4LT5A

Structure of a naegleria tet-like dioxygenase in complex with 5-methylcytosine dna
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
265
structure length
265
Chain Sequence
INKKSLLQNLLSKCKTTFQQSFTNANITLKDEKWLKNVRTAYFVCDHDGSVELAYLPNVLPKELVEEFTEKFESIQTGRKKDTGYSGILDNSMPFNYVTADLSQELGQYLSEIVNPQINYYISKLLTCVSSRTINYLVSLNDSYYALNNCLYPSTAFNSLKPSNDGHRIRKPHKDNLDITPSSLFYFGNFQNTEGYLELTDKNCKVFVQPGDVLFFKGNEYKHVVANITSGWRIGLVYFAHKGSKTKPYYEDTQKNSLKIHKETK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naegleria Tet-like dioxygenase
publication title Structure of a Naegleria Tet-like dioxygenase in complex with 5-methylcytosine DNA.
pubmed doi rcsb
source organism Naegleria gruberi
molecule tags Oxidoreductase/dna
total genus 85
structure length 265
sequence length 265
ec nomenclature ec 1.14.11.n2: Methylcytosine dioxygenase.
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1640 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lt5A00
5CG8A 4LT5A 5CG9A
chains in the Genus database with same CATH superfamily
4YNIA 5DPNA 3BYWA 1LOBA 2EIEA 1RXGA 1EV13 3CHXA 1H9WA 4WZCA 1AYN2 3I3MA 2VMDA 1UN1A 1R092 3MUZ1 1WLTA 5IK4A 2DBNA 1RINA 2FD8A 3MV01 2CWMA 3K48A 3Q8CA 4Q2FA 3GGLA 1SBDA 1F4AA 4WM7B 1KJLA 4HSLA 1VBA1 1S0EA 5F3EA 3RZMA 3IMNA 2Q8EA 4LXLA 1KEXA 2VM9A 1W06A 5LA9A 4NWVA 1POV3 4QU1A 5A7SA 1REEA 5KHGA 1CAXB 2Q4SA 2XUMA 1QXRA 3BN6A 3C2UA 2OQ6A 5DQ0A 1U12A 3R0RA 1GYKA 4N7IA 4IEVA 2WS92 5L9VA 5EFUA 4A4AA 2WNOA 4BDVB 3AYCA 2OIIA 1WLDA 3RYRA 4F83A 2K0GA 5D1IA 5F5IA 3VDAA 4LIVA 3LCPA 3ZKYA 1YEWA 4D3WA 3SMHA 4KBZA 2Z2SB 1TME2 5J1XA 1R1ZA 4LHLA 4K9SA 2HEWF 2Y0OA 2ZGUA 3GALA 4K40A 1XE0A 2N7GA 4RYDA 2A6WA 3LDRA 1IS6A 3NJVA 1C28A 2W52A 3FE5A 2WA3A 5F39A 5IVVA 4NRPA 3MW2A 1YRZA 5A7NA 4F3JA 4CUGA 4I0AA 3VZMA 4WVVA 2ARAA 3H9AA 4PBOA 4DO0A 1R093 2DU1A 3OUJA 2Q1FA 4GKXA 4CZSA 1KJRA 1ZBA3 2P6HA 2QQIA 2GNMA 2VE1A 3AJZA 5GKAC 2ZAHA 4NRMA 2R061 1FMD1 4S2GA 4LO6B 3WG3A 1W2AX 5IK5A 1CAVB 5E89A 3ACGA 2R0FA 4XAAA 2GC1A 5JVVA 4QAWA 1JZ7A 3SC7X 3POWA 1FV2A 1OVPA 4D69A 1LHNA 3BTXA 2WO2A 1J3QA 3KV5A 3SISA 4CCMA 1V9U2 5L19A 1GV9A 5L73A 2HWD2 3P1IA 2YU1A 3OJBA 4J6GA 4M0NA 2RVAA 1BLZA 2SBAA 2VGDA 1JZ6A 5KBFA 2F6BA 3R05A 3MLLA 4CUBA 4L92A 4PLMA 3DECA 4MSVA 1IPSA 1VRH2 1W6OA 2ZX0A 3CO2A 4NHKA 3E5XA 5HV4A 4YWAA 3M3OA 4NIGA 1OLRA 4CCNA 2VBBA 3WW1A 3ZYPA 1NLQA 2W91A 1ACCA 1K45A 1UY4A 1V0AA 1VBB3 2D43A 2Z5WA 3CJIA 4KG8A 5EJZB 4BQ4A 1Y9GA 4EN0A 2H6CA 5FBJA 1W8OA 3N9PA 2GNTA 2P1BA 1S0GA 3HVDA 3I7DA 1R64A 1VBC2 2BBAA 4DY5A 2WO1A 4QXCA 1NY71 4QPGA 3AKRA 1NA1A 2HWE2 1W28A 4O9GA 4R4XA 4FTBA 3T2QA 3CJIC 1UZYA 1KQRA 4XUOA 4CPBD 3B5LB 3WX5A 4IL7A 1LNSA 4QKNA 1N3OA 2XL7A 1UY0A 2RMU1 1XC6A 1SBEA 4JKKA 4GWIA 2UY9A 1NA1C 5JMCA 1SDDB 3RZGA 4AR2A 3M3IA 1TNRA 1LCLA 1OUSA 2VTXA 3OPTA 2XJQA 4JAAA 4P9IA 4BXSV 4OZOA 4YFWA 4CXXA 2O8QA 1RJ7A 3KQ4B 5JPMB 3THPA 3POBA 4FPJA 4JX0A 2QDRA 1WMXA 3LEMA 5C71A 1UKRA 1AL23 5IAXA 4YM2A 1MZEA 4XFAA 1LHUA 3I2KA 5IW0A 2VXRA 3LE0A 5FMOL 1XNTA 4B7KA 2G19A 4BB3A 4DS0A 1ZYBA 3HNBM 2X09A 2FHRA 2D3RA 5H9SA 3VKFC 5A7QA 5EJ1B 1MEC3 1S1AA 1DQ2A 3POFA 1GBGA 1PVC2 2DVFA 4KNCA 5GZGA 4ZHNA 3CJIB 1O8SA 1O5LA 2Q8CA 4Q4X3 1Z7S1 3KB5A 3B9CA 3TN93 1I5ZA 1XE7A 2WJSA 4AAXA 1HKDA 1XPWA 1VBC3 5C3SA 4JRLA 5LK5A 1IOAA 4QXHA 4TLFA 1NA1B 1QQP3 5FK8A 3SH5A 1ZZ9A 2HWE3 5FY1A 2WNEA 4Q27A 3QBQA 2AGSA 3OBRA 3ES4A 4FPEA 1WCDJ 2JWPA 1Q43A 3LSDA 4E27A 1O3QA 1JXNA 1IQAA 4XEZA 4LLOA 3HN1A 2WAAA 4BK5A 3EYPA 4RFT0 4YSFA 3J8F2 4BIFA 1VBD2 3HQRA 5LA1A 1RVF3 1JU4A 5I8SA 4L97A 5ERLA 3JQWA 5LA0A 1H0BA 1A3KA 3TAYA 1AYM3 2QQKA 3WY6A 5FO7B 5FZEA 2D6LX 2VBDA 2VCAA 1Q8SA 1CONA 4PI0A 4GD4A 3OUHA 2GN7A 3K75B 3WG4A 5I0UA 1G9DA 4FXGB 3WF0A 4A3XA 4KGQA 4UI9L 4A41A 4K7JA 2AENA 3E6BA 4A42A 1D2QA 1AHSA 1QH6A 4OFGA 1XNCA 5DUVA 1NE6A 1I9RA 2PN5A 3HIFA 3IBMA 5F3CA 5HXMA 2QDNA 2WZR3 2H0VA 3HQUA 4ISRA 4W8JA 2B9UA 4ZZ5A 2A3WA 3I3BA 1PIV2 4CDUA 4HVQA 2VQTA 5F3GA 4NHXA 1ENSA 2UURA 2OPWA 1SG3A 1QH7A 5DAXA 1HB3A 4LA3A 3WXPA 2XOMA 3POGA 2Q5TA 1I1EA 5T55A 2B5HA 2V73A 3KD4A 1GP4A 2K9ZA 1RTVA 1UO9A 2NQYA 1J3RA 2RJKA 5CADA 5JLVA 5CKNA 4EJRA 4FPKA 2RS12 3LB9A 4OHYA 2RS32 3UT0A 4B8EA 3G7DA 5FRAA 5IFPA 3PIJA 4JDOA 3CNAA 1SLCA 2VZPA 3N4MA 3UJQA 1ZBA1 4GMP3 5FZAA 3FUQA 1VBD3 5FY4A 2KR2A 5E1RA 3WZ1A 2IVIB 2E6VA 5FY5A 3H8RA 4FPFA 1OXCA 3RS6A 1TZOA 1CVNA 2DVBA 2WT1A 4AI9A 4QHOA 4UF0A 4FAGA 1HRI1 3MEPA 3N3HA 1D4M2 1CIYA 3WP3A 1POQA 2DU0A 4HN1A 4XFCA 4YRDA 5LA2A 4A7YA 1LTEA 5A70A 3JBG2 2V4AA 3EB7A 5FTTC 2WQ4A 3HR9A 1RUD3 4UXAA 4QB1A 2HYKA 1QJX1 1S0CA 2VBPA 3AZVA 4PQQA 1ENRA 2B45X 3N9MA 1CWPA 1OI6A 5FCCA 1UOFA 2LALA 5C7GA 5BNQA 4LQRA 4FPLA 2C26A 4W65A 4Y1YA 4XUNA 5F3IA 2VNOA 4K8FA 3VZJA 4YW5A 5FZ9A 3ZXFA 1BYHA 3CBNA 2R043 2WR9A 1CD3G 3J7NA 1SACA 2GP5A 1RUF3 2WABA 1BBT2 1GU3A 1VBB1 4IEQA 2XWJB 4P9WA 1PO22 2BNNA 2WNUC 3DUIA 2BU9A 5FZ0A 5BNNA 1WKYA 1S55A 4XXAA 2WIIB 3LAGA 2VZUA 4XFHA 2BFUS 4B4RA 1Y3TA 4QX8A 1DLCA 3OBZA 3T0DA 5L36A 3J4UH 1H1IA 2XUEA 4LOTA 1JODA 1O4TA 3UGHA 2J1AA 3FHAA 1JZ3A 5BNNC 3QACA 5FOJB 4UF0B 1J59A 1EAH3 1XYOA 1YIFA 2VOTA 4HOOA 4LR4A 1IKPA 2RR13 3ZXEA 3K51A 5IYYA 3CZUA 3MFAA 4ZONA 3THCA 4QT6A 3N9LA 2VY0A 5BNPA 3NV1A 4RQPA 1V6OA 1BHGA 2VZTA 3HMYA 5D21A 2ZHLA 4P14A 2GNBA 4WM8A 3NWKA 3W58A 4XFGA 1HX6A 4K6BA 3BALA 1DQ4A 2E32A 2Y34A 5I93A 5A6YA 5BNPC 4RQPC 4CU6A 5A3LA 5IVBA 2WSVA 5K0UA 2V5DA 1UU4A 4S2DA 1EP0A 1EPWA 4WM8C 4KWLA 1Y4WA 4X8NA 3A4UA 2FBEA 4BCUA 1UYZA 2DUPA 2QE3A 1FAYA 1AR62 1BBT3 2PLV2 4G9SB 1R1A2 5EP9A 3I4IA 1TMF3 4S2FA 4YW7A 3TN91 5BNNB 1LOFA 3FLPA 4X6RB 5K0UC 2VR4A 4YZ4A 4Q4V1 1FNZA 4MGYE 5F6KA 4UWDA 3ELNA 1ZRDA 5APAA 3D5OA 3FUOA 1M4WA 1W8NA 1OPMA 4H7LA 1TEIA 4CRQA 5LATA 1LOFC 2TEPA 3JQXA 1YI9A 1NZCA 5A1FA 4META 5FZKA 1QJY1 5DABA 1VLNA 4EWEA 4G4FA 1RVF1 4NHYA 5F32A 1H8TA 2ZEWA 5FR3A 2XWBB 2ZEZA 5BNPB 2JJ6A 2JG9A 2QFEA 2YPJA 4RQPB 2FCTA 2LM3A 4L0PA 4RHV3 5GZEA 4CXWA 3U4SA 3LWCA 3V65A 5C5UA 1OHFA 1W0PA 3AXEA 3CF6E 5J96B 2ZGTA 4WM8B 1S0BA 4XJ9A 1H9PA 4XE9A 2IFWA 5A80A 2HWB1 1H8TC 4YW4A 3RWNA 4ZU7A 3J7LA 3DF0A 4MGSA 1GQPA 2JG9C 3AM2A 1DIWA 1PX4A 4EV0A 1VMFA 2JE8A 4HMZA 1W8WA 4IGOA 2WBKA 4OMDA 4BH9A 5K0UB 3KGZA 2DUQA 2RM22 3MIEA 3THDA 3ZPOA 5FY8A 4NR1A 2BOJA 5FYYA 3F2ZA 3MDPA 3MLJA 1RUE2 1R1A3 3EO6A 4XIOA 1GQGA 5I8TA 1P8JA 1GP5A 4PHZA 3U11A 4QKFA 1UOBA 4QGMA 1H4HA 3I2HA 4XJAA 4C1XA 1SLTA 1O7FA 2YPDA 4EYUA 3MO4A 2KA3A 1RMU1 5BYNA 5I0SA 3H8XA 1CESA 3FMGA 2WL1A 3GHMA 3KV4A 4XIKA 4LBKA 2WINB 2VL4A 4ATFA 3I97A 1HLCA 5CZKA 2QQVA 1H8TB 5FMOS 1N1YA 1F31A 1APNA 4R9CA 1G9AA 4JRAA 2JG9B 2KXLA 4FPYA 4IDZA 2D6PA 2ZGPA 3L9JT 2DURA 4LEJA 3HOBA 4GJZA 3DL3A 2PXJA 4NE9A 2RDRA 4FOVA 2J1RA 2BGPA 3ZO0B 1ZRRA 4BQ2A 2XBO2 5FZIA 4ASMB 3NSTA 1R082 4Q4Y3 4YZ1A 4XF9A 2XHKA 5C5TA 1DYOA 2A1XA 5FIXA 5C8CA 2JD9A 2JE7A 1IPKA 3DN7A 2WWSA 5A3TA 5AC93 5LWBA 2NMOA 1VMHA 2CY6A 1LECA 2JDPA 2C1FA 4HT1T 1LENA 4MV2A 2RDSA 4I0WB 4EN8B 3UNPA 1EPZA 4IEWA 2HJIA 1ZZ6A 1HQWA 1IGOA 1NX9A 3MLKA 4KI5M 4P9YA 2BNOA 4NWWA 1BQPA 1VBA2 4BPZA 5C8CC 3AK0A 1NLSA 3LSEA 2MPFA 3NV4A 2DTYA 3T08A 2ZEXA 2IC1A 3K4ZA 1PMIA 4PIZA 4JZRA 5EYXA 3ON7A 2YU2A 4CVUA 3Q9OA 1VBE3 1GICA 2JICA 3UESA 5AVPA 1C1LA 3VBOA 5J48A 1HN0A 2Y0IA 2OVUA 1FNYA 1NLRA 4YW3A 5K9YA 5I0TA 3LEGA 2ZGKA 5IVJA 4HANA 2JENA 2GH2A 1UF2C 4AI2A 1EAH1 4LLFA 3VBOC 1ZREA 1JS9A 3EMRA 2RR11 2JG8A 2D3SA 5A6QA 4YG3A 4AG4A 4I30A 2DF7A 2J42A 4TTGA 5FO8B 4O65A 2NLRA 3AP9A 5C8CB 1RB8G 2FMDA 4J1WA 5CFCA 4OUEA 5J09A 1WBLA 4GQ7A 2XONA 5KHIA 1NZIA 2JG8C 3FHQA 1TG7A 4XF1A 3GZTB 4CCLA 3R4DB 2BP6A 2R062 1CPNA 1DQ1A 4L99A 4QHBA 5CFCC 4OUSA 1QF3A 4YVWA 1JZ4A 4FPGA 1V6MA 4WZFA 5FYMA 4EN6B 2XJVA 1S0IA 2D6NA 2GN3A 4LNVA 2CGOA 4G3YC 1NKGA 2HWC1 4Q0QA 4INDA 5HCHA 1XU1A 2PQSA 2C9KA 1XQNA 1LEDA 4PF1A 3LPGA 3VBOB 1KGYA 1ZRIA 3D0SA 4AEMA 3U75A 4AQ6A 4OUMA 3UJOA 3D8CA 3POJA 2E7QA 3VD5A 2UYBA 1IQDC 1GZCA 3C7EA 2ZABA 3MZHA 1H6XA 4YM3A 2JD4A 3VLBB 3N9NA 1Z0HA 5F5QA 1QJU1 4UBGA 1W9WA 2JG8B 2NM1A 5F6LB 1DGRN 1DYKA 3ZN6A 4A6SA 2GNDA 4CYDA 1YUDA 1X33A 4Y5Z0 1T6GC 3T1LA 3L2HA 4LK7A 4BHPA 4BJ0A 5B4NA 1Q56A 4K1ZA 3IMMA 5CFCB 3O1UA 5JUVA 1C1FA 1NY72 1UXZA 3ME2A 4XUQA 5C33A 2UWCA 1NYWA 5FJKA 3JD71 3BUCA 2C0ZA 4YW2A 2KD7A 4JTNA 3DYPA 5FPVA 5JDBA 1IS4A 3LFMA 2K46A 1FMD3 4CCKA 3BCWA 1GOHA 5KWRA 4UOJA 5FXZA 3D0JA 1ASJ1 3RG0A 2GAUA 5AFEA 2YFZA 3WF1A 4F8AA 2A70A 1XNAA 4LE3A 3AB0A 4JHZA 4AHYA 5IFTA 2Q1MA 2HH9A 3S5AA 3B00A 1RHI2 2YBKA 4AI3A 2CU5A 5GZFA 1YJLA 4DMIA 2TBVA 3ZMOA 1HJFA 2YUEA 4GWMA 5BXXA 5T5JA 3VV1A 4DNYA 4SLIA 4XFBA 4I0BA 3S5QA 2HEVF 1KS4A 1YHFA 4Q0UA 1OC1A 3IM0A 1J3PA 3AXDA 5IJRA 5FP3A 3ZN6B 2QQMA 2CGPA 4BK4A 1GZWA 1LHOA 4OHXA 1U5XA 2DBIA 3A0NA 1Z7S2 4IV1C 3ZYFA 1VAKA 2Q30A 3ITQA 1WUVA 2XDVA 3WP6A 1KD7A 2GP3A 2RE9A 4BQYA 1X82A 4JKLA 1HXS2 2YC4A 2FDJA 4E8DA 5DG2A 4QQLA 2P5BA 3RGBA 4Y1ZA 5IAVA 3T2TA 3JUUA 4DZGA 5FREA 2A75A 1QXPA 2B9VA 1WD4A 2WRAA 1PZ7A 3IWZA 2RMU3 4Y4YA 1LGBA 3SKVA 2B39A 1K5JA 2O14A 2W87A 3FX3A 1W6NA 3AMNA 1SLIA 3O7OA 4KWUA 1ULCA 5EXOA 5FPLA 3FBYA 5FMDA 2CDPA 1O59A 1FT9A 5FZDA 3P3PA 1PNFA 1AX2A 2YY1A 4P00B 3N7KA 4YGEA 1RUI1 2GMEA 3BTAA 4Y20A 3PHMA 4KGGA 2IZWA 4QM9A 2VCMA 2R0HA 5JR7B 5A1LA 4MUVA 2EA7A 4YLZA 2RV9A 4XMIA 1WW7A 4UFMA 3HQXA 4AEDA 4CP9A 4ES8A 5ISLA 2ZMNA 3RZKA 3B69A 2A71A 5FZMA 5JXHA 3BOPA 4XXPA 5BPXA 1GZWB 3VD9A 1FX5A 2PHTA 1YQ2A 5IK7A 2PHUA 4OQ8A 2L9LA 3DEMA 4LHKA 4W4ZA 4XYXA 3N35A 4BM8A 3U37A 4E4SA 4EROA 5A3NA 4AEDC 2QTWB 1CX4A 2QQNA 2DWRA 2EIBA 4LO7A 3SCFA 3WDYA 4BQ3A 4FBFA 1UW8A 4Y4RA 4ZU5A 2XLAA 5E88A 4GAZA 5A33A 3V0BA 3TNPB 2ORXA 3HWJA 4MG2A 1BJQA 1W8HA 2PQQA 2IXCA 3VBFA 4CU9A 2YZ4A 4QHZA 1ZBA2 1W6NB 3BB6A 2I74A 3CEWA 1Q8OA 2J7MA 3IAPA 4R4ZA 1K5MC 3KMHA 4K20A 2D44A 3SEEA 5I0DA 2WNVA 1DDLA 1S4CA 1JYTA 2FDGA 1L7LA 1CAVA 3WUDA 3O1PA 1RUG1 3VBFC 2ZOEB 4Y20B 2PYTA 2XB6C 4LO5B 3W21A 2BW8A 3ZXLA 5I91A 4KL1A 5JOYA 4KU7A 2WNVC 3AKPA 3OEAA 3BTZA 1G8WA 1SHWB 3H7YA 4AEDB 4MXWA 2DFBA 2ZKNA 4CP9B 4RR3C 1AJOA 3IDBB 2ID4A 3TRSB 5J36A 4FOWA 1MZFA 4RS5A 1DFQA 4DB5A 2R32A 4R9AA 4CUAA 1H1AA 1PNGA 3WNOA 1ZZ8A 4CE8A 1Y43B 2EXIA 4P5HA 1IG3A 2Y8KA 1BZWA 1GUIA 4FPHA 3LIHA 3OYWA 1DP0A 2EF6A 2Q8DA 1VBB2 1RUNA 4DPNA 1RUC1 1UQXA 1O3SA 4RS5C 1SDWA 3T30A 2E7AA 1K5MB 1LRHA 4ZS3A 2Z69A 1QXJA 3RVHA 5HCBA 5A33B 3M8LA 3V0BB 4XFFA 2Y33A 3PUQA 3VBFB 4AVBA 5JSRA 3E6DA 2XQRA 4C0BA 1MS1A 5LCWL 2AH2A 2RDQA 2WNVB 3ZDSA 4O9EA 3VZOA 4CCCA 1TNFA 5F2WA 1HRI3 2XPJA 1ENXA 2QZ3A 4RR3B 4XDQA 5FUNA 2XVKA 5A7WA 2JE9A 1BMV2 1OQDA 3M70A 4V2VA 3ZSLA 4NO4A 2VU9A 2ARBA 5GLVA 4DEVA 4P9GA 1O8PA 4HPKA 3KLSA 1MVQA 1FV3A 4OMCA 1HB1A 5LBFA 2BVVA 4MXWB 1AL22 1RUH1 1QJX3 4GALA 5G04L 4E8CA 5JAXA 5AFBA 4XILA 1GP6A 2VMGA 4RS5B 5JI7A 2R073 1V6JA 3F95A 4L8QA 1GZTA 1WW4A 2RS51 1U5YA 2W1QA 2ZGNA 4MGTA 1VMJA 2ET1A 2XLGA 2Y60A 3GBWA 1Q3EA 4I09A 4Q0PA 2JDMA 2A6ZA 1MEC2 3HNMA 1QEXA 3OG2A 4XC9A 3NO8A 4NN0A 3OYWB 2DVDA 1YQ8A 4RL7A 5FZLA 3BIEA 5DZFA 4HG6B 1W3XA 4GH4A 3WW3A 4JQTA 1UZ0A 4Q4X2 5KC5A 1Y9QA 2TNFA 3M1HA 3TN92 3QCWA 3UKVA 3J7MA 1FOD3 4GB31 4UAPA 4JCKA 1H1MA 4KG0A 4PJYA 4Y3OA 1LHWA 4R9DA 5HBAA 4AFDA 2WFF1 1I5PA 1QQP2 4FSJA 1OLME 5L9BA 1U5ZA 4AI0A 3LF7A 3I3DA 4GH4C 3E1F1 4N90A 2V72A 1JMUB 1UZZA 3GM8A 3ZOIA 5JOWA 3BODA 2BUKA 4AHXA 3WF2A 3OCPA 3KF3A 4FPCA 4HZFA 4DXTA 2CAVA 5B2GB 4A44A 3R4UA 1ODNA 4WV8A 1IPJA 1RVF2 5A7WB 1PO13 4IXLA 3HT1A 1F15A 1SFNA 2AZ5A 1W0OA 1AUYA 1AYM2 1OA4A 1CIWA 4HPKB 3UETA 2ZTNA 3VD4A 3ZYHA 2D3PA 4HL0A 4LBQD 3AVRA 2D93A 3RZLA 5CG8A 3A0KA 3GJAA 3WNLA 1JYWA 5DXDA 3ZYGA 1Q8QA 3VHPA 1H30A 2WZR2 1DLLA 3H0OA 4Z82A 1OFSA 4EZHA 2OXBA 3DPRA 4MX3A 5DAVA 3LPFA 4GH4B 3B7MA 1SCSA 3KS7A 2DYCA 3OY8A 1C4RA 2PHDA 3VDBA 1T2XA 3MIBA 3KM5A 5FPUA 2P3JA 4FT8A 3S7EA 2ORZA 3WDVA 2XH6A 2W9XA 5JSOA 2I45A 4A3ZA 4AVTA 3FJSA 3IIIA 1PGW2 4Q4V3 3DPRC 4DXZA 4GKYA 5IVFA 3VBSC 1LOCA 4KH9A 1AR91 1US3A 2VMIA 2ENRA 5A7PA 2Z4FA 2R7EB 3JB8A 1AX1A 2A6VA 2IXIA 3OGSA 1MZ6A 3T2PA 4BQWA 1QJY3 5FUPA 1D7PM 2Z42A 5BV6A 4IERA 4PDWA 1VR3A 4CDWC 4NAMA 4Z2WA 5CFDA 1E5RA 3USSA 4ZPIA 2VZQA 2XJTA 1W8UA 5FFOC 5K8SA 5DZEA 2PAKA 4ISQA 4RD7A 5LY2A 4AF9A 4D6RA 2I2SA 3Q8FA 4QQPA 2HWB3 1COV1 3WW2A 1RUD2 2NMNA 4PDWC 4BIOA 1W39A 1AR71 5CFDC 2A73B 1HB4A 4LORA 5LW9A 1WCUA 5GJ6A 4IE0A 4YGDA 4DQAA 4IEXA 4OULA 3N9OA 1NQDA 2Q8OA 1LU2A 4MXVA 2QNKA 3DPRB 1UAIA 3VN4A 1W8ZA 1WMDA 5B4XA 3VBSB 3OY8B 4UW3A 1HJGA 3KZ4C 3OBAA 1U0AA 5FMCA 5C8WA 5HPOA 2QUOA 1JW6A 3H1WA 4KBBA 4CEWA 5ACA1 4LPLA 1KDMA 2R042 1QWRA 4IQPA 2JIGA 3AYAA 1RUF2 2W3JA 1HQNA 5FZGA 4DY3A 1F9KA 1D0GA 3KCYA 3LDKA 4H2AA 1LGCA 3ETQA 3AKSA 1RMU3 2C5DA 3D4KA 3VBHA 4DUVA 2R30A 4CEWC 4Q4W1 1JUIA 1YI7A 2J22A 2JDUA 3PL0A 1Q5OA 5FYVA 1W2OA 4LO4B 5EPAA 3B9IA 3CQOA 1ZX5A 4K21A 2OPKA 2VECA 3J9SA 3VBHC 5K4LA 1J58A 2VULA 3C8XA 4PDWB 3PTRB 2HWF1 5A6XA 5CFDB 3KT4A 1FPN1 1XRUA 2A7AA 4ZXEA 1EAH2 4NUBA 1MR5A 4MVTA 1XYPA 2GZWA 1V70A 4YGBA 2RR12 1GMMA 4JGYA 1W03A 1VAVA 1W2TA 1GSLA 2CHHA 4P9XA 4UFJA 3ZXJA 2FZ2A 5CNAA 5CAZA 3SNMA 2G9ZA 1UIKA 3ROUA 1ULDA 1SCRA 3G6JB 3MPBA 2YXSA 1OT5A 2R1DA 1PMJX 4Q8LA 2YGLA 4NIIA 1AYN1 1JUHA 2YMZA 1WCKA 1ULOA 2W2IA 4JGYC 3ZXKA 1BEV3 3PLQA 2R071 3NNMA 5CVRA 4CEWB 4OI2A 2WNUA 4AAPA 1JYNA 1W6MA 1PHMA 1YLLA 3Q8EA 4OCTA 5CKMA 3EXUA 3NW4A 4XTPA 1ZRCA 3J26N 3VKLA 4D7YA 3I2OA 2EAAA 3PIGA 4NIAA 4BLIA 3B3QE 5FP8A 4CP2A 5CBLA 2ZACA 3VBHB 1TMF2 2WT2A 4A45A 1ULGA 1FOD1 1MZ5A 2BEOA 3UL2A 3VD3A 3SQOA 3VKMA 2WS91 3W20A 3U07A 2OYZA 4ZKTB 3CJXA 1F2NA 1NUKA 2V4VA 2VC9A 5FZCA 2YDEA 2G9GA 2WZEA 1GZ9A 4NHMA 3LD8A 1TME1 4TYSA 3H1YA 3PVOA 5FZ4A 1SLBA 2HLEA 3O5SA 1GWMA 1SLLA 3A23A 1A6CA 3VKNA 3BKZA 3HJRA 2DCTA 4JGYB 1PO11 3M3EA 1F35A 3FHIB 5EWSA 4P9JA 5F1RA 1AVBA 4HVRA 3C7FA 3HBZA 4RHV2 1PGL2 3LKJA 1CPMA 1IG0A 2YB7A 4C1WA 3VZLA 4FVVA 1RUOA 3B02A 3KSCA 3O1OA 3M3CA 4HXCA 4LO8A 1JHJA 3RFRA 2WNUB 3WHTA 1W6MB 2QZ2A 3FFZA 1IKQA 4P08A 1DQ5A 1KFXL 3TBDA 2RG4A 3OGVA 5L7OC 3AP4A 3WW4A 2O1QA 2GSYA 1RITA 4XURA 3FC0A 4W6XA 4GWNA 3GHNA 2BVBA 3KV6A 2HWC3 1V9U1 2XQXA 3SEPA 3E97A 2G1MA 5C70A 2HWD1 3ZMNA 5CISA 4D6SA 2BERA 4HKOA 1A8DA 4XUTA 4CSWA 1K42A 4QPIC 4HETA 3SCHA 1DGWX 3AP5A 4BMEA 3QD6A 2AEYA 4XJWA 4FOYA 3RPQA 4ES9A 1VB4A 1EYBA 1VRH1 5C4WA 5FZ3A 1UOGA 1HQLA 3C7GA 3LFIA 5I8YA 1OOPA 3OGGA 3AFKA 4DOUA 3KHCA 1SQ4A 2W0XA 1ZZCA 1QJU3 2PFWA 1CJDA 2ZS6B 3MIFA 4NROA 3VB9A 4MHRA 2Y26A 4CP1A 4XACA 4XOGA 2JECA 4KU8A 4LUKA 4A7KA 1JYXA 4QMAA 1G9CA 5C4WC 4FFHA 4YG0A 1LODA 1OOPC 3TYJA 2DVGA 2IUWA 3ST7A 2VTFA 2VZRA 2DDUA 5FP9A 3POEA 2JKXA 4Y5SA 4EN7B 4Q4Y2 3JD73 1US2A 1K12A 2OW4A 4Y22A 2QQPA 2HEYF 5AC92 3T1MA 1YQCA 3NJXA 5A3PA 1YFUA 2UY8A 4WVZA 5GLWA 4E9KA 4N9IA 2R1BA 2OT7A 4D7TA 4QPIB 4Z07A 3DCQA 4QKDA 1ASJ3 3ACFA 5CYYA 2E26A 5JXIA 1W3VA 2Y6HA 2ZGOA 2CSGA 4AHWA 2E33A 1UOJA 2XR4A 3KF5A 5JMOA 4PBPA 5C6CA 4KWJA 5DUWA 3WR0A 3VD7A 2QQLA 1VBE2 3LA3A 2W39A 5C4WB 2ET7A 2VJXA 3WLUA 2WO7A 3UYJA 1OOPB 5FP7A 1MS0A 1GOFA 4Y1UA 4JQRA 3K3NA 3ZFGC 1SMVA 1GLHA 2PAEA 4LBOA 3RSJA 1CAUA 1DHKB 2ZCWA 3PTYA 1NG0A 4CA9A 4URAA 4AVVA 1BK1A 1SLAA 1N47A 4FFFA 3MBWA 4V2WA 3OEBA 5DUUA 3SITA 3U10A 4AW7A 4B3NA 5JZGC 3A7QA 4CDXA 4XF3A 1D4VB 5LEJA 3I49A 3POYA 2P34A 5JXJA 2CNAA 5T5OA 5LRSA 4Y22B 3SH3A 1H8VA 4R8HA 2YBSA 4COUA 1Q8VA 2FMYA 2WLPA 4ZU4A 4YZ5A 4XVHA 1WD3A 4B29A 3DKWA 1DGRA 4CDXC 1BEV1 3INAA 3FBMA 3ILRA 4XDOA 2AC1A 4GULA 1CZTA 3ZLIA 1LKNA 1WMFA 3W5MA 4CPBA 5JWPA 3ACLA 1JHNA 1U5IA 1H2MA 4Y5TA 1QIQA 5J3UA 3EHKA 3M7AA 4M0HA 4DIQA 5C3RA 1RUI3 3QH6A 1S2KA 4WVWA 2RDNA 1XSQA 4XDPA 3UKTA 1CN1A 1M06G 4QDRA 5FLHA 3MI8A 5JZGB 2VOKA 2BV4A 1B09A 4R9BA 1PZ9A 4OVEA 4FFIA 2E9QA 4ZY9A 3JZVA 3I3EA 4BOWA 1NXMA 3OD4A 3O1TA 1CAUB 5HCAA 4Q26A 1LULA 1D0HA 2BNMA 1O3TA 4NPMA 3UKNA 1OA2A 1S0FA 1W9TA 3I8TA 4QD2A 2A3XA 3ZXDA 2Y38A 5JOZA 5F5CA 1SZBA 4CDXB 2VMEA 4B1MA 2IXKA 1WW6A 3ZYBA 5JCTA 2XGXA 3TEZA 5IK8A 3ZXGA 2ZX1A 3GXUA 3WCRA 3ZR5A 5FZ6A 4L9BA 1DF0A 2W1SA 3ZSKA 1MACA 2OUHA 2RS11 4BQ5A 2ZX4A 3NV3A 4WBBA 2OUJA 3ATGA 4MADA 4AGGA 3ZVXA 1NXD1 2DV9A 3ETPA 3ACIA 1LOAA 3LOBA 4ASKA 1N3QA 2BWCA 2W92A 3ILNA 1FMD2 3TEYA 2WYSA 1PM4A 4JC1A 1D4M1 2VMHA 5DUXA 4QDSA 3WUCA 4AVCA 1VJ2A 1O6UA 4AWDA 1RUG3 3NKGA 1OUXA 2YROA 4HK8A 2FCUA 1YYNA 1WLCA 3JBG1 2WN2A 3WP4A 3WT3A 4XZUG 2XLFA 1DU3D 5I0RA 1A78A 1LHVA 2W94A 1GNZA 2OA2A 3MYXA 4LBNA 2DFCA 4HONA 2ZA9A 2JDHA 2BQPA 3VBRA 2QQOA 1DQ6A 2J1SA 2LTNA 3I3QA 4AK3A 3I2FA 1STMA 5T52A 5E8AA 5T5PA 2YGMA 4URTA 3WEZA 1DG6A 3LZZA 3I2IA 4IW3A 1BKZA 4RGKA 4J25A 1ZRFA 1RUC3 1H2NA 4AL9A 1URXA 2EXHA 3N7JA 1PO21 3VBRC 2DCZA 4ITCA 1RUJ3 3AMMA 3QLQA 4CDQA 4N53A 2QQWA 3WQ0A 3IDEA 3H3ZA 5BUVA 2BDRA 3KQRA 1AZDA 3RRDA 2PHWA 1PZ8A 4RGGA 1VALA 4OQ9A 4OHVA 5FXWA 1FXZA 2B42B 2VQAA 3MHZA 4BU2A 4YVSA 3E6CC 1CJPA 4YGCA 4CDQC 4N53C 2O0OA 2RMU2 4FP2A 2IVJA 4H7MA 3CDZB 1AR81 2BZDA 3K2OA 2EALA 4U36A 1JZ5A 4YVSC 5FYZA 3SH4A 3ZYJB 2QQUA 3AVSA 2IFRA 4CCOA 5FZFA 2JDAA 3LOIA 4YPJA 1RUH3 1UPSA 3BU0A 3SXWA 4RA0A 3KGLA 2LW8A 5FQ0B 2OZ6A 1BCXA 4ASLA 3KVAA 4QX5A 3VBRB 5JIUA 3LGRA 2RS53 4IV1A 4QX2A 4XCBA 3RYKA 1OQ1A 2GALA 5FK7A 5KXCA 1YFYA 2J1EA 3J7HA 3AZXA 4M01A 3PDQA 1QJEA 2NYYA 4YARA 3C3VA 1EUUA 5JIAA 2PLV1 2VUDA 3GDBA 1EUTA 3UK9A 5M0TA 3BGAA 4C8DA 4CDQB 4N53B 5A3MA 3K4AA 4GB33 5JI9A 3N7MA 4GA9A 3MUY1 2ZGMA 2NPIA 2WFF3 5FYIA 3QH7A 5IATA 1LJ7A 5CEHA 4XZPA 4OI0A 4PCRA 1XE8A 3HT2A 4XHXA 5F5AA 3CMGA 1UIJA 4YVSB 3R6SA 1AX0A 4HKWA 3EJKA 2WFPA 5J37A 4O7XA 2A6XA 1V00A 2BBVA 3SKJE 5EIYB 2QBXA 3R4SA 4HKLA 4LITA 4N9HA 1VPHA 5BNOC 5KXDA 3EBRA 2XXZA 3H8UA 3NNLA 2WZ8A 3FN9A 3AKTA 2RJ2A 4XJUA 1VIWB 4XBQA 2Z79A 4NRQA 2ZMLA 1E5IA 1MQTA 3ILFA 4UFKA 3TNQA 3ZR6A 1KRIA 3RDIA 2CDOA 1ZBE3 3WG1A 4Y1XA 3FZ3A 1OA3A 5SV5A 1LOGA 3OPZA 4COWA 2ZGSA 3IAQA 3DKQA 4OI1A 4QPYA 3WQBA 3ABZA 4IV1B 3OPWA 3TEXA 1ND3A 1S0DA 4UFHA 2Q1ZB 1MQTC 2RM21 1GNHA 4MLOA 4M4RA 2C9AA 1C8M3 4YYOA 4ONUA 3BPZA 1UYPA 1XJAA 1OBNA 4M3CF 1RUE1 2AYHA 2VCBA 3T4HB 2ZX2A 4BZ4A 1ND3C 3NAPA 2ZXQA 2WC2A 1V6KA 4YG6A 3VL9A 1TE1B 3O0VA 4BYYA 3APBA 3DYOA 3MF6A 4N8MA 5BNOB 2YYOA 1AR93 1K5MA 4Q4W2 4XF0A 2FDIA 4BE3A 4QQ2A 3NAPC 4H14A 4BA6A 2F4LA 3WDUA 1C8NA 3AC0A 5JXGA 1GNYA 2WAOA 2MEV1 5HCFA 4K3UA 1MS9A 1QHDA 3OD0A 5A3OA 5T54A 2X5IA 3ZIXA 1UMZA 2K2SA 2VVEA 1OFNA 5FP4A 4ZXKA 3RI9A 3URFA 4XF4A 1MQTB 5EJ3A 1HRI2 3AFGA 3O12A 2BYVE 2YC2A 1L7QA 3ACHA 1SFYA 1KS5A 4RR3A 5FZ7A 1UYXA 3RWKX 3BTYA 2XBO1 5E16A 2CYFA 2V5YA 2X5IC 1COV3 1R081 4XFIA 4AGRA 3UGGA 1ND3B 1AR73 1X7NA 1PK6A 1QJX2 5CU1A 5DDJ3 1UYYA 3U1XA 3VGIA 1ONAA 2X10A 4QXBA 2R072 1WLWA 1JOPA 1UD1A 5KC6A 2WQZC 5FYHA 1W9SA 1WCSA 2ZJCA 5IUQA 3VHOA 3NAPB 5ACA3 1PK6C 3MPPG 3P3NA 2R6QA 5FPBA 5GZCA 4AI1A 1OURA 3U78A 3ZYRA 4Q1RA 2F4PA 2PELA 3EQEA 1AF9A 2BFUL 2D98A 1YIPA 2W1WA 5FMBA 5FZOB 1WCQA 2W5FA 4UFLA 1H2KA 3IZOA 5FAXA 5DG1A 3N36A 1FOD2 4XJZA 1RUJ1 4COVA 2A5ZA 3NKTA 4IEOA 2GH8A 1PVXA 4Q4W3 2VPVA 1IZ3A 3KV9A 1ZA4A 3FFQA 1WBFA 3T09A 3VDDA 4MHUA 2H0BA 2FZ1A 1A34A 4X6QB 5LZ6A 2X5IB 1DGWA 3N9QA 2D6MA 2XJRA 3CIHA 1Y7BA 5G05L 2CL2A 2HWF3 3KCCA 5ABJA 4LBMA 1FPN3 2CV6A 4DEQA 4RGAA 2ADEA 4XAEA 3NVCA 1PO12 4FXKB 2XJUA 1K3IA 1CAWA 1C5HA 1DZQA 3M4FA 4MYEA 3VDDC 4RN5A 5JOXA 2ZGLA 4K1YA 4QXKA 4DUXA 1OLQA 5EQUA 3MFCA 1PK6B 2VZ3A 2JB8A 3CZJA 4Y24A 5LB6A 3WNPA 5ABJC 1AYN3 3IDCB 4JTOA 4IEUA 2D6OX 2VAUA 4Z2AA 1J84A 1BVVA 4K8RB 4AOCA 2EVXA 4AFBA 4D8MA 1X9PA 1HRV1 2WKKA 4E2QA 4E2GA 4GIQA 4IV3A 1VP6A 1ALYA 1DZTA 1KXGA 2XJSA 3H3LA 4EWDA 4W6WA 2IXJA 1C3HA 2A6YA 3GBFA 3RMXA 1LR5A 2ADDA 1BVP1 4LULA 4PF5A 4ET7A 5DAPA 4D7SA 1BK0A 4IV3C 1V6LA 4EWAA 1FI2A 3HAGA 2WS93 3POIA 3S0MA 4I01A 4Q4V2 3WF3A 3VDDB 3D3AA 1ZZBA 1OLMA 1JTZX 1W9FA 2OX0A 2Q0AA 3NL1A 2P4EA 1XYNA 1SBFA 2PHXA 4I3PA 2ZZQA 4QX1A 3LQCA 3S6PA 4FP3A 1OSGA 2VZSA 4AXOA 1TME3 2B8MA 5ABJB 2GDFA 5H9RA 4EN9B 3U0ZA 2XL9A 4RFRB 1QJY2 1SPPA 2KM2A 4Z1VA 1OF4A 2YV8A 1CAWB 4AI8A 5AVAA 2VVDA 2XVLA 4LT5A 1OF3A 5FV3A 2GC0A 5ANQA 3WDTA 5FXXA 3O1SA 2HYXA 1J1TA 4YM0A 4MGIE 4LHSA 4P5YA 2NN8A 5FPAA 3SHRA 1JYVA 1ZBE1 3WDXA 2P3YA 1XNDA 4JV4A 3GF6A 1JOJA 1QJFA 4QX3A 3POSA 1W05A 4B7EA 2WA4A 4ARYA 4XJ8A 2ERFA 4D6QA 1QU0A 2HWB2 3I2DA 5FO9B 2ZAAA 2AUYA 3WD5A 3LIGA 1GOGA 4HN0A 1XB9A 1B35A 2E53A 5KR7A 4IV3B 4IESA 4MH0E 4FTSA 3N7LA 5GLTA 4CXYA 2E31A 3P5BA 4QPGC 4UT5A 4DXRA 1C8M1 2ARXA 1Q8PA 3VBSA 5LBCA 4DXSA 1GQHA 4BWOA 2D7FA 1O91A 4LKEA 2GMPA 1B35C 4A2UA 1V9U3 2RHPA 2YC0A 4H3WA 3T3YA 5C3QA 4PQ9A 4E4HA 2HWD3 4UW4A 2QKDA 5FYTA 1GWKA 2X05A 2WYFA 1RHI1 1RMU2 4UFIA 2QVSB 3I2GA 2QQJA 2VUCA 1W6OB 5F9TA 3AL5A 3LA2A 4FQZA 4C0HA 4EE2A 5CA6A 4FPOB 3OUIA 1VRH3 4OHWA 3ZFEA 5DZGA 3Q8BA 3AL6A 1SPPB 1XNBA 1JOBA 1F5FA 1JYIA 1DGLA 2D5HA 2E63A 5JSPA 1O5UA 2F17A 1QDCA 3U4XA 3ZFEC 4AHZA 4RSUA 4QGNA 4FO9A 1UKGA 4QPGB 1WA4A 4LUMA 4QU2A 5FLIA 4D0QA 5EHDA 3BOWA 3ZPYA 1HXS1 2UWBA 1W8TA 4QB2A 3IKWA 1B35B 1EV11 4B4PA 1JYCA 3K46A 1ULFA 5DDJ1 5FBZA 1L3JA 3JXSA 2VMFA 1QY4A 1BEV2 2A3YA 2QJVA 1YO8A 5CKQA 1YWKA 3E5QA 1DYPA 3HN3A 1W99A 4LTAA 4NOTA 5FKCA 1HW5A 2QCSB 3H7JA 4MOAA 4PLOA 3RYPA 3WNNA 5A32A 3IN9A 5DAQA 4AFCA 5FZ8A 4KMQA 1S2EA 2HBUA 1MS8A 1N1VA 1POV1 2VO5A 3I59A 3RZJA 5C9AA 1UU5A 5FYUA 3VDCA 4YW6A 2YFUA 4BLJA 4TN7A 1ZA7A 2FQPA 3ZFEB 4OLLA 3RI8A 4IETA 3ZSEA 3MW3A 3OB8A 2EIGA 5FLJA 2Y6FA 1WWYA 1QNYA 4M3CE 1L7RA 1MVEA 4M3CA 4AVSA 1PVC3 5C9AC 5GM0A 1UWWA 5KHHA 4XBNA 1REFA 5FYSA 2ZBJA 4MGQA 5GLZA 2XKOA 5FPXA 1FYUA 1QNWA 4MGZE 3S30A 1WA6X 2YBPA 3AMQA 1YQ5A 3S7IA 5JR2A 1G7YA 2OKXA 4GZ9A 3ZIWA 1ZNPA 5DAWA 4XQ4A 4CDUC 3PNAA 4MO3M 1H2LA 1TVGA 1CZVA 3VZKA 4AVAA 4FI9A 2W68A 3GZUC 1JBCA 3ORJA 3ZM8A 3KHBA 3WNKA 3RZZA 4DUWA 1R091 2CAUA 3T2OA 3BU7A 4CEYA 4QWNA 1X8EA 1GANA 3J8F3 5CIRA 2ARCA 1YNAA 1AXKA 3NMBA 3MGUA 2XJPA 2X8KA 2ZGRA 5D2AA 5A32B 2JDYA 2YG0A 3WCSA 4LJHA 1ODMA 1G9BA 4E4DX 5GALA 3I54A 4CEYC 2JIJA 1UCXA 3C7OA 3I59B 2EXJA 2WO3A 5C9AB 4IE6A 2HWC2 2DCJA 4CUCA 4A6OA 2Y6GA 1H4GA 4GWJA 4FOQA 4AZZA 2IWGB 2ETEA 5A1AA 4V1PA 4AFAA 2C6SA 1NCRA 2ZHKA 3H50A 1UY1A 4M3CB 4HBNA 3AZYA 3W9AA 3ZXAC 2VZ1A 3WG2A 4DFSA 5SV8A 4CDUB 3WNMA 1HV1A 3NQHA 1PIV3 3MICA 4JDMA 2XMLA 5KXEA 1POV0 4S2HA 1ZVFA 2FCVA 1G9FA 1QJU2 3WQ1A 1NCRC 1W2NA 5IVCA 3TB0A 4CCEA 1PX3A 1I6XA 1MS3A 1NCQA 2Y64A 1CR7A 3ZDVA 2VQUA 5K7PA 1BXHA 3B01A 4IGPA 1QKQA 4E4ZA 1JH5A 1UX6A 4H55A 4JGZA 2RS13 4XTMA 1JU3A 1W6PA 4PIXA 2RS33 3MW4A 2WT0A 2VNGA 3GJBA 3ZSJA 4B1LA 5L7OA 4EQVA 4CEYB 3JD72 4L11A 4KQ7A 4LMFA 1NCQC 3C7HA 3O1RA 3CKHA 4COYA 3GCXA 2UU8A 4YM1A 3IT8A 2AEZA 2DTWA 3RQ0A 4BMBA 2VW2A 3LEKA 3RJRA 4JGZC 1RJ8A 5HV0A 1RGSA 2R16A 4BQ1A 4OYUA 4LKSA 1D4M3 3FL7A 3V0AA 2WLQA 1N3PA 5EV7A 3O1VA 1BMV1 2VNRA 1ASJ2 1QDOA 4QPIA 1AR82 2JDKA 5FYBA 1V6NA 3JBG3 4TLGA 2B4KA 5F2SA 4UYBA 5FDBA 3SCGA 3JU9A 3MV11 3PU8A 4HK9A 3T0BA 3AZWA 3PUHA 4I3GA 2PTMA 3OSDA 1NAEA 3MF9A 1NCRB 1AL21 1LEMA 1W90A 2CWSA 2ZMKA 1KFUL 4Y26A 5C3OA 4LBLA 3M3QA 4AEKA 2PHFA 4FFGA 2G9FA 3ZN5A 4AQSA 3K3OA 3VHRA 4YZ3A 2CGNA 3HBKA 3SLIA 1UU6A 1AJKA 2WN3A 4QDQA 5KXBA 1MEC1 2EXKA 5CB7A 1REDA 2VZVA 4YZ2A 1NCQB 2ZHNA 4Q4X1 3WSOA 1V6IA 2IXLA 3NRUA 4HLTA 4LE4A 5LBEA 5F37A 1PO23 1SFPA 4JGZB 3KVBA 3ZN4A 1GKBA 1VBC1 1W6PB 2VOWA 3JB4C 1OH3A 5TSWA 1S2BA 5L7OB 1QQP1 1MPXA 2EICA 2HWE1 2LROA 1XNKA 1XBFA 2HBTA 4KWKA 5H9QA 5L9RA 5T5LA 3CL1A 2WDBA 4PLNA 4AYUA 4MGKE 1N1SA 3WDWA 2FDKA 4HVOA 1YC61 4IGQA 3ES1A 3JCIA 5LK7B 4ZS2A 3V0AB 4AFMA 3TOJA 5E6HA 2FDFA 3NJZA 2W1UA 4ARXA 2W46A 3WF4A 4CCJA 1AR83 1AYM1 2D40A 2PHRA 3IDAA 3IIAA 4N43A 1PMHX 4NAOA 3VKOA 3BI3A 2BJSA 3FWEA 4W50A 2WWJA 1N1TA 2ZGQA 3AJYA 5J7MA 2WWUA 5FWEA 1RUI2 3OF1A 3ZFGA 4UW5A 3PVEA 4J1XA 4UW6A 3PUSA 3B93A 3DV8A 5LASA 1OMIA 5H9PA 3MIDA 3V56A 4N43C 4XCAA 4GJYA 4O61A 5IT6A 4Q0SA 4HSJA 2WZR1 5JZGA 2BRTA 4BXFA 5DN2A 4TZDA 2PMWB 1NOVA 1PVC1 2ZX3A 3A22A 4TSVA 3UV9A 1RL3A 2WUHA 5FXVA 5FY0A 3VZNA 1VB2A 1AR63 2NZ9A 3K4DA 2PLV3 4OZXA 3RMYA 2VZOA 5IVEA 4A7ZA 5KHJA 3ALQA 1DZRA 1H6YA 1XSRA 2I07B 2OQ7A 1XU2A 5BY5A 1D2SA 4JVAA 5LEKA 4XQDA 1UPIA 3L2YA 4ATEA 3LDBA 1NE4A 1PGW1 1HB2A 4IEZA 5EZWA 5FZBA 4AQTA 1AXYA 1HN1A 5FJHA 3PJYA 2GMMA 4JHTA 1NQJA 2W47A 2Y6JA 3OGJA 1JN2P 3OBTA 2B7YA 3GNEA 3ZX7A 3A21A 4AGVA 5FYCA 2J1UA 2PHLA 3BVCA 3WVJA 5HI0A 2MEV2 2VUAA 3H8OA 4GMP1 3VUOA 3J8F1 2FDHA 2JEMA 1VBD1 1NT0A 3O0WA 3RZHA 3DGTA 3PU3A 1UY3A 4D94A 3DYMA 1VAMA 2JXAA 3OTFA 4N43B 3AMHA 1Z78A 3NJYA 1W8FA 3E5UA 3PUAA 1GFF2 1AXZA 2VMCA 5C3PA 5FY7A 2EIDA 2UWAA 1RUG2 3ZFGB 1RYYA 2VQ0A 3WNXA 3H42B 2IXHA 2E7TA 1RUD1 5T3NA 3WV6A 1PM7A 1LOEA 4PIYA 1GWLA 3KT7A 3WHUA 2CTVA 2XG3A 5EYYA 2MHFA 3OGRA 2VTXJ 1QGLA 3LA7A 2RM23 5T50A 4LBQA 4JKMA 1JZ2A 1C5IA 1OVSA 1PIV1 1QOOA 2JDZA 4OHZA 4XUPA 4ORFA 4FTEA 1RUE3 1UZWA 1X9TA 2VD7A 2R041 2BWAA 1QOTA 4M4PA 4E2SA 5IHRA 1RUF1 1X50A 2GC2A 2J1VA 1OQEA 3HD8B 1RUC2 4NPRA 4DINB 4IE4A 4NVPA 2ZZJA 1KDKA 5FZHA 5LBBA 4XPVA 1RUJ2 3GZEA 4BISA 3ZFFA 3THTA 3H1MA 3USUA 2P6CA 1W9YA 2RS31 2YHJA 4LKFA 3ASIA 1X36A 3HNYM 4Z8BA 1F5JA 2ATFA 1TQ5A 2H6BA 2MEV3 1ULPA 1ZM1A 3D82A 5A3WA 5J98B 2RJLA 3RNSA 1W0NA 5JPNB 3NV2A 2PA7A 3ZFFC 4IEYA 1O3RA 1DCSA 2EAKA 1QOSA 3O14A 1ENQA 4QKBA 4LOSA 1SEFA 5FZ1A 4CU8A 3IB3A 4LKDA 2B46X 1OD3A 2W08A 2BTVC 3IPVA 2XBO3 2VNVA 4LIUA 5ANNA 1R083 4IEPA 4JDNA 3PJQA 3AKQA 2ES3A 2P3IA 1W2UA 4GMP0 3ENRA 1CGPA 1CQ9A 1RUH2 2W95A 1UX7A 4LBQB 1UL9A 4LA2A 4WVMA 4UBHA 4LBJA 4I02A 1HRV2 2AR6A 2ZPXA 3GCWA 3T4VA 2RS52 4LHNA 4EZ4A 5FQ0A 3VBUA 3TEWA 5A7OA 1G86A 4P02B 4TWTA 5F8PA 1VBA3 4BQXA 4L2NA 2VOXA 1CZSA 5FUIA 3O1MA 4LK6A 1GR3A 1BBT1 2D97A 1UMIA 1O4ZA 1TMF1 4XMAA 3KWVA 4AEJA 2VW1A 3VBUC 4QQOA 3ZFFB 4GB32 5FOBB 3MIGA 2JDNA 1A8MA 4QX7A 3USUB 4YW1A 4YVWC 2WFF2 1JZ8A 4COZA 4C91A 3KCXA 2VVFA 5KHKA 1IHMA 2VCCA 1LAJA 5FY9A 4GXLA 2ZEYA 3AP6A 1YCIA 5A3UA 5CG9A 1WZXA 1VE0A 1X8MA 4NJ4A 1WMEA 3FLRA 4CDWA 3NNFA 3BIWE 1IS3A 1RC6A 2ZKLA 4IE7A 4R52A 5D8AA 1LGNA 3S57A 1UXXX 3AX4A 1OKQA 1S0JA 3ECQA 1ND2A 1YJKA 1LU1A 3Q8AA 3WQ7A 1KITA 3PUIA 3IPVB 1QJZA 2VOVA 3GZAA 1UNBA 2BGCA 2ZHMA 3FLTA 1XOYA 1ZZ7A 2V09A 4RHV1 1PGL1 2BGOA 2OS2A 4Q5OA 4QGLA 3AMPA 4OI4A 1EY2A 1W6QA 2DCYA 1ZBE2 5D8AC 4NIDA 4Y33A 4Q29A 2P17A 1PGSA 2P3KA 1WGPA 4NMIA 3PVBB 2WZPP 4NHLA 2NP0A 2WSUA 4WVMB 1ND2C 2X53S 2G4IA 3T0AA 2JKBA 1RIRA 1HRV3 3VBUB 3BPSA 1E5HA 1YQ6A 3PMSA 2P37A 4CTEA 2R063 1MS4A 2R49A 1YFWA 4HFSA 1OD5A 1YXWA 4YVWB 3WP5A 2X29A 2ILMA 3PMEA 1C8M2 2DUOA 1ST8A 3K77A 4QB6A 1DQ0A 2HKXA 2D5FA 4F7ZA 1AR61 2C4XA 2VXJA 1HDKA 1R1A1 3D6EA 1E5SA 2C24A 2XVGA 1C57A 4FCAA 1E57A 2O8OA 2UYAA 5IWFA 3LEIA 3PURA 1AL0G 4XQWA 4DRVA 3AYEA 1HV0A 4B4QA 1HIXA 5BNOA 1MS5A 1AR92 2D6KA 2BOIA 2VH9A 3TWIA 4CU7A 4YFZA 1UZVA 4CDWB 5D8AB 3RJ2X 3VL8A 1OH4A 1RXFA 3HPNA 4C90A 4NIHA 5LRRA 4U2AA 3M2MA 2JX9A 1CX1A 1ND2B 3QOPA 3UGFA 4NPLA 3VHNA 1ULEA 5LY1A 3P6BA 2XHNA 1OPOA 1WW5A 4PT6A 3U14A 1J83A 1W6QB 4CP0A 1VRBA 4Q1PA 5GZDA 4CCDA 1LB2A 3I2JA 4M00A 4QX0A 4TXWA 3NNGA 1F8VA 1COV2 4Q4Y1 4W6YA 4QPWA 1AR72 1EV12 3O0XA 4Z92B 5AC91 1I3HA 2BPA2 4IUGA 1XXNA 2VUJA 2VW0A 5DDJ2 2WQ8A 2GC3A 2Y6LA 4XW3A 4XBLA 3X29B 3AYDA 4IE5A 4MZUA 3V64A 3ZKUA 1QMJA 3H3UA 5A6ZA 3DXTA 5ACA2 1O4YA 4WM7A 3CLPA 3PVNA 4Y1VA 3B94A 4P9LA 2DCKA 3OOXA 3ZSMA 3KT1A 1IS5A 4AQ2A 4SBVA 4DRRA 3DXUA 2OZJA 1RHI3 1F4HA 2PAMA 1UY2A 4FQ4A 5FZOA 2P2KA 5HXVA 1CAXA 4Q8KA 5DMYA 2GU9A 5F7UA 1VBE1 1T6BX 4WM7C 4AE2A 5FPZA 5FWJA 3ZYIB 2SLIA 3CU7A 3HEIA 4XABA 4N7UA 4ZZ8A 4QM8A 4QQHA 3GBGA 4I2OA 2LS6A 4Q0VA 5GLUA 1Y9MA 4FAHA 4PI2A 1YFXA 3WINE 2VG9A 3W5NA 1JI6A 2E51A 1OKOA 2HWF2 2LUWA 1J1LA 1DBNA 1FPN2 1Z7S3 2AACA 2DVAA 2TUNA 3AP7A 1G6NA 3GYDA 4X8PA 5FKBA 2AREA 3WOGA 5IVYA 3MIHA 4XETA 3W59A 1LESA 3AZZA 2MNGA 1UMHA 2JB4A 2Y6KA 3NNJA 4XHBA 1W04A 2LRPA 1FATA 1HXS3 2J1TA 2XKPA
chains in the Genus database with same CATH topology
4YNIA 1LOBA 1EV13 1H9WA 4WZCA 1AYN2 1UN1A 1R092 5IK4A 1WLTA 1RINA 2CWMA 3K48A 4Q2FA 1SBDA 4WM7B 1KJLA 4HSLA 1VBA1 1S0EA 3IMNA 4NWVA 1POV3 1REEA 5KHGA 1CAXB 2Q4SA 2XUMA 1QXRA 3C2UA 1U12A 3R0RA 1GYKA 4N7IA 4IEVA 2WS92 5EFUA 3AYCA 2OIIA 1WLDA 3RYRA 4F83A 2K0GA 5D1IA 4D3WA 3LCPA 3SMHA 2Z2SB 1TME2 1R1ZA 4LHLA 4K9SA 2HEWF 2Y0OA 2ZGUA 3GALA 4K40A 2N7GA 2A6WA 1IS6A 1C28A 2W52A 3FE5A 2WA3A 3MW2A 1YRZA 4F3JA 4I0AA 3VZMA 4WVVA 3H9AA 4PBOA 1R093 2DU1A 4GKXA 4CZSA 1KJRA 1ZBA3 2GNMA 3AJZA 5GKAC 2ZAHA 2R061 1FMD1 4S2GA 4LO6B 3WG3A 5IK5A 1CAVB 5E89A 2R0FA 5JVVA 2GC1A 3POWA 1FV2A 4D69A 1LHNA 1J3QA 3SISA 1V9U2 5L19A 1GV9A 5L73A 2HWD2 3OJBA 4J6GA 4M0NA 2VGDA 2SBAA 5KBFA 2F6BA 3R05A 3MLLA 4L92A 4PLMA 4MSVA 1VRH2 1W6OA 2ZX0A 3CO2A 4NHKA 3E5XA 3M3OA 1OLRA 3WW1A 3ZYPA 1VBB3 4KG8A 2D43A 2Z5WA 3CJIA 4EN0A 2H6CA 2GNTA 3I7DA 1S0GA 1VBC2 4DY5A 1NY71 4QPGA 3AKRA 1NA1A 2HWE2 4O9GA 4R4XA 4FTBA 3CJIC 1UZYA 1KQRA 3B5LB 3WX5A 4IL7A 1N3OA 2XL7A 2RMU1 1SBEA 2UY9A 1NA1C 5JMCA 3M3IA 1TNRA 1LCLA 2XJQA 4JAAA 4P9IA 4YFWA 2O8QA 1RJ7A 5JPMB 3THPA 4FPJA 2QDRA 1UKRA 1AL23 4YM2A 1MZEA 4XFAA 1LHUA 2VXRA 4B7KA 5FMOL 4DS0A 1ZYBA 2FHRA 2D3RA 5H9SA 3VKFC 1MEC3 1S1AA 1DQ2A 1GBGA 1PVC2 2DVFA 4KNCA 5GZGA 3CJIB 1O5LA 4Q4X3 1Z7S1 3KB5A 3B9CA 3TN93 1I5ZA 1XE7A 2WJSA 1HKDA 1VBC3 4JRLA 5LK5A 1IOAA 4TLFA 1NA1B 1QQP3 3SH5A 1ZZ9A 2HWE3 2WNEA 4Q27A 3QBQA 2AGSA 3OBRA 3ES4A 4FPEA 1WCDJ 3LSDA 1Q43A 4E27A 1O3QA 1JXNA 1IQAA 4XEZA 4LLOA 3HN1A 4YSFA 4RFT0 3J8F2 4BIFA 1VBD2 1ZRCA 1RVF3 5I8SA 4L97A 3JQWA 1H0BA 1A3KA 3TAYA 1AYM3 3WY6A 5FO7B 2D6LX 1Q8SA 1CONA 2GN7A 3WG4A 5I0UA 1G9DA 4FXGB 4A3XA 4KGQA 4K7JA 2AENA 3E6BA 1D2QA 1AHSA 1QH6A 4OFGA 1XNCA 5DUVA 1NE6A 1I9RA 2PN5A 3HIFA 3IBMA 2QDNA 2WZR3 2H0VA 4ISRA 2B9UA 2A3WA 1PIV2 4CDUA 4HVQA 1ENSA 2UURA 1QH7A 3WXPA 4LA3A 2Q5TA 1I1EA 5T55A 2B5HA 2V73A 3KD4A 2K9ZA 1RTVA 2NQYA 1J3RA 2RJKA 5JLVA 4EJRA 4FPKA 2RS12 3LB9A 4OHYA 2RS32 4B8EA 3G7DA 5FRAA 4JDOA 3CNAA 1SLCA 3N4MA 3UJQA 1ZBA1 4GMP3 3FUQA 1VBD3 5E1RA 3WZ1A 2E6VA 4FPFA 3RS6A 1CVNA 2DVBA 2WT1A 4FAGA 1HRI1 3MEPA 3N3HA 1D4M2 3WP3A 2DU0A 4XFCA 4HN1A 4YRDA 4A7YA 1LTEA 3JBG2 5FTTC 2WQ4A 3HR9A 1RUD3 4UXAA 2HYKA 1QJX1 1S0CA 3AZVA 1ENRA 2B45X 1OI6A 5FCCA 2LALA 5BNQA 4FPLA 4W65A 4Y1YA 2VNOA 4K8FA 3VZJA 4YW5A 3ZXFA 1BYHA 2R043 1CD3G 1SACA 1RUF3 1BBT2 1VBB1 4IEQA 2XWJB 4P9WA 1PO22 2BNNA 2WNUC 3DUIA 5BNNA 1S55A 4XXAA 2WIIB 3LAGA 4XFHA 4B4RA 2BFUS 1Y3TA 5L36A 3J4UH 1H1IA 1O4TA 5BNNC 3QACA 5FOJB 1J59A 1EAH3 1XYOA 1YIFA 4LR4A 1IKPA 2RR13 3ZXEA 3K51A 3MFAA 4QT6A 2VY0A 5BNPA 3NV1A 4RQPA 1V6OA 3HMYA 2ZHLA 4P14A 2GNBA 4WM8A 3NWKA 3W58A 4XFGA 1HX6A 4K6BA 3BALA 1DQ4A 5I93A 5BNPC 4RQPC 5A3LA 2WSVA 5K0UA 1UU4A 4S2DA 1EP0A 1EPWA 4WM8C 4KWLA 4X8NA 3A4UA 2FBEA 4BCUA 2DUPA 2QE3A 1FAYA 1AR62 1BBT3 2PLV2 4G9SB 1R1A2 3I4IA 1TMF3 4S2FA 3TN91 5BNNB 1LOFA 3FLPA 4X6RB 5K0UC 4YZ4A 4Q4V1 1FNZA 4MGYE 5F6KA 3ELNA 1ZRDA 3D5OA 3FUOA 1M4WA 1OPMA 4H7LA 1TEIA 4CRQA 1LOFC 2TEPA 3JQXA 1YI9A 1NZCA 4META 1QJY1 1VLNA 4EWEA 4G4FA 1RVF1 1H8TA 2XWBB 5BNPB 2YPJA 2JJ6A 2JG9A 2QFEA 4RQPB 5GZEA 2LM3A 4RHV3 5J96B 3LWCA 3V65A 1OHFA 1W0PA 3AXEA 3CF6E 2ZGTA 4WM8B 1S0BA 4XJ9A 1H9PA 4XE9A 2IFWA 2HWB1 1H8TC 4YW4A 3RWNA 4ZU7A 3DF0A 2JG9C 3AM2A 1DIWA 4EV0A 4HMZA 4BH9A 5K0UB 3KGZA 2DUQA 2RM22 3MIEA 4NR1A 3MDPA 3MLJA 1RUE2 1R1A3 3EO6A 4XIOA 1GQGA 5I8TA 3U11A 4C1XA 4QGMA 1H4HA 4XJAA 1SLTA 1O7FA 2KA3A 1RMU1 5BYNA 5I0SA 1CESA 3FMGA 2WL1A 3GHMA 4XIKA 4LBKA 2WINB 4ATFA 1HLCA 1H8TB 5FMOS 1N1YA 1F31A 1APNA 4R9CA 1G9AA 4JRAA 2JG9B 2KXLA 4FPYA 2D6PA 2ZGPA 3L9JT 2DURA 4LEJA 3DL3A 4FOVA 3ZO0B 1ZRRA 2XBO2 4ASMB 3NSTA 1R082 4Q4Y3 4YZ1A 4XF9A 2XHKA 5C8CA 3DN7A 2JE7A 1IPKA 5AC93 2WWSA 2NMOA 2CY6A 1LECA 2C1FA 4HT1T 1LENA 4MV2A 4I0WB 4EN8B 1EPZA 4IEWA 1ZZ6A 1HQWA 1IGOA 2HJIA 3MLKA 4P9YA 2BNOA 4NWWA 1BQPA 1VBA2 4BPZA 5C8CC 3AK0A 1NLSA 3LSEA 2MPFA 3NV4A 2DTYA 2IC1A 1PMIA 4PIZA 5EYXA 3Q9OA 1VBE3 1GICA 2JICA 5AVPA 1C1LA 3VBOA 5J48A 2Y0IA 2OVUA 1FNYA 1NLRA 4YW3A 5K9YA 5I0TA 2ZGKA 4HANA 2JENA 2GH2A 1UF2C 4AI2A 1EAH1 4LLFA 3VBOC 1ZREA 2RR11 2JG8A 2D3SA 4YG3A 4AG4A 4I30A 2DF7A 5FO8B 2NLRA 3AP9A 5C8CB 1RB8G 2FMDA 4J1WA 5CFCA 5J09A 1WBLA 4GQ7A 5KHIA 2JG8C 4XF1A 3GZTB 3R4DB 2R062 1CPNA 1DQ1A 4L99A 4QHBA 5CFCC 4OUSA 1QF3A 4YVWA 4FPGA 1V6MA 4WZFA 4EN6B 2XJVA 1S0IA 2D6NA 2GN3A 4LNVA 2CGOA 4G3YC 2HWC1 4Q0QA 4INDA 1XU1A 1XQNA 1LEDA 3VBOB 3D0SA 4AEMA 4AQ6A 4OUMA 3UJOA 3D8CA 2E7QA 2UYBA 1GZCA 2ZABA 3MZHA 4YM3A 2JD4A 3VLBB 1Z0HA 5F5QA 1QJU1 4UBGA 2JG8B 2NM1A 5F6LB 1DGRN 1DYKA 3ZN6A 4CYDA 2GNDA 1YUDA 1X33A 4Y5Z0 1T6GC 3T1LA 3L2HA 4BHPA 1Q56A 4K1ZA 5CFCB 1C1FA 1NY72 3ME2A 5C33A 2UWCA 1NYWA 3JD71 2C0ZA 4YW2A 4JTNA 5JDBA 1IS4A 1FMD3 3BCWA 5KWRA 3D0JA 1ASJ1 3RG0A 2GAUA 5AFEA 4F8AA 2A70A 4LE3A 4AHYA 3AB0A 2Q1MA 3B00A 1RHI2 4AI3A 5GZFA 1YJLA 4DMIA 2TBVA 3ZMOA 3VV1A 2YUEA 4GWMA 5BXXA 5T5JA 4DNYA 4SLIA 4XFBA 4I0BA 2HEVF 1KS4A 1YHFA 4Q0UA 3IM0A 1J3PA 3AXDA 3ZN6B 2CGPA 1GZWA 1LHOA 4OHXA 1U5XA 3A0NA 1Z7S2 4IV1C 1VAKA 2Q30A 1WUVA 3WP6A 1KD7A 2RE9A 1X82A 1HXS2 5DG2A 4QQLA 4Y1ZA 3T2TA 4DZGA 3JUUA 5FREA 2A75A 1QXPA 1WD4A 1PZ7A 3IWZA 2RMU3 4Y4YA 1LGBA 2B39A 3FX3A 1W6NA 3AMNA 1SLIA 3O7OA 1ULCA 5EXOA 3FBYA 1FT9A 3P3PA 1PNFA 1AX2A 2YY1A 3N7KA 4YGEA 1RUI1 2GMEA 3BTAA 4Y20A 3PHMA 4KGGA 2IZWA 4QM9A 5JR7B 2R0HA 4MUVA 2EA7A 4YLZA 4XMIA 1WW7A 3HQXA 4AEDA 2ZMNA 3B69A 2A71A 3BOPA 4XXPA 5BPXA 1GZWB 1FX5A 2PHTA 5IK7A 2PHUA 4LHKA 4E4SA 4EROA 4XYXA 3N35A 4BM8A 4AEDC 1CX4A 2DWRA 4LO7A 3SCFA 3WDYA 4FBFA 1UW8A 4ZU5A 2XLAA 5E88A 5A33A 3V0BA 3TNPB 3HWJA 1BJQA 2PQQA 2IXCA 3VBFA 2YZ4A 1ZBA2 1W6NB 3BB6A 2I74A 3CEWA 1Q8OA 4R4ZA 1K5MC 3KMHA 4K20A 2D44A 1DDLA 2WNVA 1CAVA 3WUDA 1RUG1 3VBFC 2ZOEB 4Y20B 2PYTA 2XB6C 4LO5B 3ZXLA 2BW8A 5I91A 4KL1A 5JOYA 4KU7A 2WNVC 3AKPA 1G8WA 3H7YA 4AEDB 4MXWA 2DFBA 2ZKNA 5J36A 4RR3C 1AJOA 3IDBB 3TRSB 4FOWA 1MZFA 4RS5A 1DFQA 4DB5A 2R32A 4R9AA 1H1AA 1PNGA 1ZZ8A 1Y43B 2EXIA 4P5HA 1BZWA 4FPHA 3OYWA 2EF6A 1VBB2 1RUNA 4DPNA 1RUC1 1O3SA 4RS5C 1SDWA 2E7AA 1K5MB 1LRHA 2Z69A 1QXJA 5HCBA 5A33B 3M8LA 3V0BB 4XFFA 3VBFB 4AVBA 5JSRA 3E6DA 4C0BA 1MS1A 2AH2A 2WNVB 3ZDSA 4O9EA 3VZOA 1TNFA 1HRI3 2XPJA 1ENXA 2QZ3A 4RR3B 4XDQA 2XVKA 2JE9A 1BMV2 1OQDA 3M70A 3ZSLA 4NO4A 2VU9A 2ARBA 5GLVA 4P9GA 4HPKA 3KLSA 1MVQA 1FV3A 2BVVA 4MXWB 1AL22 1RUH1 1QJX3 4GALA 5JAXA 5AFBA 4XILA 4RS5B 2VMGA 5JI7A 2R073 1V6JA 4L8QA 1WW4A 2ZGNA 2RS51 1U5YA 2ET1A 2XLGA 3GBWA 1Q3EA 4I09A 4Q0PA 2A6ZA 1MEC2 3NO8A 4NN0A 3OYWB 2DVDA 4RL7A 5DZFA 3WW3A 4GH4A 4Q4X2 5KC5A 1Y9QA 2TNFA 3M1HA 3TN92 3QCWA 3UKVA 1FOD3 4GB31 4JCKA 1H1MA 4KG0A 4PJYA 1LHWA 4R9DA 5HBAA 4AFDA 2WFF1 1QQP2 4FSJA 1U5ZA 4AI0A 4GH4C 4N90A 1UZZA 5JOWA 3BODA 2BUKA 4AHXA 3OCPA 4FPCA 4HZFA 2CAVA 5B2GB 3R4UA 4WV8A 1IPJA 1RVF2 1PO13 4IXLA 3HT1A 1W0OA 1SFNA 2AZ5A 1AUYA 1AYM2 1OA4A 1CIWA 4HPKB 2ZTNA 2D3PA 4HL0A 4LBQD 2D93A 5CG8A 3A0KA 5DXDA 3ZYGA 1Q8QA 3VHPA 1H30A 2WZR2 1DLLA 3H0OA 4Z82A 1OFSA 3DPRA 4MX3A 4GH4B 3B7MA 1SCSA 3KS7A 2DYCA 3OY8A 1C4RA 2PHDA 3MIBA 3KM5A 2P3JA 4FT8A 3S7EA 3WDVA 2XH6A 5JSOA 2I45A 4AVTA 3FJSA 1PGW2 4Q4V3 3DPRC 4DXZA 4GKYA 3VBSC 1LOCA 4KH9A 1AR91 2VMIA 2ENRA 3JB8A 1AX1A 2A6VA 2IXIA 1MZ6A 1QJY3 2Z42A 5BV6A 4IERA 4PDWA 1VR3A 4Z2WA 5CFDA 3USSA 2XJTA 5FFOC 5K8SA 5DZEA 2PAKA 4ISQA 4RD7A 4AF9A 2I2SA 4QQPA 2HWB3 1COV1 3WW2A 1RUD2 2NMNA 4PDWC 4BIOA 1W39A 1AR71 5CFDC 2A73B 5GJ6A 4YGDA 4DQAA 4IEXA 4OULA 1NQDA 2Q8OA 1LU2A 4MXVA 2QNKA 3DPRB 1UAIA 3VN4A 1WMDA 3VBSB 3OY8B 4UW3A 5C8WA 3KZ4C 1U0AA 2QUOA 1JW6A 3H1WA 4KBBA 4CEWA 5ACA1 1KDMA 2R042 1QWRA 4IQPA 3AYAA 1RUF2 1HQNA 4DY3A 1F9KA 1D0GA 3KCYA 1LGCA 3ETQA 3AKSA 1RMU3 2C5DA 3D4KA 3VBHA 2R30A 4CEWC 4Q4W1 1JUIA 1YI7A 1Q5OA 4LO4B 3B9IA 1ZX5A 4K21A 2OPKA 2VECA 3J9SA 3VBHC 1J58A 2VULA 4PDWB 2HWF1 5CFDB 3KT4A 1FPN1 1XRUA 2A7AA 1EAH2 1MR5A 4MVTA 1XYPA 2GZWA 1V70A 4YGBA 2RR12 4JGYA 1VAVA 4P9XA 1GSLA 3ZXJA 2FZ2A 5CNAA 5CAZA 3SNMA 1UIKA 3ROUA 1ULDA 1SCRA 3G6JB 3MPBA 2YXSA 2R1DA 4Q8LA 2YGLA 1AYN1 1JUHA 2YMZA 1WCKA 4JGYC 3ZXKA 1BEV3 3PLQA 2R071 5CVRA 4CEWB 4OI2A 2WNUA 1W6MA 1PHMA 1YLLA 3EXUA 3NW4A 4XTPA 3J26N 3VKLA 4D7YA 2EAAA 4BLIA 3B3QE 4CP2A 5CBLA 2ZACA 3VBHB 1TMF2 2WT2A 1ULGA 1FOD1 1MZ5A 2BEOA 3UL2A 3VKMA 2WS91 3U07A 2OYZA 4ZKTB 3CJXA 1F2NA 2YDEA 2G9GA 1GZ9A 4NHMA 1TME1 4TYSA 3H1YA 3PVOA 1SLBA 3O5SA 1SLLA 3VKNA 1A6CA 2DCTA 4JGYB 1PO11 3M3EA 3FHIB 5EWSA 4P9JA 5F1RA 1AVBA 4HVRA 3HBZA 4RHV2 1PGL2 3LKJA 1CPMA 4C1WA 3VZLA 4FVVA 1RUOA 3B02A 3KSCA 3M3CA 4LO8A 2WNUB 3WHTA 1W6MB 2QZ2A 3FFZA 1IKQA 1DQ5A 1KFXL 3TBDA 5L7OC 3AP4A 3WW4A 2O1QA 2GSYA 1RITA 3FC0A 4W6XA 4GWNA 3GHNA 2BVBA 2HWC3 1V9U1 3E97A 2HWD1 3ZMNA 4HKOA 1A8DA 4QPIC 4HETA 3SCHA 1DGWX 3AP5A 4BMEA 3QD6A 4XJWA 4FOYA 3RPQA 4ES9A 1VB4A 1EYBA 1VRH1 5C4WA 1HQLA 5I8YA 1OOPA 3OGGA 3AFKA 4DOUA 1SQ4A 2W0XA 1ZZCA 1QJU3 2PFWA 1CJDA 2ZS6B 3MIFA 2Y26A 4CP1A 4XOGA 2JECA 4KU8A 4LUKA 4A7KA 1G9CA 4QMAA 5C4WC 4YG0A 1LODA 1OOPC 3TYJA 2DVGA 3ST7A 4EN7B 4Q4Y2 3JD73 4Y22A 2OW4A 2QQPA 2HEYF 5AC92 3T1MA 1YFUA 2UY8A 4WVZA 5GLWA 4E9KA 4N9IA 2R1BA 4D7TA 4QPIB 4Z07A 1ASJ3 2ZGOA 4AHWA 4PBPA 5C6CA 4KWJA 5DUWA 3WR0A 1VBE2 3LA3A 2W39A 5C4WB 2ET7A 3WLUA 1OOPB 1MS0A 4Y1UA 4JQRA 3ZFGC 1SMVA 1GLHA 2PAEA 4LBOA 3RSJA 1CAUA 1DHKB 2ZCWA 3PTYA 1NG0A 4AVVA 1BK1A 1SLAA 1N47A 5DUUA 5JZGC 3U10A 4AW7A 3SITA 4B3NA 5LEJA 4CDXA 4XF3A 1D4VB 3POYA 2P34A 2CNAA 5T5OA 5LRSA 4Y22B 3SH3A 1H8VA 4R8HA 4COUA 1Q8VA 2FMYA 2WLPA 4ZU4A 4YZ5A 1WD3A 4B29A 3DKWA 1DGRA 4CDXC 1BEV1 3INAA 3FBMA 3ILRA 4GULA 1LKNA 1WMFA 5JWPA 3ACLA 1JHNA 1U5IA 1H2MA 5J3UA 3EHKA 3M7AA 4M0HA 1RUI3 3QH6A 1S2KA 4WVWA 3UKTA 1CN1A 1M06G 5FLHA 3MI8A 5JZGB 2VOKA 4R9BA 1B09A 1PZ9A 4OVEA 2E9QA 3JZVA 4BOWA 1NXMA 3OD4A 1CAUB 5HCAA 4Q26A 1LULA 1D0HA 2BNMA 1O3TA 3UKNA 1OA2A 1S0FA 3I8TA 4QD2A 3ZXDA 2A3XA 5JOZA 2Y38A 4CDXB 2IXKA 1WW6A 5JCTA 2XGXA 5IK8A 3ZXGA 2ZX1A 3WCRA 4L9BA 1DF0A 3ZSKA 1MACA 2OUHA 2RS11 2ZX4A 3NV3A 4WBBA 2OUJA 3ATGA 4AGGA 3ZVXA 1NXD1 2DV9A 1LOAA 3LOBA 1N3QA 2BWCA 3ILNA 1FMD2 4JC1A 1D4M1 2VMHA 5DUXA 4AVCA 3WUCA 1VJ2A 4AWDA 1RUG3 3NKGA 2YROA 4HK8A 3JBG1 1YYNA 1WLCA 3WP4A 3WT3A 2XLFA 1DU3D 5I0RA 1A78A 1LHVA 1GNZA 2OA2A 3MYXA 4LBNA 2DFCA 2ZA9A 3VBRA 2BQPA 1DQ6A 2LTNA 4AK3A 5T52A 5E8AA 5T5PA 2YGMA 4URTA 1DG6A 3LZZA 1ZRFA 1BKZA 1RUC3 1H2NA 1URXA 2EXHA 3N7JA 1PO21 3VBRC 2DCZA 4ITCA 1RUJ3 3AMMA 3QLQA 4CDQA 4N53A 3WQ0A 3IDEA 3H3ZA 5BUVA 3KQRA 1AZDA 3RRDA 2PHWA 1PZ8A 4RGGA 1VALA 4OHVA 1FXZA 2B42B 2VQAA 3E6CC 4YVSA 1CJPA 4YGCA 4CDQC 4N53C 2O0OA 2RMU2 4FP2A 4H7MA 1AR81 2EALA 4U36A 4YVSC 3SH4A 3ZYJB 2IFRA 3LOIA 1RUH3 1UPSA 3SXWA 4RA0A 3KGLA 5FQ0B 2OZ6A 1BCXA 4ASLA 4QX5A 3VBRB 5JIUA 3LGRA 2RS53 4IV1A 3RYKA 1OQ1A 2GALA 5KXCA 1YFYA 4M01A 3AZXA 2NYYA 4YARA 3C3VA 5JIAA 2PLV1 3UK9A 4CDQB 4N53B 5A3MA 4GB33 5JI9A 3N7MA 4GA9A 2ZGMA 2NPIA 2WFF3 3QH7A 1LJ7A 4OI0A 4XZPA 4PCRA 1XE8A 3HT2A 4XHXA 1UIJA 4YVSB 3R6SA 1AX0A 4HKWA 3EJKA 2WFPA 5J37A 2A6XA 1V00A 2BBVA 4HKLA 3R4SA 5BNOC 4N9HA 5KXDA 3EBRA 3H8UA 3AKTA 4XJUA 1VIWB 4XBQA 2Z79A 2ZMLA 3ILFA 1MQTA 3TNQA 1KRIA 3RDIA 1ZBE3 3WG1A 4Y1XA 3FZ3A 1OA3A 5SV5A 1LOGA 3OPZA 4COWA 2ZGSA 4OI1A 4QPYA 4IV1B 1ND3A 1S0DA 2Q1ZB 1MQTC 2RM21 1GNHA 4MLOA 4YYOA 2C9AA 1C8M3 4ONUA 3BPZA 4M3CF 1RUE1 2AYHA 4BZ4A 2ZX2A 1ND3C 3NAPA 2WC2A 1V6KA 4YG6A 3VL9A 1TE1B 3O0VA 4BYYA 3APBA 3MF6A 5BNOB 2YYOA 1AR93 1K5MA 4Q4W2 4XF0A 4BE3A 4QQ2A 3NAPC 4H14A 4BA6A 3WDUA 1C8NA 2MEV1 5HCFA 4K3UA 1MS9A 1QHDA 3OD0A 5T54A 2X5IA 3ZIXA 1UMZA 2K2SA 2VVEA 1OFNA 4ZXKA 3RI9A 3URFA 4XF4A 1MQTB 5EJ3A 1HRI2 3AFGA 3O12A 2BYVE 1SFYA 1KS5A 4RR3A 2XBO1 5E16A 2CYFA 2V5YA 2X5IC 1COV3 1R081 4XFIA 4AGRA 1ND3B 1AR73 1X7NA 1PK6A 1QJX2 5CU1A 5DDJ3 3VGIA 1ONAA 2R072 1WLWA 1UD1A 5KC6A 2WQZC 1WCSA 2ZJCA 5IUQA 3VHOA 3NAPB 5ACA3 1PK6C 3MPPG 3P3NA 2R6QA 5GZCA 4AI1A 3ZYRA 4Q1RA 2F4PA 2PELA 3EQEA 1AF9A 2BFUL 2D98A 1YIPA 5FAXA 1H2KA 5DG1A 3N36A 1FOD2 4XJZA 1RUJ1 4COVA 2A5ZA 3NKTA 4IEOA 2GH8A 1PVXA 4Q4W3 2VPVA 1IZ3A 1ZA4A 3FFQA 1WBFA 3VDDA 2H0BA 2FZ1A 4X6QB 2X5IB 1DGWA 2D6MA 2XJRA 1Y7BA 2CL2A 2HWF3 3KCCA 5ABJA 4LBMA 1FPN3 2CV6A 4RGAA 3NVCA 1PO12 4FXKB 2XJUA 1CAWA 1C5HA 1DZQA 3M4FA 4MYEA 3VDDC 2ZGLA 4K1YA 4QXKA 1OLQA 3MFCA 1PK6B 5ABJC 4Y24A 1AYN3 3IDCB 4JTOA 4IEUA 2D6OX 1BVVA 2EVXA 4AFBA 1HRV1 2WKKA 4E2QA 4E2GA 4GIQA 4IV3A 1VP6A 1ALYA 1DZTA 1KXGA 2XJSA 4EWDA 4W6WA 2IXJA 1C3HA 2A6YA 3GBFA 3RMXA 1LR5A 4LULA 1BVP1 4PF5A 4D7SA 4IV3C 1V6LA 4EWAA 1FI2A 3HAGA 2WS93 3S0MA 4I01A 4Q4V2 3VDDB 1ZZBA 3NL1A 1JTZX 2Q0AA 1XYNA 1SBFA 2PHXA 4I3PA 2ZZQA 3S6PA 4FP3A 1OSGA 4AXOA 1TME3 2B8MA 5ABJB 2GDFA 5H9RA 4EN9B 3U0ZA 2XL9A 1QJY2 4Z1VA 2KM2A 2YV8A 1CAWB 4AI8A 5AVAA 2VVDA 2XVLA 4LT5A 2GC0A 3WDTA 1J1TA 4YM0A 4MGIE 3SHRA 2NN8A 1ZBE1 3WDXA 1XNDA 4JV4A 3GF6A 1JOJA 5JOXA 3POSA 4B7EA 5FO9B 2WA4A 4XJ8A 2ERFA 1QU0A 2HWB2 3I2DA 2ZAAA 2AUYA 3WD5A 4HN0A 1B35A 2E53A 4IV3B 4IESA 4MH0E 4FTSA 3N7LA 5GLTA 4QPGC 1C8M1 2ARXA 1Q8PA 3VBSA 1GQHA 4BWOA 2D7FA 1O91A 2GMPA 1B35C 4A2UA 1V9U3 2RHPA 2YC0A 4H3WA 4PQ9A 2HWD3 4UW4A 2QKDA 1RHI1 1RMU2 2QVSB 1W6OB 5F9TA 3LA2A 4FQZA 4C0HA 5CA6A 4FPOB 4OHWA 1VRH3 3ZFEA 5DZGA 1XNBA 1F5FA 1JYIA 1DGLA 2D5HA 2E63A 5JSPA 1O5UA 1QDCA 3U4XA 3ZFEC 4AHZA 4RSUA 4QGNA 4FO9A 1UKGA 4QPGB 1WA4A 4LUMA 4QU2A 5FLIA 3ZPYA 3BOWA 1HXS1 2UWBA 3IKWA 1B35B 1EV11 4B4PA 1JYCA 1ULFA 5DDJ1 5FBZA 1L3JA 1QY4A 1BEV2 2A3YA 2QJVA 1YO8A 1YWKA 3E5QA 1DYPA 4NOTA 4LTAA 1HW5A 2QCSB 3H7JA 4PLOA 3RYPA 5A32A 3IN9A 4AFCA 1MS8A 1N1VA 1POV1 3I59A 5C9AA 1UU5A 4BLJA 2FQPA 3ZFEB 4OLLA 3RI8A 4IETA 3ZSEA 3MW3A 2EIGA 5FLJA 1QNYA 4M3CE 4AVSA 1MVEA 4M3CA 1PVC3 5C9AC 5GM0A 5KHHA 4XBNA 1REFA 2ZBJA 5GLZA 2XKOA 5FPXA 1FYUA 1QNWA 4MGZE 3S30A 3AMQA 3S7IA 1G7YA 3ZIWA 1ZNPA 4XQ4A 4CDUC 3PNAA 1H2LA 4AVAA 3VZKA 2W68A 3GZUC 1JBCA 3RZZA 1R091 2CAUA 3BU7A 4CEYA 1X8EA 1GANA 3J8F3 5CIRA 1YNAA 1AXKA 3MGUA 2XJPA 2X8KA 2ZGRA 5A32B 3WCSA 1G9BA 4E4DX 5GALA 3I54A 4CEYC 1UCXA 3I59B 2EXJA 5C9AB 2HWC2 2DCJA 1H4GA 4FOQA 2IWGB 2ETEA 4V1PA 4AFAA 2ZHKA 1NCRA 3H50A 4M3CB 4HBNA 3AZYA 3W9AA 3ZXAC