF2A 4HCJA 4ASUA 1EGMB 1J8DA 3R09A 3W90A 4BO4A 1I4LD 4P83A 1PFGA 1P4GA 3NI2A 1JMVA 2JK1A 3RRMA 5EAIA 4YFYA 3O92A 3A6DA 3OY7A 4HNUA 5GJBA 3HJUA 3VO1A 5FTLA 4OYRA 3AG6A 1VMKA 3UBTA 1NONA 3F8SA 4HY3A 5D6NA 5LM3A 1RACA 1LEHA 2OKCA 1A9YA 1P45A 2HEIA 2AWOA 3I2KA 3NHSA 3D0KA 3K32A 4RE5A 4AN0A 3GNLA 2EWVA 3WNQA 3F7NA 1X80B 3NYQA 1M75A 1FJ2A 5P21A 2XCSB 2Z98A 1YZ3A 2X77A 2BL4A 3KZCA 5I3CA 3EIWA 1FYXA 4DGQA 3GGGA 4EYOA 4YQYA 5I4CA 3AK4A 4S1TA 1KVRA 1D2MA 4IG4A 4Y2XA 4R1QA 1UUFA 1JKFA 4FNGA 3NUQA 4XIIA 1P9NA 1X9IA 2C1EA 3T5BA 4C4ZA 5LMZA 3GDGA 3KQUA 3ZR4B 5L7TA 4IM7A 3CNBA 5KJCA 3E9NA 4DUGD 1KEPA 1AZWA 4I1YA 3NASA 2WJPA 3KLPX 3CURA 1QZZA 2BOVA 3N74A 4PCAA 4EUSA 1P18A 3HU1A 3D5TA 4R7TA 3HO1A 1IBLB 4BMOB 2ZIEA 5EVCA 5A9SB 1ULHA 3KVYA 4X20A 4LVNA 4OHOA 3ZHRA 4CKCB 5I9SA 4A16A 4AYWA 5KYWB 3SIRA 4OXQA 1WDMA 2WUWE 3TMKA 1OC4A 3C6KA 3G17A 3JPYA 2IC5A 4EG6A 4RKRA 2XTNA 2PG3A 4J0EA 4ND6A 5EWMA 1OXXK 4ZVSA 5A04A 5BPHA 4JI5B 2GPNA 1N6RA 4BVGA 4DV4B 2Q0XA 1CE8A 2J0UA 2WWFA 3CNNA 4EF4A 2J67A 3GJYA 3VKHA 1VZ3A 1H65A 3EGDB 2X0DA 1QIFA 1Z4QA 5KHOC 1XL0A 3F1KA 4P80A 4RPJA 1JDVA 4AJNA 5K0LA 5CA0A 4HDQB 3FOCA 5CB4F 5LZ4A 4MW5A 3BFVA 3FCCA 3ZDZB 4MUHA 4WKOA 5K09A 1E2LA 2AVNA 2CLSA 2VTDA 4PCLA 2RGEA 1F1BA 3QFFA 1U81A 4ESHA 2GVDC 3R3HA 4L27A 1G2QA 4WKNA 5FUVA 2NAFA 3D59A 3HFRA 1RFLA 4YH1A 1AB6A 3X2FA 2CBXA 1LI7A 4AY3A 3RUFA 1MC4A 1NMXA 1FX0A 1EVJA 2WJZB 3GFQA 4Y1EA 2XDQB 5EUBA 2I78A 5FWYA 1TEZA 5CCEA 5LOVB 3E8SA 4DUYB 3OOWA 2C78A 2CUZA 2WFLB 2YTZA 3EPRA 3O75A 4GLJA 5JSKA 5C0OE 3ZGLA 3ZLTA 4DABA 5CLFA 5K0EA 1NG1A 3A4NA 3OT4A 5SYAA 4YWJA 4A5OA 1LW6E 2NX2A 2LVBA 3FUVA 3FOWA 1L7MA 3IE2A 3JR7A 4UCQA 4XA8A 1Z7WA 3KNZA 3P9YA 5F2KA 4E5KA 4EY3A 1OLOA 2P6PA 1I4WA 2BFDA 2OCPA 2YIMA 4F4DA 2O6LA 1O0CA 1T5SA 3QOXA 1QG2A 3BJEA 2K2QB 3TQSA 1JI3A 1P80A 2DSTA 1GRRA 2EWWA 2J08A 5IHPA 3VYTB 1TCUA 5FUYA 3VPHA 2OBLA 4TTAA 4Z7JA 1G63A 3V48A 4KE8A 1E79A 1SCKA 3E5RA 4ZO9A 3PD7A 3M89A 1H3EA 2A9KA 3ACBA 1AKUA 3F90A 2HMUA 3N2EA 4RD6A 4KIFA 1GNQA 3EOBI 4LGYA 4D4KA 4LSGA 1OJLA 2Z08A 3I72A 1GG9A 4B6QA 6YASA 3HY4A 1Z63A 2OB2A 1OYVA 1S3FA 1SXHA 1PP4A 4DYHA 1UM8A 1Y1PA 2PMKA 2CDNA 3ZIUA 1RHUA 1OY1A 1ZG3A 2RHMA 5A5DA 3KKZA 5BUCA 2DLCX 2JGDB 1JEJA 3GJ3A 3OF3A 3IBGA 4Y6OA 4KE6A 5DHQA 4AVYA 3AUFA 1XP5A 2C7BA 1UT6A 1LLFA 1PJ4A 2XSZD 4AS1A 3K6JA 3KSMA 4JVLA 1C3OB 4RJJA 4TOIA 4QRDA 1L8LA 1FFCA 2PMDA 3Q98A 4B4VA 2C2ZA 3ANYB 3VV2A 1FNDA 5KWEA 4BX0A 2J7PA 3KB1A 2MJLA 3GO4A 3PEVA 4L5BA 4X41A 5F4ZA 3PC6A 2AC7A 2H51A 5TSDA 1EM8A 1EUZA 4D92A 5KJ6A 1H9AA 2IU4A 3OBIA 3MELA 3KJHA 4FYMA 4BQSA 3KELA 1JH8A 3OOHA 2QVZX 1BS9A 5ERGB 1QHFA 1VHWA 2JS7A 3RHZA 4AY4A 2WT9A 3AY6A 3PQ4A 1C0KA 4KU4A 3WP0A 4PNHA 2Z5GA 1TK3A 1B93A 5FNVB 1WMFA 3M2PA 1GLNA 4MOWA 4EY8A 3EWNA 3HDTA 1GLGA 5B6IA 4XJXA 4R8VA 3MQ2A 3Q1LA 1XU4A 3HNPA 3VPCA 1OLUA 1B73A 1CUCA 4ND4A 2X8JA 1PUXA 2Z8YA 3NJ8A 4HPJB 5FUQA 1XHLA 4I81A 2PS9A 4NU8X 5LZ8A 1FMJA 1QLHA 5EIBC 1EAMA 1ZN9A 3C3JA 3NIBA 4ND8B 2I3AA 3S8EA 3PHCA 1RW4A 1MP0A 2ZBDA 4HPXB 3ZI7A 1QRDA 1BC5A 3WRVA 4HH4A 1QAQA 3RTDA 3W6OA 2F9LA 1WKVA 4ND5A 1T3TA 4NU6A 3CRQA 3R9XA 3AHJA 5AK4A 2V54A 3GG9A 1SBZA 2IXGA 3M0EA 2V7VA 1DAOA 1WQ1R 2QZSA 4TL6A 5E6SB 3T0GA 4E5YA 1HQYE 3WGUA 4FFNA 4PYNA 2PRJA 3BSWA 4BFUA 8GPBA 2BGNA 1BXZA 2Q0QA 3D6MA 4LI0A 5KYYA 1X7XB 2AUNA 3KKNA 3L4BC 3V4RA 4Y1RA 4B6OA 1TAUA 1E3DA 2BDUA 1M1NA 4EI7A 3C6YA 1FU7A 1P2VA 1D2NA 5DKFA 1KPIA 1UKEA 4MKGA 5C53B 4UQLA 2PIDA 4GYJA 3S1AA 4OV6B 5JJIA 2PGXA 2VLBA 3UMFA 3R0ZA 4JIGA 3HNRA 2RCNA 2VF8A 1UPCA 1VKNA 3ESDA 1ZC3A 1EUYA 4LZJA 4DT1B 3L4EA 4D6XA 4NL4H 2RCYA 5LQNA 1A7UA 4PINA 3LI2A 4KMMA 1TIPA 2FEPA 4PLHA 1U90A 2AMJA 1Y98A 2JEYA 3GI1A 3IA2A 4OG2A 3Q5GA 3CX3A 7MDHA 3FX2A 2GD6A 4PXAA 2LW7A 2KLHA 3I2YX 5AWFC 1LK5A 3BOSA 2P3OA 2FOXA 2HJHA 4IH9A 1M5UA 4EG7A 5DSXA 3T1NA 1YVUA 1NAIA 1L7QA 3VYSB 2ATIA 3PXBA 2HCRA 3CR8A 3IIEA 1XK6A 4Y6SA 4OHUA 2R1UA 1F7UA 1TJPB 3D4NA 1XCGB 5E9QA 2Q5HA 3DE4X 5AKYA 1GPAA 1MOZA 1US8B 4O08A 2XA2A 4TRJA 1G66A 4C03A 5HTKA 1YMVA 4F2PA 4OHXA 4N6NA 3TOCA 3ZV4A 4PLVA 4TMXA 4FIZA 3GLVA 3JWIA 1E96A 2W43A 3MGBA 4XWYA 1FSGA 2GZ1A 3DLAA 4XR4A 2KHZA 2ZSJA 3DT8A 1L5HA 3V4LA 1R10A 2UXBB 3EFOA 3LH5A 2V55B 4B3FX 3S2UA 5TARA 2F8LA 4BKRA 5DX8A 4B71A 3M82A 1PUIA 4WUTA 1NQOA 3EDMA 5GMOA 2VP4A 4FE3A 1OW3B 2DECA 4GQIA 2HDOA 2VPPA 4G8JA 1NJ2A 2VA9A 1LSUA 1YR9A 3NWBA 4KIWA 4WVLA 4I4NA 2BKLA 3HCEA 3DKRA 4IX9A 3GF4A 5A03A 1GY8A 4AKHA 3OCUA 3DO5A 5M7EA 2W37A 1YS9A 2VHQA 3I2HA 1R6BX 1XHEA 1Y8AA 1TJYA 5KWSA 1HEIA 4N8EA 2VNKA 3PNVA 4F21A 1A7AA 2GBIA 3AINA 2HPVA 3NHBA 5FB3A 1OXSC 3OQ1A 3W5JA 1D5WA 2Q6VA 3A3KA 1Z2PX 1QHHA 5EERA 4Z4FA 1NVDA 5ERYA 1VM6A 1X9GA 5BURA 1I7NA 4DMKA 3LM8A 1E92A 4OHWA 3O0TA 4NBSA 2H4XA 1M8KA 3MB8A 4LJYA 2X8LA 4CRWB 3LPLA 3AVXA 3MGGA 2XMQA 3HMKA 2AG6A 2R8RA 2ZJZA 3R4VA 4URWR 1JLKA 2ZTSA 3O26A 1PNVA 1VJRA 3TZBA 2QRVB 4QQ8A 3CX4A 3LQ2A 1DBVO 4YAJA 1FP4B 2QU8A 1FA9A 3BIOA 5AVKA 4IRXA 5BRJA 3AHIA 3RODA 1WW3A 1C8VB 2PR2A 2JGEA 3JASA 3K9GA 4WX2B 1J8QA 1MX3A 1L0BA 1WZUA 3MOIA 5F76A 3HVHA 2ZK7A 3U4MA 2XNDD 2ZI7A 3SPXA 1UM9A 2I7VA 4JMPA 5AW3A 1EWQA 4KGZA 3BM5A 4IDHA 4BFTA 2YDXA 2OILA 4TLDA 2XODA 3HYCA 1OH7A 2F55A 2E4UA 2XUOA 2VHZA 2DWCA 4M54A 2BDTA 2HW8A 2AIRA 3RU2A 1A2BA 1UMKA 2FZCA 1XU9A 2G88A 2QTNA 3CXRA 3CB4A 3DM9B 3GP3A 3OZGA 1I4OA 2OHJA 2VUSA 5EQTA 3QNWA 5FL7D 3UHAA 3WJ1A 1GTL1 3KJIA 4YQFA 3J7TA 5A5FA 1XZQA 5EJ9A 2AQ8A 2RH5A 4M53A 5E9AA 1KOJA 2EF1A 3FPJA 2V0NA 2EDAA 4PYMA 1EFPA 3L7CA 2ACKA 3L4BA 4BY9E 3JYLA 4D3XA 1I10A 2JLBA 4KPUB 4O2BA 4QYIB 2J6CA 4ZTZB 4GDFA 2C98A 3B3JA 3IGFA 1IM5A 1A72A 4P8RA 2GNPA 4AUMA 4I14A 1FPMA 1A77A 1GUBA 1X6VA 1ZKMA 3CZQA 5ULLA 3UAYA 3QFTA 4O8ZA 3QG5A 3IILA 4MQ4A 5DI3B 1H8ED 2W2XA 2F9FA 4DCOA 4O4HA 5JNWA 3KEMA 5FWAA 2E9SA 1JH9A 4I4TB 1IZYA 2LWIA 3W7AA 3K8YA 4QXPA 3Q7PA 3DW3X 1GCIA 1V5EA 3HZHA 3LBFA 1EFLA 2PM8A 3Q6MA 1KI2A 4Q03A 3RIGA 1OX6A 2WTBA 2J0SA 4JFRA 4R5MA 5KC9A 3NX4A 4WLVA 1E9CA 4FK8A 1Z7EA 1P39A 4TLCA 1GAWA 4R7GA 3RT9A 1CUHA 1C9JA 2V3VA 3MPOA 4WQMA 4DYVA 5JROA 5LQAA 2GF2A 3S3TA 1I6KA 4P98A 1JJIA 1H0HA 2OD7A 1ZH2A 1WX1A 1DFGA 1ULAA 3DT6A 3LCVB 4D5GA 3I9OA 1MZPA 3FBWA 4F5DA 3SXUB 1NZFA 4A10A 1N1DA 2JFHA 5KOJA 3U9SA 1IN8A 1NXXA 2ZLBA 3O8BA 3G1TA 2FUNB 1AKYA 4QA9A 3E84A 2G09A 4M9RA 4XM1A 4EPRA 4BXOA 3OO1A 4JLDA 3H0CA 4R9VA 2WKWA 4K0KB 2GA8A 2ATVA 3KU1A 5GONF 4KP7A 4UM9B 2FY8A 1AHHA 2YYAA 3HGMA 4NTZA 4X54A 1T9GS 3WWEA 4WN3A 1HX7A 4DNQA 4X62B 1QZUA 4H0CA 1C29B 4RS3A 1MXFA 1X3LA 1LPPA 2I6FA 1NR7A 2I3ZA 4W63A 2I3BA 3MWKA 1SU6A 2F1IA 4UBNA 4XTRA 3QI7A 5EQDA 3SM9A 1HTBA 2QENA 2B4TO 5E4YA 5JWRA 2MSCB 2DQ4A 2VDOB 1AK2A 1HLGA 4UUNA 4E30A 3THXA 4COKA 4L8VA 3HZRA 3I9NA 4RH0A 4W7IA 1KZHA 1P73A 3T3GA 5JAMA 3UUGA 3JSAA 3RBVA 1T35A 3G7UA 2UUCB 1EHCA 5TVGA 2TMGA 1B7GO 2RARA 2WUVA 3FSRA 4MPDA 5BNZA 5BO5A 3L41A 3QA9A 1KXZA 3WRWA 4HT3B 2O8FA 2J3LA 1DCFA 2WR8A 2W2LA 3AOEC 3JYNA 3PUKA 3B6MA 5EXXA 4WXYB 3UMJA 3OX2A 1A5AB 1VIDA 3HB4X 3KXIA 3ONVA 4L02A 1NATA 1FIUA 3ZHXA 1FYDA 5KYUA 5L6MB 2W2OA 4JLBA 4OFWA 4QT0A 4XB2A 4I7EA 4PQYA 1WLYA 1N5OX 3OAAA 3CSSA 1HG1A 4M1KA 1JEQA 2D5AA 1SZJG 2PSSA 3FTCA 4O4LB 2DX7A 5TQ2B 4O3MA 3F5SA 3EG9B 4YB8A 4MJLA 3B3QA 1M2OB 3AV3A 1E66A 1HDGO 4BYMA 4E88A 2IT1A 5DNVA 1J23A 5JZBA 1QHIA 3R1IA 5HQ3B 1K7XB 1ZK3A 3QW2A 2HA7A 4MRSA 1J7KA 1GPWB 1KF0A 1F20A 3D7KA 1ZUD1 1KYWA 1O89A 3UMVA 4ZCRA 2VR1A 1NUAA 2OCGA 3DAGA 1D1TA 1VOTA 3W0LB 3ZBUA 3DFFA 3AHEA 1LC3A 5HEKA 3U7IA 2MT9A 1ENYA 3EW7A 1P62B 4LHSA 5KI6A 4KL8S 3RI3A 5IT5A 1UAYA 3G2LA 3ZXSA 3QK7A 5SYNA 3RAGA 3KCQA 3U4AA 2VNJA 4F8YA 4Q3LA 3CQ9A 3L0DA 3KWFA 1P9OA 2EIHA 1EFKA 1EWKA 3SC6A 2QUJA 3O4VA 2DUUA 1ORWA 3P0RA 5HJ7A 3DGFC 1K8QA 1L4EA 4DCJA 3OKAA 4YWHA 3TRIA 2Z9CA 3BTVA 3UIEA 1EA5A 1SK8A 3S2GA 1BE1A 3ZH2A 4B7AA 4LOHA 3AEYA 2YIVX 2OYRA 1VYUA 2O3UA 5FHQA 3LYAA 3UAZA 3VH3A 1Y6ZA 4YAEA 1RIFA 1R5OA 2GNOA 4YRKA 1GD1O 4FHZA 1U9CA 1J8FA 4PBTA 1SD1A 3GLKA 4PZDA 4R1NA 1BO6A 1CUUA 2VNHA 3GRKA 4XM0A 1FDIA 2DH5A 2XMGA 3TL2A 1UIRA 4OQYA 6AT1A 5FUMA 1DARA 1NVTA 3WBFA 1WUYA 2RH4A 3G2PA 2GJKA 4NG5A 3UJDA 2VHCA 1Z62A 3N8HA 1ZM3A 4RDHA 3SMQA 2ZIGA 2I66A 1BYUA 3BH7A 2ZBQA 3GW8A 2ETVA 4U8HA 1A3CA 3SQMA 4XWGA 1N5KA 4E6PA 1PFWA 3T7EA 5J2TA 5JPDA 1FZTA 1EFHA 5DCYA 3NVAA 4UMFA 1YZVA 3UT5B 3H2GA 4BB6A 5LVAA 1R6UA 3Q9SA 4QATA 5FWXA 4OB6A 5AP9A 1L4KA 2H3EA 4GMDA 2WSLA 4FSDA 4AJEA 4LV8B 1AXEA 1L5GB 3FWHA 2G6TA 2NT3A 5FI0B 1DJNA 2GK4A 4H3HB 5LQKA 5AVJA 4LOIA 2I29A 1P3Y1 4L50A 4V0ME 1JQ3A 3G79A 2RAFA 1XB2A 2XTMA 4ILKA 1JSCA 3A6JA 4MVJH 1P60A 2JVIA 5ICFA 4EJ0A 2HZBA 2O54A 2FRVA 2GCGA 3J81A 4ZMBA 4PX3A 2R97A 5CFPA 4NENA 2QRNA 4DJDC 1FTQA 5A6VA 5I7UA 3UTCA 4MKXA 3OZRA 1TRHA 4FB5A 1P4JA 2YYYA 3IOCA 1UDWA 4JU9A 1QKJA 1Y7LA 3CISA 1SQFA 3LLVA 2IWRA 2IE8A 3R5FA 3WDSA 2QGZA 3DFZA 4YY3B 3AVYA 4DA9A 3RU9A 3NVKI 4ZVKA 5IW8A 3OX4A 1IRXA 4RZHA 4AUEA 4GIBA 1ZI9A 3WHIA 1JJBA 4K3VA 2E4AA 4M0LA 2J3IA 3F9RA 4Y3UA 1W8IA 3UFBA 4EO7A 4BKQA 1QIDA 3WL8A 2V6BA 3GVPA 3PNSA 2NPFA 3AOEA 2I87A 3QW4B 2HSGA 3H6KA 1BNCA 2V5AA 3RGWS 2D5LA 3QEMA 4EBFA 1GKYA 4Y2YA 4I3HA 3PX3A 4X8HA 3C6ZA 2IHZA 1N92A 4N3NA 3AF4A 1JXMA 2VVTA 1GLVA 1OR8A 3F8TA 5EEHA 1SVIA 1HDXA 1HT2E 1UP4A 2FW1A 3IAS6 1A76A 5EJIA 5IVHA 4EPXA 3OHSX 2XGMA 4BP8A 2CF5A 2W2PA 3JYHA 4TPKA 4KQFA 2YS7A 3X2EA 3CZRA 1QG6A 1Y6QA 1MEOA 2YJ4A 1WB9A 3MCTA 5EXTA 1B6SA 4IV8A 1NVXQ 1P33A 4MUMA 4ON9A 3V1LA 2JH8A 2VL7A 2HDWA 4DNXA 2I4TA 1LJLA 3OOYA 2L18A 1PWXA 3SCZA 4DSUA 1HWYA 4A6DA 2VTEA 5I9NA 2VRWA 4U5QA 2X2EA 3AI1A 3I04A 1B0UA 1C7IA 3Q87B 1LS1A 3GLHB 1JG3A 4H4DA 1PT7A 4P3XA 4RGYA 1E2EA 1ZCBA 2GGSA 2IHYA 4LOKA 4FHDA 2EGGA 2YWGA 2AXPA 1LDGA 2NUPB 4HS9A 4P08A 3AHGA 1A1SA 4RVCA 2R9VA 5GIPE 3N0WA 3KQKA 1RCFA 2Q8PA 4K6CA 1V9CA 4R9NA 1ADGA 1LI4A 3BDAA 4CR6A 5AKEA 3UK6A 1VECA 3ESRA 3WTBA 4AP9A 1V16A 4BVJA 2E4WA 2QUKA 4PYOA 4WLFA 3KEQA 5SY9A 4A36A 4LS3A 1AXGA 4BKPA 1JJAA 2VPYA 5U4XA 3LMKA 1H5NA 1M8GA 1RM3A 5T6MA 1XA0A 2HCTA 2J9XB 4K9QA 1AHPA 3PGJA 2YJ5A 3NDPA 4IDFA 4LY9A 1UBRS 3K70D 2A67A 2PZ8A 3I9V1 4UULA 4RKQA 2HKIA 4WZAA 3LL4A 3OT1B 4Y8VA 3R6DA 4OHFA 4PYQA 1I6MA 2HADA 2R6CA 3D8NA 4LRWA 2J5XA 4UTPA 1WEHA 1P29A 3F5MA 2XYPA 2PUAA 3TTXA 1GN8A 4TZTA 4GPIB 3EJWA 1G4AE 4M0PA 5CUQA 1MAAA 3AI7A 3PFIA 3KAJA 1UBJS 1GA6A 1VE5A 1Z3IX 3E0XA 4Q19A 5I48A 3E1GA 3T52A 2GD0A 1GZUA 1XRPA 3UMRA 2B36A 1E5VA 3K9QO 4HGOA 4MQ6A 3OP4A 1L5YA 5AOCA 3SOPA 2B61A 4XVCA 3LCRA 3S2ZA 1UAAA 4NNPA 1A9RA 2VTKA 4FFBA 1Z5PA 2AMVA 2E1RA 2ZI4A 1PV1A 1YDWA 4PZ0A 5CK5A 3D7SA 1NKTA 2FPSA 4IINA 4LJ4A 1HYEA 3I4LA 5PGMA 3X3HA 1WVIA 1LNQA 2OP0A 3BWDD 3JV7A 4MV1A 4LYFA 5A4IS 5HDBB 1NN5A