4LTUA

Crystal structure of ferredoxin from rhodopseudomonas palustris haa2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
106
structure length
106
Chain Sequence
b'PSITFIHPDGRSEIVDAAIGDSAMFAALNHGIDSIVAECGGNAVCATCHVYVDDLWLAKLPPVDANEDDLLDGTASDRLPNSRLSCQIKIAPELDGLVLRIPERQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Crystal Structure of Ferredoxin from Rhodopseudomonas palustris HaA2
rcsb
source organism Rhodopseudomonas palustris
molecule tags Electron transport
total genus 25
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ltuA00
1UWMA 1N62A 1TKGA 2OHFA 3AEDB 2Q5WD 3LXFA 4N58A 1CJEA 2W3SA 5H92C 2QIEB 1R7SA 3AE4B 3AE5B 2WS3B 1L6VA 3BIID 5MPOA 1JALA 1YJIA 4YSYB 3W5UB 2WLBA 3P4RB 3RPFC 4ZHOA 1ZXIA 1VDVA 3PO0A 3VRBB 3L4PA 1N60A 3AE3B 1ZOYB 3AEAB 5C2TB 1DGJA 4YT0B 4HROA 2BS3B 5GXGB 1NYQA 4A9AA 3VR9B 2DBYA 1JQ4A 1KF6B 3AE1B 2N0SB 1ZUD2 3AE2B 1OQQA 2JX5A 3W5VB 3P1MA 1YQ4B 4JX1C 2PIAA 1RWSA 2MJ3A 4US9A 1FMAD 2MH7A 3HUIA 2PVGC 2M19A 1TYGB 1QOBA 2FBWB 1V97A 1SIJA 1WWTA 1XLOA 1VJKA 4JWUC 5EE3A 2G1EA 3AM9A 1F0ZA 1JROA 1J7BA 1NI3A 1NVID 3AE8B 3ETRA 2DWQA 1JWBD 4US8A 1PDXA 1N61A 2CJNA 1T3QA 2W54A 3WCQA 1NENB 3B2FA 1WXQA 5EE1A 4C7YA 4YTNB 4LTUA 1AYFA 2WDVB 3DWMA 1SF0A 2M56B 1QOAA 1ZP0B 2H89B 3HVZA 3SFEB 1FIQA 1DOIA 4YSZB 1QLBB 3VRAB 1QF6A 1TJEA 2L52A 3NVVA 1FXAA 3AE9B 3AV8A 4ZHPA 1N5WA 3B9JA 1XO3A 1EWYC 1CZPA 2WDQB 3P4SB 1E6EB 5G5HA 3AN1A 1J7CA 1FO4A 1KFYB 1L5PA 1YJJA 2WDRB 1XLQA 1J7AA 3AEBB 1DOXA 2BS4B 4YTPB 1OFFA 2JQRB 3NVWA 4USAA 3W9CB 3SFDB 1FM0D 4JWSC 4N6EB 1JW9D 3P4PB 1FXIA 1WRIA 1A70A 1YQ3B 3EUB2 2WQYB 2CJOA 2WP9B 2LEKA 3LB8C 1WGKA 1RFKA 2K5PA 1I7HA 4KX6B 2L83A 3B2GA 1RM6C 2Y5CA 1SB3C 2K22A 1FRRA 3ABVB 1PUTA 4P6VF 2W3RA 3AEEB 3AEGB 1IUEA 3FC4A 5H8YE 4WQMA 4HRSA 1VLBA 3AB5A 1DOYA 5G5GA 2MJDA 3VR8B 3NVYA 1XLPA 3DWGC 3FAHA 1L0VB 2EKIA 2CU3A 4C7ZA 2KAJA 2HTME 2WU5B 3ZYYX 1E7PB 1NYRA 2K9XA 3KWLA 1V8CA 2H88B 3AMZA 4ZOHC 5AUKA 4C80A 4YSXB 1GPXA 4YTMB 3AE7B 3SR6A 1ROEA 3NRZA 3NS1A 3AE6B 1OQRA 3P4QB 4IDIA 1FRDA 4N59A 1E0ZA 1KRHA 3HRDD 1NEKB 3P63A 2BT6A 2WU2B 1QOFA 2AX5A 1GAQB 2MJEA 3AH7A 3NVZA 1JWAD 2KMMA 1B9RA 5EE0A 2PKOA 2W55A 4WWMA 1AWDA 5EE9A 1E9MA 1FFUA 4FXCA 3CIRB 3AECB 5C3JB 1RYJA 2PVOD 1E10A 1QOGA 4ITKA 4YXDB 2ACZB 1JRPA 2E3TA 3AEFB 1TKEA 1TKYA 1L6UA 1N63A 2B76B 2QJLA 1WYGA 3CWIA 1QT9A 1PFDA 1N5XA 2BS2B 1FFVA 5AUIA 1XLNA
chains in the Genus database with same CATH superfamily
4IM2A 4LCDE 1CJEA 2FIDA 1UELA 4RMAA 4ARCA 3ZUNA 4JIOU 5GXGB 2IO2B 1OQQA 3QK0A 1UD7A 2PIAA 1ZKHA 2N1VA 4ANUA 2DZMA 2M19A 2J0KA 4DQOC 2G1EA 2BVCA 1HZ5A 2G9HD 1LFDA 3H7PB 1EF1A 1SSNA 2CU1A 4C7YA 3PS6A 2JZ3B 2VRRB 3KVFB 5LXHA 2WDVB 2M56B 2H89B 4F8CB 3EFUA 1ET9A 2L52A 1IBXB 4MELA 3B9JA 5G5HA 4HKQA 2K1FA 2VZKD 1VD2A 1M4VA 4GDLB 1CQVA 1E8WA 1YQ3B 4URKA 4MGIE 4LLGM 2Y5PA 1XT9B 4ACFA 4KX6B 3I63C 2K22A 4P6VF 3ALBA 3AEGB 1TIFA 3N20C 4EZKA 1XLPA 1KOTA 4LNFA 3SHQA 4AP4C 2BKFA 1F1HA 1E7PB 2KN5A 4DBGA 2XK5B 4WWOA 1WGDA 3KW5B 3NJTA 5JHBA 2CHWA 4MGYE 2DZIA 1JWAD 2LJIA 2QCZA 4OVZA 2DLBA 3BVGA 2E3TA 3I57A 3RMKC 3A4SC 2PLPA 2KQ4X 3VFKA 3UF8A 3M62B 4IM3A 3APFA 4L2YA 2V3SA 1V5OA 2JWZA 3AE4B 2KNBA 1VZ8A 2L32A 3RPFC 1VDVA 5FKAC 5C2TB 5BYQA 2BPSA 3P2BA 1RLFA 2L05A 2MBBB 1WX8A 2D3BA 3W5VB 1XQQA 4G3XB 2ZVNA 3A1QA 2PVGC 3LJ3A 1NI3A 1TY2A 3RD2A 1N61A 2WDTB 4FJZA 1C9FA 3MFGA 2DX5B 2WXOA 2KKCA 4W9JA 3WAMA 1FIQA 3Q3JA 1V5TA 4II2B 2FUG1 2M1MA 2DZKA 2YLMA 1BT0A 2JPHA 1DOXA 2KMAA 5D2MB 3R2TA 3WIMA 1YN4A 1X1MA 2LEKA 3ZTCA 2KMCA 1I7HA 3C8YA 2MP2B 2A5UA 3U30A 1AN8A 2ZCCA 4GMVA 1SBBB 2L3ZA 2PEAA 1LM8B 4WQMA 4QAYA 3VR8B 4W9CA 2WU5B 3B1LX 2JZPA 3HK0A 1FRDA 2NTTA 5EE0A 2N7EA 3WANA 2WXIA 1EU4A 3BVZA 2LVQA 4AOFA 2MRPA 2PVOD 4W9GA 1WYGA 2BBCA 5AUIA 3Q8FA 2JSVX 2JRHA 4BAXA 2RDHA 4HXDA 2QEJC 3R66C 3RI7C 2RDBC 2LRWA 3AEAB 4XWWA 3VR9B 3BINA 2GI9A 1V49A 5HFYA 2KX0A 4MSMB 2JWUA 3DVNU 4W9IA 2WGSA 4W9FA 3N3KB 5D7GA 3NZ3A 1R4NI 1J7BA 3TEZA 1T6BX 1JWBD 2KDMA 2MHJA 4MH8A 1WIAA 4YTNB 1I4RA 2AEHA 3DWMA 2IO1B 2KT7A 4NJ7A 3ZW3A 1ZP0B 1D3ZA 1TJEA 1FXAA 4G11A 4ZHPA 2C9WB 4WJNA 4NPNA 1SE9A 1TS5A 2O2VA 2N9XA 2MBOA 1YJJA 2IJ0A 2AL3A 2DAJA 4XDCA 3R7QA 4M8MA 4JWSC 4RM9A 3OLMD 1Y56A 4ZRPA 1S1QB 2LHDA 3APDA 3X23A 1Q1OA 1FRRA 2W3RA 2O6VB 3KYDD 1YIWA 1WJ4A 1JWUD 1GOZA 2SAKA 4RGMA 1WF9A 2V0GA 5TSSA 2KAJA 4M8NA 1F2RC 1SJHD 2IZVB 4KSKC 2CHZA 2QDFA 3NRZA 3NS1A 1OQRA 1U4AA 1NEKB 3VTVA 2QMTA 4HPPA 2W55A 5E6OA 3UIPB 2KOXA 4A20A 3QHTA 3DCGA 1JRPA 2JYTA 4I6LB 5D6JB 3GS2A 1S3SG 2OHFA 4M02A 2N1WA 4KIKB 4ZRKA 1YJIA 2BYTA 3W1SC 1FNWA 4ZHOA 1T0YA 2QILA 3KLSX 1SEBD 3WA0A 5D94A 3L4PA 2M4NA 2BQQA 2W9NA 3AULA 1TZ1A 1Q5WB 1C3TA 1YMHE 4NQKE 3ML9A 3Q2AC 4DK5A 4BOSC 1Z5SB 2K39A 3TUOA 3ETRA 1VZ7A 3EHVA 1XCTL 3VTUA 3PHWB 3WCQA 1XF5L 3U7DA 5EE1A 3QA8A 4LDTB 3S2AA 4HEA1 4KKIA 1P9DU 1SE4A 1TGZB 3L08A 4GDLA 1MHHE 4FULA 5T8IA 3QAQA 1QF6A 4E3CA 1QLBB 1Z2MA 1YNTE 2LGIA 1SGHA 3AV8A 3L54A 3NOBA 3P4SB 5FK9C 1FO4A 2K6QA 2N7DA 2L0TA 1VR9A 1XLQA 4YTPB 1WE6A 1FCLA 4NZLB 4MJSB 3ECIA 4B0EA 1K8RB 2KDIA 1V2YA 1FXIA 1OQYA 2WQYB 2K5PA 4W9HA 1D4BA 4KKJA 3IVFA 3A33B 4RGNA 3FAHA 4CO7A 2FAZA 2EKIA 1M94A 2GBNA 2E6XA 2MEKA 3FILB 3KWLA 3CF6E 3BZDB 4N59A 2GBJA 2JF5A 4TUUA 4WJPA 4IWPA 1LXDA 1TKEA 3RCZA 1IGCA 4AJWA 3PGEA 3TMPB 3ZQ4A 1WE7A 4JE3B 4RNAA 5HI1A 1R7SA 2NBWB 3BIID 2WXLA 2WNMA 1EF5A 1N60A 1ZOYB 4A9AA 2JX5A 2MJ3A 1WX7A 1WMHB 1FEHA 2G4DB 2G4SA 2MWSB 1L0YB 2D11A 2LVPA 3VQIA 2RGFA 3DHGC 4HLEA 1F77A 3Q6BA 1PDXA 1MVKA 3NZSA 3IG3A 1NENB 1TZOA 3V61A 1OEYJ 1PGXA 1C76A 1ET6A 3AXCA 4DXGA 2MP2A 1R4MI 2ZEQA 2J52A 1MG8A 1YQBA 2W82A 2GBKA 3AN1A 4W9LA 3PSEB 1QKZA 2KWCA 2ZVOA 5HKHA 1OFFA 4USAA 4HPLB 3ZNID 3PLVA 3BK1A 2PW9A 4UDUC 2Y3AA 2CJOA 4RF1A 3N9YC 2NCNA 1WGRA 4LNKA 4EKUA 3GB1A 2DYOA 3A9KB 5AUKA 4C80A 2N7JA 3AE6B 2O6VD 1JWSD 2AX5A 3NVZA 2V9HA 3DQVA 5EE9A 3MC9A 2EKEC 4FXCA 2BTEA 3AECB 5G2NA 2NTSA 5LLIA 1ISNA 1P7FA 3P42A 2REXA 1TKYA 5BMHA 1YX6B 5G55A 1SIFA 4ANWA 1PFDA 2QSDA 1WFYA 3L16A 1XLNA 3LXFA 3M3JA 4K7UA 2Z0EB 2K25A 3AE5B 2LGSA 2WLBA 3Q3MC 4N9F4 2PMVA 3GZNI 3HM6X 4C4VB 4GDKB 1CMXB 2M0AA 1FMAD 3RNEC 2JRIB 1TYGB 2AYOB 1V97A 4EFOA 1L4DB 4OVUA 2NS5A 2NMQA 4YWGG 4BBNF 2DYMA 2EMTA 1EWCA 1MHXA 3T9LA 2QHOA 2KK8A 1GB1A 2DNFA 2K8CA 1XO3A 5IP4D 4G0NB 4A55A 4LDTD 2O6VA 4KGRA 3ZDMC 4E71A 2MLBA 3V62A 2BB6A 1WZ3A 5IO9A 1ZXHA 4KZCA 1V9JA 4IWQA 4EZLA 5JHAA 3IT4B 3Q14C 1KM7A 1LQBA 2WYQA 1I4PA 4WAFA 1A70A 2IYDB 4MM3B 3ZGZA 1OEYA 3GE8C 3NZUA 2LGXA 2GMIC 3FC4A 1VLBA 2PPHA 3KUDB 1TS4A 1L0VB 1YX5B 3ZYYX 4ZOHC 3AE7B 4KIKA 1I4HA 3KWVA 2XEWA 1C4PA 1MJDA 1T0RC 1UZXB 5DPTA 3U2SC 1WYWB 2ACZB 3B08A 1VRAB 3W1SA 1L6UA 1ACCA 3OJ4B 2KQSA 4NAWA 2N9LA 3V3XA 2KTRB 2LGDA 3EGRA 1JALA 4YSYB 3MTNB 4W9EA 2V4IB 1ZXIA 4DXAB 3UQAA 4LJOB 2HTHA 5IAAC 1YQ4B 2K8HA 4ZDVA 2M0XA 3ML8A 2BGFA 1YD8U 2GB1A 4E74A 4RGTA 1RRBA 3VAWA 4FA6A 3UGBB 4LNOA 4MJSA 4TSSA 3HHMA 1JCKB 2KFKB 3Q69A 1IYFA 1SF0A 4MSQB 2PE9A 2CHXA 5BMIA 1NBFC 3RNFC 1CZPA 1E6EB 3DBLI 1J7CA 2LWPA 1KFYB 1E8YA 1L5PA 2WX1A 2JY6A 2B3AA 2JQRB 4BKSD 3FILA 3SFDB 3TEXA 4RGOS 4FHKA 4BBNC 3NUHB 3AI5A 4DHJB 1WGKA 3VVWB 1UWXA 3Q3OC 4GGQA 1V1PA 4GN1A 1G6JA 1IUEA 2EMSA 1K52A 2MJDA 2PTLA 3DBHB 5CTRC 3DWGC 1YOVB 3SEBA 3TL5A 4FLHA 2ZZPB 1GB4A 2GRIA 2K9XA 1I4QA 2IO3B 2L7RA 3BWUD 4M0WA 4CHKA 4BFRA 4ARIA 2BT6A 2KMMA 1V6EA 4TV3A 4PT5A 3RNCC 3CIRB 1STEA 3H6NA 3AU5A 2ZCBA 4TQ1A 3PTFC 4W9DA 2KJHB 1IPGA 5KHOA 2Q5WD 2ICIA 2ZPYA 5MPOA 3MP9A 3BVMA 4B6WA 5GMVA 2WXPA 3DBHI 3GP7A 2KVZA 2R61A 2FIFA 1RFAA 2MA9B 1R4NB 3RYTA 4I6NB 2N0SB 4US9A 4BKSA 2J0MA 3EECA 1SXTA 2WXHA 1QOBA 1XLOA 1C78A 3AE8B 3N1XC 3OAWA 2BW2A 2LXAA 2IY1B 2KJRA 2C7NB 2AWTA 1AYFA 1FNUA 3N30A 3SFEB 4FHJA 2RPVA 4KZ0A 5TR5A 4WWPA 1MI0A 3KUZA 5E6PA 3TBLD 3T8MA 1CK1A 1WI0A 2JVCA 4DDGD 2ZW0A 3BY4B 3A9KA 3E56A 2ZW1A 5BYRA 2KD0A 3NVWA 3W9CB 2RDGA 3NY5A 1KLUD 2ONQA 3P4PB 1WRIA 3DPDA 3N1YC 4HCPB 2WXMA 2V3PA 1TY0A 3UIOB 2HJ8A 3IAM1 3JVZX 3A4RA 1UGJA 3SD5A 2LVOA 1NI2A 1E0ZA 1FXTB 1E90A 5C3JB 3MJWA 4RM8A 3MC0B 4YXDB 4C4VA 5D3DA 4F1SA 4GDKA 2B76B 3N32A 4A8XC 3KQ4A 3M63B 3ZNZB 5HG2A 1AW7A 2WS3B 5CHFA 2LI5A 3C19A 2ZNVB 1I4GA 2BF8B 3VUXA 2K0PA 1T5XD 5C23A 4YT0B 1JRUA 2GLSA 4X57B 1ESFA 1KF6B 3TIXA 2JZZA 1SIJA 2LXCA 2KHWB 2WXRA 2DWQA 5BYSA 2DAFA 3QX1A 2V3NA 4P1BC 1QQRA 4JL9A 2KN4A 3H7PA 4S17A 3IBEA 4AJYB 4AQ7A 4H2AA 1WJUA 1IBXA 2OEDA 4K3CA 3AEBB 4ASWC 2JYEA 3NHEB 1UH6A 5CHVC 1Y8RC 2J42A 4C00A 2AL6A 3PZ8A 4JLCA 4XZ4A 3VDZA 4WURA 1GNUA 1RM6C 2LJ5A 1C1YB 2FCSA 2V4LA 1WGGA 5H8YE 1K51A 4O1NA 3T3OA 1D5MC 2CU3A 1P98A 2HTME 4DHJD 2OJWA 2KTRA 4IDIA 3RFZB 1L2NA 3HRDD 2I38A 2RSUA 3P63A 1QOFA 2BYEA 2XK5A 4B95A 3RNAC 4WQOB 1E9MA 2DYBA 1RYJA 1QOGA 1TS2A 1J19A 3PVLA 1N63A 2UU7A 2BS2B 2D3GA 2XNAC 1TKGA 2FCQA 2EELA 2RR9A 3A9JB 2W3SA 4XYCA 2LGYA 1C4CA 4G50A 3PO0A 3PZDA 2D10A 4FN2A 2WXGA 3OJ3A 2KDBA 2MSED 2KLCA 3TEYA 1P7EA 1B1ZA 3AE1B 4BZAA 3H7SA 3RZFA 3JSVB 3MC8A 4A90A 5IOIA 4AS1A 1ENFA 1FPYA 5EE3A 4ANVA 4R3DA 2BWFA 1R4MB 5JH5C 3UQBA 2R2OA 1DYQA 1J0GA 1LO5D 1WY8A 4IUMB 3PRPB 3VUWA 3UI3A 4WJOA 4XDDA 3R3MA 1TBEA 4RCOA 3QARA 1GC6A 2Z59B 3NS8A 3ZXRA 2K8BA 1HTOA 3ZO5B 4GOCA 3H8HA 2WXQA 1L0XB 5CX3A 5KHQA 5AZGA 4WAAA 1L4ZB 1F9JA 1RFKA 4NAMA 2L83A 2GBMA 3PRMB 2N9EB 2MBHA 3ZRCA 3W1YA 3KUCB 1DOYA 3AB5A 1EO6A 5G5GA 2BKRB 3Q8AA 3GOEA 3VUYA 1GC7A 4ANXA 3KH0A 2IGGA 2L76A 4ICVA 4B0MA 4EEWA 1WGHA 2MJEA 4K3BA 3ZLZA 4WWMA 2UYZB 1ZGUB 4KGTA 5J17A 1UGMA 3VH3B 4ITKA 2KXJA 3V6CB 1E7UA 1TT5B 2FNJB 2LMCA 1GJZA 1QILA 2KO3A 3ZIMA 4PYUA 2CKHB 3GZNB 1YJ1A 1K53A 1XEEA 2QIEB 3ZNGC 2KC1A 1WJ6A 4L23A 4EUTA 3J9CA 2X38A 1BMLC 2K3UA 4HROA 2BS3B 4HCNB 4XWTA 5DPRA 1MFWA 5LNK1 3T3NA 3HIZA 3DHHC 3DBRB 4A6QA 2NPTB 3VTWA 3RZWC 1TTNA 3AU4A 5E6JA 1WXVA 2XBBC 2KVRA 4KDLB 1EM7A 4PS8A 2KLGA 3R2IA 3IT6B 3ZTDA 1WM2A 3IFWB 2KWVB 4ZYNA 5IN7A 3NVVA 1WRDB 3LYYA 3TEWA 3AE9B 2IBIB 5BMGA 2G3QB 2WDQB 2INNE 1OTRB 4PS7A 4Q2JA 5C1ZA 1Q10A 4II3B 2RD0A 2KANA 1FM0D 2OOBB 3DBRI 2HD5B 3JW0X 2FCMA 4B9KA 2LASA 3CSTA 2WP9B 1H8CA 4J3OD 4IWOA 2I1JA 4LK0M 2UWQA 4M01A 4TMAB 2INDC 2INPE 1I35A 2N9PC 2MBQA 3DHIC 4BOZB 2NR2A 2WXNA 4GLSC 2L1AA 3U7ZA 1I42A 5EDSA 4WH4A 3I9V1 2VH1A 2ZPNA 2KX3A 5J18A 1FFUA 2QJLA 4HKZE 1QT9A 1N5XA 3EFCA 3FKYA 2CR5A 4EZJA 3AEDB 4HDOA 1FNVA 1XXGA 5H92C 2LUEA 4HJKA 3PHXB 4K1RB 2IY0B 2FCNA 1HE8A 1ZDVA 3PV1A 4HDQA 3EC8A 2DBYA 3P1MA 1HA5A 3HUIA 2D07B 3WALA 2FBWB 1WWTA 3Q3FA 3AM9A 3ZRFA 1MG4A 1GG3A 2LHEA 1L7YA 3CMMB 3DBLB 4FBJB 2M17A 3MHSD 5JZEB 1SE2A 1DOIA 4P1CC 3I5JC 1UUPA 3QC8B 4KGSA 3PREA 4MACA 1ZPSA 4TKNA 3HM3A 3SDLC 5CHWA 2IO0B 2WXJA 4OZCA 4A3OA 2ZJDA 2NVUI 1JW9D 2KACA 1BXTA 4IM0A 1NDDA 1PGBA 4K7WA 2Y5CA 1P1AA 3X0WA 3K9OB 1V86A 4HRSA 3BK2A 2N4FA 3NVYA 3RT3B 1RAXA 4MDKE 4DWFA 4YSXB 2H88B 1GPXA 4LJPB 1WXMA 3A9JA 2KZRA 3U8ZA 3DVNV 1WGYA 1GAQB 4PK1A 1EUVB 3ZKJC 1N6ZA 1UBIA 1E10A 1ZE3D 2C7HA 1LGRA 3ENEA 3JSVA 3CSFA 1VCBA 4KDIC 1V1OA 2JU6X 2D3CA 2M8SA 3Q3NC 4FJYA 2DZJA 3R7RA 1T0QC 3V6EB 3GE3C 3VRBB 3U52E 2Z8LA 4RH6A 2KDFB 4HPMB 3O65B 1KH0A 2C5LC 3Q8CA 5IA7A 3QIJA 3ZJUA 5L95C 1WMHA 1F0ZA 1YN5A 2KFJA 3HVDA 3RNBC 2GBRA 3ZVVA 2X8XX 3TJPA 2W54A 4FJVB 2J7QB 1D5ZC 4DHZE 1HZ6A 4DHZB 4RFBA 3VRAB 2KWUB 3TSSA 4CQNA 3N1ZC 3RULA 3KYCD 4K81A 2GOWA 1EWYC 2SEBD 5L83A 2Y5BB 3VH4B 4BKGA 3L17A 2BS4B 2AQ3B 3DDCB 4LNIA 1WX9A 3ZXVA 4GIVA 5IKCM 2N9KA 3LB8C 4S0RA 1C79A 3B2GA 3DOWA 4IKGA 1TS3A 1WZ0A 3Q8EA 3PLUA 3M95A 2D3AA 2KWDA 1V8CA 4K7SA 4YTMB 3SR6A 4OZBA 3AH7A 2J0JA 4JPSA 2BYFA 2L8JA 2KJ6A 3L13A 1SJED 2MX2A 1FFVA 4IOIE 1C77A 5DCNA 2L0FA 1N62A 1K50A 2D2QA 3QJZA 2NPTA 1JMLA 1UNSA 3IHPC 4GXBA 2YEPF 4RF0A 3QWZB 2LD9A 2ON8A 3OG5A 3E9SA 3APCA 1NYQA 1EU3A 1V80A 2L00B 1ZUD2 1H4RA 4REZA 4US8A 4JX1C 1RWSA 1KJTA 2MH7A 3DBSA 4P7IA 3H1UA 1JWMD 3DVGX 3QQ8B 5I4DA 2ZNVC 1AARA 4EOYA 3VXWA 2DHZA 1T3QA 2G45B 2MCNB 1KLVA 2MBEA 3B2FA 3DVGY 4NY0A 4P16A 2JXXA 1GUAB 4ZRJA 1WXSA 3ZJTA 1VZ6A 4HWIB 1E5WA 2V1YA 1ZW7A 1J7AA 1OGWA 2J4XA 2HJ1A 1I4XA 1PQSA 4L1BA 4HVBA 4I6PA 2RMMA 4MEMA 1HTQA 1HQRD 1IP9A 3EUB2 4MGKE 4TQ0A 2C60A 3LDZE 4MM3A 1HEZE 2LZ6A 5D3IB 3PT2B 4NNJB 1P0RA 5AEKB 5J2RA 2NBUA 2PE6B 4F7ZA 4HJGE 1WSPA 2A4ZA 1F52A 4AUQC 1NYRA 3AMZA 3IXSA 1HXYD 3P4QB 2PJHA 4EE2A 1XD3B 2AQ2B 2HE7A 2IPKD 1ZDXA 2OJRA 2PKOA 5AZFA 3H9DA 4NJ6A 3WAPA 4NAWB 4KV2A 2DENB 1J8CA 3CWIA 1Q0WB 1F2RI 2WXFA 1UWMA 5JXVA 2KDEB 1D5XC 2YVCA 2BWES 3I3TB 1E8ZA 1D6EC 3AE3B 2XN9C 3ZDTA 1JQ4A 4C56C 2AQ1B 2NBVB 4BVUC 1C4AA 4GU2A 3V60A 1QZEA 1VJKA 2I2YA 4GSWA 3QCAA 4FADA 3BYYB 4CYEA 3JYUA 1YN3A 4LTUA 2YEPB 2RPQA 3UINB 2KFKA 2CS4A 5LXIB 1WR1A 2HDEA 2VZKB 3A1QB 2J53A 1N5WA 2WX0A 4XX5A 2BB5A 4IC7B 4IW0A 5HHDG 4XE0A 2BYVE 2WWZA 2Z0DB 3V05A 4ICUA 4J6IA 3SU8X 4N6EB 2D5GA 4BKTA 1UF0A 2LUMA 1P3QU 1UBQA 3URYA 5BO4B 1V1PB 1SB3C 3ABVB 3AEEB 2MQJA 3ZNHB 3K9PB 3L10B 1FD6A 4NJCA 4M0WB 3PRZA 4MT5A 2JT4B 2INCC 1ROEA 2WXKA 1KRHA 4OHJA 4ZRQA 2WU2B 1FCCC 1A5RA 2LRUA 1AWDA 3BYTB 3R8BA 4WWNA 3AEFB 5FR3A 2FE8A 3L0WB 2TSSA 3O13A 3PZ7A 4A3PA 4N58A 4NQLB 4KVGB 1WJNA 1E7VA 4GB9A 1L6VA 3W5UB 3P4RB 2KTFA 1IGDA 1WR6E 1DGJA 1MPEA 2IGHA 4OZAA 4XGAB 4D2KA 4OVVA 3AE2B 4AWJA 4MGZE 3MJ5A 4JWUC 1V81A 1JROA 2KYWA 1NVID 4W9KA 2KC2A 4MH0E 2ASQA 2CJNA 1WM3A 4OW0A 3TCAA 1WXQA 2FUHB 1E8XA 1PGAA 4LNNA 3PPAA 1QOAA 5DPWA 4KSLC 3HVZA 3IAS1 4YSZB 1KTKA 1KLGD 1PYWD 3B0AA 1T0SC 4HK2A 3NG0A 4M00A 3Q8BA 2WDRB 2KQ7A 3C0RB 2JUOA 5E6NA 2MW5A 4JQWC 4WIPA 2LFIA 4ZYSA 3D32A 2JXTA 3W2DA 2WHIA 1WXAA 2IGDA 1BUIC 3VHTC 3ONSA 4PYZA 1PUTA 2O2VB 1XCQL 4IG7B 3ZJVA 3RN9C 4JGHB 2IDYA 3OWEB 4C7ZA 2C7MB 4XC2A 5AZHA 2QC8A 3U4EG 4ZRIA 5FR6A 4DXFA 2R2QA 4WJQA 1B9RA 1SE3A 4PS3A 4DDID 3RNGC 4YL8A 2I1KA 2K6DB 3MHZA 1WH3A 3WAOA 3EA6A 3RUIB 5DPSA 2VH2A
chains in the Genus database with same CATH topology
3ZQ4A 4A8XC 1V1OA 4JE3B 4RNAA 5HI1A 3KQ4A 2JU6X 1CJEA 5HG2A 1R7SA 1AW7A 2WS3B 3BIID 2WXLA 4ARCA 2WNMA 3VRBB 1I4GA 2Z8LA 1N60A 3U52E 1ZOYB 1T5XD 2K0PA 4RH6A 4YT0B 5GXGB 4A9AA 1KH0A 1ESFA 1KF6B 3Q8CA 1OQQA 2JX5A 2PIAA 2MJ3A 3ZJUA 1FEHA 2M19A 1L0YB 1SIJA 4DQOC 2WXRA 2G1EA 1YN5A 3VQIA 1F0ZA 3HVDA 1F77A 2DWQA 1HZ5A 2G9HD 1PDXA 5BYSA 1MVKA 2W54A 1NENB 1TZOA 2V3NA 1D5ZC 1SSNA 4C7YA 1HZ6A 1QQRA 2KN4A 2WDVB 1PGXA 1C76A 2M56B 1ET6A 2H89B 4RFBA 3VRAB 1ET9A 2L52A 3TSSA 4CQNA 4DXGA 4AQ7A 1IBXB 3B9JA 2J52A 1EWYC 2SEBD 4H2AA 5G5HA 2W82A 3AN1A 1IBXA 4HKQA 1QKZA 2OEDA 3AEBB 2JYEA 2BS4B 1OFFA 2AQ3B 4USAA 2VZKD 1M4VA 3BK1A 4GDLB 2J42A 1CQVA 2PW9A 1YQ3B 4UDUC 2Y3AA 2N9KA 2Y5PA 2CJOA 3PZ8A 4LLGM 3LB8C 4WURA 1C79A 4KX6B 3B2GA 4IKGA 1RM6C 4RF1A 1TS3A 3N9YC 2K22A 4P6VF 3Q8EA 3AEGB 5H8YE 3GB1A 2DYOA 1K51A 1XLPA 4O1NA 3T3OA 1D5MC 2CU3A 2HTME 2KWDA 1E7PB 5AUKA 4C80A 1V8CA 2N7JA 4YTMB 3SR6A 4IDIA 3AE6B 3RFZB 1JWSD 3HRDD 4OZBA 2I38A 3P63A 3AH7A 1QOFA 2AX5A 3NVZA 1JWAD 4JPSA 2LJIA 5EE9A 1E9MA 4FXCA 4OVZA 2DLBA 3AECB 2BTEA 2NTSA 1RYJA 1P7FA 1QOGA 1SJED 1TS2A 2E3TA 3BVGA 3I57A 3P42A 1TKYA 5BMHA 1N63A 2PLPA 2KQ4X 1PFDA 2BS2B 2QSDA 1FFVA 4IOIE 1C77A 1XLNA 2XNAC 1N62A 1K50A 1TKGA 3LXFA 2EELA 4L2YA 2W3SA 1JMLA 3AE4B 1UNSA 3AE5B 4RF0A 2YEPF 1VZ8A 2L32A 1C4CA 2ON8A 2WLBA 3RPFC 1VDVA 3E9SA 3PO0A 2WXGA 5FKAC 5C2TB 5BYQA 2PMVA 1NYQA 1EU3A 3TEYA 1P7EA 1B1ZA 3AE1B 1ZUD2 4GDKB 4REZA 4US8A 3W5VB 2M0AA 4JX1C 1RWSA 1FMAD 2MH7A 4A90A 2PVGC 1TYGB 4AS1A 1V97A 1ENFA 1JWMD 5EE3A 1L4DB 1NI3A 1TY2A 5I4DA 4R3DA 1N61A 1T3QA 3B2FA 2NMQA 1C9FA 3MFGA 1DYQA 1LO5D 4P16A 4YWGG 2WXOA 2DYMA 1EWCA 3UI3A 1MHXA 1FIQA 1GB1A 2FUG1 4XDDA 3ZJTA 1VZ6A 1XO3A 4RCOA 4A55A 4KGRA 2BB6A 1J7AA 1DOXA 1ZXHA 3R2TA 2J4XA 1I4XA 3H8HA 2WXQA 4L1BA 1L0XB 3IT4B 1YN4A 2RMMA 1HQRD 1L4ZB 1I4PA 4WAFA 1A70A 3EUB2 4MM3B 2LEKA 1RFKA 4NAMA 1I7HA 3C8YA 4TQ0A 2L83A 1AN8A 3ZGZA 1SBBB 1HEZE 5D3IB 3FC4A 4WQMA 1DOYA 1VLBA 3AB5A 5G5GA 3VR8B 1TS4A 1L0VB 3Q8AA 4HJGE 1WSPA 2WU5B 3ZYYX 1NYRA 3AMZA 4ZOHC 3IXSA 3AE7B 1HXYD 2IGGA 2JZPA 3P4QB 4EE2A 4B0MA 1I4HA 1FRDA 2AQ2B 2IPKD 3KWVA 2NTTA 2MJEA 1C4PA 1ZDXA 5EE0A 2PKOA 4WWMA 2WXIA 1EU4A 3BVZA 4KGTA 2PVOD 3U2SC 4ITKA 2ACZB 4NAWB 1VRAB 3W1SA 1L6UA 1ACCA 1WYGA 3CWIA 1F2RI 2BBCA 2N9LA 2WXFA 2LMCA 5AUIA 3Q8FA 1UWMA 5JXVA 1QILA 3V3XA 2JSVX 1D5XC 1K53A 1XEEA 2QIEB 2RDHA 2QEJC 3EGRA 4L23A 1JALA 4YSYB 3J9CA 2V4IB 1ZXIA 2X38A 1D6EC 1BMLC 3AE3B 3AEAB 4XWWA 2K3UA 2XN9C 4HROA 2BS3B 4XWTA 3VR9B 1JQ4A 2GI9A 5LNK1 1YQ4B 4C56C 2AQ1B 5HFYA 3T3NA 1C4AA 2JWUA 4A6QA 5D7GA 1VJKA 3NZ3A 2GB1A 2I2YA 1J7BA 4RGTA 3TEZA 1T6BX 1JWBD 2KDMA 5E6JA 3BYYB 4TSSA 1EM7A 1YN3A 4MH8A 4YTNB 1JCKB 1I4RA 3R2IA 4LTUA 3DWMA 3IT6B 3Q69A 1SF0A 2YEPB 1ZP0B 5BMIA 1TJEA 3NVVA 2HDEA 2VZKB 3LYYA 1FXAA 3TEWA 3AE9B 4ZHPA 2J53A 5BMGA 1N5WA 1CZPA 2WDQB 1E6EB 1TS5A 2BB5A 2INNE 1J7CA 5HHDG 1KFYB 4Q2JA 4XE0A 1L5PA 1YJJA 2IJ0A 1Q10A 2JQRB 3V05A 4XDCA 3FILA 3SFDB 1FM0D 4RGOS 3TEXA 4JWSC 1Y56A 4N6EB 4ZRPA 2D5GA 3NUHB 2LHDA 2LUMA 2WP9B 4J3OD 1WGKA 3URYA 4LK0M 1V1PB 4TMAB 1SB3C 1UWXA 2INPE 1FRRA 3ABVB 1V1PA 2W3RA 3AEEB 1IUEA 1K52A 2MJDA 2PTLA 3DWGC 1JWUD 1GOZA 3SEBA 2SAKA 1FD6A 4RGMA 2V0GA 4NJCA 5TSSA 2KAJA 2GRIA 1GB4A 1F2RC 1SJHD 4MT5A 2K9XA 1I4QA 3BWUD 4M0WA 1ROEA 3NRZA 2WXKA 2WXNA 1OQRA 3NS1A 2L1AA 4GLSC 3U7ZA 1KRHA 4OHJA 3I9V1 1NEKB 4WH4A 2BT6A 2WU2B 1FCCC 4ZRQA 4ARIA 2KMMA 2QMTA 2W55A 4PT5A 1AWDA 1FFUA 3CIRB 3BYTB 3R8BA 1STEA 1JRPA 3AEFB 4TQ1A 5FR3A 2FE8A 2JYTA 2QJLA 2TSSA 3O13A 1QT9A 4HKZE 1N5XA 3PZ7A 3GS2A 2OHFA 3AEDB 2Q5WD 4N58A 1FNVA 1XXGA 2ICIA 5H92C 1L6VA 5MPOA 1YJIA 3MP9A 3W5UB 2BYTA 1FNWA 3BVMA 3P4RB 4ZHOA 2QILA 2WXPA 1SEBD 3KLSX 3GP7A 2R61A 3L4PA 1ZDVA 1IGDA 1DGJA 1MPEA 2IGHA 4OZAA 4D2KA 2DBYA 2N0SB 3AE2B 3P1MA 1YMHE 4US9A 1HA5A 3HUIA 1SXTA 2WXHA 3TUOA 1QOBA 2FBWB 3MJ5A 1XLOA 1WWTA 4JWUC 3AM9A 1JROA 1NVID 1C78A 3AE8B 3ETRA 1VZ7A 2BW2A 1XCTL 2CJNA 2LHEA 3WCQA 4OW0A 1WXQA 1XF5L 5EE1A 1PGAA 4HEA1 4KKIA 1AYFA 1FNUA 1SE4A 1MHHE 1QOAA 5T8IA 1SE2A 3HVZA 3IAS1 3SFEB 4YSZB 1QF6A 1DOIA 1KTKA 1KLGD 1QLBB 2RPVA 1YNTE 2LGIA 1PYWD 3AV8A 1MI0A 1UUPA 4KGSA 3P4SB 4MACA 1ZPSA 5FK9C 1FO4A 1CK1A 3Q8BA 2WDRB 1VR9A 2ZW0A 1XLQA 3E56A 4YTPB 1FCLA 2ZW1A 4NZLB 5BYRA 2WXJA 3NVWA 4OZCA 3W9CB 4B0EA 2RDGA 1KLUD 2ONQA 4WIPA 1JW9D 3P4PB 1FXIA 1WRIA 2LFIA 2KACA 4ZYSA 1BXTA 2JXTA 2WQYB 3W2DA 1PGBA 2K5PA 1D4BA 2Y5CA 2IGDA 2WXMA 1BUIC 4KKJA 1PUTA 2V3PA 1XCQL 4RGNA 4HRSA 3BK2A 3ZJVA 1TY0A 3NVYA 3FAHA 2EKIA 3IAM1 2IDYA 3OWEB 4C7ZA 2E6XA 2MEKA 3FILB 3KWLA 2H88B 4YSXB 1GPXA 3U4EG 3BZDB 1UGJA 4N59A 4DXFA 1E0ZA 1GAQB 1B9RA 1SE3A 5C3JB 1E10A 3MC0B 4YXDB 3MHZA 1ZE3D 1TKEA 5D3DA 3EA6A 2B76B 1IGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWM A;  1N62 A;  1TKG A;  2OHF A;  3AED B;  2Q5W D;  3LXF A;  4N58 A;  1CJE A;  2W3S A;  5H92 C;  2QIE B;  1R7S A;  3AE4 B;  3AE5 B;  2WS3 B;  1L6V A;  3BII D;  5MPO A;  1JAL A;  1YJI A;  4YSY B;  3W5U B;  2WLB A;  3P4R B;  3RPF C;  4ZHO A;  1ZXI A;  1VDV A;  3PO0 A;  3VRB B;  3L4P A;  1N60 A;  3AE3 B;  1ZOY B;  3AEA B;  5C2T B;  1DGJ A;  4YT0 B;  4HRO A;  2BS3 B;  5GXG B;  1NYQ A;  4A9A A;  3VR9 B;  2DBY A;  1JQ4 A;  1KF6 B;  3AE1 B;  2N0S B;  1ZUD 2;  3AE2 B;  1OQQ A;  2JX5 A;  3W5V B;  3P1M A;  1YQ4 B;  4JX1 C;  2PIA A;  1RWS A;  2MJ3 A;  4US9 A;  1FMA D;  2MH7 A;  3HUI A;  2PVG C;  2M19 A;  1TYG B;  1QOB A;  2FBW B;  1V97 A;  1SIJ A;  1WWT A;  1XLO A;  1VJK A;  4JWU C;  5EE3 A;  2G1E A;  3AM9 A;  1F0Z A;  1JRO A;  1J7B A;  1NI3 A;  1NVI D;  3AE8 B;  3ETR A;  2DWQ A;  1JWB D;  4US8 A;  1PDX A;  1N61 A;  2CJN A;  1T3Q A;  2W54 A;  3WCQ A;  1NEN B;  3B2F A;  1WXQ A;  5EE1 A;  4C7Y A;  4YTN B;  4LTU A;  1AYF A;  2WDV B;  3DWM A;  1SF0 A;  2M56 B;  1QOA A;  1ZP0 B;  2H89 B;  3HVZ A;  3SFE B;  1FIQ A;  1DOI A;  4YSZ B;  1QLB B;  3VRA B;  1QF6 A;  1TJE A;  2L52 A;  3NVV A;  1FXA A;  3AE9 B;  3AV8 A;  4ZHP A;  1N5W A;  3B9J A;  1XO3 A;  1EWY C;  1CZP A;  2WDQ B;  3P4S B;  1E6E B;  5G5H A;  3AN1 A;  1J7C A;  1FO4 A;  1KFY B;  1L5P A;  1YJJ A;  2WDR B;  1XLQ A;  1J7A A;  3AEB B;  1DOX A;  2BS4 B;  4YTP B;  1OFF A;  2JQR B;  3NVW A;  4USA A;  3W9C B;  3SFD B;  1FM0 D;  4JWS C;  4N6E B;  1JW9 D;  3P4P B;  1FXI A;  1WRI A;  1A70 A;  1YQ3 B;  3EUB 2;  2WQY B;  2CJO A;  2WP9 B;  2LEK A;  3LB8 C;  1WGK A;  1RFK A;  2K5P A;  1I7H A;  4KX6 B;  2L83 A;  3B2G A;  1RM6 C;  2Y5C A;  1SB3 C;  2K22 A;  1FRR A;  3ABV B;  1PUT A;  4P6V F;  2W3R A;  3AEE B;  3AEG B;  1IUE A;  3FC4 A;  5H8Y E;  4WQM A;  4HRS A;  1VLB A;  3AB5 A;  1DOY A;  5G5G A;  2MJD A;  3VR8 B;  3NVY A;  1XLP A;  3DWG C;  3FAH A;  1L0V B;  2EKI A;  2CU3 A;  4C7Z A;  2KAJ A;  2HTM E;  2WU5 B;  3ZYY X;  1E7P B;  1NYR A;  2K9X A;  3KWL A;  1V8C A;  2H88 B;  3AMZ A;  4ZOH C;  5AUK A;  4C80 A;  4YSX B;  1GPX A;  4YTM B;  3AE7 B;  3SR6 A;  1ROE A;  3NRZ A;  3NS1 A;  3AE6 B;  1OQR A;  3P4Q B;  4IDI A;  1FRD A;  4N59 A;  1E0Z A;  1KRH A;  3HRD D;  1NEK B;  3P63 A;  2BT6 A;  2WU2 B;  1QOF A;  2AX5 A;  1GAQ B;  2MJE A;  3AH7 A;  3NVZ A;  1JWA D;  2KMM A;  1B9R A;  5EE0 A;  2PKO A;  2W55 A;  4WWM A;  1AWD A;  5EE9 A;  1E9M A;  1FFU A;  4FXC A;  3CIR B;  3AEC B;  5C3J B;  1RYJ A;  2PVO D;  1E10 A;  1QOG A;  4ITK A;  4YXD B;  2ACZ B;  1JRP A;  2E3T A;  3AEF B;  1TKE A;  1TKY A;  1L6U A;  1N63 A;  2B76 B;  2QJL A;  1WYG A;  3CWI A;  1QT9 A;  1PFD A;  1N5X A;  2BS2 B;  1FFV A;  5AUI A;  1XLN A; 
#chains in the Genus database with same CATH topology
 4IM2 A;  4LCD E;  1CJE A;  2FID A;  1UEL A;  4RMA A;  4ARC A;  3ZUN A;  4JIO U;  5GXG B;  2IO2 B;  1OQQ A;  3QK0 A;  1UD7 A;  2PIA A;  1ZKH A;  2N1V A;  4ANU A;  2DZM A;  2M19 A;  2J0K A;  4DQO C;  2G1E A;  2BVC A;  1HZ5 A;  2G9H D;  1LFD A;  3H7P B;  1EF1 A;  1SSN A;  2CU1 A;  4C7Y A;  3PS6 A;  2JZ3 B;  2VRR B;  3KVF B;  5LXH A;  2WDV B;  2M56 B;  2H89 B;  4F8C B;  3EFU A;  1ET9 A;  2L52 A;  1IBX B;  4MEL A;  3B9J A;  5G5H A;  4HKQ A;  2K1F A;  2VZK D;  1VD2 A;  1M4V A;  4GDL B;  1CQV A;  1E8W A;  1YQ3 B;  4URK A;  4MGI E;  4LLG M;  2Y5P A;  1XT9 B;  4ACF A;  4KX6 B;  3I63 C;  2K22 A;  4P6V F;  3ALB A;  3AEG B;  1TIF A;  3N20 C;  4EZK A;  1XLP A;  1KOT A;  4LNF A;  3SHQ A;  4AP4 C;  2BKF A;  1F1H A;  1E7P B;  2KN5 A;  4DBG A;  2XK5 B;  4WWO A;  1WGD A;  3KW5 B;  3NJT A;  5JHB A;  2CHW A;  4MGY E;  2DZI A;  1JWA D;  2LJI A;  2QCZ A;  4OVZ A;  2DLB A;  3BVG A;  2E3T A;  3I57 A;  3RMK C;  3A4S C;  2PLP A;  2KQ4 X;  3VFK A;  3UF8 A;  3M62 B;  4IM3 A;  3APF A;  4L2Y A;  2V3S A;  1V5O A;  2JWZ A;  3AE4 B;  2KNB A;  1VZ8 A;  2L32 A;  3RPF C;  1VDV A;  5FKA C;  5C2T B;  5BYQ A;  2BPS A;  3P2B A;  1RLF A;  2L05 A;  2MBB B;  1WX8 A;  2D3B A;  3W5V B;  1XQQ A;  4G3X B;  2ZVN A;  3A1Q A;  2PVG C;  3LJ3 A;  1NI3 A;  1TY2 A;  3RD2 A;  1N61 A;  2WDT B;  4FJZ A;  1C9F A;  3MFG A;  2DX5 B;  2WXO A;  2KKC A;  4W9J A;  3WAM A;  1FIQ A;  3Q3J A;  1V5T A;  4II2 B;  2FUG 1;  2M1M A;  2DZK A;  2YLM A;  1BT0 A;  2JPH A;  1DOX A;  2KMA A;  5D2M B;  3R2T A;  3WIM A;  1YN4 A;  1X1M A;  2LEK A;  3ZTC A;  2KMC A;  1I7H A;  3C8Y A;  2MP2 B;  2A5U A;  3U30 A;  1AN8 A;  2ZCC A;  4GMV A;  1SBB B;  2L3Z A;  2PEA A;  1LM8 B;  4WQM A;  4QAY A;  3VR8 B;  4W9C A;  2WU5 B;  3B1L X;  2JZP A;  3HK0 A;  1FRD A;  2NTT A;  5EE0 A;  2N7E A;  3WAN A;  2WXI A;  1EU4 A;  3BVZ A;  2LVQ A;  4AOF A;  2MRP A;  2PVO D;  4W9G A;  1WYG A;  2BBC A;  5AUI A;  3Q8F A;  2JSV X;  2JRH A;  4BAX A;  2RDH A;  4HXD A;  2QEJ C;  3R66 C;  3RI7 C;  2RDB C;  2LRW A;  3AEA B;  4XWW A;  3VR9 B;  3BIN A;  2GI9 A;  1V49 A;  5HFY A;  2KX0 A;  4MSM B;  2JWU A;  3DVN U;  4W9I A;  2WGS A;  4W9F A;  3N3K B;  5D7G A;  3NZ3 A;  1R4N I;  1J7B A;  3TEZ A;  1T6B X;  1JWB D;  2KDM A;  2MHJ A;  4MH8 A;  1WIA A;  4YTN B;  1I4R A;  2AEH A;  3DWM A;  2IO1 B;  2KT7 A;  4NJ7 A;  3ZW3 A;  1ZP0 B;  1D3Z A;  1TJE A;  1FXA A;  4G11 A;  4ZHP A;  2C9W B;  4WJN A;  4NPN A;  1SE9 A;  1TS5 A;  2O2V A;  2N9X A;  2MBO A;  1YJJ A;  2IJ0 A;  2AL3 A;  2DAJ A;  4XDC A;  3R7Q A;  4M8M A;  4JWS C;  4RM9 A;  3OLM D;  1Y56 A;  4ZRP A;  1S1Q B;  2LHD A;  3APD A;  3X23 A;  1Q1O A;  1FRR A;  2W3R A;  2O6V B;  3KYD D;  1YIW A;  1WJ4 A;  1JWU D;  1GOZ A;  2SAK A;  4RGM A;  1WF9 A;  2V0G A;  5TSS A;  2KAJ A;  4M8N A;  1F2R C;  1SJH D;  2IZV B;  4KSK C;  2CHZ A;  2QDF A;  3NRZ A;  3NS1 A;  1OQR A;  1U4A A;  1NEK B;  3VTV A;  2QMT A;  4HPP A;  2W55 A;  5E6O A;  3UIP B;  2KOX A;  4A20 A;  3QHT A;  3DCG A;  1JRP A;  2JYT A;  4I6L B;  5D6J B;  3GS2 A;  1S3S G;  2OHF A;  4M02 A;  2N1W A;  4KIK B;  4ZRK A;  1YJI A;  2BYT A;  3W1S C;  1FNW A;  4ZHO A;  1T0Y A;  2QIL A;  3KLS X;  1SEB D;  3WA0 A;  5D94 A;  3L4P A;  2M4N A;  2BQQ A;  2W9N A;  3AUL A;  1TZ1 A;  1Q5W B;  1C3T A;  1YMH E;  4NQK E;  3ML9 A;  3Q2A C;  4DK5 A;  4BOS C;  1Z5S B;  2K39 A;  3TUO A;  3ETR A;  1VZ7 A;  3EHV A;  1XCT L;  3VTU A;  3PHW B;  3WCQ A;  1XF5 L;  3U7D A;  5EE1 A;  3QA8 A;  4LDT B;  3S2A A;  4HEA 1;  4KKI A;  1P9D U;  1SE4 A;  1TGZ B;  3L08 A;  4GDL A;  1MHH E;  4FUL A;  5T8I A;  3QAQ A;  1QF6 A;  4E3C A;  1QLB B;  1Z2M A;  1YNT E;  2LGI A;  1SGH A;  3AV8 A;  3L54 A;  3NOB A;  3P4S B;  5FK9 C;  1FO4 A;  2K6Q A;  2N7D A;  2L0T A;  1VR9 A;  1XLQ A;  4YTP B;  1WE6 A;  1FCL A;  4NZL B;  4MJS B;  3ECI A;  4B0E A;  1K8R B;  2KDI A;  1V2Y A;  1FXI A;  1OQY A;  2WQY B;  2K5P A;  4W9H A;  1D4B A;  4KKJ A;  3IVF A;  3A33 B;  4RGN A;  3FAH A;  4CO7 A;  2FAZ A;  2EKI A;  1M94 A;  2GBN A;  2E6X A;  2MEK A;  3FIL B;  3KWL A;  3CF6 E;  3BZD B;  4N59 A;  2GBJ A;  2JF5 A;  4TUU A;  4WJP A;  4IWP A;  1LXD A;  1TKE A;  3RCZ A;  1IGC A;  4AJW A;  3PGE A;  3TMP B;  3ZQ4 A;  1WE7 A;  4JE3 B;  4RNA A;  5HI1 A;  1R7S A;  2NBW B;  3BII D;  2WXL A;  2WNM A;  1EF5 A;  1N60 A;  1ZOY B;  4A9A A;  2JX5 A;  2MJ3 A;  1WX7 A;  1WMH B;  1FEH A;  2G4D B;  2G4S A;  2MWS B;  1L0Y B;  2D11 A;  2LVP A;  3VQI A;  2RGF A;  3DHG C;  4HLE A;  1F77 A;  3Q6B A;  1PDX A;  1MVK A;  3NZS A;  3IG3 A;  1NEN B;  1TZO A;  3V61 A;  1OEY J;  1PGX A;  1C76 A;  1ET6 A;  3AXC A;  4DXG A;  2MP2 A;  1R4M I;  2ZEQ A;  2J52 A;  1MG8 A;  1YQB A;  2W82 A;  2GBK A;  3AN1 A;  4W9L A;  3PSE B;  1QKZ A;  2KWC A;  2ZVO A;  5HKH A;  1OFF A;  4USA A;  4HPL B;  3ZNI D;  3PLV A;  3BK1 A;  2PW9 A;  4UDU C;  2Y3A A;  2CJO A;  4RF1 A;  3N9Y C;  2NCN A;  1WGR A;  4LNK A;  4EKU A;  3GB1 A;  2DYO A;  3A9K B;  5AUK A;  4C80 A;  2N7J A;  3AE6 B;  2O6V D;  1JWS D;  2AX5 A;  3NVZ A;  2V9H A;  3DQV A;  5EE9 A;  3MC9 A;  2EKE C;  4FXC A;  2BTE A;  3AEC B;  5G2N A;  2NTS A;  5LLI A;  1ISN A;  1P7F A;  3P42 A;  2REX A;  1TKY A;  5BMH A;  1YX6 B;  5G55 A;  1SIF A;  4ANW A;  1PFD A;  2QSD A;  1WFY A;  3L16 A;  1XLN A;  3LXF A;  3M3J A;  4K7U A;  2Z0E B;  2K25 A;  3AE5 B;  2LGS A;  2WLB A;  3Q3M C;  4N9F 4;  2PMV A;  3GZN I;  3HM6 X;  4C4V B;  4GDK B;  1CMX B;  2M0A A;  1FMA D;  3RNE C;  2JRI B;  1TYG B;  2AYO B;  1V97 A;  4EFO A;  1L4D B;  4OVU A;  2NS5 A;  2NMQ A;  4YWG G;  4BBN F;  2DYM A;  2EMT A;  1EWC A;  1MHX A;  3T9L A;  2QHO A;  2KK8 A;  1GB1 A;  2DNF A;  2K8C A;  1XO3 A;  5IP4 D;  4G0N B;  4A55 A;  4LDT D;  2O6V A;  4KGR A;  3ZDM C;  4E71 A;  2MLB A;  3V62 A;  2BB6 A;  1WZ3 A;  5IO9 A;  1ZXH A;  4KZC A;  1V9J A;  4IWQ A;  4EZL A;  5JHA A;  3IT4 B;  3Q14 C;  1KM7 A;  1LQB A;  2WYQ A;  1I4P A;  4WAF A;  1A70 A;  2IYD B;  4MM3 B;  3ZGZ A;  1OEY A;  3GE8 C;  3NZU A;  2LGX A;  2GMI C;  3FC4 A;  1VLB A;  2PPH A;  3KUD B;  1TS4 A;  1L0V B;  1YX5 B;  3ZYY X;  4ZOH C;  3AE7 B;  4KIK A;  1I4H A;  3KWV A;  2XEW A;  1C4P A;  1MJD A;  1T0R C;  1UZX B;  5DPT A;  3U2S C;  1WYW B;  2ACZ B;  3B08 A;  1VRA B;  3W1S A;  1L6U A;  1ACC A;  3OJ4 B;  2KQS A;  4NAW A;  2N9L A;  3V3X A;  2KTR B;  2LGD A;  3EGR A;  1JAL A;  4YSY B;  3MTN B;  4W9E A;  2V4I B;  1ZXI A;  4DXA B;  3UQA A;  4LJO B;  2HTH A;  5IAA C;  1YQ4 B;  2K8H A;  4ZDV A;  2M0X A;  3ML8 A;  2BGF A;  1YD8 U;  2GB1 A;  4E74 A;  4RGT A;  1RRB A;  3VAW A;  4FA6 A;  3UGB B;  4LNO A;  4MJS A;  4TSS A;  3HHM A;  1JCK B;  2KFK B;  3Q69 A;  1IYF A;  1SF0 A;  4MSQ B;  2PE9 A;  2CHX A;  5BMI A;  1NBF C;  3RNF C;  1CZP A;  1E6E B;  3DBL I;  1J7C A;  2LWP A;  1KFY B;  1E8Y A;  1L5P A;  2WX1 A;  2JY6 A;  2B3A A;  2JQR B;  4BKS D;  3FIL A;  3SFD B;  3TEX A;  4RGO S;  4FHK A;  4BBN C;  3NUH B;  3AI5 A;  4DHJ B;  1WGK A;  3VVW B;  1UWX A;  3Q3O C;  4GGQ A;  1V1P A;  4GN1 A;  1G6J A;  1IUE A;  2EMS A;  1K52 A;  2MJD A;  2PTL A;  3DBH B;  5CTR C;  3DWG C;  1YOV B;  3SEB A;  3TL5 A;  4FLH A;  2ZZP B;  1GB4 A;  2GRI A;  2K9X A;  1I4Q A;  2IO3 B;  2L7R A;  3BWU D;  4M0W A;  4CHK A;  4BFR A;  4ARI A;  2BT6 A;  2KMM A;  1V6E A;  4TV3 A;  4PT5 A;  3RNC C;  3CIR B;  1STE A;  3H6N A;  3AU5 A;  2ZCB A;  4TQ1 A;  3PTF C;  4W9D A;  2KJH B;  1IPG A;  5KHO A;  2Q5W D;  2ICI A;  2ZPY A;  5MPO A;  3MP9 A;  3BVM A;  4B6W A;  5GMV A;  2WXP A;  3DBH I;  3GP7 A;  2KVZ A;  2R61 A;  2FIF A;  1RFA A;  2MA9 B;  1R4N B;  3RYT A;  4I6N B;  2N0S B;  4US9 A;  4BKS A;  2J0M A;  3EEC A;  1SXT A;  2WXH A;  1QOB A;  1XLO A;  1C78 A;  3AE8 B;  3N1X C;  3OAW A;  2BW2 A;  2LXA A;  2IY1 B;  2KJR A;  2C7N B;  2AWT A;  1AYF A;  1FNU A;  3N30 A;  3SFE B;  4FHJ A;  2RPV A;  4KZ0 A;  5TR5 A;  4WWP A;  1MI0 A;  3KUZ A;  5E6P A;  3TBL D;  3T8M A;  1CK1 A;  1WI0 A;  2JVC A;  4DDG D;  2ZW0 A;  3BY4 B;  3A9K A;  3E56 A;  2ZW1 A;  5BYR A;  2KD0 A;  3NVW A;  3W9C B;  2RDG A;  3NY5 A;  1KLU D;  2ONQ A;  3P4P B;  1WRI A;  3DPD A;  3N1Y C;  4HCP B;  2WXM A;  2V3P A;  1TY0 A;  3UIO B;  2HJ8 A;  3IAM 1;  3JVZ X;  3A4R A;  1UGJ A;  3SD5 A;  2LVO A;  1NI2 A;  1E0Z A;  1FXT B;  1E90 A;  5C3J B;  3MJW A;  4RM8 A;  3MC0 B;  4YXD B;  4C4V A;  5D3D A;  4F1S A;  4GDK A;  2B76 B;  3N32 A;  4A8X C;  3KQ4 A;  3M63 B;  3ZNZ B;  5HG2 A;  1AW7 A;  2WS3 B;  5CHF A;  2LI5 A;  3C19 A;  2ZNV B;  1I4G A;  2BF8 B;  3VUX A;  2K0P A;  1T5X D;  5C23 A;  4YT0 B;  1JRU A;  2GLS A;  4X57 B;  1ESF A;  1KF6 B;  3TIX A;  2JZZ A;  1SIJ A;  2LXC A;  2KHW B;  2WXR A;  2DWQ A;  5BYS A;  2DAF A;  3QX1 A;  2V3N A;  4P1B C;  1QQR A;  4JL9 A;  2KN4 A;  3H7P A;  4S17 A;  3IBE A;  4AJY B;  4AQ7 A;  4H2A A;  1WJU A;  1IBX A;  2OED A;  4K3C A;  3AEB B;  4ASW C;  2JYE A;  3NHE B;  1UH6 A;  5CHV C;  1Y8R C;  2J42 A;  4C00 A;  2AL6 A;  3PZ8 A;  4JLC A;  4XZ4 A;  3VDZ A;  4WUR A;  1GNU A;  1RM6 C;  2LJ5 A;  1C1Y B;  2FCS A;  2V4L A;  1WGG A;  5H8Y E;  1K51 A;  4O1N A;  3T3O A;  1D5M C;  2CU3 A;  1P98 A;  2HTM E;  4DHJ D;  2OJW A;  2KTR A;  4IDI A;  3RFZ B;  1L2N A;  3HRD D;  2I38 A;  2RSU A;  3P63 A;  1QOF A;  2BYE A;  2XK5 A;  4B95 A;  3RNA C;  4WQO B;  1E9M A;  2DYB A;  1RYJ A;  1QOG A;  1TS2 A;  1J19 A;  3PVL A;  1N63 A;  2UU7 A;  2BS2 B;  2D3G A;  2XNA C;  1TKG A;  2FCQ A;  2EEL A;  2RR9 A;  3A9J B;  2W3S A;  4XYC A;  2LGY A;  1C4C A;  4G50 A;  3PO0 A;  3PZD A;  2D10 A;  4FN2 A;  2WXG A;  3OJ3 A;  2KDB A;  2MSE D;  2KLC A;  3TEY A;  1P7E A;  1B1Z A;  3AE1 B;  4BZA A;  3H7S A;  3RZF A;  3JSV B;  3MC8 A;  4A90 A;  5IOI A;  4AS1 A;  1ENF A;  1FPY A;  5EE3 A;  4ANV A;  4R3D A;  2BWF A;  1R4M B;  5JH5 C;  3UQB A;  2R2O A;  1DYQ A;  1J0G A;  1LO5 D;  1WY8 A;  4IUM B;  3PRP B;  3VUW A;  3UI3 A;  4WJO A;  4XDD A;  3R3M A;  1TBE A;  4RCO A;  3QAR A;  1GC6 A;  2Z59 B;  3NS8 A;  3ZXR A;  2K8B A;  1HTO A;  3ZO5 B;  4GOC A;  3H8H A;  2WXQ A;  1L0X B;  5CX3 A;  5KHQ A;  5AZG A;  4WAA A;  1L4Z B;  1F9J A;  1RFK A;  4NAM A;  2L83 A;  2GBM A;  3PRM B;  2N9E B;  2MBH A;  3ZRC A;  3W1Y A;  3KUC B;  1DOY A;  3AB5 A;  1EO6 A;  5G5G A;  2BKR B;  3Q8A A;  3GOE A;  3VUY A;  1GC7 A;  4ANX A;  3KH0 A;  2IGG A;  2L76 A;  4ICV A;  4B0M A;  4EEW A;  1WGH A;  2MJE A;  4K3B A;  3ZLZ A;  4WWM A;  2UYZ B;  1ZGU B;  4KGT A;  5J17 A;  1UGM A;  3VH3 B;  4ITK A;  2KXJ A;  3V6C B;  1E7U A;  1TT5 B;  2FNJ B;  2LMC A;  1GJZ A;  1QIL A;  2KO3 A;  3ZIM A;  4PYU A;  2CKH B;  3GZN B;  1YJ1 A;  1K53 A;  1XEE A;  2QIE B;  3ZNG C;  2KC1 A;  1WJ6 A;  4L23 A;  4EUT A;  3J9C A;  2X38 A;  1BML C;  2K3U A;  4HRO A;  2BS3 B;  4HCN B;  4XWT A;  5DPR A;  1MFW A;  5LNK 1;  3T3N A;  3HIZ A;  3DHH C;  3DBR B;  4A6Q A;  2NPT B;  3VTW A;  3RZW C;  1TTN A;  3AU4 A;  5E6J A;  1WXV A;  2XBB C;  2KVR A;  4KDL B;  1EM7 A;  4PS8 A;  2KLG A;  3R2I A;  3IT6 B;  3ZTD A;  1WM2 A;  3IFW B;  2KWV B;  4ZYN A;  5IN7 A;  3NVV A;  1WRD B;  3LYY A;  3TEW A;  3AE9 B;  2IBI B;  5BMG A;  2G3Q B;  2WDQ B;  2INN E;  1OTR B;  4PS7 A;  4Q2J A;  5C1Z A;  1Q10 A;  4II3 B;  2RD0 A;  2KAN A;  1FM0 D;  2OOB B;  3DBR I;  2HD5 B;  3JW0 X;  2FCM A;  4B9K A;  2LAS A;  3CST A;  2WP9 B;  1H8C A;  4J3O D;  4IWO A;  2I1J A;  4LK0 M;  2UWQ A;  4M01 A;  4TMA B;  2IND C;  2INP E;  1I35 A;  2N9P C;  2MBQ A;  3DHI C;  4BOZ B;  2NR2 A;  2WXN A;  4GLS C;  2L1A A;  3U7Z A;  1I42 A;  5EDS A;  4WH4 A;  3I9V 1;  2VH1 A;  2ZPN A;  2KX3 A;  5J18 A;  1FFU A;  2QJL A;  4HKZ E;  1QT9 A;  1N5X A;  3EFC A;  3FKY A;  2CR5 A;  4EZJ A;  3AED B;  4HDO A;  1FNV A;  1XXG A;  5H92 C;  2LUE A;  4HJK A;  3PHX B;  4K1R B;  2IY0 B;  2FCN A;  1HE8 A;  1ZDV A;  3PV1 A;  4HDQ A;  3EC8 A;  2DBY A;  3P1M A;  1HA5 A;  3HUI A;  2D07 B;  3WAL A;  2FBW B;  1WWT A;  3Q3F A;  3AM9 A;  3ZRF A;  1MG4 A;  1GG3 A;  2LHE A;  1L7Y A;  3CMM B;  3DBL B;  4FBJ B;  2M17 A;  3MHS D;  5JZE B;  1SE2 A;  1DOI A;  4P1C C;  3I5J C;  1UUP A;  3QC8 B;  4KGS A;  3PRE A;  4MAC A;  1ZPS A;  4TKN A;  3HM3 A;  3SDL C;  5CHW A;  2IO0 B;  2WXJ A;  4OZC A;  4A3O A;  2ZJD A;  2NVU I;  1JW9 D;  2KAC A;  1BXT A;  4IM0 A;  1NDD A;  1PGB A;  4K7W A;  2Y5C A;  1P1A A;  3X0W A;  3K9O B;  1V86 A;  4HRS A;  3BK2 A;  2N4F A;  3NVY A;  3RT3 B;  1RAX A;  4MDK E;  4DWF A;  4YSX B;  2H88 B;  1GPX A;  4LJP B;  1WXM A;  3A9J A;  2KZR A;  3U8Z A;  3DVN V;  1WGY A;  1GAQ B;  4PK1 A;  1EUV B;  3ZKJ C;  1N6Z A;  1UBI A;  1E10 A;  1ZE3 D;  2C7H A;  1LGR A;  3ENE A;  3JSV A;  3CSF A;  1VCB A;  4KDI C;  1V1O A;  2JU6 X;  2D3C A;  2M8S A;  3Q3N C;  4FJY A;  2DZJ A;  3R7R A;  1T0Q C;  3V6E B;  3GE3 C;  3VRB B;  3U52 E;  2Z8L A;  4RH6 A;  2KDF B;  4HPM B;  3O65 B;  1KH0 A;  2C5L C;  3Q8C A;  5IA7 A;  3QIJ A;  3ZJU A;  5L95 C;  1WMH A;  1F0Z A;  1YN5 A;  2KFJ A;  3HVD A;  3RNB C;  2GBR A;  3ZVV A;  2X8X X;  3TJP A;  2W54 A;  4FJV B;  2J7Q B;  1D5Z C;  4DHZ E;  1HZ6 A;  4DHZ B;  4RFB A;  3VRA B;  2KWU B;  3TSS A;  4CQN A;  3N1Z C;  3RUL A;  3KYC D;  4K81 A;  2GOW A;  1EWY C;  2SEB D;  5L83 A;  2Y5B B;  3VH4 B;  4BKG A;  3L17 A;  2BS4 B;  2AQ3 B;  3DDC B;  4LNI A;  1WX9 A;  3ZXV A;  4GIV A;  5IKC M;  2N9K A;  3LB8 C;  4S0R A;  1C79 A;  3B2G A;  3DOW A;  4IKG A;  1TS3 A;  1WZ0 A;  3Q8E A;  3PLU A;  3M95 A;  2D3A A;  2KWD A;  1V8C A;  4K7S A;  4YTM B;  3SR6 A;  4OZB A;  3AH7 A;  2J0J A;  4JPS A;  2BYF A;  2L8J A;  2KJ6 A;  3L13 A;  1SJE D;  2MX2 A;  1FFV A;  4IOI E;  1C77 A;  5DCN A;  2L0F A;  1N62 A;  1K50 A;  2D2Q A;  3QJZ A;  2NPT A;  1JML A;  1UNS A;  3IHP C;  4GXB A;  2YEP F;  4RF0 A;  3QWZ B;  2LD9 A;  2ON8 A;  3OG5 A;  3E9S A;  3APC A;  1NYQ A;  1EU3 A;  1V80 A;  2L00 B;  1ZUD 2;  1H4R A;  4REZ A;  4US8 A;  4JX1 C;  1RWS A;  1KJT A;  2MH7 A;  3DBS A;  4P7I A;  3H1U A;  1JWM D;  3DVG X;  3QQ8 B;  5I4D A;  2ZNV C;  1AAR A;  4EOY A;  3VXW A;  2DHZ A;  1T3Q A;  2G45 B;  2MCN B;  1KLV A;  2MBE A;  3B2F A;  3DVG Y;  4NY0 A;  4P16 A;  2JXX A;  1GUA B;  4ZRJ A;  1WXS A;  3ZJT A;  1VZ6 A;  4HWI B;  1E5W A;  2V1Y A;  1ZW7 A;  1J7A A;  1OGW A;  2J4X A;  2HJ1 A;  1I4X A;  1PQS A;  4L1B A;  4HVB A;  4I6P A;  2RMM A;  4MEM A;  1HTQ A;  1HQR D;  1IP9 A;  3EUB 2;  4MGK E;  4TQ0 A;  2C60 A;  3LDZ E;  4MM3 A;  1HEZ E;  2LZ6 A;  5D3I B;  3PT2 B;  4NNJ B;  1P0R A;  5AEK B;  5J2R A;  2NBU A;  2PE6 B;  4F7Z A;  4HJG E;  1WSP A;  2A4Z A;  1F52 A;  4AUQ C;  1NYR A;  3AMZ A;  3IXS A;  1HXY D;  3P4Q B;  2PJH A;  4EE2 A;  1XD3 B;  2AQ2 B;  2HE7 A;  2IPK D;  1ZDX A;  2OJR A;  2PKO A;  5AZF A;  3H9D A;  4NJ6 A;  3WAP A;  4NAW B;  4KV2 A;  2DEN B;  1J8C A;  3CWI A;  1Q0W B;  1F2R I;  2WXF A;  1UWM A;  5JXV A;  2KDE B;  1D5X C;  2YVC A;  2BWE S;  3I3T B;  1E8Z A;  1D6E C;  3AE3 B;  2XN9 C;  3ZDT A;  1JQ4 A;  4C56 C;  2AQ1 B;  2NBV B;  4BVU C;  1C4A A;  4GU2 A;  3V60 A;  1QZE A;  1VJK A;  2I2Y A;  4GSW A;  3QCA A;  4FAD A;  3BYY B;  4CYE A;  3JYU A;  1YN3 A;  4LTU A;  2YEP B;  2RPQ A;  3UIN B;  2KFK A;  2CS4 A;  5LXI B;  1WR1 A;  2HDE A;  2VZK B;  3A1Q B;  2J53 A;  1N5W A;  2WX0 A;  4XX5 A;  2BB5 A;  4IC7 B;  4IW0 A;  5HHD G;  4XE0 A;  2BYV E;  2WWZ A;  2Z0D B;  3V05 A;  4ICU A;  4J6I A;  3SU8 X;  4N6E B;  2D5G A;  4BKT A;  1UF0 A;  2LUM A;  1P3Q U;  1UBQ A;  3URY A;  5BO4 B;  1V1P B;  1SB3 C;  3ABV B;  3AEE B;  2MQJ A;  3ZNH B;  3K9P B;  3L10 B;  1FD6 A;  4NJC A;  4M0W B;  3PRZ A;  4MT5 A;  2JT4 B;  2INC C;  1ROE A;  2WXK A;  1KRH A;  4OHJ A;  4ZRQ A;  2WU2 B;  1FCC C;  1A5R A;  2LRU A;  1AWD A;  3BYT B;  3R8B A;  4WWN A;  3AEF B;  5FR3 A;  2FE8 A;  3L0W B;  2TSS A;  3O13 A;  3PZ7 A;  4A3P A;  4N58 A;  4NQL B;  4KVG B;  1WJN A;  1E7V A;  4GB9 A;  1L6V A;  3W5U B;  3P4R B;  2KTF A;  1IGD A;  1WR6 E;  1DGJ A;  1MPE A;  2IGH A;  4OZA A;  4XGA B;  4D2K A;  4OVV A;  3AE2 B;  4AWJ A;  4MGZ E;  3MJ5 A;  4JWU C;  1V81 A;  1JRO A;  2KYW A;  1NVI D;  4W9K A;  2KC2 A;  4MH0 E;  2ASQ A;  2CJN A;  1WM3 A;  4OW0 A;  3TCA A;  1WXQ A;  2FUH B;  1E8X A;  1PGA A;  4LNN A;  3PPA A;  1QOA A;  5DPW A;  4KSL C;  3HVZ A;  3IAS 1;  4YSZ B;  1KTK A;  1KLG D;  1PYW D;  3B0A A;  1T0S C;  4HK2 A;  3NG0 A;  4M00 A;  3Q8B A;  2WDR B;  2KQ7 A;  3C0R B;  2JUO A;  5E6N A;  2MW5 A;  4JQW C;  4WIP A;  2LFI A;  4ZYS A;  3D32 A;  2JXT A;  3W2D A;  2WHI A;  1WXA A;  2IGD A;  1BUI C;  3VHT C;  3ONS A;  4PYZ A;  1PUT A;  2O2V B;  1XCQ L;  4IG7 B;  3ZJV A;  3RN9 C;  4JGH B;  2IDY A;  3OWE B;  4C7Z A;  2C7M B;  4XC2 A;  5AZH A;  2QC8 A;  3U4E G;  4ZRI A;  5FR6 A;  4DXF A;  2R2Q A;  4WJQ A;  1B9R A;  1SE3 A;  4PS3 A;  4DDI D;  3RNG C;  4YL8 A;  2I1K A;  2K6D B;  3MHZ A;  1WH3 A;  3WAO A;  3EA6 A;  3RUI B;  5DPS A;  2VH2 A; 
#chains in the Genus database with same CATH homology
 3ZQ4 A;  4A8X C;  1V1O A;  4JE3 B;  4RNA A;  5HI1 A;  3KQ4 A;  2JU6 X;  1CJE A;  5HG2 A;  1R7S A;  1AW7 A;  2WS3 B;  3BII D;  2WXL A;  4ARC A;  2WNM A;  3VRB B;  1I4G A;  2Z8L A;  1N60 A;  3U52 E;  1ZOY B;  1T5X D;  2K0P A;  4RH6 A;  4YT0 B;  5GXG B;  4A9A A;  1KH0 A;  1ESF A;  1KF6 B;  3Q8C A;  1OQQ A;  2JX5 A;  2PIA A;  2MJ3 A;  3ZJU A;  1FEH A;  2M19 A;  1L0Y B;  1SIJ A;  4DQO C;  2WXR A;  2G1E A;  1YN5 A;  3VQI A;  1F0Z A;  3HVD A;  1F77 A;  2DWQ A;  1HZ5 A;  2G9H D;  1PDX A;  5BYS A;  1MVK A;  2W54 A;  1NEN B;  1TZO A;  2V3N A;  1D5Z C;  1SSN A;  4C7Y A;  1HZ6 A;  1QQR A;  2KN4 A;  2WDV B;  1PGX A;  1C76 A;  2M56 B;  1ET6 A;  2H89 B;  4RFB A;  3VRA B;  1ET9 A;  2L52 A;  3TSS A;  4CQN A;  4DXG A;  4AQ7 A;  1IBX B;  3B9J A;  2J52 A;  1EWY C;  2SEB D;  4H2A A;  5G5H A;  2W82 A;  3AN1 A;  1IBX A;  4HKQ A;  1QKZ A;  2OED A;  3AEB B;  2JYE A;  2BS4 B;  1OFF A;  2AQ3 B;  4USA A;  2VZK D;  1M4V A;  3BK1 A;  4GDL B;  2J42 A;  1CQV A;  2PW9 A;  1YQ3 B;  4UDU C;  2Y3A A;  2N9K A;  2Y5P A;  2CJO A;  3PZ8 A;  4LLG M;  3LB8 C;  4WUR A;  1C79 A;  4KX6 B;  3B2G A;  4IKG A;  1RM6 C;  4RF1 A;  1TS3 A;  3N9Y C;  2K22 A;  4P6V F;  3Q8E A;  3AEG B;  5H8Y E;  3GB1 A;  2DYO A;  1K51 A;  1XLP A;  4O1N A;  3T3O A;  1D5M C;  2CU3 A;  2HTM E;  2KWD A;  1E7P B;  5AUK A;  4C80 A;  1V8C A;  2N7J A;  4YTM B;  3SR6 A;  4IDI A;  3AE6 B;  3RFZ B;  1JWS D;  3HRD D;  4OZB A;  2I38 A;  3P63 A;  3AH7 A;  1QOF A;  2AX5 A;  3NVZ A;  1JWA D;  4JPS A;  2LJI A;  5EE9 A;  1E9M A;  4FXC A;  4OVZ A;  2DLB A;  3AEC B;  2BTE A;  2NTS A;  1RYJ A;  1P7F A;  1QOG A;  1SJE D;  1TS2 A;  2E3T A;  3BVG A;  3I57 A;  3P42 A;  1TKY A;  5BMH A;  1N63 A;  2PLP A;  2KQ4 X;  1PFD A;  2BS2 B;  2QSD A;  1FFV A;  4IOI E;  1C77 A;  1XLN A;  2XNA C;  1N62 A;  1K50 A;  1TKG A;  3LXF A;  2EEL A;  4L2Y A;  2W3S A;  1JML A;  3AE4 B;  1UNS A;  3AE5 B;  4RF0 A;  2YEP F;  1VZ8 A;  2L32 A;  1C4C A;  2ON8 A;  2WLB A;  3RPF C;  1VDV A;  3E9S A;  3PO0 A;  2WXG A;  5FKA C;  5C2T B;  5BYQ A;  2PMV A;  1NYQ A;  1EU3 A;  3TEY A;  1P7E A;  1B1Z A;  3AE1 B;  1ZUD 2;  4GDK B;  4REZ A;  4US8 A;  3W5V B;  2M0A A;  4JX1 C;  1RWS A;  1FMA D;  2MH7 A;  4A90 A;  2PVG C;  1TYG B;  4AS1 A;  1V97 A;  1ENF A;  1JWM D;  5EE3 A;  1L4D B;  1NI3 A;  1TY2 A;  5I4D A;  4R3D A;  1N61 A;  1T3Q A;  3B2F A;  2NMQ A;  1C9F A;  3MFG A;  1DYQ A;  1LO5 D;  4P16 A;  4YWG G;  2WXO A;  2DYM A;  1EWC A;  3UI3 A;  1MHX A;  1FIQ A;  1GB1 A;  2FUG 1;  4XDD A;  3ZJT A;  1VZ6 A;  1XO3 A;  4RCO A;  4A55 A;  4KGR A;  2BB6 A;  1J7A A;  1DOX A;  1ZXH A;  3R2T A;  2J4X A;  1I4X A;  3H8H A;  2WXQ A;  4L1B A;  1L0X B;  3IT4 B;  1YN4 A;  2RMM A;  1HQR D;  1L4Z B;  1I4P A;  4WAF A;  1A70 A;  3EUB 2;  4MM3 B;  2LEK A;  1RFK A;  4NAM A;  1I7H A;  3C8Y A;  4TQ0 A;  2L83 A;  1AN8 A;  3ZGZ A;  1SBB B;  1HEZ E;  5D3I B;  3FC4 A;  4WQM A;  1DOY A;  1VLB A;  3AB5 A;  5G5G A;  3VR8 B;  1TS4 A;  1L0V B;  3Q8A A;  4HJG E;  1WSP A;  2WU5 B;  3ZYY X;  1NYR A;  3AMZ A;  4ZOH C;  3IXS A;  3AE7 B;  1HXY D;  2IGG A;  2JZP A;  3P4Q B;  4EE2 A;  4B0M A;  1I4H A;  1FRD A;  2AQ2 B;  2IPK D;  3KWV A;  2NTT A;  2MJE A;  1C4P A;  1ZDX A;  5EE0 A;  2PKO A;  4WWM A;  2WXI A;  1EU4 A;  3BVZ A;  4KGT A;  2PVO D;  3U2S C;  4ITK A;  2ACZ B;  4NAW B;  1VRA B;  3W1S A;  1L6U A;  1ACC A;  1WYG A;  3CWI A;  1F2R I;  2BBC A;  2N9L A;  2WXF A;  2LMC A;  5AUI A;  3Q8F A;  1UWM A;  5JXV A;  1QIL A;  3V3X A;  2JSV X;  1D5X C;  1K53 A;  1XEE A;  2QIE B;  2RDH A;  2QEJ C;  3EGR A;  4L23 A;  1JAL A;  4YSY B;  3J9C A;  2V4I B;  1ZXI A;  2X38 A;  1D6E C;  1BML C;  3AE3 B;  3AEA B;  4XWW A;  2K3U A;  2XN9 C;  4HRO A;  2BS3 B;  4XWT A;  3VR9 B;  1JQ4 A;  2GI9 A;  5LNK 1;  1YQ4 B;  4C56 C;  2AQ1 B;  5HFY A;  3T3N A;  1C4A A;  2JWU A;  4A6Q A;  5D7G A;  1VJK A;  3NZ3 A;  2GB1 A;  2I2Y A;  1J7B A;  4RGT A;  3TEZ A;  1T6B X;  1JWB D;  2KDM A;  5E6J A;  3BYY B;  4TSS A;  1EM7 A;  1YN3 A;  4MH8 A;  4YTN B;  1JCK B;  1I4R A;  3R2I A;  4LTU A;  3DWM A;  3IT6 B;  3Q69 A;  1SF0 A;  2YEP B;  1ZP0 B;  5BMI A;  1TJE A;  3NVV A;  2HDE A;  2VZK B;  3LYY A;  1FXA A;  3TEW A;  3AE9 B;  4ZHP A;  2J53 A;  5BMG A;  1N5W A;  1CZP A;  2WDQ B;  1E6E B;  1TS5 A;  2BB5 A;  2INN E;  1J7C A;  5HHD G;  1KFY B;  4Q2J A;  4XE0 A;  1L5P A;  1YJJ A;  2IJ0 A;  1Q10 A;  2JQR B;  3V05 A;  4XDC A;  3FIL A;  3SFD B;  1FM0 D;  4RGO S;  3TEX A;  4JWS C;  1Y56 A;  4N6E B;  4ZRP A;  2D5G A;  3NUH B;  2LHD A;  2LUM A;  2WP9 B;  4J3O D;  1WGK A;  3URY A;  4LK0 M;  1V1P B;  4TMA B;  1SB3 C;  1UWX A;  2INP E;  1FRR A;  3ABV B;  1V1P A;  2W3R A;  3AEE B;  1IUE A;  1K52 A;  2MJD A;  2PTL A;  3DWG C;  1JWU D;  1GOZ A;  3SEB A;  2SAK A;  1FD6 A;  4RGM A;  2V0G A;  4NJC A;  5TSS A;  2KAJ A;  2GRI A;  1GB4 A;  1F2R C;  1SJH D;  4MT5 A;  2K9X A;  1I4Q A;  3BWU D;  4M0W A;  1ROE A;  3NRZ A;  2WXK A;  2WXN A;  1OQR A;  3NS1 A;  2L1A A;  4GLS C;  3U7Z A;  1KRH A;  4OHJ A;  3I9V 1;  1NEK B;  4WH4 A;  2BT6 A;  2WU2 B;  1FCC C;  4ZRQ A;  4ARI A;  2KMM A;  2QMT A;  2W55 A;  4PT5 A;  1AWD A;  1FFU A;  3CIR B;  3BYT B;  3R8B A;  1STE A;  1JRP A;  3AEF B;  4TQ1 A;  5FR3 A;  2FE8 A;  2JYT A;  2QJL A;  2TSS A;  3O13 A;  1QT9 A;  4HKZ E;  1N5X A;  3PZ7 A;  3GS2 A;  2OHF A;  3AED B;  2Q5W D;  4N58 A;  1FNV A;  1XXG A;  2ICI A;  5H92 C;  1L6V A;  5MPO A;  1YJI A;  3MP9 A;  3W5U B;  2BYT A;  1FNW A;  3BVM A;  3P4R B;  4ZHO A;  2QIL A;  2WXP A;  1SEB D;  3KLS X;  3GP7 A;  2R61 A;  3L4P A;  1ZDV A;  1IGD A;  1DGJ A;  1MPE A;  2IGH A;  4OZA A;  4D2K A;  2DBY A;  2N0S B;  3AE2 B;  3P1M A;  1YMH E;  4US9 A;  1HA5 A;  3HUI A;  1SXT A;  2WXH A;  3TUO A;  1QOB A;  2FBW B;  3MJ5 A;  1XLO A;  1WWT A;  4JWU C;  3AM9 A;  1JRO A;  1NVI D;  1C78 A;  3AE8 B;  3ETR A;  1VZ7 A;  2BW2 A;  1XCT L;  2CJN A;  2LHE A;  3WCQ A;  4OW0 A;  1WXQ A;  1XF5 L;  5EE1 A;  1PGA A;  4HEA 1;  4KKI A;  1AYF A;  1FNU A;  1SE4 A;  1MHH E;  1QOA A;  5T8I A;  1SE2 A;  3HVZ A;  3IAS 1;  3SFE B;  4YSZ B;  1QF6 A;  1DOI A;  1KTK A;  1KLG D;  1QLB B;  2RPV A;  1YNT E;  2LGI A;  1PYW D;  3AV8 A;  1MI0 A;  1UUP A;  4KGS A;  3P4S B;  4MAC A;  1ZPS A;  5FK9 C;  1FO4 A;  1CK1 A;  3Q8B A;  2WDR B;  1VR9 A;  2ZW0 A;  1XLQ A;  3E56 A;  4YTP B;  1FCL A;  2ZW1 A;  4NZL B;  5BYR A;  2WXJ A;  3NVW A;  4OZC A;  3W9C B;  4B0E A;  2RDG A;  1KLU D;  2ONQ A;  4WIP A;  1JW9 D;  3P4P B;  1FXI A;  1WRI A;  2LFI A;  2KAC A;  4ZYS A;  1BXT A;  2JXT A;  2WQY B;  3W2D A;  1PGB A;  2K5P A;  1D4B A;  2Y5C A;  2IGD A;  2WXM A;  1BUI C;  4KKJ A;  1PUT A;  2V3P A;  1XCQ L;  4RGN A;  4HRS A;  3BK2 A;  3ZJV A;  1TY0 A;  3NVY A;  3FAH A;  2EKI A;  3IAM 1;  2IDY A;  3OWE B;  4C7Z A;  2E6X A;  2MEK A;  3FIL B;  3KWL A;  2H88 B;  4YSX B;  1GPX A;  3U4E G;  3BZD B;  1UGJ A;  4N59 A;  4DXF A;  1E0Z A;  1GAQ B;  1B9R A;  1SE3 A;  5C3J B;  1E10 A;  3MC0 B;  4YXD B;  3MHZ A;  1ZE3 D;  1TKE A;  5D3D A;  3EA6 A;  2B76 B;  1IGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...