4LTUA

Crystal structure of ferredoxin from rhodopseudomonas palustris haa2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
106
structure length
106
Chain Sequence
b'PSITFIHPDGRSEIVDAAIGDSAMFAALNHGIDSIVAECGGNAVCATCHVYVDDLWLAKLPPVDANEDDLLDGTASDRLPNSRLSCQIKIAPELDGLVLRIPERQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
molecule tags Electron transport
source organism Rhodopseudomonas palustris
publication title Crystal Structure of Ferredoxin from Rhodopseudomonas palustris HaA2
rcsb
total genus 25
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ltuA00
1FRDA 1N61A 2BS4B 3AE9B 3P4QB 1KRHA 1OFFA 3AE1B 1UWMA 2MJDA 2PVGC 3DWMA 1L6VA 5C2TB 1N62A 4P6VF 3W5VB 3AH7A 3AB5A 3AE8B 1VLBA 3P63A 3NS1A 3P1MA 1DOYA 4IDIA 4ZOHC 2Y5CA 1L5PA 1YQ3B 3AV8A 4HRSA 1DGJA 3VR8B 1QOAA 1WRIA 1PDXA 4YSYB 4ZHOA 4ZHPA 1NYRA 4ITKA 2WU5B 3HVZA 3AECB 4N6EB 1OQQA 1QOFA 1YQ4B 3AM9A 2WDRB 2WDVB 3P4PB 4C7ZA 2KAJA 5G5HA 2QJLA 1ZP0B 1FXIA 1ZXIA 3SR6A 3AMZA 2QIEB 2K5PA 2MH7A 3LB8C 2PVOD 1TKEA 1N60A 1RM6C 1ROEA 2CU3A 1JW9D 3VRAB 1JRPA 2E3TA 3AEGB 1QT9A 3FAHA 1KF6B 1NVID 1GAQB 1IUEA 1FFUA 3WCQA 1N5WA 2WP9B 1RFKA 2H89B 2DWQA 1AWDA 3VR9B 1F0ZA 3P4RB 4C7YA 1QLBB 3B2FA 4JWUC 3AEBB 1VDVA 1XLNA 3VRBB 3AE3B 4YSZB 4YTMB 2W55A 2KMMA 4N59A 1FRRA 1E7PB 2PKOA 1CZPA 1A70A 5EE1A 2L83A 1FMAD 1N5XA 2OHFA 2WLBA 3BIID 5H8YE 4FXCA 2DBYA 2K22A 3NRZA 4US9A 2WDQB 3SFEB 3NVVA 2ACZB 2WQYB 5EE3A 5GXGB 3AE7B 2PIAA 1J7BA 1DOIA 1GPXA 4JWSC 5H92C 1JQ4A 1WYGA 3RPFC 1WWTA 1V97A 1ZUD2 5AUIA 1E10A 1JWAD 3AEFB 2H88B 3HUIA 4YSXB 2AX5A 1XLOA 1OQRA 1L0VB 1YJJA 2N0SB 3NVZA 3AE4B 3AE5B 3PO0A 4YTPB 2EKIA 4A9AA 3W9CB 3EUB2 2CJOA 5MPOA 3SFDB 1SF0A 1CJEA 1JWBD 1TYGB 1QOGA 1ZOYB 3NVWA 1V8CA 4LTUA 1FM0D 2BS2B 3KWLA 3ZYYX 1QF6A 1XO3A 1VJKA 2B76B 4YTNB 1NI3A 2W54A 1DOXA 1RWSA 1EWYC 3L4PA 1J7AA 2LEKA 3CIRB 1SB3C 1YJIA 5G5GA 3CWIA 1T3QA 1FXAA 4WQMA 2L52A 4US8A 1WXQA 1B9RA 4N58A 2G1EA 4C80A 1NENB 1XLPA 3AE6B 5EE9A 5EE0A 3B9JA 1QOBA 1E6EB 2M56B 3P4SB 4HROA 2JQRB 2BS3B 1N63A 1L6UA 2FBWB 2WU2B 3AEEB 3AEAB 3NVYA 1FFVA 2W3SA 2WS3B 3AN1A 1TKGA 3ETRA 4JX1C 1TKYA 4YXDB 1NEKB 3B2GA 1JALA 1SIJA 1KFYB 2JX5A 1JROA 3DWGC 3W5UB 1RYJA 1E9MA 2CJNA 2M19A 1AYFA 3FC4A 3LXFA 1NYQA 1WGKA 2BT6A 4WWMA 1FO4A 1R7SA 1J7CA 3ABVB 2K9XA 4KX6B 1I7HA 1XLQA 1PUTA 2MJ3A 2W3RA 1FIQA 3HRDD 5C3JB 3AE2B 5AUKA 4USAA 1E0ZA 2Q5WD 3AEDB 2MJEA 4YT0B 1PFDA 2HTME 1TJEA
chains in the Genus database with same CATH superfamily
1N62A 3C8YA 2KTRA 2N1VA 1DOYA 1WSPA 3AV8A 2YVCA 2DHZA 4YSYB 2KTFA 2D07B 1TS2A 4C00A 1AW7A 3ALBA 1ZP0B 2LFIA 3OWEB 1EU4A 1ZXIA 1OTRB 2JZ3B 3M3JA 4LJPB 2FCNA 1FD6A 1H8CA 1R4MI 2O6VB 1S1QB 3SEBA 4GGQA 4BKGA 1GAQB 2N9EB 1VZ6A 3ECIA 4W9CA 1ET6A 2FUG1 4MM3B 1F0ZA 1KLGD 1HZ6A 2ZVNA 3VRBB 3AE3B 4W9DA 1CZPA 5EE1A 1FMAD 1HZ5A 2DYMA 3ZQ4A 1JRUA 3NVVA 3EHVA 1GPXA 3UIOB 4LNNA 2DZMA 3LYYA 1WGRA 3RULA 4W9KA 2PE6B 3BK1A 2EKIA 1MHXA 5MPOA 1OEYJ 2MBQA 1V9JA 2JRIB 3OAWA 3CSTA 3KWLA 1LFDA 4FA6A 2JVCA 2GLSA 5BO4B 3CWIA 3ZTCA 1JWMD 2BGFA 1XLPA 4OW0A 3VXWA 3APCA 5DCNA 1E8XA 2FCSA 4BBNC 1HTQA 2Q5WD 3HVDA 1P7FA 1DOIA 4IUMB 3AE1B 4MT5A 2OJRA 4NAWB 3ZRFA 2JU6X 2RDBC 3WANA 1HE8A 4P6VF 4BOZB 4PS8A 1XCTL 1I42A 3P1MA 1C9FA 4OVVA 2DLBA 2DYBA 3BY4B 3KQ4A 4B0EA 4WURA 1PGXA 2D10A 3DDCB 1YQ4B 3VHTC 1WGGA 1IGCA 3PLUA 4RH6A 1UGJA 1FXIA 2FCMA 3VRAB 4ANUA 5LXIB 3RZFA 1EUVB 3U4EG 1LO5D 3DBSA 1C76A 3PZ8A 4IG7B 1I4RA 1AWDA 2HJ1A 2REXA 2DX5B 4RF0A 2ON8A 1YX5B 2KO3A 1TS4A 2C7HA 4HKQA 2BKRB 2KDIA 4QAYA 1WI0A 1UD7A 3MJWA 5T8IA 3SFEB 3Q14C 2KOXA 3S2AA 2O6VA 2Z8LA 3RYTA 4GSWA 4KDLB 1JWAD 1C78A 4XC2A 2BYTA 3QQ8B 1YQBA 2ZPYA 3N1XC 4OZBA 1JWUD 2DAFA 1G6JA 3DCGA 4K3BA 2MBEA 3OJ3A 1QF6A 1WGDA 1NI3A 2DAJA 1D5MC 2N7EA 3BVGA 3A4SC 2OJWA 2ZW0A 2O2VB 1FNVA 3SU8X 4EUTA 3AEEB 1FFVA 4KGSA 4PYUA 3B2GA 3DWGC 2JX5A 2LUEA 1K51A 2LVOA 1YMHE 1F52A 3QCAA 2M4NA 5C3JB 4P1BC 4BAXA 4HLEA 1JMLA 2MEKA 3K9PB 4L2YA 1I4QA 4F1SA 3A1QA 3P4QB 3APFA 5HHDG 1XQQA 3P63A 3W2DA 1KM7A 1E8ZA 3IAM1 5D3DA 2N9PC 3TEWA 4MGKE 4BKSA 4KGRA 1GJZA 1Q10A 2KQ4X 4FJZA 4IOIE 2PVOD 1TKEA 3LDZE 3VFKA 2E3TA 4YL8A 4MJSA 1RLFA 3RT3B 4DXAB 1XF5L 3WCQA 2WP9B 1WMHB 3VR9B 1GNUA 2MLBA 3W1YA 3BYYB 2N1WA 2WXQA 1XT9B 2IO3B 1BT0A 5H8YE 4FXCA 4US9A 1MHHE 5DPTA 1N6ZA 1XEEA 2NBVB 2WXOA 5AZFA 2Z0DB 1TT5B 2DZIA 2BF8B 3AE4B 1MG4A 1KH0A 3AULA 3RI7C 3V62A 1C3TA 2CHXA 5JHAA 2G4SA 4LTUA 4NJ6A 1L7YA 3QK0A 2KWCA 4S17A 2PMVA 4YTNB 3W1SC 2C60A 2D3BA 4XX5A 3UF8A 2SEBD 1FNWA 2KQ7A 1I35A 4A6QA 1AARA 2KX0A 2ZEQA 4CYEA 4EEWA 3DBLB 4ANXA 1RYJA 1R4MB 4WQOB 3TBLD 3LXFA 1NYQA 3RD2A 2DZKA 2FE8A 1XLQA 3DPDA 4GXBA 2INCC 4EE2A 4BKTA 2YEPF 4GOCA 4GDKA 5D2MB 3T9LA 1GC6A 3O13A 1UWMA 3DWMA 1LGRA 3Q8BA 5IKCM 2IJ0A 2LGYA 1P3QU 4A90A 1UBQA 2Y5CA 4GU2A 1UNSA 1ZGUB 2GRIA 3TIXA 1TZOA 3IBEA 3MHSD 4LK0M 3N20C 2WDRB 4MM3A 3I5JC 3NS8A 5HG2A 1ISNA 3LB8C 2SAKA 4AS1A 3JVZX 4MGYE 1SBBB 2BBCA 2LASA 5D6JB 1PYWD 1ZXHA 2KX3A 1T0SC 1C4PA 3VTWA 4EZLA 3I9V1 4LNOA 3APDA 1WR6E 2M17A 1ZDVA 4RM9A 1RRBA 1XCQL 1YNTE 2D3CA 1C77A 1QILA 3QWZB 4ZYSA 1J19A 4RF1A 3WIMA 5FR3A 2YLMA 3PPAA 1F1HA 3A4RA 2EKEC 2A4ZA 3E9SA 2ZPNA 5IP4D 2D11A 4ZRQA 3QAQA 1V1OA 2I1JA 4ZRIA 3V3XA 4EKUA 2FCQA 3IXSA 1FM0D 2N7DA 2LGSA 4HEA1 2GBRA 1HQRD 4MGIE 3ZKJC 2GBNA 4DHZB 2BKFA 3VQIA 4WQMA 3VH4B 2KC1A 4LDTB 2A5UA 2QHOA 2LXCA 3P4SB 1MG8A 3AEAB 1FCCC 3VTVA 1TKYA 1WXMA 4FADA 1UBIA 1E9MA 4GB9A 5J17A 3U30A 4RGMA 4AJYB 1I7HA 1YN3A 4A8XC 3A9JB 3AE2B 4BBNF 3WAMA 4CQNA 3UQAA 3PTFC 1PFDA 4XYCA 4LJOB 4OVZA 3NJTA 3BWUD 4G50A 4JE3B 3DVNU 3MP9A 1Z2MA 1K8RB 1SEBD 3P42A 1PDXA 3BZDB 2CHWA 4ITKA 2AL6A 4C7ZA 3PVLA 2EMTA 3DHHC 3PZDA 1YN4A 3KH0A 2CU3A 3GP7A 2G45B 3ZJUA 2WX0A 1YX6B 4IC7B 2BW2A 4XWTA 2AYOB 4HJKA 3H7PA 1T6BX 3PLVA 4EZKA 4N59A 1FRRA 2MQJA 2BTEA 1N5XA 4MACA 2OHFA 2GBKA 2KDBA 3GE3C 2UYZB 2L7RA 2I38A 1JQ4A 3Q3MC 2QSDA 1WWTA 2BPSA 2V3PA 2KWVB 3NUHB 3NVZA 2L32A 1NBFC 5L83A 3Q8AA 4AWJA 4IW0A 1VR9A 1XO3A 2B76B 4M02A 1EWYC 2UU7A 2XNAC 3IG3A 3Q69A 2AEHA 2D2QA 4KKJA 3QIJA 1D5ZC 3B9JA 4RGOS 4NQKE 2WU2B 2XK5B 4GDLA 4CO7A 1X1MA 3KYCD 4KKIA 4ANWA 4RCOA 4AUQC 3R66C 4WWOA 2MJEA 4JPSA 2KDFB 4C56C 2D5GA 1L6VA 1QZEA 4P1CC 1V5OA 2C5LC 3MC0B 2KC2A 3L13A 3ZJVA 4K7UA 3NOBA 4BKSD 1I4XA 3SD5A 2NTTA 3HHMA 2ZZPB 3L0WB 3Q8CA 2QIEB 2C9WB 4FJVB 1ROEA 3ZLZA 4A3PA 3V6EB 3ZDMC 1RFKA 2BQQA 3T3NA 2KLCA 3DOWA 1E7PB 3KLSX 2WLBA 2Z59B 3GOEA 3NRZA 1D3ZA 3DBRI 3AI5A 5IOIA 4HXDA 3JSVA 1E8WA 2ICIA 4C4VB 1IYFA 1L0VB 3ENEA 2JSVX 4W9LA 2UWQA 3DQVA 3W9CB 3B0AA 3I57A 4HPLB 1V8CA 1Z5SB 1K50A 5HKHA 2HTHA 5G2NA 3VAWA 4HPPA 4US8A 2RR9A 3SDLC 5EE9A 4ZDVA 3PHWB 2WS3B 4GLSC 2L3ZA 2NPTB 3I3TB 4WIPA 2J0MA 5D7GA 3N30A 5BYRA 1R7SA 1J7CA 1K53A 2MJ3A 1V80A 2ZCBA 2MJDA 3AE8B 3ZVVA 2WXLA 4RGNA 2K8HA 2CKHB 1QOAA 4NAWA 1ET9A 4KGTA 2W82A 3H9DA 2K8CA 3IVFA 2WHIA 3L17A 2BYVE 4MH8A 3SR6A 5LXHA 4IWPA 2FIFA 1QT9A 2WYQA 4KIKA 4FBJB 2L00B 2M1MA 3GB1A 2O2VA 2ASQA 1XLNA 4II3B 2IGHA 4WH4A 4E3CA 1WE7A 2KANA 1YIWA 5E6NA 4ZRJA 1ESFA 5C1ZA 1J7BA 2KJHB 4EOYA 4EFOA 2PJHA 1ZUD2 2MBHA 4X57B 3M63B 1GG3A 1WYWB 4ANVA 3HM6X 2X38A 2AQ1B 5CTRC 3DBHI 3A9KB 2LZ6A 1SGHA 4KV2A 4HKZE 2RD0A 1FCLA 2WXPA 1I4PA 4DK5A 1WJ6A 2RMMA 5TSSA 2KDMA 3TEXA 1MVKA 2BB5A 3Q3FA 3AN1A 2Y3AA 3BVZA 3TJPA 3V61A 4JLCA 1AYFA 1TZ1A 1WGKA 3RUIB 1FIQA 1ZE3D 4HVBA 3URYA 2JZPA 3L54A 4R3DA 1VD2A 1PQSA 3AH7A 1IGDA 1V1PA 1HEZE 2EELA 4TMAB 3ONSA 1WJ4A 2JY6A 3ZJTA 3AM9A 1LXDA 5I4DA 4PS3A 2KN4A 4KDIC 2NCNA 2MH7A 5FR6A 4MJSB 4NJ7A 4MEMA 3L16A 4BFRA 2KKCA 3U52E 4PYZA 3ZXVA 1WZ3A 1IUEA 1BXTA 3GZNB 4WJNA 1WGHA 2JF5A 3MFGA 1JWSD 3B2FA 5FK9C 1WXVA 2INPE 2KZRA 1L0YB 5CHWA 2ACZB 2WWZA 2LWPA 2NTSA 3WAPA 2BVCA 2OEDA 3A9KA 1C4CA 3DBHB 1JCKB 2K39A 4L1BA 4C4VA 3EECA 2RGFA 3SFDB 3QJZA 3KUCB 2PLPA 3N1ZC 2W54A 1RWSA 1V49A 1E7UA 4AP4C 1IP9A 1FXAA 4JQWC 2BYEA 5EDSA 3FKYA 5AZGA 1NENB 1TGZB 5L95C 1V86A 2DENB 1QOBA 3Q8FA 1VRAB 2JWZA 1N63A 2V0GA 2K1FA 4KIKB 4M8NA 3RMKC 3B08A 1WX8A 2K9XA 2QILA 5BYSA 2WXMA 4L23A 1WFYA 1TJEA 4LNKA 4WJOA 1KRHA 5BYQA 2FIDA 4NPNA 1ENFA 2JUOA 3MC8A 2HDEA 3KYDD 4MSMB 3VR8B 4ASWC 3ZNZB 1WRIA 1GC7A 1NYRA 4DBGA 1QOFA 1MI0A 2LGDA 2QEJC 1RFAA 2D3GA 1F9JA 4FJYA 4XGAB 3FAHA 2NPTA 5IA7A 1NVID 3R3MA 2MBBB 3L08A 2NVUI 1N5WA 2I2YA 2X8XX 2WXGA 3AEBB 3P2BA 2LJIA 1E7VA 2GBMA 2GMIC 3RCZA 1UWXA 1UZXB 4N9F4 2LRWA 2MP2A 2WDQB 3R2TA 4DHJB 2BWFA 3AE7B 2VZKD 3H6NA 2GBJA 2LHDA 5D3IB 2WXIA 2RPQA 1WX9A 5JHBA 4YSXB 3RNGC 3PO0A 3BK2A 1WIAA 4AJWA 1SF0A 1GUAB 1D4BA 2C7NB 3UGBB 4BZAA 1F2RI 3NVWA 2QMTA 4DDGD 3Q2AC 2KDEB 2MSED 1SB3C 4B6WA 1YJIA 2CU1A 5JXVA 2KD0A 3PS6A 5FKAC 2PPHA 5EE0A 4HROA 2NBUA 1L6UA 1TKGA 2XN9C 3MTNB 4YXDB 3BVMA 1CMXB 3UQBA 3H1UA 3TUOA 2CJNA 2JXXA 2BT6A 3DVGX 3PHXB 1SE3A 3IHPC 2G4DB 2KQSA 1YD8U 2PVGC 2WXNA 1DYQA 4ZRPA 1WZ0A 1CQVA 1P9DU 1PGAA 4TKNA 1P0RA 2W9NA 3QHTA 1HA5A 4ZYNA 1UGMA 4N6EB 3I63C 2LRUA 3ZGZA 2QJLA 1WR1A 2AWTA 2ZJDA 3NZSA 1JW9D 1JRPA 3C0RB 1OGWA 4RNAA 2XK5A 3Q3NC 2MP2B 2J42A 2H89B 2LUMA 3U8ZA 4LNIA 4TQ1A 4DDID 2K6DB 2W55A 2CS4A 2ZNVC 3NHEB 3Q6BA 4AQ7A 1KLVA 5GXGB 3O65B 4NY0A 4LNFA 2KTRB 2JYEA 4DXGA 1IBXA 3AEFB 2H88B 5IAAC 4ARCA 1R4NI 2N4FA 1EU3A 2PE9A 3TMPB 3KUDB 2KFKB 2V4LA 1CJEA 2MRPA 1TYGB 2J53A 3FILB 4KSKC 1VJKA 2EMSA 2N9XA 4IM2A 3UIPB 3A1QB 4JGHB 3H7PB 4K7SA 2W3SA 4ZHOA 1EF1A 3R7RA 3QARA 3V6CB 4F8CB 1HTOA 1TY0A 2KMAA 4O1NA 2L1AA 3GZNI 4P16A 2KFKA 4TSSA 4USAA 3CMMB 3AE9B 1OFFA 1C79A 5LNK1 1XXGA 2LMCA 3HK0A 1V6EA 1WXAA 3MC9A 4UDUC 3AB5A 2BWES 4XDDA 2IPKD 2E6XA 3DVNV 2INNE 2CHZA 3LJ3A 2FAZA 1DGJA 3ZNHB 2WU5B 4CHKA 4GDKB 3EFUA 5J18A 1TIFA 4BOSC 4PT5A 2HD5B 4KZ0A 2KXJA 2KNBA 3AMZA 2IGDA 1MFWA 4HDQA 1L0XB 4WJQA 4J3OD 3ZNID 2NR2A 5D94A 2J7QB 2AL3A 3AU4A 1VZ7A 4FULA 3TCAA 4HDOA 1WM2A 3PSEB 2WXFA 3U7ZA 1I4GA 3EA6A 1FNUA 3MJ5A 3BIID 1SE9A 2NMQA 2WQYB 4PS7A 3ZXRA 1B1ZA 2PEAA 5AUIA 1EWCA 4A3OA 4G3XB 3NG0A 2DYOA 2WXKA 4TUUA 3BYTB 3V05A 4DHZE 2V3SA 2CJOA 3ZNGC 1J8CA 2G3QB 3ZYYX 4W9GA 2IO0B 1V5TA 4HWIB 3GS2A 1J7AA 3CIRB 1EO6A 4IM3A 5G5GA 4E71A 1OEYA 4MELA 3E56A 4WWPA 4GN1A 2V1YA 4XE0A 4K1RB 1XD3B 3RNFC 4W9IA 3PZ7A 4URKA 4OHJA 3TEZA 4W9HA 2QCZA 2JRHA 2D3AA 2KJ6A 1P1AA 1ACCA 2K6QA 2ONQA 1V2YA 5C2TB 3W5VB 2DNFA 3ZUNA 1S3SG 2IO1B 4FHKA 2LGXA 4ZOHC 1GB1A 2KYWA 5E6PA 1C4AA 1SJHD 3CF6E 5KHOA 3V60A 3DHGC 4ICUA 4W9JA 1T0YA 3R2IA 1LQBA 3PT2B 5J2RA 2AQ2B 3Q3JA 2WDVB 3KVFB 5G5HA 4TQ0A 2LI5A 3ML8A 4E74A 2LVQA 1E90A 4I6NB 3OG5A 4K7WA 1PGBA 1WH3A 4NNJB 3N1YC 3NY5A 4OVUA 3RNAC 2IGGA 2DWQA 2JT4B 3IFWB 3N32A 2FUHB 4ACFA 1VDVA 3H7SA 4YSZB 3DHIC 3C19A 5JH5C 2L83A 3IAS1 2B3AA 2DBYA 4WAFA 3BINA 3VDZA 3WA0A 1V81A 1TTNA 4XDCA 4OZAA 4JWSC 2LXAA 1VCBA 1NI2A 2YEPB 5E6OA 1L4ZB 2VH1A 2RSUA 4I6PA 2AX5A 1K52A 1YJJA 2RDHA 4A9AA 2LHEA 4H2AA 3JYUA 4LDTD 4HPMB 4B9KA 2IO2B 1T0QC 3DBLI 2WXRA 1FXTB 1EM7A 3T8MA 5CHFA 5E6JA 1R4NB 1T0RC 2J4XA 2L52A 1TS3A 2WX1A 2BYFA 3PRZA 4K3CA 1WMHA 1E6EB 4RFBA 2KLGA 2INDC 3ETRA 3UINB 3W5UB 3KWVA 1FPYA 2I1KA 1WM3A 2MX2A 3FC4A 1E5WA 3VUYA 1SE2A 2OOBB 1ZDXA 5AUKA 3AEGB 4N58A 4YT0B 2BS3B 4LLGM 2HTME 5C23A 1SIFA 2LJ5A 3IT6B 3PRMB 4IDIA 4W9FA 4B95A 5TR5A 4JIOU 4J6IA 4FLHA 5BMIA 2KK8A 3IT4B 4DQOC 1QQRA 1WX7A 2K5PA 3JSVB 2QDFA 2WDTB 2K8BA 4FN2A 4G11A 2N9KA 1H4RA 1SE4A 2V3NA 2NS5A 4HK2A 1KOTA 5BMGA 3ZDTA 5AZHA 1ZPSA 3VTUA 3P4RB 3A33B 2QC8A 2PKOA 1WE6A 3B1LX 1V1PB 2KACA 5CX3A 4B0MA 3RPFC 1V97A 1YN5A 2KHWB 4M01A 1MJDA 1OQRA 2N0SB 4YTPB 5DPWA 3EUB2 1JWBD 1ZOYB 2GI9A 4RM8A 2IY0B 2MWSB 4MH0E 2ZW1A 1ZW7A 3M95A 2C7MB 2ZNVB 1QKZA 3CSFA 1B9RA 4XWWA 5JZEB 1RAXA 1SXTA 4ZRKA 4A55A 4JL9A 4RMAA 3NVYA 2KN5A 1JROA 2TSSA 3ABVB 2KJRA 4II2B 3HRDD 4MDKE 2MBOA 1P98A 1FRDA 4GIVA 3W1SA 2J0KA 3TSSA 1UH6A 3QX1A 4XZ4A 3U7DA 1P7EA 2LD9A 2V9HA 4ZHPA 5DPSA 2RPVA 5KHQA 2IYDB 3EGRA 1CK1A 2L0FA 3TL5A 2VRRB 1M94A 2PTLA 3AXCA 4DXFA 4REZA 4M8MA 4AOFA 3VH3B 5HI1A 2HE7A 4HJGE 1WXSA 4JWUC 2VH2A 1IPGA 1A5RA 2L05A 3EFCA 1KJTA 2VZKB 3JW0X 2K0PA 3PV1A 2Y5PA 2ZCCA 2WNMA 1WJNA 5IO9A 5EE3A 2J0JA 2IY1B 3M62B 3FILA 1NDDA 2BB6A 1Q0WB 1D5XC 2MHJA 4KZCA 4DWFA 4HCPB 5AEKB 3AE5B 3NZUA 1OQYA 3D32A 2KFJA 2M8SA 3WAOA 2KVZA 3ZW3A 3DBRB 2LGIA 3ZIMA 2NBWB 4K81A 1E8YA 3L4PA 2IBIB 2PW9A 2Y5BB 4MGZE 1WXQA 3ML9A 3X23A 4C80A 3AE6B 1Y8RC 5LLIA 2M56B 2JZZA 4NAMA 2L8JA 1JALA 1SIJA 2GB1A 1U4AA 2FNJB 1STEA 3J9CA 4WWMA 4S0RA 5HFYA 1UF0A 2K3UA 2W3RA 2M0XA 3AEDB 2JXTA 3ZTDA 1SJED 1T5XD 1A70A 4EZJA 2BS4B 3NZ3A 4IWQA 4D2KA 2WGSA 4RGTA 3DVGY 4IWOA 1VLBA 2R2OA 3NS1A 3EC8A 3SHQA 2M0AA 2R61A 1YQ3B 3RFZB 1M4VA 3X0WA 5IN7A 3U2SC 4G0NB 1L2NA 1OQQA 3QA8A 3P4PB 5BMHA 1WY8A 4IKGA 2DZJA 4BVUC 1WJUA 4FHJA 3UI3A 1RM6C 4Q2JA 3T3OA 2MW5A 1Q5WB 2XBBC 1KF6B 2L76A 1VZ8A 2XEWA 3RNEC 3OLMD 4C7YA 1QLBB 4ARIA 1YOVB 2KMMA 3OJ4B 2AQ3B 5DPRA 3Q8EA 2K22A 1FEHA 2PIAA 5H92C 3VVWB 1WYGA 3HUIA 4M00A 1KLUD 2O6VD 1KTKA 2WXJA 4LCDE 4DHJD 4P7IA 1IBXB 2JPHA 1WGYA 4ICVA 1DOXA 3RNBC 4GDLB 3H8HA 2ZVOA 1GOZA 2LEKA 1T3QA 2MCNB 1TBEA 5GMVA 4HCNB 1AN8A 2KWUB 2WXHA 2CR5A 4NZLB 4A20A 3L10B 3HIZA 2FBWB 4JX1C 1UUPA 3RN9C 2L0TA 1MPEA 1BUIC 3KUZA 2GOWA 1Y56A 4TV3A 1FO4A 2KWDA 3QC8B 4PK1A 3TEYA 1L4DB 1ZKHA 2MA9B 1TY2A 2RDGA 3VUWA 1D6EC 1N61A 3R7QA 4WWNA 3N3KB 4M0WA 1L5PA 2JYTA 4HRSA 4M0WB 1J0GA 4WJPA 1TS5A 1HXYD 1YJ1A 3KW5B 4IM0A 4NJCA 3AU5A 4GMVA 3HVZA 3AECB 4MSQB 2KAJA 1GB4A 1WRDB 1I4HA 3ZRCA 1F77A 1N60A 2K25A 2LVPA 2IDYA 1FFUA 3WALA 1EF5A 4KVGB 2N7JA 4YTMB 3ZO5B 1UELA 2KVRA 3RNCC 3VUXA 2N9LA 2J52A 1E10A 1XLOA 3N9YC 4YWGG 3A9JA 2R2QA 1WF9A 4F7ZA 3MHZA 1QOGA 3PGEA 2BS2B 2KMCA 2IZVB 2V4IB 3HM3A 5G55A 3Q3OC 5CHVC 3PREA 2Z0EB 2KT7A 1Q1OA 2G9HD 2G1EA 3GE8C 2JQRB 3PRPB 4I6LB 1NEKB 3K9OB 1KFYB 3R8BA 1BMLC 4NQLB 2M19A 3RZWC 4KSLC 4OZCA 1LM8B 4KX6B 1F2RC 1PUTA 1SSNA 2HJ8A 1E0ZA 2JWUA 4WAAA 1C1YB 4W9EA
chains in the Genus database with same CATH topology
4OVZA 1KRHA 3BWUD 5BYQA 1N62A 4JE3B 3C8YA 3MP9A 1ENFA 1SEBD 1WSPA 1DOYA 3IT6B 4IDIA 2HDEA 3AV8A 3P42A 3VR8B 1WRIA 1PDXA 3BZDB 4YSYB 1NYRA 4ITKA 5BMIA 1TS2A 1QOFA 1MI0A 2QEJC 4C7ZA 1AW7A 3IT4B 4DQOC 1ZP0B 2LFIA 1QQRA 3OWEB 1EU4A 1ZXIA 2K5PA 1YN4A 1FD6A 2CU3A 3GP7A 3FAHA 2N9KA 3SEBA 1SE4A 1NVID 2V3NA 1GAQB 3ZJUA 2BW2A 4XWTA 1VZ6A 1N5WA 4LLGM 1ET6A 5BMGA 1ZPSA 2FUG1 4MM3B 1F0ZA 3P4RB 1T6BX 2I2YA 1KLGD 1HZ6A 2WXGA 3AEBB 3VRBB 3AE3B 4N59A 1FRRA 2LJIA 2PKOA 2BTEA 1CZPA 5EE1A 1FMAD 1HZ5A 1N5XA 1UWXA 2OHFA 4MACA 2DYMA 3ZQ4A 1V1PB 2WDQB 2KACA 3NVVA 3R2TA 2I38A 3AE7B 2VZKD 2LHDA 1GPXA 4B0MA 5D3IB 1JQ4A 2QSDA 2WXIA 3RPFC 1WWTA 1V97A 1YN5A 3LYYA 2V3PA 4YSXB 1OQRA 2N0SB 3BK1A 3NUHB 3NVZA 4YTPB 3PO0A 2EKIA 1MHXA 3EUB2 5MPOA 2L32A 3BK2A 1SF0A 1D4BA 1JWBD 1ZOYB 3Q8AA 1F2RI 2GI9A 3NVWA 1VR9A 2QMTA 3KWLA 1XO3A 2B76B 1EWYC 2ZW1A 1SB3C 2XNAC 3Q69A 1YJIA 3CWIA 5JXVA 1QKZA 5FKAC 1JWMD 1B9RA 1XLPA 4KKJA 4XWWA 5EE0A 1D5ZC 1SXTA 3B9JA 4RGOS 4HROA 2WU2B 4OW0A 1L6UA 4A55A 3NVYA 1TKGA 2XN9C 4YXDB 3BVMA 1JROA 3TUOA 2CJNA 2BT6A 4KKIA 2TSSA 3ABVB 4RCOA 3HRDD 1SE3A 2Q5WD 3HVDA 2MJEA 1P7FA 1DOIA 4JPSA 1FRDA 4C56C 2D5GA 3AE1B 4MT5A 4NAWB 3W1SA 2PVGC 2JU6X 1L6VA 2WXNA 4P6VF 3TSSA 1DYQA 1XCTL 4ZRPA 3P1MA 3MC0B 1C9FA 2DLBA 1CQVA 3ZJVA 1PGAA 3KQ4A 1P7EA 4B0EA 1HA5A 4WURA 1PGXA 4ZHPA 4N6EB 1YQ4B 2RPVA 1I4XA 3EGRA 1IGCA 1CK1A 2NTTA 4RH6A 3ZGZA 2QJLA 1UGJA 1FXIA 3Q8CA 2QIEB 1ROEA 2PTLA 4DXFA 4REZA 1JW9D 3VRAB 1JRPA 3U4EG 1LO5D 4RNAA 1C76A 3PZ8A 2J42A 1I4RA 1RFKA 2H89B 2LUMA 1AWDA 5HI1A 4HJGE 4RF0A 4JWUC 2ON8A 4TQ1A 3T3NA 2W55A 1TS4A 4HKQA 1E7PB 2VZKB 2K0PA 3KLSX 2Y5PA 2WLBA 4AQ7A 3NRZA 5T8IA 2WNMA 3SFEB 5EE3A 5GXGB 2JYEA 4DXGA 1IBXA 3FILA 2Z8LA 1JWAD 3AEFB 2H88B 2ICIA 2BB6A 4ARCA 1D5XC 1EU3A 1C78A 1L0VB 3AE5B 2BYTA 2JSVX 3W9CB 3I57A 4OZBA 1JWUD 1CJEA 1TYGB 2J53A 1V8CA 1K50A 3FILB 2LGIA 1QF6A 1VJKA 1NI3A 1D5MC 3L4PA 3BVGA 2PW9A 2ZW0A 4US8A 1WXQA 1FNVA 4C80A 3AE6B 5EE9A 2M56B 3AEEB 4NAMA 1FFVA 2W3SA 2WS3B 4KGSA 4GLSC 4ZHOA 3B2GA 3DWGC 1JALA 1SIJA 2GB1A 2JX5A 4WIPA 5D7GA 1K51A 1STEA 1YMHE 3J9CA 4WWMA 5BYRA 1R7SA 5HFYA 1J7CA 1K53A 1TY0A 2K3UA 4O1NA 2W3RA 2L1AA 2MJ3A 4P16A 5C3JB 4TSSA 4USAA 3AEDB 2JXTA 1JMLA 2MEKA 4L2YA 1SJED 1A70A 1T5XD 1I4QA 2BS4B 3AE9B 3NZ3A 3P4QB 1OFFA 1C79A 5LNK1 1XXGA 4D2KA 2MJDA 2LMCA 4UDUC 3AB5A 4RGTA 5HHDG 3AE8B 1VLBA 3P63A 3W2DA 3NS1A 4XDDA 2IPKD 2E6XA 2M0AA 1YQ3B 2R61A 2WXLA 2INNE 3IAM1 1M4VA 4RGNA 5D3DA 3RFZB 1DGJA 3TEWA 1QOAA 3U2SC 1ET9A 2WU5B 4KGTA 1OQQA 2W82A 4KGRA 4GDKB 3P4PB 5BMHA 1Q10A 4PT5A 4IKGA 2KQ4X 3SR6A 3AMZA 4IOIE 4MH8A 2IGDA 2PVOD 1TKEA 3UI3A 1RM6C 4Q2JA 3T3OA 2E3TA 1QT9A 1KF6B 1L0XB 4J3OD 1XF5L 3GB1A 3WCQA 1VZ8A 2WP9B 1VZ7A 3VR9B 4C7YA 1QLBB 4ARIA 1XLNA 2WXFA 3BYYB 3U7ZA 2KMMA 2AQ3B 1I4GA 2WXQA 3EA6A 1FNUA 2IGHA 4WH4A 3MJ5A 3BIID 3Q8EA 5H8YE 4FXCA 2K22A 4US9A 1MHHE 2NMQA 2WQYB 1ESFA 1FEHA 2PIAA 1J7BA 1B1ZA 5H92C 1WYGA 1XEEA 2WXOA 1ZUD2 5AUIA 1EWCA 3HUIA 1KLUD 2DYOA 2WXKA 2X38A 3BYTB 3AE4B 3V05A 1KH0A 2AQ1B 1KTKA 2CJOA 2WXJA 4LTUA 4HKZE 1IBXB 3ZYYX 1FCLA 2PMVA 4YTNB 2WXPA 1DOXA 1I4PA 4GDLB 3H8HA 1GOZA 3GS2A 1J7AA 2LEKA 3CIRB 2RMMA 5G5GA 5TSSA 1T3QA 2KDMA 2SEBD 1AN8A 3E56A 1FNWA 3TEXA 1MVKA 2WXHA 2BB5A 4NZLB 4A6QA 2FBWB 4JX1C 3AN1A 1UUPA 2Y3AA 3BVZA 4XE0A 1RYJA 1MPEA 3LXFA 1AYFA 1BUIC 1NYQA 1WGKA 1Y56A 1FO4A 2KWDA 3PZ7A 2FE8A 4OHJA 1L4DB 1XLQA 3TEYA 3TEZA 1FIQA 1ZE3D 4EE2A 1TY2A 2YEPF 2RDGA 3URYA 2JZPA 1D6EC 1N61A 1ACCA 2ONQA 1UWMA 3DWMA 3O13A 4R3DA 5C2TB 3Q8BA 3W5VB 3AH7A 4M0WA 2IJ0A 4A90A 1IGDA 1V1PA 1HEZE 1L5PA 2EELA 1UNSA 2JYTA 2Y5CA 4TMAB 4ZOHC 1GB1A 4HRSA 1C4AA 2GRIA 1SJHD 1TS5A 1HXYD 1TZOA 4NJCA 3R2IA 3HVZA 2AQ2B 3AECB 4LK0M 3ZJTA 3AM9A 2WDRB 2WDVB 5I4DA 2KAJA 1GB4A 5G5HA 4TQ0A 2KN4A 1I4HA 5HG2A 2MH7A 3LB8C 1F77A 2SAKA 1N60A 4AS1A 3U52E 1SBBB 2BBCA 1PGBA 1PYWD 1ZXHA 2IDYA 1IUEA 1BXTA 1FFUA 2IGGA 1C4PA 2DWQA 3I9V1 3MFGA 1JWSD 3B2FA 5FK9C 1VDVA 2N7JA 4YSZB 4YTMB 2INPE 1L0YB 2L83A 3IAS1 1ZDVA 1XCQL 1YNTE 2DBYA 4WAFA 1C77A 2ACZB 1QILA 4XDCA 2N9LA 4OZAA 4ZYSA 4JWSC 2J52A 2NTSA 4RF1A 5FR3A 2YEPB 2OEDA 1E10A 1L4ZB 1C4CA 1JCKB 2AX5A 1XLOA 1K52A 3N9YC 1YJJA 3E9SA 4YWGG 2RDHA 4A9AA 4L1BA 2LHEA 4ZRQA 4H2AA 1V1OA 3MHZA 3SFDB 3V3XA 2PLPA 1QOGA 3IXSA 1FM0D 2BS2B 4HEA1 2WXRA 2W54A 1RWSA 2V4IB 1HQRD 1EM7A 5E6JA 3VQIA 1FXAA 4WQMA 2J4XA 2L52A 1TS3A 4N58A 2G9HD 2G1EA 1NENB 1QOBA 1E6EB 3P4SB 3Q8FA 1VRAB 2BS3B 1N63A 2JQRB 4RFBA 3AEAB 2V0GA 1FCCC 3ETRA 1TKYA 1NEKB 1KFYB 3R8BA 3W5UB 3KWVA 1BMLC 1E9MA 2M19A 3FC4A 4OZCA 4RGMA 1SE2A 2K9XA 4KX6B 1I7HA 1YN3A 4A8XC 1F2RC 1PUTA 1SSNA 2QILA 5BYSA 3AE2B 2WXMA 1ZDXA 4L23A 5AUKA 2JWUA 3AEGB 4CQNA 1E0ZA 4YT0B 1PFDA 2HTME 1TJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FRD A;  1N61 A;  2BS4 B;  3AE9 B;  3P4Q B;  1KRH A;  1OFF A;  3AE1 B;  1UWM A;  2MJD A;  2PVG C;  3DWM A;  1L6V A;  5C2T B;  1N62 A;  4P6V F;  3W5V B;  3AH7 A;  3AB5 A;  3AE8 B;  1VLB A;  3P63 A;  3NS1 A;  3P1M A;  1DOY A;  4IDI A;  4ZOH C;  2Y5C A;  1L5P A;  1YQ3 B;  3AV8 A;  4HRS A;  1DGJ A;  3VR8 B;  1QOA A;  1WRI A;  1PDX A;  4YSY B;  4ZHO A;  4ZHP A;  1NYR A;  4ITK A;  2WU5 B;  3HVZ A;  3AEC B;  4N6E B;  1OQQ A;  1QOF A;  1YQ4 B;  3AM9 A;  2WDR B;  2WDV B;  3P4P B;  4C7Z A;  2KAJ A;  5G5H A;  2QJL A;  1ZP0 B;  1FXI A;  1ZXI A;  3SR6 A;  3AMZ A;  2QIE B;  2K5P A;  2MH7 A;  3LB8 C;  2PVO D;  1TKE A;  1N60 A;  1RM6 C;  1ROE A;  2CU3 A;  1JW9 D;  3VRA B;  1JRP A;  2E3T A;  3AEG B;  1QT9 A;  3FAH A;  1KF6 B;  1NVI D;  1GAQ B;  1IUE A;  1FFU A;  3WCQ A;  1N5W A;  2WP9 B;  1RFK A;  2H89 B;  2DWQ A;  1AWD A;  3VR9 B;  1F0Z A;  3P4R B;  4C7Y A;  1QLB B;  3B2F A;  4JWU C;  3AEB B;  1VDV A;  1XLN A;  3VRB B;  3AE3 B;  4YSZ B;  4YTM B;  2W55 A;  2KMM A;  4N59 A;  1FRR A;  1E7P B;  2PKO A;  1CZP A;  1A70 A;  5EE1 A;  2L83 A;  1FMA D;  1N5X A;  2OHF A;  2WLB A;  3BII D;  5H8Y E;  4FXC A;  2DBY A;  2K22 A;  3NRZ A;  4US9 A;  2WDQ B;  3SFE B;  3NVV A;  2ACZ B;  2WQY B;  5EE3 A;  5GXG B;  3AE7 B;  2PIA A;  1J7B A;  1DOI A;  1GPX A;  4JWS C;  5H92 C;  1JQ4 A;  1WYG A;  3RPF C;  1WWT A;  1V97 A;  1ZUD 2;  5AUI A;  1E10 A;  1JWA D;  3AEF B;  2H88 B;  3HUI A;  4YSX B;  2AX5 A;  1XLO A;  1OQR A;  1L0V B;  1YJJ A;  2N0S B;  3NVZ A;  3AE4 B;  3AE5 B;  3PO0 A;  4YTP B;  2EKI A;  4A9A A;  3W9C B;  3EUB 2;  2CJO A;  5MPO A;  3SFD B;  1SF0 A;  1CJE A;  1JWB D;  1TYG B;  1QOG A;  1ZOY B;  3NVW A;  1V8C A;  4LTU A;  1FM0 D;  2BS2 B;  3KWL A;  3ZYY X;  1QF6 A;  1XO3 A;  1VJK A;  2B76 B;  4YTN B;  1NI3 A;  2W54 A;  1DOX A;  1RWS A;  1EWY C;  3L4P A;  1J7A A;  2LEK A;  3CIR B;  1SB3 C;  1YJI A;  5G5G A;  3CWI A;  1T3Q A;  1FXA A;  4WQM A;  2L52 A;  4US8 A;  1WXQ A;  1B9R A;  4N58 A;  2G1E A;  4C80 A;  1NEN B;  1XLP A;  3AE6 B;  5EE9 A;  5EE0 A;  3B9J A;  1QOB A;  1E6E B;  2M56 B;  3P4S B;  4HRO A;  2JQR B;  2BS3 B;  1N63 A;  1L6U A;  2FBW B;  2WU2 B;  3AEE B;  3AEA B;  3NVY A;  1FFV A;  2W3S A;  2WS3 B;  3AN1 A;  1TKG A;  3ETR A;  4JX1 C;  1TKY A;  4YXD B;  1NEK B;  3B2G A;  1JAL A;  1SIJ A;  1KFY B;  2JX5 A;  1JRO A;  3DWG C;  3W5U B;  1RYJ A;  1E9M A;  2CJN A;  2M19 A;  1AYF A;  3FC4 A;  3LXF A;  1NYQ A;  1WGK A;  2BT6 A;  4WWM A;  1FO4 A;  1R7S A;  1J7C A;  3ABV B;  2K9X A;  4KX6 B;  1I7H A;  1XLQ A;  1PUT A;  2MJ3 A;  2W3R A;  1FIQ A;  3HRD D;  5C3J B;  3AE2 B;  5AUK A;  4USA A;  1E0Z A;  2Q5W D;  3AED B;  2MJE A;  4YT0 B;  1PFD A;  2HTM E;  1TJE A; 
#chains in the Genus database with same CATH topology
 1N62 A;  3C8Y A;  2KTR A;  2N1V A;  1DOY A;  1WSP A;  3AV8 A;  2YVC A;  2DHZ A;  4YSY B;  2KTF A;  2D07 B;  1TS2 A;  4C00 A;  1AW7 A;  3ALB A;  1ZP0 B;  2LFI A;  3OWE B;  1EU4 A;  1ZXI A;  1OTR B;  2JZ3 B;  3M3J A;  4LJP B;  2FCN A;  1FD6 A;  1H8C A;  1R4M I;  2O6V B;  1S1Q B;  3SEB A;  4GGQ A;  4BKG A;  1GAQ B;  2N9E B;  1VZ6 A;  3ECI A;  4W9C A;  1ET6 A;  2FUG 1;  4MM3 B;  1F0Z A;  1KLG D;  1HZ6 A;  2ZVN A;  3VRB B;  3AE3 B;  4W9D A;  1CZP A;  5EE1 A;  1FMA D;  1HZ5 A;  2DYM A;  3ZQ4 A;  1JRU A;  3NVV A;  3EHV A;  1GPX A;  3UIO B;  4LNN A;  2DZM A;  3LYY A;  1WGR A;  3RUL A;  4W9K A;  2PE6 B;  3BK1 A;  2EKI A;  1MHX A;  5MPO A;  1OEY J;  2MBQ A;  1V9J A;  2JRI B;  3OAW A;  3CST A;  3KWL A;  1LFD A;  4FA6 A;  2JVC A;  2GLS A;  5BO4 B;  3CWI A;  3ZTC A;  1JWM D;  2BGF A;  1XLP A;  4OW0 A;  3VXW A;  3APC A;  5DCN A;  1E8X A;  2FCS A;  4BBN C;  1HTQ A;  2Q5W D;  3HVD A;  1P7F A;  1DOI A;  4IUM B;  3AE1 B;  4MT5 A;  2OJR A;  4NAW B;  3ZRF A;  2JU6 X;  2RDB C;  3WAN A;  1HE8 A;  4P6V F;  4BOZ B;  4PS8 A;  1XCT L;  1I42 A;  3P1M A;  1C9F A;  4OVV A;  2DLB A;  2DYB A;  3BY4 B;  3KQ4 A;  4B0E A;  4WUR A;  1PGX A;  2D10 A;  3DDC B;  1YQ4 B;  3VHT C;  1WGG A;  1IGC A;  3PLU A;  4RH6 A;  1UGJ A;  1FXI A;  2FCM A;  3VRA B;  4ANU A;  5LXI B;  3RZF A;  1EUV B;  3U4E G;  1LO5 D;  3DBS A;  1C76 A;  3PZ8 A;  4IG7 B;  1I4R A;  1AWD A;  2HJ1 A;  2REX A;  2DX5 B;  4RF0 A;  2ON8 A;  1YX5 B;  2KO3 A;  1TS4 A;  2C7H A;  4HKQ A;  2BKR B;  2KDI A;  4QAY A;  1WI0 A;  1UD7 A;  3MJW A;  5T8I A;  3SFE B;  3Q14 C;  2KOX A;  3S2A A;  2O6V A;  2Z8L A;  3RYT A;  4GSW A;  4KDL B;  1JWA D;  1C78 A;  4XC2 A;  2BYT A;  3QQ8 B;  1YQB A;  2ZPY A;  3N1X C;  4OZB A;  1JWU D;  2DAF A;  1G6J A;  3DCG A;  4K3B A;  2MBE A;  3OJ3 A;  1QF6 A;  1WGD A;  1NI3 A;  2DAJ A;  1D5M C;  2N7E A;  3BVG A;  3A4S C;  2OJW A;  2ZW0 A;  2O2V B;  1FNV A;  3SU8 X;  4EUT A;  3AEE B;  1FFV A;  4KGS A;  4PYU A;  3B2G A;  3DWG C;  2JX5 A;  2LUE A;  1K51 A;  2LVO A;  1YMH E;  1F52 A;  3QCA A;  2M4N A;  5C3J B;  4P1B C;  4BAX A;  4HLE A;  1JML A;  2MEK A;  3K9P B;  4L2Y A;  1I4Q A;  4F1S A;  3A1Q A;  3P4Q B;  3APF A;  5HHD G;  1XQQ A;  3P63 A;  3W2D A;  1KM7 A;  1E8Z A;  3IAM 1;  5D3D A;  2N9P C;  3TEW A;  4MGK E;  4BKS A;  4KGR A;  1GJZ A;  1Q10 A;  2KQ4 X;  4FJZ A;  4IOI E;  2PVO D;  1TKE A;  3LDZ E;  3VFK A;  2E3T A;  4YL8 A;  4MJS A;  1RLF A;  3RT3 B;  4DXA B;  1XF5 L;  3WCQ A;  2WP9 B;  1WMH B;  3VR9 B;  1GNU A;  2MLB A;  3W1Y A;  3BYY B;  2N1W A;  2WXQ A;  1XT9 B;  2IO3 B;  1BT0 A;  5H8Y E;  4FXC A;  4US9 A;  1MHH E;  5DPT A;  1N6Z A;  1XEE A;  2NBV B;  2WXO A;  5AZF A;  2Z0D B;  1TT5 B;  2DZI A;  2BF8 B;  3AE4 B;  1MG4 A;  1KH0 A;  3AUL A;  3RI7 C;  3V62 A;  1C3T A;  2CHX A;  5JHA A;  2G4S A;  4LTU A;  4NJ6 A;  1L7Y A;  3QK0 A;  2KWC A;  4S17 A;  2PMV A;  4YTN B;  3W1S C;  2C60 A;  2D3B A;  4XX5 A;  3UF8 A;  2SEB D;  1FNW A;  2KQ7 A;  1I35 A;  4A6Q A;  1AAR A;  2KX0 A;  2ZEQ A;  4CYE A;  4EEW A;  3DBL B;  4ANX A;  1RYJ A;  1R4M B;  4WQO B;  3TBL D;  3LXF A;  1NYQ A;  3RD2 A;  2DZK A;  2FE8 A;  1XLQ A;  3DPD A;  4GXB A;  2INC C;  4EE2 A;  4BKT A;  2YEP F;  4GOC A;  4GDK A;  5D2M B;  3T9L A;  1GC6 A;  3O13 A;  1UWM A;  3DWM A;  1LGR A;  3Q8B A;  5IKC M;  2IJ0 A;  2LGY A;  1P3Q U;  4A90 A;  1UBQ A;  2Y5C A;  4GU2 A;  1UNS A;  1ZGU B;  2GRI A;  3TIX A;  1TZO A;  3IBE A;  3MHS D;  4LK0 M;  3N20 C;  2WDR B;  4MM3 A;  3I5J C;  3NS8 A;  5HG2 A;  1ISN A;  3LB8 C;  2SAK A;  4AS1 A;  3JVZ X;  4MGY E;  1SBB B;  2BBC A;  2LAS A;  5D6J B;  1PYW D;  1ZXH A;  2KX3 A;  1T0S C;  1C4P A;  3VTW A;  4EZL A;  3I9V 1;  4LNO A;  3APD A;  1WR6 E;  2M17 A;  1ZDV A;  4RM9 A;  1RRB A;  1XCQ L;  1YNT E;  2D3C A;  1C77 A;  1QIL A;  3QWZ B;  4ZYS A;  1J19 A;  4RF1 A;  3WIM A;  5FR3 A;  2YLM A;  3PPA A;  1F1H A;  3A4R A;  2EKE C;  2A4Z A;  3E9S A;  2ZPN A;  5IP4 D;  2D11 A;  4ZRQ A;  3QAQ A;  1V1O A;  2I1J A;  4ZRI A;  3V3X A;  4EKU A;  2FCQ A;  3IXS A;  1FM0 D;  2N7D A;  2LGS A;  4HEA 1;  2GBR A;  1HQR D;  4MGI E;  3ZKJ C;  2GBN A;  4DHZ B;  2BKF A;  3VQI A;  4WQM A;  3VH4 B;  2KC1 A;  4LDT B;  2A5U A;  2QHO A;  2LXC A;  3P4S B;  1MG8 A;  3AEA B;  1FCC C;  3VTV A;  1TKY A;  1WXM A;  4FAD A;  1UBI A;  1E9M A;  4GB9 A;  5J17 A;  3U30 A;  4RGM A;  4AJY B;  1I7H A;  1YN3 A;  4A8X C;  3A9J B;  3AE2 B;  4BBN F;  3WAM A;  4CQN A;  3UQA A;  3PTF C;  1PFD A;  4XYC A;  4LJO B;  4OVZ A;  3NJT A;  3BWU D;  4G50 A;  4JE3 B;  3DVN U;  3MP9 A;  1Z2M A;  1K8R B;  1SEB D;  3P42 A;  1PDX A;  3BZD B;  2CHW A;  4ITK A;  2AL6 A;  4C7Z A;  3PVL A;  2EMT A;  3DHH C;  3PZD A;  1YN4 A;  3KH0 A;  2CU3 A;  3GP7 A;  2G45 B;  3ZJU A;  2WX0 A;  1YX6 B;  4IC7 B;  2BW2 A;  4XWT A;  2AYO B;  4HJK A;  3H7P A;  1T6B X;  3PLV A;  4EZK A;  4N59 A;  1FRR A;  2MQJ A;  2BTE A;  1N5X A;  4MAC A;  2OHF A;  2GBK A;  2KDB A;  3GE3 C;  2UYZ B;  2L7R A;  2I38 A;  1JQ4 A;  3Q3M C;  2QSD A;  1WWT A;  2BPS A;  2V3P A;  2KWV B;  3NUH B;  3NVZ A;  2L32 A;  1NBF C;  5L83 A;  3Q8A A;  4AWJ A;  4IW0 A;  1VR9 A;  1XO3 A;  2B76 B;  4M02 A;  1EWY C;  2UU7 A;  2XNA C;  3IG3 A;  3Q69 A;  2AEH A;  2D2Q A;  4KKJ A;  3QIJ A;  1D5Z C;  3B9J A;  4RGO S;  4NQK E;  2WU2 B;  2XK5 B;  4GDL A;  4CO7 A;  1X1M A;  3KYC D;  4KKI A;  4ANW A;  4RCO A;  4AUQ C;  3R66 C;  4WWO A;  2MJE A;  4JPS A;  2KDF B;  4C56 C;  2D5G A;  1L6V A;  1QZE A;  4P1C C;  1V5O A;  2C5L C;  3MC0 B;  2KC2 A;  3L13 A;  3ZJV A;  4K7U A;  3NOB A;  4BKS D;  1I4X A;  3SD5 A;  2NTT A;  3HHM A;  2ZZP B;  3L0W B;  3Q8C A;  2QIE B;  2C9W B;  4FJV B;  1ROE A;  3ZLZ A;  4A3P A;  3V6E B;  3ZDM C;  1RFK A;  2BQQ A;  3T3N A;  2KLC A;  3DOW A;  1E7P B;  3KLS X;  2WLB A;  2Z59 B;  3GOE A;  3NRZ A;  1D3Z A;  3DBR I;  3AI5 A;  5IOI A;  4HXD A;  3JSV A;  1E8W A;  2ICI A;  4C4V B;  1IYF A;  1L0V B;  3ENE A;  2JSV X;  4W9L A;  2UWQ A;  3DQV A;  3W9C B;  3B0A A;  3I57 A;  4HPL B;  1V8C A;  1Z5S B;  1K50 A;  5HKH A;  2HTH A;  5G2N A;  3VAW A;  4HPP A;  4US8 A;  2RR9 A;  3SDL C;  5EE9 A;  4ZDV A;  3PHW B;  2WS3 B;  4GLS C;  2L3Z A;  2NPT B;  3I3T B;  4WIP A;  2J0M A;  5D7G A;  3N30 A;  5BYR A;  1R7S A;  1J7C A;  1K53 A;  2MJ3 A;  1V80 A;  2ZCB A;  2MJD A;  3AE8 B;  3ZVV A;  2WXL A;  4RGN A;  2K8H A;  2CKH B;  1QOA A;  4NAW A;  1ET9 A;  4KGT A;  2W82 A;  3H9D A;  2K8C A;  3IVF A;  2WHI A;  3L17 A;  2BYV E;  4MH8 A;  3SR6 A;  5LXH A;  4IWP A;  2FIF A;  1QT9 A;  2WYQ A;  4KIK A;  4FBJ B;  2L00 B;  2M1M A;  3GB1 A;  2O2V A;  2ASQ A;  1XLN A;  4II3 B;  2IGH A;  4WH4 A;  4E3C A;  1WE7 A;  2KAN A;  1YIW A;  5E6N A;  4ZRJ A;  1ESF A;  5C1Z A;  1J7B A;  2KJH B;  4EOY A;  4EFO A;  2PJH A;  1ZUD 2;  2MBH A;  4X57 B;  3M63 B;  1GG3 A;  1WYW B;  4ANV A;  3HM6 X;  2X38 A;  2AQ1 B;  5CTR C;  3DBH I;  3A9K B;  2LZ6 A;  1SGH A;  4KV2 A;  4HKZ E;  2RD0 A;  1FCL A;  2WXP A;  1I4P A;  4DK5 A;  1WJ6 A;  2RMM A;  5TSS A;  2KDM A;  3TEX A;  1MVK A;  2BB5 A;  3Q3F A;  3AN1 A;  2Y3A A;  3BVZ A;  3TJP A;  3V61 A;  4JLC A;  1AYF A;  1TZ1 A;  1WGK A;  3RUI B;  1FIQ A;  1ZE3 D;  4HVB A;  3URY A;  2JZP A;  3L54 A;  4R3D A;  1VD2 A;  1PQS A;  3AH7 A;  1IGD A;  1V1P A;  1HEZ E;  2EEL A;  4TMA B;  3ONS A;  1WJ4 A;  2JY6 A;  3ZJT A;  3AM9 A;  1LXD A;  5I4D A;  4PS3 A;  2KN4 A;  4KDI C;  2NCN A;  2MH7 A;  5FR6 A;  4MJS B;  4NJ7 A;  4MEM A;  3L16 A;  4BFR A;  2KKC A;  3U52 E;  4PYZ A;  3ZXV A;  1WZ3 A;  1IUE A;  1BXT A;  3GZN B;  4WJN A;  1WGH A;  2JF5 A;  3MFG A;  1JWS D;  3B2F A;  5FK9 C;  1WXV A;  2INP E;  2KZR A;  1L0Y B;  5CHW A;  2ACZ B;  2WWZ A;  2LWP A;  2NTS A;  3WAP A;  2BVC A;  2OED A;  3A9K A;  1C4C A;  3DBH B;  1JCK B;  2K39 A;  4L1B A;  4C4V A;  3EEC A;  2RGF A;  3SFD B;  3QJZ A;  3KUC B;  2PLP A;  3N1Z C;  2W54 A;  1RWS A;  1V49 A;  1E7U A;  4AP4 C;  1IP9 A;  1FXA A;  4JQW C;  2BYE A;  5EDS A;  3FKY A;  5AZG A;  1NEN B;  1TGZ B;  5L95 C;  1V86 A;  2DEN B;  1QOB A;  3Q8F A;  1VRA B;  2JWZ A;  1N63 A;  2V0G A;  2K1F A;  4KIK B;  4M8N A;  3RMK C;  3B08 A;  1WX8 A;  2K9X A;  2QIL A;  5BYS A;  2WXM A;  4L23 A;  1WFY A;  1TJE A;  4LNK A;  4WJO A;  1KRH A;  5BYQ A;  2FID A;  4NPN A;  1ENF A;  2JUO A;  3MC8 A;  2HDE A;  3KYD D;  4MSM B;  3VR8 B;  4ASW C;  3ZNZ B;  1WRI A;  1GC7 A;  1NYR A;  4DBG A;  1QOF A;  1MI0 A;  2LGD A;  2QEJ C;  1RFA A;  2D3G A;  1F9J A;  4FJY A;  4XGA B;  3FAH A;  2NPT A;  5IA7 A;  1NVI D;  3R3M A;  2MBB B;  3L08 A;  2NVU I;  1N5W A;  2I2Y A;  2X8X X;  2WXG A;  3AEB B;  3P2B A;  2LJI A;  1E7V A;  2GBM A;  2GMI C;  3RCZ A;  1UWX A;  1UZX B;  4N9F 4;  2LRW A;  2MP2 A;  2WDQ B;  3R2T A;  4DHJ B;  2BWF A;  3AE7 B;  2VZK D;  3H6N A;  2GBJ A;  2LHD A;  5D3I B;  2WXI A;  2RPQ A;  1WX9 A;  5JHB A;  4YSX B;  3RNG C;  3PO0 A;  3BK2 A;  1WIA A;  4AJW A;  1SF0 A;  1GUA B;  1D4B A;  2C7N B;  3UGB B;  4BZA A;  1F2R I;  3NVW A;  2QMT A;  4DDG D;  3Q2A C;  2KDE B;  2MSE D;  1SB3 C;  4B6W A;  1YJI A;  2CU1 A;  5JXV A;  2KD0 A;  3PS6 A;  5FKA C;  2PPH A;  5EE0 A;  4HRO A;  2NBU A;  1L6U A;  1TKG A;  2XN9 C;  3MTN B;  4YXD B;  3BVM A;  1CMX B;  3UQB A;  3H1U A;  3TUO A;  2CJN A;  2JXX A;  2BT6 A;  3DVG X;  3PHX B;  1SE3 A;  3IHP C;  2G4D B;  2KQS A;  1YD8 U;  2PVG C;  2WXN A;  1DYQ A;  4ZRP A;  1WZ0 A;  1CQV A;  1P9D U;  1PGA A;  4TKN A;  1P0R A;  2W9N A;  3QHT A;  1HA5 A;  4ZYN A;  1UGM A;  4N6E B;  3I63 C;  2LRU A;  3ZGZ A;  2QJL A;  1WR1 A;  2AWT A;  2ZJD A;  3NZS A;  1JW9 D;  1JRP A;  3C0R B;  1OGW A;  4RNA A;  2XK5 A;  3Q3N C;  2MP2 B;  2J42 A;  2H89 B;  2LUM A;  3U8Z A;  4LNI A;  4TQ1 A;  4DDI D;  2K6D B;  2W55 A;  2CS4 A;  2ZNV C;  3NHE B;  3Q6B A;  4AQ7 A;  1KLV A;  5GXG B;  3O65 B;  4NY0 A;  4LNF A;  2KTR B;  2JYE A;  4DXG A;  1IBX A;  3AEF B;  2H88 B;  5IAA C;  4ARC A;  1R4N I;  2N4F A;  1EU3 A;  2PE9 A;  3TMP B;  3KUD B;  2KFK B;  2V4L A;  1CJE A;  2MRP A;  1TYG B;  2J53 A;  3FIL B;  4KSK C;  1VJK A;  2EMS A;  2N9X A;  4IM2 A;  3UIP B;  3A1Q B;  4JGH B;  3H7P B;  4K7S A;  2W3S A;  4ZHO A;  1EF1 A;  3R7R A;  3QAR A;  3V6C B;  4F8C B;  1HTO A;  1TY0 A;  2KMA A;  4O1N A;  2L1A A;  3GZN I;  4P16 A;  2KFK A;  4TSS A;  4USA A;  3CMM B;  3AE9 B;  1OFF A;  1C79 A;  5LNK 1;  1XXG A;  2LMC A;  3HK0 A;  1V6E A;  1WXA A;  3MC9 A;  4UDU C;  3AB5 A;  2BWE S;  4XDD A;  2IPK D;  2E6X A;  3DVN V;  2INN E;  2CHZ A;  3LJ3 A;  2FAZ A;  1DGJ A;  3ZNH B;  2WU5 B;  4CHK A;  4GDK B;  3EFU A;  5J18 A;  1TIF A;  4BOS C;  4PT5 A;  2HD5 B;  4KZ0 A;  2KXJ A;  2KNB A;  3AMZ A;  2IGD A;  1MFW A;  4HDQ A;  1L0X B;  4WJQ A;  4J3O D;  3ZNI D;  2NR2 A;  5D94 A;  2J7Q B;  2AL3 A;  3AU4 A;  1VZ7 A;  4FUL A;  3TCA A;  4HDO A;  1WM2 A;  3PSE B;  2WXF A;  3U7Z A;  1I4G A;  3EA6 A;  1FNU A;  3MJ5 A;  3BII D;  1SE9 A;  2NMQ A;  2WQY B;  4PS7 A;  3ZXR A;  1B1Z A;  2PEA A;  5AUI A;  1EWC A;  4A3O A;  4G3X B;  3NG0 A;  2DYO A;  2WXK A;  4TUU A;  3BYT B;  3V05 A;  4DHZ E;  2V3S A;  2CJO A;  3ZNG C;  1J8C A;  2G3Q B;  3ZYY X;  4W9G A;  2IO0 B;  1V5T A;  4HWI B;  3GS2 A;  1J7A A;  3CIR B;  1EO6 A;  4IM3 A;  5G5G A;  4E71 A;  1OEY A;  4MEL A;  3E56 A;  4WWP A;  4GN1 A;  2V1Y A;  4XE0 A;  4K1R B;  1XD3 B;  3RNF C;  4W9I A;  3PZ7 A;  4URK A;  4OHJ A;  3TEZ A;  4W9H A;  2QCZ A;  2JRH A;  2D3A A;  2KJ6 A;  1P1A A;  1ACC A;  2K6Q A;  2ONQ A;  1V2Y A;  5C2T B;  3W5V B;  2DNF A;  3ZUN A;  1S3S G;  2IO1 B;  4FHK A;  2LGX A;  4ZOH C;  1GB1 A;  2KYW A;  5E6P A;  1C4A A;  1SJH D;  3CF6 E;  5KHO A;  3V60 A;  3DHG C;  4ICU A;  4W9J A;  1T0Y A;  3R2I A;  1LQB A;  3PT2 B;  5J2R A;  2AQ2 B;  3Q3J A;  2WDV B;  3KVF B;  5G5H A;  4TQ0 A;  2LI5 A;  3ML8 A;  4E74 A;  2LVQ A;  1E90 A;  4I6N B;  3OG5 A;  4K7W A;  1PGB A;  1WH3 A;  4NNJ B;  3N1Y C;  3NY5 A;  4OVU A;  3RNA C;  2IGG A;  2DWQ A;  2JT4 B;  3IFW B;  3N32 A;  2FUH B;  4ACF A;  1VDV A;  3H7S A;  4YSZ B;  3DHI C;  3C19 A;  5JH5 C;  2L83 A;  3IAS 1;  2B3A A;  2DBY A;  4WAF A;  3BIN A;  3VDZ A;  3WA0 A;  1V81 A;  1TTN A;  4XDC A;  4OZA A;  4JWS C;  2LXA A;  1VCB A;  1NI2 A;  2YEP B;  5E6O A;  1L4Z B;  2VH1 A;  2RSU A;  4I6P A;  2AX5 A;  1K52 A;  1YJJ A;  2RDH A;  4A9A A;  2LHE A;  4H2A A;  3JYU A;  4LDT D;  4HPM B;  4B9K A;  2IO2 B;  1T0Q C;  3DBL I;  2WXR A;  1FXT B;  1EM7 A;  3T8M A;  5CHF A;  5E6J A;  1R4N B;  1T0R C;  2J4X A;  2L52 A;  1TS3 A;  2WX1 A;  2BYF A;  3PRZ A;  4K3C A;  1WMH A;  1E6E B;  4RFB A;  2KLG A;  2IND C;  3ETR A;  3UIN B;  3W5U B;  3KWV A;  1FPY A;  2I1K A;  1WM3 A;  2MX2 A;  3FC4 A;  1E5W A;  3VUY A;  1SE2 A;  2OOB B;  1ZDX A;  5AUK A;  3AEG B;  4N58 A;  4YT0 B;  2BS3 B;  4LLG M;  2HTM E;  5C23 A;  1SIF A;  2LJ5 A;  3IT6 B;  3PRM B;  4IDI A;  4W9F A;  4B95 A;  5TR5 A;  4JIO U;  4J6I A;  4FLH A;  5BMI A;  2KK8 A;  3IT4 B;  4DQO C;  1QQR A;  1WX7 A;  2K5P A;  3JSV B;  2QDF A;  2WDT B;  2K8B A;  4FN2 A;  4G11 A;  2N9K A;  1H4R A;  1SE4 A;  2V3N A;  2NS5 A;  4HK2 A;  1KOT A;  5BMG A;  3ZDT A;  5AZH A;  1ZPS A;  3VTU A;  3P4R B;  3A33 B;  2QC8 A;  2PKO A;  1WE6 A;  3B1L X;  1V1P B;  2KAC A;  5CX3 A;  4B0M A;  3RPF C;  1V97 A;  1YN5 A;  2KHW B;  4M01 A;  1MJD A;  1OQR A;  2N0S B;  4YTP B;  5DPW A;  3EUB 2;  1JWB D;  1ZOY B;  2GI9 A;  4RM8 A;  2IY0 B;  2MWS B;  4MH0 E;  2ZW1 A;  1ZW7 A;  3M95 A;  2C7M B;  2ZNV B;  1QKZ A;  3CSF A;  1B9R A;  4XWW A;  5JZE B;  1RAX A;  1SXT A;  4ZRK A;  4A55 A;  4JL9 A;  4RMA A;  3NVY A;  2KN5 A;  1JRO A;  2TSS A;  3ABV B;  2KJR A;  4II2 B;  3HRD D;  4MDK E;  2MBO A;  1P98 A;  1FRD A;  4GIV A;  3W1S A;  2J0K A;  3TSS A;  1UH6 A;  3QX1 A;  4XZ4 A;  3U7D A;  1P7E A;  2LD9 A;  2V9H A;  4ZHP A;  5DPS A;  2RPV A;  5KHQ A;  2IYD B;  3EGR A;  1CK1 A;  2L0F A;  3TL5 A;  2VRR B;  1M94 A;  2PTL A;  3AXC A;  4DXF A;  4REZ A;  4M8M A;  4AOF A;  3VH3 B;  5HI1 A;  2HE7 A;  4HJG E;  1WXS A;  4JWU C;  2VH2 A;  1IPG A;  1A5R A;  2L05 A;  3EFC A;  1KJT A;  2VZK B;  3JW0 X;  2K0P A;  3PV1 A;  2Y5P A;  2ZCC A;  2WNM A;  1WJN A;  5IO9 A;  5EE3 A;  2J0J A;  2IY1 B;  3M62 B;  3FIL A;  1NDD A;  2BB6 A;  1Q0W B;  1D5X C;  2MHJ A;  4KZC A;  4DWF A;  4HCP B;  5AEK B;  3AE5 B;  3NZU A;  1OQY A;  3D32 A;  2KFJ A;  2M8S A;  3WAO A;  2KVZ A;  3ZW3 A;  3DBR B;  2LGI A;  3ZIM A;  2NBW B;  4K81 A;  1E8Y A;  3L4P A;  2IBI B;  2PW9 A;  2Y5B B;  4MGZ E;  1WXQ A;  3ML9 A;  3X23 A;  4C80 A;  3AE6 B;  1Y8R C;  5LLI A;  2M56 B;  2JZZ A;  4NAM A;  2L8J A;  1JAL A;  1SIJ A;  2GB1 A;  1U4A A;  2FNJ B;  1STE A;  3J9C A;  4WWM A;  4S0R A;  5HFY A;  1UF0 A;  2K3U A;  2W3R A;  2M0X A;  3AED B;  2JXT A;  3ZTD A;  1SJE D;  1T5X D;  1A70 A;  4EZJ A;  2BS4 B;  3NZ3 A;  4IWQ A;  4D2K A;  2WGS A;  4RGT A;  3DVG Y;  4IWO A;  1VLB A;  2R2O A;  3NS1 A;  3EC8 A;  3SHQ A;  2M0A A;  2R61 A;  1YQ3 B;  3RFZ B;  1M4V A;  3X0W A;  5IN7 A;  3U2S C;  4G0N B;  1L2N A;  1OQQ A;  3QA8 A;  3P4P B;  5BMH A;  1WY8 A;  4IKG A;  2DZJ A;  4BVU C;  1WJU A;  4FHJ A;  3UI3 A;  1RM6 C;  4Q2J A;  3T3O A;  2MW5 A;  1Q5W B;  2XBB C;  1KF6 B;  2L76 A;  1VZ8 A;  2XEW A;  3RNE C;  3OLM D;  4C7Y A;  1QLB B;  4ARI A;  1YOV B;  2KMM A;  3OJ4 B;  2AQ3 B;  5DPR A;  3Q8E A;  2K22 A;  1FEH A;  2PIA A;  5H92 C;  3VVW B;  1WYG A;  3HUI A;  4M00 A;  1KLU D;  2O6V D;  1KTK A;  2WXJ A;  4LCD E;  4DHJ D;  4P7I A;  1IBX B;  2JPH A;  1WGY A;  4ICV A;  1DOX A;  3RNB C;  4GDL B;  3H8H A;  2ZVO A;  1GOZ A;  2LEK A;  1T3Q A;  2MCN B;  1TBE A;  5GMV A;  4HCN B;  1AN8 A;  2KWU B;  2WXH A;  2CR5 A;  4NZL B;  4A20 A;  3L10 B;  3HIZ A;  2FBW B;  4JX1 C;  1UUP A;  3RN9 C;  2L0T A;  1MPE A;  1BUI C;  3KUZ A;  2GOW A;  1Y56 A;  4TV3 A;  1FO4 A;  2KWD A;  3QC8 B;  4PK1 A;  3TEY A;  1L4D B;  1ZKH A;  2MA9 B;  1TY2 A;  2RDG A;  3VUW A;  1D6E C;  1N61 A;  3R7Q A;  4WWN A;  3N3K B;  4M0W A;  1L5P A;  2JYT A;  4HRS A;  4M0W B;  1J0G A;  4WJP A;  1TS5 A;  1HXY D;  1YJ1 A;  3KW5 B;  4IM0 A;  4NJC A;  3AU5 A;  4GMV A;  3HVZ A;  3AEC B;  4MSQ B;  2KAJ A;  1GB4 A;  1WRD B;  1I4H A;  3ZRC A;  1F77 A;  1N60 A;  2K25 A;  2LVP A;  2IDY A;  1FFU A;  3WAL A;  1EF5 A;  4KVG B;  2N7J A;  4YTM B;  3ZO5 B;  1UEL A;  2KVR A;  3RNC C;  3VUX A;  2N9L A;  2J52 A;  1E10 A;  1XLO A;  3N9Y C;  4YWG G;  3A9J A;  2R2Q A;  1WF9 A;  4F7Z A;  3MHZ A;  1QOG A;  3PGE A;  2BS2 B;  2KMC A;  2IZV B;  2V4I B;  3HM3 A;  5G55 A;  3Q3O C;  5CHV C;  3PRE A;  2Z0E B;  2KT7 A;  1Q1O A;  2G9H D;  2G1E A;  3GE8 C;  2JQR B;  3PRP B;  4I6L B;  1NEK B;  3K9O B;  1KFY B;  3R8B A;  1BML C;  4NQL B;  2M19 A;  3RZW C;  4KSL C;  4OZC A;  1LM8 B;  4KX6 B;  1F2R C;  1PUT A;  1SSN A;  2HJ8 A;  1E0Z A;  2JWU A;  4WAA A;  1C1Y B;  4W9E A; 
#chains in the Genus database with same CATH homology
 4OVZ A;  1KRH A;  3BWU D;  5BYQ A;  1N62 A;  4JE3 B;  3C8Y A;  3MP9 A;  1ENF A;  1SEB D;  1WSP A;  1DOY A;  3IT6 B;  4IDI A;  2HDE A;  3AV8 A;  3P42 A;  3VR8 B;  1WRI A;  1PDX A;  3BZD B;  4YSY B;  1NYR A;  4ITK A;  5BMI A;  1TS2 A;  1QOF A;  1MI0 A;  2QEJ C;  4C7Z A;  1AW7 A;  3IT4 B;  4DQO C;  1ZP0 B;  2LFI A;  1QQR A;  3OWE B;  1EU4 A;  1ZXI A;  2K5P A;  1YN4 A;  1FD6 A;  2CU3 A;  3GP7 A;  3FAH A;  2N9K A;  3SEB A;  1SE4 A;  1NVI D;  2V3N A;  1GAQ B;  3ZJU A;  2BW2 A;  4XWT A;  1VZ6 A;  1N5W A;  4LLG M;  1ET6 A;  5BMG A;  1ZPS A;  2FUG 1;  4MM3 B;  1F0Z A;  3P4R B;  1T6B X;  2I2Y A;  1KLG D;  1HZ6 A;  2WXG A;  3AEB B;  3VRB B;  3AE3 B;  4N59 A;  1FRR A;  2LJI A;  2PKO A;  2BTE A;  1CZP A;  5EE1 A;  1FMA D;  1HZ5 A;  1N5X A;  1UWX A;  2OHF A;  4MAC A;  2DYM A;  3ZQ4 A;  1V1P B;  2WDQ B;  2KAC A;  3NVV A;  3R2T A;  2I38 A;  3AE7 B;  2VZK D;  2LHD A;  1GPX A;  4B0M A;  5D3I B;  1JQ4 A;  2QSD A;  2WXI A;  3RPF C;  1WWT A;  1V97 A;  1YN5 A;  3LYY A;  2V3P A;  4YSX B;  1OQR A;  2N0S B;  3BK1 A;  3NUH B;  3NVZ A;  4YTP B;  3PO0 A;  2EKI A;  1MHX A;  3EUB 2;  5MPO A;  2L32 A;  3BK2 A;  1SF0 A;  1D4B A;  1JWB D;  1ZOY B;  3Q8A A;  1F2R I;  2GI9 A;  3NVW A;  1VR9 A;  2QMT A;  3KWL A;  1XO3 A;  2B76 B;  1EWY C;  2ZW1 A;  1SB3 C;  2XNA C;  3Q69 A;  1YJI A;  3CWI A;  5JXV A;  1QKZ A;  5FKA C;  1JWM D;  1B9R A;  1XLP A;  4KKJ A;  4XWW A;  5EE0 A;  1D5Z C;  1SXT A;  3B9J A;  4RGO S;  4HRO A;  2WU2 B;  4OW0 A;  1L6U A;  4A55 A;  3NVY A;  1TKG A;  2XN9 C;  4YXD B;  3BVM A;  1JRO A;  3TUO A;  2CJN A;  2BT6 A;  4KKI A;  2TSS A;  3ABV B;  4RCO A;  3HRD D;  1SE3 A;  2Q5W D;  3HVD A;  2MJE A;  1P7F A;  1DOI A;  4JPS A;  1FRD A;  4C56 C;  2D5G A;  3AE1 B;  4MT5 A;  4NAW B;  3W1S A;  2PVG C;  2JU6 X;  1L6V A;  2WXN A;  4P6V F;  3TSS A;  1DYQ A;  1XCT L;  4ZRP A;  3P1M A;  3MC0 B;  1C9F A;  2DLB A;  1CQV A;  3ZJV A;  1PGA A;  3KQ4 A;  1P7E A;  4B0E A;  1HA5 A;  4WUR A;  1PGX A;  4ZHP A;  4N6E B;  1YQ4 B;  2RPV A;  1I4X A;  3EGR A;  1IGC A;  1CK1 A;  2NTT A;  4RH6 A;  3ZGZ A;  2QJL A;  1UGJ A;  1FXI A;  3Q8C A;  2QIE B;  1ROE A;  2PTL A;  4DXF A;  4REZ A;  1JW9 D;  3VRA B;  1JRP A;  3U4E G;  1LO5 D;  4RNA A;  1C76 A;  3PZ8 A;  2J42 A;  1I4R A;  1RFK A;  2H89 B;  2LUM A;  1AWD A;  5HI1 A;  4HJG E;  4RF0 A;  4JWU C;  2ON8 A;  4TQ1 A;  3T3N A;  2W55 A;  1TS4 A;  4HKQ A;  1E7P B;  2VZK B;  2K0P A;  3KLS X;  2Y5P A;  2WLB A;  4AQ7 A;  3NRZ A;  5T8I A;  2WNM A;  3SFE B;  5EE3 A;  5GXG B;  2JYE A;  4DXG A;  1IBX A;  3FIL A;  2Z8L A;  1JWA D;  3AEF B;  2H88 B;  2ICI A;  2BB6 A;  4ARC A;  1D5X C;  1EU3 A;  1C78 A;  1L0V B;  3AE5 B;  2BYT A;  2JSV X;  3W9C B;  3I57 A;  4OZB A;  1JWU D;  1CJE A;  1TYG B;  2J53 A;  1V8C A;  1K50 A;  3FIL B;  2LGI A;  1QF6 A;  1VJK A;  1NI3 A;  1D5M C;  3L4P A;  3BVG A;  2PW9 A;  2ZW0 A;  4US8 A;  1WXQ A;  1FNV A;  4C80 A;  3AE6 B;  5EE9 A;  2M56 B;  3AEE B;  4NAM A;  1FFV A;  2W3S A;  2WS3 B;  4KGS A;  4GLS C;  4ZHO A;  3B2G A;  3DWG C;  1JAL A;  1SIJ A;  2GB1 A;  2JX5 A;  4WIP A;  5D7G A;  1K51 A;  1STE A;  1YMH E;  3J9C A;  4WWM A;  5BYR A;  1R7S A;  5HFY A;  1J7C A;  1K53 A;  1TY0 A;  2K3U A;  4O1N A;  2W3R A;  2L1A A;  2MJ3 A;  4P16 A;  5C3J B;  4TSS A;  4USA A;  3AED B;  2JXT A;  1JML A;  2MEK A;  4L2Y A;  1SJE D;  1A70 A;  1T5X D;  1I4Q A;  2BS4 B;  3AE9 B;  3NZ3 A;  3P4Q B;  1OFF A;  1C79 A;  5LNK 1;  1XXG A;  4D2K A;  2MJD A;  2LMC A;  4UDU C;  3AB5 A;  4RGT A;  5HHD G;  3AE8 B;  1VLB A;  3P63 A;  3W2D A;  3NS1 A;  4XDD A;  2IPK D;  2E6X A;  2M0A A;  1YQ3 B;  2R61 A;  2WXL A;  2INN E;  3IAM 1;  1M4V A;  4RGN A;  5D3D A;  3RFZ B;  1DGJ A;  3TEW A;  1QOA A;  3U2S C;  1ET9 A;  2WU5 B;  4KGT A;  1OQQ A;  2W82 A;  4KGR A;  4GDK B;  3P4P B;  5BMH A;  1Q10 A;  4PT5 A;  4IKG A;  2KQ4 X;  3SR6 A;  3AMZ A;  4IOI E;  4MH8 A;  2IGD A;  2PVO D;  1TKE A;  3UI3 A;  1RM6 C;  4Q2J A;  3T3O A;  2E3T A;  1QT9 A;  1KF6 B;  1L0X B;  4J3O D;  1XF5 L;  3GB1 A;  3WCQ A;  1VZ8 A;  2WP9 B;  1VZ7 A;  3VR9 B;  4C7Y A;  1QLB B;  4ARI A;  1XLN A;  2WXF A;  3BYY B;  3U7Z A;  2KMM A;  2AQ3 B;  1I4G A;  2WXQ A;  3EA6 A;  1FNU A;  2IGH A;  4WH4 A;  3MJ5 A;  3BII D;  3Q8E A;  5H8Y E;  4FXC A;  2K22 A;  4US9 A;  1MHH E;  2NMQ A;  2WQY B;  1ESF A;  1FEH A;  2PIA A;  1J7B A;  1B1Z A;  5H92 C;  1WYG A;  1XEE A;  2WXO A;  1ZUD 2;  5AUI A;  1EWC A;  3HUI A;  1KLU D;  2DYO A;  2WXK A;  2X38 A;  3BYT B;  3AE4 B;  3V05 A;  1KH0 A;  2AQ1 B;  1KTK A;  2CJO A;  2WXJ A;  4LTU A;  4HKZ E;  1IBX B;  3ZYY X;  1FCL A;  2PMV A;  4YTN B;  2WXP A;  1DOX A;  1I4P A;  4GDL B;  3H8H A;  1GOZ A;  3GS2 A;  1J7A A;  2LEK A;  3CIR B;  2RMM A;  5G5G A;  5TSS A;  1T3Q A;  2KDM A;  2SEB D;  1AN8 A;  3E56 A;  1FNW A;  3TEX A;  1MVK A;  2WXH A;  2BB5 A;  4NZL B;  4A6Q A;  2FBW B;  4JX1 C;  3AN1 A;  1UUP A;  2Y3A A;  3BVZ A;  4XE0 A;  1RYJ A;  1MPE A;  3LXF A;  1AYF A;  1BUI C;  1NYQ A;  1WGK A;  1Y56 A;  1FO4 A;  2KWD A;  3PZ7 A;  2FE8 A;  4OHJ A;  1L4D B;  1XLQ A;  3TEY A;  3TEZ A;  1FIQ A;  1ZE3 D;  4EE2 A;  1TY2 A;  2YEP F;  2RDG A;  3URY A;  2JZP A;  1D6E C;  1N61 A;  1ACC A;  2ONQ A;  1UWM A;  3DWM A;  3O13 A;  4R3D A;  5C2T B;  3Q8B A;  3W5V B;  3AH7 A;  4M0W A;  2IJ0 A;  4A90 A;  1IGD A;  1V1P A;  1HEZ E;  1L5P A;  2EEL A;  1UNS A;  2JYT A;  2Y5C A;  4TMA B;  4ZOH C;  1GB1 A;  4HRS A;  1C4A A;  2GRI A;  1SJH D;  1TS5 A;  1HXY D;  1TZO A;  4NJC A;  3R2I A;  3HVZ A;  2AQ2 B;  3AEC B;  4LK0 M;  3ZJT A;  3AM9 A;  2WDR B;  2WDV B;  5I4D A;  2KAJ A;  1GB4 A;  5G5H A;  4TQ0 A;  2KN4 A;  1I4H A;  5HG2 A;  2MH7 A;  3LB8 C;  1F77 A;  2SAK A;  1N60 A;  4AS1 A;  3U52 E;  1SBB B;  2BBC A;  1PGB A;  1PYW D;  1ZXH A;  2IDY A;  1IUE A;  1BXT A;  1FFU A;  2IGG A;  1C4P A;  2DWQ A;  3I9V 1;  3MFG A;  1JWS D;  3B2F A;  5FK9 C;  1VDV A;  2N7J A;  4YSZ B;  4YTM B;  2INP E;  1L0Y B;  2L83 A;  3IAS 1;  1ZDV A;  1XCQ L;  1YNT E;  2DBY A;  4WAF A;  1C77 A;  2ACZ B;  1QIL A;  4XDC A;  2N9L A;  4OZA A;  4ZYS A;  4JWS C;  2J52 A;  2NTS A;  4RF1 A;  5FR3 A;  2YEP B;  2OED A;  1E10 A;  1L4Z B;  1C4C A;  1JCK B;  2AX5 A;  1XLO A;  1K52 A;  3N9Y C;  1YJJ A;  3E9S A;  4YWG G;  2RDH A;  4A9A A;  4L1B A;  2LHE A;  4ZRQ A;  4H2A A;  1V1O A;  3MHZ A;  3SFD B;  3V3X A;  2PLP A;  1QOG A;  3IXS A;  1FM0 D;  2BS2 B;  4HEA 1;  2WXR A;  2W54 A;  1RWS A;  2V4I B;  1HQR D;  1EM7 A;  5E6J A;  3VQI A;  1FXA A;  4WQM A;  2J4X A;  2L52 A;  1TS3 A;  4N58 A;  2G9H D;  2G1E A;  1NEN B;  1QOB A;  1E6E B;  3P4S B;  3Q8F A;  1VRA B;  2BS3 B;  1N63 A;  2JQR B;  4RFB A;  3AEA B;  2V0G A;  1FCC C;  3ETR A;  1TKY A;  1NEK B;  1KFY B;  3R8B A;  3W5U B;  3KWV A;  1BML C;  1E9M A;  2M19 A;  3FC4 A;  4OZC A;  4RGM A;  1SE2 A;  2K9X A;  4KX6 B;  1I7H A;  1YN3 A;  4A8X C;  1F2R C;  1PUT A;  1SSN A;  2QIL A;  5BYS A;  3AE2 B;  2WXM A;  1ZDX A;  4L23 A;  5AUK A;  2JWU A;  3AEG B;  4CQN A;  1E0Z A;  4YT0 B;  1PFD A;  2HTM E;  1TJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...