4LU5L

Structure of murine igg2a a20g2-fab in complex with vaccinia antigen a33r at the resolution of 2.9 angstroms
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
219
structure length
219
Chain Sequence
DVVMTQTPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGIYYCVQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of Anti-A33 Antibodies Reveal a Potent Cross-Species Orthopoxviruses Neutralizer.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Immune system
molecule keywords A33R
total genus 47
structure length 219
sequence length 219
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lu5L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lu5L01
4OLVL 4PTUB 1KULA 3SQBA 4PJXF 5CJOL 5DMKA 3OKEB 2VZTA 2D0HA 4KKBC 2IPTL 3VFWA 2GY5A 2NY5C 1CZ8H 1H3WM 4MCYB 1VADA 1TJIL 4R26H 4X5LA 2OQJA 1PLGH 1VFBA 4N5UA 3QFDA 5E9DE 3QDGA 1A3QA 5FIEA 1DQDH 4PJ5E 5FECA 2NMSA 3UJJL 2P47B 4S1DC 4KHXL 3H9SB 3LDBB 5ALBH 5I1IH 4R0LA 5EOTA 1NC2A 4LOUD 5GZND 3D39A 3ZKXC 4KDTA 1YEIH 4OGAC 3FB7A 3KYNA 4NKOB 2YS4A 2DDQL 3HE7C 4QRTB 4PJ8A 3S36H 3MCG1 4XVSL 3W9DA 4RAUA 5JXAL 1QPXA 1HNFA 2O5YL 3CAFA 2EDXA 4IOIB 2EDTA 5GGTL 2ITCA 5A3IC 1AI1H 5ELIA 3PIQB 5LGJA 4LEXL 2G75A 1R0AH 1X6NA 2H2PD 1YJDL 3IDIA 3JWOH 5DHYB 5JQ6H 3FHQA 1MJJB 3H3PH 2K1MA 3TA3D 2VXVH 2ZUXA 2QADD 1A1OB 2R2BB 5ITFA 3ZKQD 1K4DB 4KKLD 3PE9A 5IGXL 1U92A 1MCOL 3P30H 3TVMA 2FX7L 3OXRA 1JPST 3DUSA 4OJFH 4JR9H 4I48A 2YR3A 4CU8A 1AFVH 5DC0A 2ITCB 1AH1A 1L0QA 1QSFB 3A6CH 5I71B 4I18A 2XA8L 5D1ZA 3ULVF 4LHUD 2VKWA 4KK6C 1JVKA 3D85A 1I8MA 3TT1L 1F00I 1KCRL 3VMNA 3PGFH 5CJQH 3QUMA 3B9VA 4HS8L 3E8UH 3EYFA 2OZ4L 3MACL 3K4DA 1UACH 4ZXBB 4KK5D 3L3IA 4GW5A 3ULVH 4LSPL 3IETB 2HN7A 5D1ZC 5F7FA 5E2TH 4I18C 5DZOA 3KAAA 2GT9B 4HPYH 5IR1B 4MAYB 2ZSWB 4HUKB 3AB0C 2D03H 2GITB 4RGOH 1T03H 1FN4B 1UXWB 5TQ2L 1KUMA 3P11L 3T4YB 3CLFH 3KNBB 1J0IA 4FHBD 2EXYC 3OF6D 2PO6B 4PRNB 1EDQA 2IH1B 3MFGB 4GAJH 1YEGL 4GUPB 2P5EA 4NZUH 3MCLH 1RIHL 1Y6KR 1ZHKA 2DL9A 3VGAB 5EBWA 4AIZB 5SWSE 4DZBB 1J0HA 1DQLH 1H0DA 3UJJH 3NPSC 4NZUL 1I9RH 4H5SB 2DQGH 3E6FB 3U7YL 2FJGA 2AJSH 4UIMB 5DK2B 3OAYK 2A6IB 4OZFB 2ARWA 4TOYL 3BN9D 2V5TA 3LPGA 3MJGX 4YXLL 4ZAKA 3HZVA 1KCVL 4HH8A 4NOBA 2VLRD 2LVCA 3F7YB 12E8L 4R0LC 3DVFA 4ZTPL 1MF2L 5DRXA 3O6FA 5F7HA 2ERJC 4ZOBA 1L0YA 4YO0B 2AI0L 2Q6WB 1YEJL 1S7RA 2DJUA 2EYSB 2FEDD 1W0VB 4AEHH 1G7JA 3RVVD 3VJ6B 5EC1B 1IQWL 2XTJB 3HUJE 3BKJH 4L4TA 4BFIB 3EGSA 2E7LA 2CIKB 5EFIB 5BS0B 1FO0L 4Y5XC 3FMGH 3RU8H 3U7WH 2WV3A 3WJLA 3A6CL 5CBAA 3GBMH 1FBIL 4MD5A 5FO8A 3QUKA 1MJ7H 3OHXB 4XCNB 3O41A 4XWGH 1I8MB 5C9KA 2AJYH 2IANA 3TBSA 1E4XL 4XPTH 1N6QL 1F11A 4JFEB 3RY6C 3MQIA 3SE9L 4ZMAT 1OAKL 5CWSA 4KK9D 1YYML 2F8VA 4WWKC 3WXVH 3O6LH 1OAZH 1U8OA 1IGFH 1I1AC 3FQWB 5DQ9A 2PO6C 4KAQL 3ILQD 2FJHB 2ZP0T 4MNQE 4BZ2H 5T3XH 1QLRA 2QKIB 2ZWLT 5DJ0A 5C3TA 1CBVL 4U0QB 4OLYH 1LQSR 4ONFL 1G6VK 1I7UA 1AGFA 3G6JA 2A9ML 2VDLH 2FYYB 3CFIC 4LARL 3RWGA 3WXWL 3IDMA 2EC9U 4NM4L 1C12A 4U3XA 1J8HD 3MRRB 1U8HA 4HWBA 1I8KA 3P0VL 5MI0C 4UZGA 2UYLB 4NKOA 4QRTA 1KJMB 2AQ2A 2ZUUA 1IKNC 3KJ6H 2EDBA 5C2BL 3SQOL 4JG1H 4UT6L 4UILL 2GJ6B 2BNRA 2DKUA 5FAAA 4Y5VC 2OJEB 4ZTOH 4ORZC 4YHYC 2PTTB 5GGRB 4KRPB 4GG6F 2DBJA 2F8OA 4J7RA 4OM1L 1WZ1L 5GIRA 3BH8A 3D3VD 3CCHB 2VNCA 4I13B 1IRAY 4Z5RA 3G5VB 4U7SA 1MEXL 2BFVH 2R1YB 4NO0B 3R06A 2DAVA 5EBLA 2AJUL 4YPGB 3QEQB 3QCTL 3LS5L 4B5EA 2K9UA 5ISZB 3VXPB 1HHKA 3BKCH 3KS0H 3MXVH 4R4ND 1BVLB 3BGFB 4K7FB 1CG9B 1B6DA 4KMQA 3C87A 3MV9B 1RK0B 2VL5A 4M61A 3KHQA 5CEXB 1IBGH 1S7TA 3VDAA 4FRWA 4TSBH 4Y1AE 2CK0L 4PLJC 1T1YA 4PRAB 5GS0H 4FFZL 1EEYB 3BUYA 3ZYOA 4P2RE 1FC1A 4W4OA 1LE9B 1MFBH 3FHAA 2ARJQ 4CVUA 5GRJH 2VDQL 4BZ1H 4RMWA 4FFVC 1BFOB 2IH3B 4FP8H 4U6HA 3WHXA 4NJ9L 2KUTA 3L3DA 3TBWA 4QHMB 1UM6L 3GMRB 4JHZA 4ODXB 1MRFH 3BZFA 1IM9B 3L3GB 1ERNA 4X6BB 4LCUB 2FEDC 4EI6B 3CVIL 4B7IA 4P4KD 4PGZA 4RFEB 2BK8A 5T1DH 1ZWIA 5I8CA 4PS4L 3IJYB 1FVEB 5E2VL 3ZKSD 4B53A 1CGSL 1M05B 5MENE 1S5HA 5MI0B 5AAMA 3OKDA 2DLFL 3KXFB 4NPYB 4RGOL 1NGQL 3ES6A 3I3EA 1CFSB 4WHCA 3MLXH 3PQYE 4YHLL 4JDVB 2DKMA 3L1OL 5J56B 3T77B 2XY2A 5F1NA 4ZUTB 5LCVL 3K2UL 2VQUA 1Z0NA 1JWUB 1GL4B 3OXSA 5IVZB 1KCRH 4K8RL 3REWA 1Z9MA 4F3FB 3GMLA 1RUML 1N2RA 3IFLH 3C8DA 2J5LB 3HAEH 4PJHA 1PY4A 3C6SB 4BSWA 5LXGH 4XBGB 1JHKH 4Z7VB 4L8BA 4MMZC 4XP1H 43C9B 3FFCE 4JO3L 1HILA 4YX2L 5IB2B 1NAMH 4FQXB 4UDUA 1MOEA 2GCYB 4ENED 5F1KC 4MMXC 1R5IB 1VEPA 5E7FA 4KK5C 4LPCA 1VPOL 1OB1B 4XNXH 3NIDF 5DRZA 3CVHA 4OF5A 4XNYL 5ABDE 1KFAH 2X5PA 4WV1C 4OTXL 1YNLH 4FQLH 3TWCL 3HI1B 3UTQB 2WAHA 1JWSB 2XT1B 1HHIB 1QSED 4KK6D 1Z5LA 3GGWA 1UM4H 3RWCA 3BKML 5IG7B 3L3KA 1FVDB 5IMOA 4PGBA 1UEMA 3PQYA 2WWKT 4YR6B 4PJ7E 4YXKL 2XWJB 2OL3L 1OLZA 4QGYA 3N85H 3VRIA 1KN2H 2ED7A 1IILE 4ZYKA 4WUKH 3MXWL 3QUMB 2G2RB 4KUZH 2HT2D 3RWDA 2B20A 1AIFA 3KPPB 4PV9A 4DCQA 4KMTH 4MS8C 1JWMA 5ACLA 4J3SA 5E0QA 1FL6B 3DRTB 4YDKH 1I1YA 3CDCA 5MP6H 5A3ID 2OCFD 3RWFB 43CAB 3U9PL 1W0YT 4NSKA 3AY4A 8FABA 1JN6A 3ALWA 3WJLC 1A6PA 4P23D 2AEWA 1GPOH 1KPUA 4Y5XA 2NXYC 3LRGA 3BPOB 4F7MA 5JPMA 3T0AA 2E7LC 2CMRL 1QFWL 3IVKB 4JM2D 3T0EC 2X2YA 1CXIA 2FL5A 1D5ZB 2FB4L 3F58H 5DJ6B 1I7TA 2CGRL 3MRNB 2BVPA 4HXBL 4NKQB 1N7ML 4JPIA 1H15A 4MJ4A 4RWHA 1QHOA 1X4XA 3E8UL 1R3LA 4JPVL 4Y4FC 3T3PF 1REIA 1V5JA 3ULUH 5FO8B 3S7GA 3R8QA 4KKBD 5I2IB 1NLDL 3QI9B 1T80A 3TJEH 2I60L 3HG1A 1E4KC 3MBEB 2R2EA 5J89A 2HVJA 3FB8A 3QUXD 3L5WB 3W5MA 5B38A 2E8YA 5DD0L 5CCKL 5MEQB 3N1GC 1NMAH 4PB0H 3V9FA 5SX4H 5D1XC 3DX9B 5BO1H 3N9GL 5JHLH 2W0PA 2Y5TB 2QQKL 1W0VA 4PRBA 1JYVA 3I50L 4HFUL 1VADB 3GSQB 5ALCL 4OZIA 1P84J 2R4SL 3LQAH 3MRLB 4EDXB 4X6EB 3VFOA 1FSKB 3E3QE 4O00A 1C8PA 3A67H 3NA9L 3RIFF 2PR4L 4TVPD 3SDDA 4HUXA 2VITB 5KSVA 2HTKC 1S9KC 2VLJA 3L7FA 2V9TA 1RJYA 4MA8L 3RP1A 1RZGB 3HA0A 2AGJH 4O2CB 2HKFH 4Q9QH 5DMJB 5JOFB 3MO1A 1ZS8B 4KXZH 3FO1A 4JFZL 5E6IA 1F6AA 4U1SA 1AD0A 1DBJH 1ADQH 1JNLL 1MWAA 3DX8B 3S35L 3L9RA 3NIDE 3GFUA 3JTSB 1BJ8A 2FATH 3U0PA 3MA7B 1MCQA 5INCB 4HUXB 2MMXA 4E5XA 2VISA 1CT8A 1PLGL 3GBLA 4G43A 4HHAA 4L1DA 1GCFA 1TCRB 2XWTA 2YA2A 5TE4L 3MGTB 5KSBF 1VCAA 4LSUH 5C0EB 1L7IH 1N6VA 4RBPK 2AJXH 2MQCA 2PR4H 3UZEA 1F42A 4LVHB 4PRBB 3GRWH 3RFZC 2H3NB 1U95B 3NFPB 4WCYL 3F8UB 4XXDA 3PL6C 1GZQA 4BK4A 3KPSD 4NUGL 1NANH 3L5WA 2A73B 5DSCB 5ICXA 4I5BA 1FO0B 4HJGB 3RWEA 1SJXA 4MJ6A 1T1XA 4TRPL 3NCJH 4LCUA 4YAQB 2IBGA 4HKZA 2ZUWA 4KTEL 2FHFA 2MTPA 3VH8G 3QWQB 1N3NB 2P5WD 4OCRL 4R7DB 3ZKNC 4OBSA 5E2UL 3UJIL 1Q72H 4P5TD 4F15C 3CFBB 2D7MA 4HSQA 3LN5B 3KPOB 3KR3H 3ARRA 1K4DA 1FNAA 1R3JA 5HPOA 5HHMB 4OAWA 4JFFE 1LGVA 3RZCD 1KTDA 5HI3C 1A1MA 4PRAA 5FHAL 3U0WH 4NN7B 3SDCB 1M6OA 5GGQL 5IBTH 5C07B 1AD9A 1IAIH 5GS2H 5C92A 4NN6C 4ODSH 3GJFA 4M6NL 5ID0B 3IXAA 1U2CA 3KWWA 3MNVB 3LH2H 1J8HE 5DFWH 4MVBD 3I02A 4IRJD 2CSPA 2NXYD 1M1SA 3U4EB 3RWDB 1U8MB 2B5IC 2EDFA 3D6GA 5BQ7B 2R8SL 2GIYA 1EHLH 1OARL 3CX5K 3MRPB 1V7MH 1BAFH 1YEKH 2UVFA 3RKPA 3FO9B 4X6FB 3NAAH 4WHYG 3SDCC 1MCLA 4XBEL 3VWKA 5JLZB 1CGWA 4Q9RL 2ESVD 5D7LA 3JV6A 3K46A 1KIPB 5F3BB 2NY6C 3ZYZA 4OT1L 3QEGH 4GRWH 3MGTA 5ICYB 3LMJL 1JGLH 3OG6B 4PTUA 1P2CB 4GAGH 4XNZB 4ZUSA 5A16B 4V1DA 4GRLC 2VXSH 4FQ2L 2B39A 1TPXC 4GFTB 4JRWA 5I9QB 1P9MC 1TNMA 3WL9A 2AJZA 3CLEL 4XP9L 4M8QB 3DETC 4WO4B 4X4XB 2ADJA 4QOKA 1KIRB 2BC4A 5IM7B 1ZLUK 1KJ3L 4QTHA 2B1HL 1BZ9A 1HKLL 4ZFFA 1K4CA 2EDEA 3D25A 4UNTA 3M07A 3C9NA 4YIQA 1YMHB 5CIPA 3UO1H 3Q6FB 4PRPA 4HUUA 4OFIA 1ZSDB 1NAMB 2DQEH 1LK2A 3DV6B 4CUCA 1PG7W 2X7LB 5LGHH 3OMZA 3GSRB 3QSKB 1X5ZA 4G80A 4NN7C 1CICC 3EJZD 1O0VA 1J5OH 4F7CB 4ZUTA 2VZOA 2UY6A 4HIHB 5D4QA 4H8WL 5F7KC 4KU1A 5DD3H 2YPLB 4WHYH 3PWLB 5D7SH 4NP4H 1IAMA 1I4FA 4PPTA 3RQ3A 3C09C 4R8WL 3S98A 4HWEH 5C6TL 2ZNXA 3CGTA 1C5CL 2V5RA 1A6TA 5KOVC 2R39A 5ICXB 3GB7B 2W59A 3QEHA 2AV1A 3MFFA 4KJWC 3RIAF 2LAAA 3ARGD 5E7BA 4R4BB 4OD1H 5ESQB 2HT3C 4KV5E 3PWLA 5DXWA 1F90H 5T33H 3KPRE 3MLSH 4RFNB 2NY2C 3BP7A 2VC2H 3SKOB 5C0FA 1ZA3A 3FRPG 3NACL 1Q1JL 2FR4B 3SDAA 1TZIB 5BVPH 1A6ZB 1QSFD 2IC2A 1G6RL 1P84K 2ICWA 1JNNL 1KN4H 3BJ91 4WI9A 3PUCA 4HUNB 5I19L 3KYOB 3QISA 3DYMA 2P8PA 5F6IC 4ZFGL 3D25B 1QOKA 1MFAL 4FQQA 4M93B 4YDJA 3DRTA 3G6AB 4FOMA 2Q8BH 2P24B 4KI5C 5T5NF 5KG9B 1RJZA 3X3FH 4I4WA 2X4SA 2H9GB 4CAGA 5HDQH 1UKTA 3MBXL 4LMQI 4H88H 3UPRB 4UQ2A 1K6QH 4BFBD 1TLKA 5SWZB 1GZPB 2GHWB 5F9JB 2B4CH 5HY9B 3QNZA 1NGZA 4U1JA 4N9GB 4QHKJ 4M02A 1JI1A 2OTWB 4MJIA 2EDHA 2Q8AL 5DJZB 3QUXA 2B0SH 4JREC 1P4LA 1Q9KB 3BW9B 1SHMA 1NC4A 1P69B 2Y5TA 4KXZI 4LKXB 4X6CF 5HI5D 4F37K 5JW4M 3WD5L 5DC9B 4H0GA 3L3IB 3C2AH 3NCCB 1CGYA 2E8ZA 4PJDB 5EZJA 3MLRL 5TH2B 3SGDI 4LEOA 3BVNB 5EORL 1MCPL 1EEZB 4NHCH 3RPIA 3PGCB 2HJFA 1VGKA 5FYKU 1JNJA 3MBEC 4JN2B 3U4EA 1NFDB 4JKPH 4JCLA 1AGBA 5CD5D 5J57B 5EU5A 1MH5B 3ZE0E 1X5IA 2Q76B 3PHSA 3KPRD 1JNHB 2VQTA 1RY7B 1T0PB 4Y19D 4IDLA 4LIQE 3QIUB 1NCWL 4XI5D 2VLJE 1LP9A 4O51A 4WFGD 3CK0L 1E28A 2BNQB 4JQIH 2G9HA 1B0WA 3FO0L 1A6ZA 3IKKA 4R7NB 3IU3A 3T2OA 1U8OB 2EXWC 4POZD 1DUZA 5EZOL 1DBAH 2FX8L 2UWEE 5E08L 4N90D 2LAGB 4WU5A 4E0RB 2OM5A 1T89C 1EJOL 2DOCA 3LPWA 4DKEL 4MJ6B 1ACYL 3F6IA 5JO5A 2VLRE 3JV4A 1A2YA 3BPNB 4YDIL 4NQTA 3ARQA 2ZCKH 4M4PA 3MNZA 3F7RA 2CIKA 3T2QA 1LE5A 1UFUA 2PXYA 3I6KB 1X5JA 3UBXI 1MREH 5C09B 5DQJA 1SEQL 3OX8A 5I8EB 5T5FL 2NY7L 4ZTPH 1ORSA 1HSBB 1OGAE 1UCBL 2P5WA 5CZXC 5I1AB 1BF8A 2GUOB 2XWTB 3GNML 4BKLA 4K3EH 1GAFL 5I74C 2B1AL 2X40A 3HE7D 2CLVB 4WUUA 3GSNL 5HY9A 3MLYL 4L3EA 3LB6D 5I1CL 3NIGF 4P57B 2MOVA 2XA3A 4KKNA 1IFHH 1BVKB 5L2KE 4XC1L 1JMXA 2V2XA 5CMAA 1H5BC 2PF6A 5JOPD 1U8PA 1EBAA 2MNUA 2D7QA 3AM8A 4P2QA 3RDTD 5J6HB 4P5MB 1DQJB 3TNMA 3MLPA 4NCC1 3S5LG 1BD2E 1ZMYA 3PWPD 5DVOA 5EBWB 4IRJA 4UT9H 3HC0A 3WIFB 4WRLA 2YKLH 5D7JC 5DUMH 2FIRT 3MR9A 1UADC 4FQJL 4HCRH 4NNPL 3FCTB 4MDJB 4B50A 3BP6B 5DURD 1OPGL 4X7TB 3P9WB 5GISH 5D70L 2X44D 3KPMA 1UACL 5JUEH 2P8LB 3MV11 3OKYA 5CP7B 4JAMB 4X4YB 3VWJC 1NGPL 1J1XL 3UTZB 1CQKA 1ORSB 4PRHA 4MNGE 3P4NA 2QR0B 4FN0A 4NKDA 1IC5H 4XAKE 2DQIH 4RGNC 4G7YH 2H32H 4AH2B 2QSVA 3KG5A 4WW1A 4PJ5A 4TN9A 5KVEL 2HVJB 3PWVB 4YDVA 4IHOA 5MENA 5HYJA 3VFRA 1AFVL 4HKJA 4ELME 1T0MB 2HA1A 2GSGB 1CIUA 4UT7H 2LTQC 3O0RL 3BI9X 4G9FD 1QO3A 1TETL 2GSIA 4YHIB 4U0RC 2X1OA 3K1DA 2BVPB 3SHSA 2I26N 1A4KB 4K94H 3TT1H 5FOJA 2O61B 5JIHA 4Y2DA 5J12B 3FQUB 1MFNA 3IVKA 5KTEH 5HGBA 1IT9H 3C60D 5I1JL 2DQIL 4P49A 1MVUA 1FORH 3JWDL 1LO3H 2QHRL 3X14B 4X7DC 4ACPA 4Q6IA 3LMJH 1CLOH 5K9JH 4WNQB 3LB6C 1QVOA 1MNUL 3EZJB 5HTSA 5JIPA 4JHAL 1I1YB 4H8WC 4LSDA 1NCWH 5EA0H 1DQTA 1I1AA 1TVDA 2BXYA 1EGJA 4IRSC 1EGJL 1YC7A 1XGRB 2FCBA 2HMID 4HJGA 2ADJB 3D39B 3Q5YA 2HJFB 2OMBA 4J3UA 2EH8H 4MNHB 4P5KB 4D2NA 2CKBA 1KOAA 3ZTJG 2YXMA 1RV6X 1RZ8A 3DI3B 1DQMH 2VXUH 3QFJB 4YHKH 1ZVHA 4XWOC 4PJGF 2X10A 2E3VA 3L3KB 5L0QB 2VDPL 5CBEA 2EYSA 2VDMH 4NKMB 4WWKB 2ZOLA 1IGIL 4LMQE 2XTJD 1INDL 1JV5B 2YD9A 1ND0A 2WIIB 3FN0H 4KRPC 5IB4A 4LRIC 3ARDC 4LAQH 4POZC 1D5BB 2HYMA 4XCYA 3STLB 3QDMB 3WUWB 2IBZY 3LD8C 2WBWB 1CL7L 2YC1A 4YDLC 3VG9C 3WFZA 4I4WB 2X89D 2NY0D 3OPZH 2Y07L 3ZDYF 3E6FA 2WINA 4HPOL 1QKZH 3RVUC 3MUY1 1PVHA 1SMAA 3C60B 2Y07H 3ZL4H 2BNUB 4NFBA 2FLBT 4MQ7A 2EE6A 3KLHD 4FQHA 2WQRA 3LVEA 3CMGA 4JQXC 1TJHL 2CDGB 3TM6A 3NVQA 3VXTA 2CGRH 4N0UA 3SCMB 3UPCA 5E08H 2YWYA 5EU7E 1DBBL 2HLAA 1MHPH 2XKSA 4BK5A 2YXFA 1A5FL 5BCAA 4M7LL 4MJID 3GZKA 1QPPA 3QT2A 4DVBB 5IBUG 3O6MH 5I18L 5IVXE 3EFFA 4P3WA 3NZ8A 1FO0A 3IDXL 4OFYA 2HLFC 1HINH 1KXVC 5DF0A 1S3KL 2NW2A 5GSVA 1GC1H 4XCEB 4XH2B 1AXSA 4RGNB 3QJFB 1S78C 2OJZL 1F97A 4JCMA 2W65A 1YMMA 3KPTA 1WIPA 1MFCH 4QRRD 3MRDB 3RKDD 3HS0A 5F1SA 2J12B 2YPVL 1E6OH 1QFWM 3S3PA 3WKMH 3V6OA 2XQYG 3EO9H 3SE8H 2R0KH 5KANI 4U1KB 1UM4L 2JIXD 4PV8A 3BP6A 5TDPA 1RIUH 4I0CC 3BUYB 3VXTB 3W82A 1AO7E 2BNUA 1FYTA 1CGVA 1WCQA 3U0PB 3HCVB 3TVMC 5DUBA 3STBA 4ZFFB 4LGPB 2VLLB 4WFED 2CRZA 3BSZL 2R23B 4Y8AA 1DL7H 2ICWJ 1D5MA 4YX2H 1UWEL 1P1ZB 1JYXA 4NM8L 4ONOA 1PYWA 1S78D 3MMEB 5K59F 2FIKB 2CJUH 3UTPD 4PY8I 4MJ5A 4PJ8C 4MAYD 3N0PB 4MAYC 5I1KH 5KVEH 1AXTL 1DE4A 2X09A 3P0YH 4IOFC 5DJ8A 5CBEB 4Z76B 3BGFC 4DUXA 2C1PA 5GIRB 2WBJD 2PXYD 1T0NB 3CCHA 4YHMH 4G6KH 2CR3A 4XP6H 4FQCL 3RI5K 1QSEB 1VKXA 4L8SA 5I6XB 2WK2A 3T3PE 4A6YL 4F80A 5KSUA 3OKNB 4JZOB 4UT9L 5JO5B 4M5YL 4L8CB 4Y4KA 2FGWL 2CPCA 4L3ED 3QJHA 2X4SB 1X4ZA 1RUAL 3MRRA 1OQXA 4JFHD 5JORB 4YXLH 3IDXH 2SEBB 4KC3B 5KS9A 1CGUA 4S11A 3BQUD 4D9LH 4WI3A 5DI8A 3RDTA 2NY0C 2Z31A 1E28B 4JGJA 4R97C 1NMCC 3KLDA 3GMNA 2GAZB 4XMKH 5HGBB 3H7LA 4IMLB 2AVGA 4G6MH 4PRID 1WITA 4NSKB 4NWTL 5IHUL 4PJXE 3HS0B 4OKDA 1B4JL 4P4RB 3R0NA 1HH9B 2BSRA 1CXHA 3B8SA 3TBSB 4KH2A 1IL1B 4OZ4A 1NQBA 3DO7B 1BD2D 1FFOA 3UZQA 2G2RA 5E2UH 3UJIH 1HDMA 3NCJL 3TN0B 5TDOA 1T6VN 4NQXB 5FUCE 4PJBF 4A2MA 2YD8A 1ACYH 4PJ5B 3MRBA 4Y4HA 2VZSA 1BOGB 5FGBC 2EDDA 2AW2A 2X05A 1XMWA 1KEML 2DB8A 4U6XB 5ANME 2DLEA 3ARSA 1JNNH 2C1OA 3GSUA 4R2GD 5TPWH 3WFEH 5F9OL 3OR6B 3KHOA 4JM2F 3LV3B 5IB3B 3D2UB 3DMMB 3KJ4C 4BQ9A 5J0BA 4LP5A 5E1AB 5GSRA 3I2CH 1MHHA 3P9MA 1SEBB 4ELMA 2AK1L 5IQ9A 5DEGA 4NO2A 1C7SA 4D0DA 3QDJD 2QSCH 1LILA 3MOQA 4D8PA 4GMSL 3MV7A 1ZE3C 1I9JL 2ZSVA 2Z4QB 3T0DA 4MLIA 1K4CB 3MRFB 5IKCA 3BDBA 4KK8D 2RAMA 5AG9A 4H25A 5IW1B 3STZA 5C2BH 1T2QL 3DYPA 2M2DA 4PJGE 4I9WD 4HGMA 4HQQH 4EJ1C 4NQCA 4F7TA 4N8PA 4I2XE 3P40A 2X9XA 4PJFE 3NABH 3T4YA 1YPZA 4HKXB 2NW3B 3WYRA 5C0IA 3MLRH 4BZ2L 4XP4H 4HW6A 3EJYC 4NQDD 3V7MA 4B0MM 3DRQB 4RGND 1U8NA 3LKPB 2PNDA 3FRPA 3ARGB 3C5SB 2DBLH 5GHWL 2X4OB 3EOAB 3L3OA 2HFGL 4Y4HB 1PY9A 1VENA 2OS7A 1TPXB 2BY1A 2DI7A 5I9QC 4U7KA 1KJ3H 1K6QL 4LLWB 4GRLB 4M1GH 4YHNA 1JGUH 3KPQA 4H26B 3KYKH 3RVVC 4PB9L 3ARVA 4FTVE 3WN5C 1IAII 1FPTL 1I4FB 3U79A 1X5AA 1ZLSL 3ESVF 3MV8E 3T8XB 5D71H 4MCZB 2V6HA 1D9KA 3V6OE 1TXKA 5FUOH 3QDHA 4YEFA 3ARFA 4WW2B 4KJQC 1JUFB 2G9HB 3V6FA 4KZDL 5DS8A 3CD4A 4JFDD 1LE9A 4CL7A 3RPKA 4GKZB 1G9MC 5D93B 4OZIE 2UWEA 4XGZA 3RL2A 5BV7B 3CFBA 3BOVA 4FQ1L 3RZCB 1JZ6A 2G75B 2ZNWA 5B39G 5KS9E 3FT3A 3G08B 3WSQH 4K23H 2IPKA 1S7XB 4YHIA 3RWIB 2IQAB 4DFIA 4OZHF 1V3MA 3QWOB 1HHKB 2D9CA 5M94B 1QRND 3HR5B 1DFBH 5GGSA 1T0MA 4JFPA 1UKQA 2X4TA 3OAYH 2PN5A 1U8JB 4OZGF 5F7DB 3ZE1E 3EW3B 4JM4L 1GGCH 5JW3L 1I9RL 3U7YH 2E7HA 3A6BH 2EH8L 3HPJA 4NRYB 4N0YL 1WWWX 4V1DB 5DD1L 4PY7B 4PJDA 2J8UE 1ZVSB 2IGFL 3LSOB 2CDFA 4N0FA 4XXDB 3UYPA 3P0VH 4UNUA 1IC4H 1UH4A 2N1KA 4NC0B 3U9UB 4KQ4H 5BJTB 2NXZC 3LEXB 4XVTL 5CP7A 4JB9H 3NCYS 5EIIA 1DE4B 2A6DA 1OP3H 5I0ZA 3MLUH 4AJ0A 3UX9B 1BM3L 3DVNA 5BRZE 1JP5A 2J2ZA 1S5IL 4MSWA 2VLKA 5DD3L 3CVHB 4LCWA 1Q0YL 5B22A 3FKUS 3LCYA 1IM3A 4WI8A 3ELAT 1IC7H 3AAZB 1VFMA 5K93A 2GJ6A 4KRMB 4NM8H 3H2WA 3T0ED 2P1YA 5IB2A 1KCKA 4IBLT 3IAGC 2B7DT 3QR2A 4K71C 1UH3A 3P73A 1ZT7B 1SY6A 1DLHA 5IBUB 5KW9L 1FYTD 4ZD3L 4BSWB 5HVFB 3V4VH 4F2MA 2JELH 3FFCB 4JO3H 4LVHC 2NX5D 1EVUA 3FO1B 5E6IB 5F89B 2KQNA 3VD4A 1HKLH 4OM0L 5EO1B 1XF4B 3W5NA 4XPFL 1AO7A 1HOCB 2UWEB 2VE6A 3EUUA 3FT2B 3TNNB 4D94A 1JF5A 3QZWB 5KSAA 3QUZB 2O5XL 2IADA 3J7HA 4JZJC 5T3XD 1OP5H 2YOCA 3T1FA 1UWGL 1EMTH 1JUFA 4RMQA 3VFVA 2ZG1A 4JQIL 4OZIB 1EK3A 2DS4A 2OR9H 4H1LH 3F58L 4TQEL 1ZHLA 2RIKA 3PDGA 5DD1H 4HQQL 2BVOB 3T4AB 1RUPH 1Z3GH 1BOYA 1DEDA 2QQLH 4P9HL 5H37G 3DSNA 5IFJA 1YEHL 1HHJB 1INEL 2CQVA 1XGPA 2WBJA 4ZXBA 3EDKA 3U1SH 4CN6A 4PGJA 3CH1A 2NW2B 2ED9A 3F7PC 4JFZH 4U4BA 1YY9D 2EXWD 4WFFE 4Q2ZB 4F7PA 1IGTA 4C55A 1CICB 3FN3A 3D69A 1OAXH 1RMFH 1U3HC 2GFBB 3RA7L 4UBDD 4PREB 5DVNA 5KTEL 2NXZD 2D31A 4NCC2 2VQ1B 3MSPA 4X7SH 3VXSB 3QHZL 3FRUB 4LHUB 1KCLA 3MLYH 5IMLB 4Y1AD 1GHFL 1XR9B 1TQCC 2LU7A 1XH3A 4G9DB 3F65A 5KJRH 3KR3L 5C08B 4HS3B 4JVUA 1ZSDA 3HC0B 3WIFA 1NAMA 5FUOL 4PJAE 3JWOC 2WINB 4OSUH 4RNRA 2PYFB 5FYJU 1OP9A 2ZCKL 3ZTJH 4HV8A 4F57H 3PWUB 4XBPA 1EPFA 4JFQB 5LAXA 3MRQA 4P59L 2NY2D 2Z4QA 2AJZB 4U2ZA 4X5XA 1G9NL 3H3KA 4WO4A 3RNQA 4HX1A 5F1IA 1BVKA 2DLHA 3IGAB 4OCNC 4NO0A 1ZLVK 5D7KD 3MXVL 1FSKC 1KIQA 1Q8MA 3MLZL 2VXQH 3P77B 4F8QA 4Z0XA 4WW2F 1DSFL 4NKMA 4HXAH 3O4LE 1KBGL 3VGHA 2WUCL 1KIPA 5F3BA 1T4KB 3QQ3B 5L88H 3QCVH 4TNWF 4DJMA 1V3KA 3RX8A 5IMMA 2F5AH 3I6KA 6FABL 2PXYB 4I0PC 3WNNA 4NQSB 2A6KB 1MCOH 2VERN 2OJEA 1MCNA 3QA3B 3VFPA 1MCIA 4LSRH 4NN5C 3FB8B 2NZIA 3EJZC 4YFLI 2C4FT 1TVBA 2XZCH 4DGIH 2WNGA 3HMXA 5GGTA 4WJ5B 4GRMB 3JWOL 1NGWA 4MB4A 4PP2A 4ONGH 3DXAB 2I9TB 3NGBB 5IHLB 3ZT7A 4CN1A 1S9VA 1I7ZB 2XXMB 3FOMB 1P4BH 1I7TB 2A9MH 3MRNA 2JK5A 2F5BH 3EBAA 1Y18A 1RJLB 1ONQA 1DEEB 2DM7A 3RNKA 3KLAA 4XZUA 1SEQH 5T5FH 1L0XA 4R4FH 2HT3D 4M03A 1PG7X 3EYSH 3V6FB 2YMXH 3KPRB 5DMIH 4DFHA 2DM3A 2APWA 4WW2A 3WFCH 1JRHH 4AL8L 3ZE0F 2CLRB 2B5IB 3DXAD 2O61A 3QXDB 3VXSA 1S9VB 3NIFF 3UMTA 2VXQL 5BZWA 1I1CA 4J4PC 1FC2D 2E6QA 4HKZB 5CJOH 2NY6D 1HXYA 1B88A 5GS0L 2JLLA 3IB4A 4H26A 5JIIA 4PLKC 4L8DB 5BMFL 2A73A 5IESL 4UT7L 4LCWE 1ORQA 3VDBA 4FZEL 3R0MA 3BQUC 1NDGB 1RUMH 2J8OA 1SYSA 1CICD 2OMNA 1PZUB 4AH2A 1MJ7L 4QO1A 5IJVB 1A8JH 1S5IH 4RQQA 4R2GC 1N4XH 3LEVH 3BRGC 3HC4L 5B3NA 1X44A 1Z5LB 4YHZH 3RVUD 2CRMA 1EHXA 2R0ZL 1FVCB 2JB6A 4WV1B 5TFSL 3JZ7A 5JUEL 4LAQL 3QEGL 1D9KD 1FH5H 5HGHA 2OTWA 5IQ7L 1U93B 5GRWA 3L5JA 3O6FB 2Y36L 1E27B 4WGVB 4N8VA 4G42B 2I9LA 4S2SA 1HINL 3QXUA 3UXFA 5HI3D 3QQ4B 1GGCL 4JFDA 4HT1H 4W6XB 4X7SL 3SJVE 3ULSA 1KTRL 4QXGL 4GOSA 1GYAA 1TJGH 4ZSOB 4P9ML 1BZ9B 5LAXB 5FYKL 3W0WA 3HC3H 1LDPH 4KI1A 3KPLA 1DR9A 1ED3B 4UUJB 3O2DL 4M6OH 4UAOC 3QNXA 2YC1B 4OZGA 2EIEA 4JZNB 1JTPA 3QO1A 5T1KD 3X12A 4JFOA 1OY3B 4EZMA 3VFOB 4AEFA 4XCFH 4HMCA 2V17H 4UNVA 3B9KB 5CEYB 4Q58C 3HG1E 4P48A 4J3TA 1O5DT 4PRHE 4EDWH 3QDME 1TZIA 5I30H 1R3IL 3VFSA 4IRSD 5IMKB 1GRWA 1A7RL 1HQRB 1JTOA 5B3JF 2NR6C 4AM0B 1NCDL 3FQRB 1DDHA 3HB3C 3WNMA 1K8IA 1OLLA 3QH3B 1EUUA 2A6JA 3BKCL 4OCXL 2FO4B 2J8UA 2HFGH 5DRWB 2ATKB 4OCMC 4HGWB 3MLTA 4TUKH 2B1HH 4FTVD 3HE6A 3CH1B 2CO6B 4FFWC 2GJ6D 3IRPX 3MV8D 1F6FB 1PDKA 3D39D 3BUTA 4HIEA 2R4RH 5FKAA 2FEEI 1WFTA 4P5TC 3V52H 2FL5B 4JJ5A 4OFDA 2NX5A 2I07B 1QYGL 3OR7B 3IDNB 1QA9B 1UGNA 5B8CA 4P46D 1JGEA 3HTLX 3T1FB 1NH6A 4PUBH 3SJVA 1CLYL 3Q3GA 4IMLA 5GRUH 2R2BA 4O51B 1LP9E 2EIDA 3FQWA 2YBRA 1BJ1J 4H20L 2BOBA 3GI9H 5CWSB 5HHMD 1YMHA 4MQSB 4BSJA 4XNQA 4LF3B 1XGQB 4Y2OA 3S88H 5IFAH 1HCVA 1HH6B 2NCMA 5AUMA 5BXFA 4LCYA 3QNYB 3K2MC 3VWJD 4ZUVA 4PJ8B 5HHQB 4HZLB 1GC1L 3TGXA 3VFUA 4G7VL 5D1XD 4GLRH 1NGQH 1TZGL 4RDQF 3WXWH 5EOTB 1NGWB 3E2HC 4JVPA 5DRWA 3MUJA 4EN3A 4M9PA 4Q9QL 3W81A 2HG5A 1KB9J 3D85D 4XRCB 4F9PA 5C0AD 4YR6A 1P2CA 1U95A 5L88L 5LGHL 1F4XH 3I85A 1MCWM 4AM0A 4ODWB 1U3HD 1YECL 2D7NA 3DVNB 3LKSB 1N5YL 1UJ3A 2YRLA 1HHHB 3MCLL 5H35B 3LIZH 1DBBH 4Y5VB 5HYIA 4JFYA 4K94L 5HHPA 1MFBL 4N9GA 4AIXA 1KTKE 3K0WA 4HLJA 3M8OL 1PG7L 1KXQE 1CT8B 2KH2B 4BZ1L 4LLUA 4NOFA 5HI4C 3RVWD 2VH5L 2Q3AA 5J6GB 1SM3L 2E9IA 4LNRB 4KKLC 1FJ1B 4LSQL 2JJTA 2AERT 4FQ2H 3NN8B 5L2KD 1HQ4B 2DYPD 3TA3C 2F54A 1AHWA 3IXTA 1EFXB 4RIRB 4PJEE 3KYKL 3MLWL 4P2QB 3C5ZC 4RNRB 3C6LB 4CVZA 4K9EH 2Z35A 3O9WC 3HLAA 4DGYL 3ARBA 5KSBB 4GAFB 4BFEA 4TRPH 4G8EB 5IVZA 1WSST 3L7FB 5I1HH 4MS8D 3REWB 3QO0B 4G6ML 3S6CA 4D9RD 1JK8B 2JKXA 4NO2B 4MZ2A 2XKNB 4K7PL 4G6FB 5I73B 1FN4A 1UXWA 3WLBA 3RVWC 3HAEG 1HKFA 3U83A 5AYQA 2XN9D 1JF1A 5FUZL 3T77A 4ONHB 2FX9H 2EYTB 3MC0A 4M4RA 1BQHB 5DZNA 4MJIE 1T7WA 3EYVB 1Q9OA 2Z9TA 4QHNB 1U3JA 3DTXA 1MCJA 5BS0D 4KWUA 4M6NH 5K9KB 4ETQA 3PWVA 5T1LA 4RFEA 1ZWIB 4JHAH 2DM2A 2UVEA 2KZWA 5EA0L 4PJ9A 3VD9A 4GXUM 3NFPA 3TO4D 2XZQH 3L3GA 3WS6C 1DBKH 5ESAB 4JPIB 3MRHB 3P11H 5I1KL 4TTDC 3B2VH 3GI8L 3B2UD 3HFMH 4GRWB 4HWUA 4FZ8L 2EDRA 3HRZB 4N0UB 3SCMA 1KFAL 3O8XC 4NBYB 1JI2A 3X13A 5FV2A 5GGVL 3NZHH 2NTSP 4FQLL 4CU7A 5E8DH 2RFXB 4P99A 4BH8A 1JK8A 1A6VH 4HUUB 5T5NG 2BRQA 4GMTH 2ED8A 3B9AA 5I66A 4HJJH 3NMEA 2WLZA 3RGVA 4IOIA 3LKQB 5D2NB 4P46C 2WUBL 2R2HB 1FJ1A 3CLEH 5F7YC 1T7ZA 4WTZA 5E4IA 3NN8A 4U1GC 1ZVYA 4UQ3A 5C7XH 1IEHA 1ZK9A 2VZUA 3L95B 1KPVA 4KJYA 2JTDA 2D7OA 2IH1A 3NH7H 4TTGA 5L7XL 2Y1VA 3X3FL 1FG2B 2IFFL 1SJHB 3MRJB 5EU3A 3BKJL 4KUCD 1KXTB 3ROLB 1IQWH 3ZKMC 5CLWA 4QWWC 3ROOA 2ZPKH 2FBJL 1PEWA 1RQ5A 1F3JB 2BNRD 2YHGA 4L3AA 1BQUA 4CBPA 2FNBA 1H8OA 3WIHA 3WNLA 4C56A 3LKNB 2HTKD 4ODWA 1KGCE 1KC5H 4IJ3C 2CMRH 2MCG1 4YHLH 3OTTA 1B2WL 2G5RA 4FFVD 1MY7A 2EO1A 4KUCF 3HZKA 1LDPL 2Y7QA 5F1IB 1Q1JH 4CJ0A 1AC0A 4ZDHB 3RVXC 1OOAA 5L2JA 3NCMA 3MRQB 4HZLA 4EKXA 2F58H 2W9DH 1R3LB 1X5XA 4KKAD 4XMLH 3WS3A 1F8TL 2OYPA 1ODAA 1IAIL 4P4RA 4KMTL 1UB6A 2QSQA 3P4OB 4YUEH 3BRFA 5D2NE 3S97C 3JSSA 3AUVA 1T3FB 1GOFA 2P7TA 1EVTC 3GMPB 2R1XB 1UCBH 2AK4A 3QEQE 2ITDB 1RHFA 3GIVB 4PV8B 4YQXH 5EG6C 4G6AC 2FJFB 3EO1B 4K3EL 1JPFA 3ZT6A 4BQ6A 2I07A 5DJAA 1WWBX 5DQ9B 1U58A 5ACZB 2A2QT 3MLWH 3BIKA 3TBVB 4AG4L 1C1EL 1MI5D 5CZVH 3GSVA 4GRWE 4XAKD 4EVNB 4Z7NE 4MD4A 1JYWA 2XG5A 1A9EB 3W9DB 5FYJD 4UV4L 1LO4L 2FH6A 3D87B 2IANB 5LWYH 1T66D 4L4VA 5IVXA 5F7EH 1G1YA 5AD0B 5D5ME 4Z7QE 4HKJB 5F7NC 1DZBA 2VIRA 1U6AH 4R90H 1SVCP 2A0LC 5E5UB 1EJOH 2X4OA 4P4KA 3UBXB 5EULV 3P4LA 3EOAA 3L3OB 4EOWH 2NLJA 3GK8H 4LSVL 1T2JA 1YEFH 4LCIL 4QLRA 1LNUB 4K8RD 2BNQE 3AREA 1BFVL 2HT2C 1K2DA 2CK2A 4OM1H 1TVHA 3WLBB 4PJFB 2UV3A 2XPGB 2BCKA 1OAYH 4GW1A 3GKWL 4I77L 4NO5B 3ZLQC 1ITBB 4OT1H 1G7MB 3ULVE 3T04D 3QG7L 4X98B 4HX1B 2R69L 3SQOH 4POYA 1X5KA 1IEAA 2VL5B 2W38A 4GMSH 4MQXC 4UUJA 4OFKA 3WFBH 3W0WB 1BWMA 4FXKA 3PXHA 1R24B 2R23A 4BSVB 3MO1B 5C08D 1VESA 2XZAL 4S1SH 5I66B 4Q9BA 2PW1A 5E2JA 5LGKA 1YN7A 4NO3A 1QLEL 5AYUH 3K8LA 1RJYB 4LARH 3CSPA 3RAJH 3WFEL 1UYWH 4U49A 1P5VA 1EEQA 4KI5D 1A7NL 1UH2A 5EPMB 1JZ7A 1WEJL 4QT5B 3TO4B 1MHPL 1M7DA 1I1FB 5GRJL 1T66C 5CSZB 3KYMB 5MEPA 3SKOA 3IETA 3W9EB 4EUPA 1G9EA 2H41A 2C4XA 4U6XA 1LE5B 5D8JH 1KG0B 3QDGD 2RB8A 4KY1L 1JYNA 4BQCA 5CZVL 1NCBL 4ORGB 3RU8L 3U7WL 5K9KA 4NWTH 1T21A 2CO7B 3OG4B 1IL1A 1D6EB 3WDJA 3QIBA 4M6MH 4MD4B 2O26U 4JG0L 4PJ8D 3TBWB 3VH8B 5D9SB 4DW2L 3DNKA 5JQHC 4AEHL 4O02L 3IU3B 4KQ4L 3S5LA 4X99B 4YLQT 4XBEH 3PABB 5T3ZL 3ARBD 2ITDA 3GIVA 2AEQH 3SE3A 1NCCH 3O9WA 4JO2H 4OQTL 5F8QC 2BSSA 4PRDA 3QDAA 2VDPH 3TA3A 4OIIH 2MFNA 1E4WH 3OZ9L 3ARFB 1MWAH 3D18B 4NKIH 5D9SA 4L5FH 2RJMA 1VSCA 4P46B 1CG9A 5I18H 2OBGA 3O3DB 3BRDA 4A2LA 2XN9A 4RGMC 3HNSH 1OSZA 4ZDHA 3C8KA 5D1ZD 4L8CA 4CNIB 2OTUB 4G8FB 4UOW1 1NDMB 3GIZH 2D4FA 2FECI 2VB5A 2VDKH 4QXTA 3CSYA 3SBWA 4RA3A 5F3HA 5FECB 5EFIA 5BS0A 5TFSH 3OJMB 4X83A 1A6WL 1RIVH 3QA3A 5E8NA 4PJ7A 1FVDA 5BZDA 2V2TB 1HQRA 3K8KA 1NCUA 4F7EB 1AY1H 2FZ3A 5IB5A 3I3DA 4NZJA 3VFNB 2DQEL 1VACB 4LPTA 4X80H 2GJJA 2YSSA 4M5ZH 1OAUH 3F7YA 4FQPA 1OB1A 4KZEL 4P5KA 4Z7OF 1BLNA 5BQ7A 4K8RC 3QIWD 5EBMB 3WKNA 1A7PH 3KPLB 4WY7L 1R24A 5IEHA 1F6AB 1S7XA 4YWGH 3SDCD 4N8CL 3IJSA 4E41A 1TFHA 5D2NA 1J12A 2WANA 4DZBA 3D18A 3NBNA 3UDWC 4WNQA 1H5BB 2BJMH 4XX1E 3P30L 2JCCB 5DVMA 1T1WB 4XPGH 5CJ5A 4ISVB 3DLQR 1CLZH 1OGTA 5GZNC 3X11A 5TDPB 3H3PL 1FQ9C 1QFHA 4JFEE 5T1MB 1N7MH 5T3XE 4Z8FH 1MQKH 4XCCH 4L4VE 1CFNA 4Q7DA 1OCWH 1Y0LB 1QLFA 4KVNL 5GGVH 2GT9A 3OKOA 5BW7C 1J05A 5JDJA 4GXUN 4YBQD 5DUML 5BS0E 1B0RB 3TZVD 4Z7UA 3JV0A 1WVZA 1CDYA 2JJSC 3G6JE 4PY8J 4R2GB 4ZFZB 1BGXL 2R0WH 4PJCA 4JM2C 4XVSH 3PNWB 5IVXB 4OZHA 3I6LD 3O6ML 5GRVK 3X3GH 1YUHB 1NSNH 4XWOD 2QADC 4MDIA 1KB9K 1QFUL 1AKJB 3EYUL 1NUNB 1LO5A 2CLRA 5HYSA 1LEGB 5C0EA 1Z9SA 1MLBA 1OSPL 3BISA 3QUML 4G3YH 5C71A 2RBLA 5TQ2H 1PSKH 3EFDH 4HC1L 1S9WA 3MNWB 3Q2CA 3NFSL 4MD0A 1T03L 4G43B 1QR1A 3QZWA 3GMPA 2X7LA 1RFDH 1RZFH 2C3GA 2IWGA 4OLVH 4JPKL 2I25N 2JJSA 3N1PC 2AV7B 3MV9A 4E41B 5B4MC 4L29A 4EUPG 5ADPL 1YNLL 3FZUC 3BH9A 5GGVY 4YDIH 5F7MC 3FFDB 3HUJF 1BQSA 3BQUB 15C8L 4Z7UF 1ZS8A 3VDCA 2BX5A 2R29L 1NMBH 1LDSA 1CD8A 2PYEE 2UY7A 5DK0B 5EB9A 4K9EL 2Y06L 3QQ4A 4S10A 2I24N 5FO7B 4YHOL 3FN0L 2QLVB 2C9AA 2GY7B 3BESR 3MRGB 3ARUA 4QRQB 3KVQA 3VXRE 4ZFOA 4KY1H 5FA4A 1QBML 1HXMB 5IMOB 3GRWL 4QRRE 2I27N 1S9YB 3LEXA 2M26A 5IIEA 1CXFA 1LEKA 3EDEA 3T0BA 3H0TB 4XNUH 4EI5B 2BSTB 3BAEH 3WFDH 4OD1L 4NC1E 1QFWI 1U36A 2R1WB 1MRDH 1XGTA 2BP3A 3EJYD 2Q86B 1JNLH 1T1ZB 3TLRA 1KJVB 2DQUL 4FQXA 3EYQC 1HDMB 2HVKA 1U8MA 4GBXC 1CQYA 2EC9T 3MJ8B 3KJ6L 3C8KB 4KPHH 1ZT4A 5JA8B 2ADIA 1CDCA 3MNVA 1FORL 3JWDH 3ESUF 4MWFA 5CGTA 2G60H 5D7IF 4QHUA 5FKPB 2J88H 4AYFA 3DSFL 4Q6IB 4P2CG 3V4PH 5D7JD 2H8PB 4NRZA 2NTFB 4WI7A 3OXSB 3QHFL 1JPFB 4O9HL 5CINH 3H3BC 3SBWC 3SGEI 5ALBL 2R69H 5TDNB 3PABA 4X99A 2A77H 4UAOB 4CDHA 1BIHA 1NLBL 1T2XA 2VTFA 2CD0A 2JK5B 4GXVH 4P4KC 5FKAB 4R96B 3FZUD 2ZCLH 2OL3A 4Y2DB 1M7XA 3TT3H 3MRDA 5BO1L 5C0GA 5DC4B 4OUUA 3OKKB 2X9YA 3WIIH 4S1QH 5DMGC 2IAMA 1FBIH 4HJ0D 2FX8H 4PP2B 5D2LA 1KJVA 2C4FU 4UOJA 1RIUL 4TUOB 3VU2A 4NQEE 3QH3A 4DVBA 3VXNB 4UIKL 1OAUL 3ARGA 2XOTA 5I19H 2H1PH 3U4BL 3SKUD 2YKLL 5DJZA 3QIBD 1CFTB 1MPAH 1O7VA 5KSAB 1ZANH 4CN4A 5JHDB 5JDSA 4EIGB 2OP4L 2R0LL 3TZVC 1VDGA 4C83A 1MCCA 4PS4H 4YBQC 1SJEA 3U36B 2DICA 4DKDC 1EIBA 3F7VA 1KSRA 3LZFL 5HSFA 1WUNT 3RWJB 3FFDA 3G04B 1RURL 3IT8D 1KTLA 1J0JA 4DZ8A 4HV8B 1WAAA 3TPKA 1TTUA 2NY5L 5CAYB 3T2NL 4BZYA 4LNRA 1FL5B 4P23C 3ULSB 5J8OA 4OF0A 3LY6A 3SDDB 3GSNH 1HZHL 1TZHA 1D5BA 5HYQA 3HPLB 4XMPH 5ISZE 4FP8L 3TIEB 5CHNA 3MGOA 3PJSB 4EDXA 1MHHB 1T7XA 4OZHE 3QQNA 2GITA 3PWNB 3VFNA 1ZLSH 5J3HD 5DFVD 3PP3K 5IMLA 4JO2L 4KTEH 4MA1B 1ZGLA 1G7LA 4OLYL 5CEZL 4LLYB 3QG6B 1JL8A 5F96L 1S7WA 2FDBP 2AJ3B 1BQLL 3VRJB 2VZ1A 4UIKH 4KAQH 1NC4D 4TUOA 3QCTH 4NQEA 1MCEA 1FZJA 4ZPVA 5LXGL 3RUGA 2VIRB 3R4DA 2W9EL 4OCSL 5CLTA 1R3HB 2A83A 3M45A 4WFHD 5CFHA 4GAYB 4Z7UB 2YPLD 4HKBB 1IQDA 3BD3A 1FGVH 1CR9H 4QHNA 4PJIB 1BBJB 3RIFK 3UROR 5D1XB 3GMRA 4FFWD 4PGEB 4LBEB 1V3LA 5IESH 4HMDA 4P2QE 2P48B 1HIMH 1QP1A 4OLUH 4ZQKB 1FL3A 3GO1L 1J1PL 3HI5L 2QEJA 4UTBL 3V0WL 7FABL 2VXVL 1UENA 3BN3B 1DQML 3QUZA 1WAAF 2X4UB 1E6OL 3S35H 5DHYA 5LCVH 2JCCA 2I5YL 4NRZB 4G8GB 4I3SH 2GK2A 4JJ5B 4LU5H 4L1HA 3AS0A 4Z18A 1UYWL 35C8L 3C08H 2CKBL 3OL2A 1I9EA 2X4QB 3VXQA 2W0FA 4RAUB 4I0PD 4ZUUB 4O9HH 3CC5B 3T0EB 1NFDE 3WE6B 2PW2A 4GQ9L 4JE4B 5F9DC 5IW6B 1YQVL 3QUKB 3ARYA 2Q7YA 4GRMA 3O3UN 3SKMB 2ATKA 1OT2A 4ZYKB 1MSPA 3VW3L 1VGKB 3R06B 1U9KA 2X70B 4L9LC 4X0KB 3TZVA 5KSUB 2NY4D 4S0TD 4QF1B 2B0SL 5IB4B 1K8IB 4BA8A 4LRNH 2JJWA 3MREA 1A14L 4LIQL 4OF8A 3LQAL 2FD6L 4NZRL 2EE3A 3OAUH 4KTYA 1FGNH 1T4KA 3QQ3A 3SGJA 1HYSD 3RHWF 2AKRB 1SYVA 3ARGC 3G5XB 4R26L 4ZFOB 1NBZB 1OAKH 4TSBL 3B8YA 5EU3B 1XF5A 2J1KA 3FB5B 1XR8B 2HTLC 4FFZH 3LS4L 1Q9WB 2Z93B 5DDHA 2E6PA 4HS6B 4EN3B 1DVFB 3KGRA 1UQSA 3L95A 1Y6NR 2V7NB 1FO0H 1CF8H 3H7BB 4YHOH 3UP1A 3U30B 3BMVA 5F1OB 2JJTC 1I8KB 1ZEAL 4LASL 2F53E 1T04A 4OGYL 4DZ8B 3KLHC 2FWOA 3KDMA 1JPGA 4LDLB 5C07D 1AXIB 4F33B 4PTTA 4PJGB 4MXWH 1G9NH 1P7KA 1BZQK 5FYLD 3QXWA 4I1NB 5F9WC 2V9QA 2D3VA 4GW4A 2XKUA 2AQ1A 2H26A 4HS3A 1URLA 1QFWH 2VN4A 5DYOA 4AENA 4AIOA 5IVNA 1WBYB 5K9OA 1S9WB 3WIIL 4CVXA 5HGDB 5A2KH 4LPVA 4BH7A 1UZ6E 4JJHA 2VO5A 3MROB 5FGRA 3RA7H 3BXNA 1R6VA 5DEFA 2ZUQB 4F9PC 3M17A 3BDYL 3EIFA 2CDEB 4WDIB 1D9KB 1QSVA 2J6EH 1BBDL 2X4PA 4GW5B 3DYOA 4GRLD 1YNKH 1HN1A 4AZ8A 2Y4SA 2CXKA 3AC0A 2DQGL 3ECBB 4KUZL 1CGTA 1C5CH 3PNWA 2F58L 1QRKA 4B7LA 1RSFA 4NQEB 1V7NH 2IAMB 2O5YH 4WEMB 1XCQA 1HXYB 2X4NA 3TN0C 4W4NA 1FV1A 4ONHA 1YEIL 3VGFA 2DIAA 2ZG2A 4HPYL 1ZHLB 4HIHA 3CVHH 1NMCB 3MX0A 4KJPD 1TQBB 3HNTH 4R7NA 3RRQA 4JGUA 4IOSD 1NUGA 3DHMA 4P5TA 1FG9C 2NYYD 1DANU 3DBXA 1F02I 5DYOB 4C58B 1UVQB 4MQ7B 4Y88A 4CVXB 3DMMC 3GMMB 3RTQB 4OIAA 5FYKD 4Z77B 1XEDA 8FABB 1IAOB 1LK2B 3DV6A 2H26B 4TVSa 3DECA 5EO1A 4X9FA 3T3ME 3HE6C 3CH8A 5IEKA 1FDLH 5C08E 3SY0A 3FFCA 2YD7A 3V6ZB 4MWFB 3GBML 1IC7L 4DGVL 5F89A 2BZDA 3MCKB 1EO7A 2ZG3A 4RIRA 3FL7A 3RZCC 1AIFB 4PV9B 2DIBA 3B5TA 5E8OB 1CU4L 2OXGA 4X98A 4HG4K 1IKFH 3EDDA 3OJDA 4D0DB 1ACZA 4U6VH 1I1AD 4L3EB 4MNGA 1S7UB 2VLKB 2DKSA 4LCWB 2AQ3A 4P2YA 4S1RH 2EKSA 5HHVH 3VD7A 5GGTH 1UJ3B 1K3ZA 1YJDH 3V4UH 1MF2H 2DMBA 1HE7A 3C5ZA 5FDWB 5ECJE 1AHWC 4R97B 3VWKB 2KQMA 2WLYA 3D3VE 4LEXH 1A7RH 3OGCB 3OV6A 1FLRL 2NLJB 1WJ3A 4HK0B 3ULVC 3QNZB 1FFNA 3JV4B 4XXCA 3IGAA 4NWUL 1CXLA 5CP3A 1MCFA 1UZ6F 1N0XL 3VXRB 2R56L 1A6WH 3VD3A 43C9A 2C3WA 5BXFB 5CIPH 4CVWA 1WBXA 3IYLW 1HNGA 3FT3B 3SY0B 4AQ1B 1C16A 1EAJA 3LKRB 5EU6E 3EOYG 5ID0A 4OZFH 1ZTXH 1AGFB 5FYKH 3X14A 2QQKH 3MOBL 4XPBL 1QLRB 3I75B 4YXKH 1YY9C 4U1HB 4Y5XB 1Z6JT 4MD0B 1WZLA 2VJXA 3JTTA 3GRWA 5KANG 1PX3A 2H6PB 1NCCL 4L4TE 4LSPH 4OI8A 4PIRF 1MELA 1FNGB 1ZANL 3GMQB 3LKRA 1ETZA 4JRYD 3ULVL 2XIDA 2DQTH 2NNAA 3P9LA 4WENB 5DJ2A 3EDJA 2I9TA 4L8SC 4LVEA 3RZWA 3SDXA 5DFTA 4P2OC 1R3HA 3ZYJA 2ADFH 3KPPA 4DCQB 4GAYA 5CKGA 1RK1A 1M7IB 1WT5A 3BP4A 5JHDE 3HZMA 4NQED 1ADQA 1GZQB 4DWHA 5TE7H 1NANI 3SO3B 1KLGA 2HKHL 3DVGA 3OJ2C 1KG0A 3BZ4A 3ISWA 3F12B 3LPFA 1C5DA 3SPVB 3CJJA 3NFSH 4OGAD 3ABZA 3DURA 5CILH 3AFLA 5HPMA 3LQMA 1G7LB 3PV7A 3OF6A 3V95A 3IDYC 5DD6A 2DN7A 1CK0H 2VDOH 4UB0H 2DJSA 3MROA 4M5ZL 2IG2H 2P5ED 3L3JA 4OF3A 4QRRA 4YXHL 3TYFB 1NBQA 4OLXL 3ULUD 1YPZB 2EDLA 4B41A 1T83A 5SWZA 4KKCD 3G6DH 2AJVH 5FYLH 4C56E 3EYSL 3QUZD 1O7SA 4NC1C 5C0RL 5GS1A 4G6FD 5C6TH 5KAQF 1A7QH 2YEZA 4IDJH 2A6IA 4OZFA 1RVFL 3H9YA 1EERB 2VDRL 4U1SB 3B3IB 1X7QB 1JMZA 4OCYL 2XZAH 4S1SL 2VWEC 5D72H 2AXGB 1PKQE 3MRFA 2VDRH 5JOFA 4I0PA 1ZLUH 1IEAB 1NPUA 1JFQL 3V6OC 1WICA 2V2WA 3G6JF 4PRNA 2H2PC 5HBBA 4GG8B 3LHPL 5JDSB 4NO5A 1U8LB 3SE3C 5E1AA 4YFLF 5I1EL 1E4JA 1J1PH 4UTBH 4HCRA 5DD0H 5EOCH 4L4TD 3NPSB 3KXFD 1YYMH 1ZA6B 3PDOB 2EEBA 4OIIL 2AJYL 5HPMB 5IF0A 3SPVA 4AY0A 2Z8RA 1AQKL 1F4AA 2E9WA 4PJ7B 3V2AR 5HI4D 1IAKB 1N5AA 3I6GB 4X6DE 3FQNB 1FCCA 3D9AL 4Y16A 5CKAA 1FE8L 2FLRT 5TPWL 1PW3A 3IJYA 4KJQD 5F88A 2C5DC 1YEDA 3ECBA 1J0KA 5J13B 5IP4A 5D6DA 1B0RA 4I18B 5IFJB 4TULL 5D1ZB 3KWWB 4FXLA 4YDLB 1QNZL 2AABH 4PP1D 2WMPA 1FRGL 4GKOA 3THML 3F7QA 2F74B 4ZUWA 3UTSD 4F7MB 5JPMB 1EO8L 1KNOB 5BVPL 3EOBA 3EOTL 2XFXB 1ZV5A 4Z7VF 5C3LD 1AQKH 5GGUB 4G3YL 3V8OA 3VXOA 1MHEB 2HWZL 4HWZB 1YZZA 5E5MA 3UTTB 1HZHH 3I75A 4FFYH 1PBYA 1ZLWH 3FOMA 3LIZL 1J8HA 4XNMB 4U1GB 3ARBB 3O2WL 3IDYB 5GXBB 3O45A 3MXWH 2OI9B 4PRIA 5EOQH 1SVZA 3VXRA 4QOKB 4D9LL 2WBJC 1MAJA 1UA6H 3MLVH 5DSCA 3PHQA 5JW4R 2VDNL 4BM7A 2ADGB 2FSEB 3P4MB 4WW1B 4HUMB 4G7VH 4LEOB 3D3VA 3P0YL 1EO8H 4QTIL 5I1DB 5IMMB 4X9GA 4QRUB 4RZCA 4KJWD 1KCUL 4NQSA 2QR0A 1IGJA 5C0CE 4JZJA 1I7RA 1FLRH 4BQ8A 2YRPA 2AEQL 4Y4HD 4RWYL 1ES0B 2QQQA 5GJTH 2N7AA 5JXEA 2B8OT 4OCRH 3DUUB 5C0IB 3FT4B 1TIUA 4O4YH 3B43A 3CFCL 4KVNH 4DOHB 4HS8H 5FA4B 1SJHA 3MRJA 4P9HC 5F9JA 1RZ8B 1JHTA 1UWGH 1FNSL 4HUVB 4UDUB 3V0WH 7FABH 1M71A 4WUUD 2BVYA 1QYGH 4JFPB 1HEZA 3GSXB 5T3ZE 5TE6H 4QRPE 4HIIA 3D9AH 2P44B 1OF2A 4H25B 1NEUA 5IK3B 1ROWA 4GG6E 5EU6A 4WY7H 5IOPB 1CI5A 2BSED 3UPAA 4YWGL 2BVEA 2JELL 4JFDB 3RKDC 3S4SB 5HVHB 3DX7A 4RBPH 4NZTH 5DD5L 1AGCA 3W0WE 5HHNA 1MY5A 2APFA 1XIWB 5FCSH 3VRLF 3O9WB 4NQVB 3CVHL 4HC1A 4JY6A 5DJXB 4KVCL 4Z7WA 3Q1SH 2F19H 3KPOA 4XHJC 3MLXL 2HFFA 4R4FL 3OR6A 4G6JH 4N0CD 4OLWH 4MDIB 3GI8H 4IMKA 3O2VH 3DOSA 5DQJB 1AKJA 4EEEA 1J86A 1UM5L 2YUWA 2AGJL 1I8LA 2R2EB 2HH0H 1MRFL 3QEHB 1M05A 5C0BD 4LLWA 3QDGE 2Z8WC 3MJ9L 1G9NC 4UV7L 1T6WA 2E5EA 2CRIA 3FQNA 5MEND 4K3DH 4I3RH 4KDVA 3IKCB 1CFQB 1HHJA 2C3VB 5D5MB 5ENWB 1ZXQA 4LLYA 1JF1B 4QHMA 4G9FA 2CDEA 4RRPA 3PG2A 2OP4H 2R0LH 1CN4A 3SE9H 1G7IB 1NCAH 4Y2DD 4YO0A 2YZ1A 1RUKH 1Q38A 1OTSC 4XWGL 5CGYC 1QR4A 4K7PH 1S7TB 2HAZA 1H5BA 4PJ7F 1FRGH 4G8EA 2ZPKL 4NNXB 5FCUH 1QNZH 2AABL 2ICES 3UC0L 4HWBL 2CUHA 4JPVH 2IPUK 5E99H 3AU1B 2PETA 1CVSC 1P7KB 1UWXH 3MRCA 5DWUH 3U2SB 3KDMB 1RI8A 5HJ3B 2YUZA 3C6LA 4CVZB 3A0OA 2IF7A 2YD5A 5FM5M 3WV0A 1EEUA 2VN7A 3ZL4L 5D7IE 4JN2A 4JO4H 5I8KH 3GSXA 2PO6D 1KIRA 3HE7B 1Q9LB 5EBLB 1GGIL 3U36A 2G5BA 3CIQA 3OKMB 3ZKXB 5J11B 5H94A 5C0ND 4KK9C 1FYHB 1TQCB 4LGSB 5GRXG 2L0DA 3JBG7 1J10A 4GW1B 1NCAL 2A1WL 4MA3B 1SM3H 1W72H 1OSPH 4KHTL 1D6VL 2EZ0C 3WHE1 1P7HL 4YC2C 3PQYD 1ZGLM 2YUVA 5GHWH 4FQIH 5JLZA 5GJSL 3WS6A 3JV6B 5JZ7C 1LEIA 4AEIH 5C09A 1IGJB 4Y89A 2PTTA 1K8DA 1T89A 2L7JA 5TQ0L 1KYOK 5FO7A 3RTQC 5GGRY 4KJYB 2Y5EA 4QCIB 5E00A 2VLKD 5FOBB 1WLHA 5AD0A 2IJ0C 1MUJB 4ODTH 4IIQA 4BYHA 4PJFF 3O3DA 4NQUA 4M93C 4ZS7H 1U8HB 4FG6D 5DHVH 1GGBH 5H37H 3BKMH 4XNQB 3U2SA 3WO4B 1EAPA 2PYFA 2D7TH 2W60A 4FXGB 1PZ5B 4JANA 4OLWL 2VSCA 1WISA 4G8GE 2HRPH 3GJFB 4QHKI 4N1CA 1OGAD 3O3EA 4OKVA 1PD6A 2I5YH 4RISL 3PHOB 2H6PA 3Q0HA 3U0TA 4H0IA 3B9KC 5EUOB 1KNOA 2FJHA 4Y7MA 1MNUH 3O6LL 3MACH 3WUZA 4PUBL 2R9HD 4JHWL 3S5LB 4GG6A 1PZ5A 4JANB 5EC2B 4RSVA 4S1QL 1D6EA 1FL6A 1N3NA 4PJIA 1H3UA 3EJJX 1CD0A 4N90E 3BGMB 1WBZA 3GSWB 3Q48A 1JTTA 4DTGH 4I9WE 4I0KA 5CBAB 3WHE0 5I17A 3IFNL 3KS0J 1A6TB 3ETBF 3QUXC 4UV4H 5KVDL 2VABB 5E8DL 4YE4L 4N0RA 5C0BB 2DIJA 5FK9B 4PGDB 1ZA6A 3PDOA 1Q0YH 1S7RB 1VEMA 3CDFA 3A6OA 5BRZB 4M48H 1KPRA 4GBXB 4LNVA 4MJIB 3RDTC 3CU7A 4MHHI 2VLJD 4LK4A 1R5WB 2XWBB 3B9KA 3BEWA 1XZ0B 2DWDA 4EN3C 5GZOC 2EC8A 3QNXB 4EDWL 4XP5L 4DVRH 4YQXL 1YN7B 5GISL 3MA7A 2O5ZH 5KSBA 2VYRE 1L9NA 3LH2L 1A3LH 4PTTB 3HNSL 1MWAB 5C86A 1ZHBB 5I1CH 2CUIA 2ICWI 2WWMC 1MIEH 2Y9RT 5SWSB 3EZ8A 3BMWA 3QHTC 4L5FL 4C57C 5GJSH 4Z6AT 3GMLB 1BREA 4NFCA 3SDAC 4PJEB 3GMMA 3RTQA 3V0AC 4N0UE 1B2WH 1FZOA 4Z7QF 5D5MF 2HMIC 3CLFL 4M62L 5IBLC 1J87A 5IT2H 1YEEL 2RHEA 2PKDA 3J8F7 1OP3K 3FT4A 5GSRB 2GUOA 4BKLB 4MAYA 1RUPL 1Z3GL 4P9HH 2EH7H 2EECA 3KLSA 3S34H 2VXTL 1I9IL 3JUYA 4U1LA 2Q87A 5MEOA 4RQQB 4JKWA 2H45A 5CJQL 3O2DA 5TF1H 1CFSA 3F6LA 5KVDH 5MEQA 1ZEAH 3GHEH 1N4XL 3LEVL 3SGKA 1XT5A 3GMOA 1BOGA 4GH7B 5L7XH 3G5YB 3RWHB 4OFVA 2ICEA 3DGCR 5AZEL 5I16A 1CU4H 3HC4H 3EYFB 3QFJD 1IM9D 4HIJB 1MREL 5D2LB 1AGDB 4TSCL 1MEXH 3QPQD 5CGMA 1EXUA 1C12B 2N7BA 3BD4A 4XI5C 5E8EA 4AMKL 3GM0A 5I15H 3S37L 3DUSB 4WHTA 5IGXH 3IFPB 1A14H 4LIQH 4DUWA 3TFKC 1I3GH 3SDXF 1A9BA 2Q3ZA 2Z0BA 4UTAH 2COQA 4NBZB 5AWNL 3V6BR 2ICCA 1NAKL 3V4PL 1GGBL 3FQUA 1A7NH 4ESKA 3SDXE 2HH0L 5L2KB 1C16B 4QRPD 4XVTH 4NHCL 5C0RH 2QQNL 1MH5A 5HI5C 2P4AB 4MB5A 5CJBA 1DVFD 1W8OA 4WEBL 2N56A 3DXAA 5HXMA 2HT4C 1RAMA 1NEZB 5IFAL 1NFDA 2XZQL 4G5ZH 5E00B 2AK4E 3QEQA 1EJ6A 4U1NA 1MCRA 1FZJB 4JKLA 3VXUB 3QDMA 4LQFH 2RCSH 2A6JB 2MKWA 3OKNA 4JZOA 3C8HA 2Z93A 5DDHB 2ESVA 5D7LD 3G9AB 2LU4A 4PLOB 3O4LA 5C0CB 5IROC 1VFBB 3WLWD 1FAIL 1Q72L 3MV01 3BX7C 4IMKC 3KPSB 3BW9A 2YN3A 4PB0L 3HI1A 4RFNC 3UTQA 2HJKB 5E9DA 3GM8A 1CXKA 1HHIA 2NY4B 3D48R 4V1DD 3LKSA 4X8XA 1IMHC 1NBVL 4F8TA 1N6QH 1J8KA 3BPLB 3MREB 2VZ3A 2ZJSH 5DR5L 3QCVL 5TE6L 1FZOB 4QOKD 3CMOH 2PYEB 5CZXD 1KYOJ 1IGCH 5DURB 1U8JA 5F7DA 4EBQL 2HRLA 4CU6A 4JY5H 1XCTB 2VR4A 4CKVX 1DQJA 2OK0L 1F2QA 1DJSA 4PLJD 5DK2A 5F96H 2DM4A 3BWAA 1JHLL 2YUXA 4ZUUA 3BEVB 4LASH 4OGYH 4ETYA 2ZOKA 1I9IH 1MHCB 3FQXA 3MBXH 5B3JE 4U33A 3VGGA 3TIDA 4NYLA 1NCDH 1RZGA 5FYLE 3W0WD 1C08A 1R3IH 3VXOB 3CFDB 4G9DA 2WIMA 5T33L 4ODUB 4XT1C 5FF6A 3I3BA 1G7IA 4HAGA 4LRNL 3MRHA 2W91A 4GXVL 1BQHG 4ZO6A 3OAUL 4ELKA 3DX9A 3VXUE 3QWRD 3NTCH 4NWUH 4JRXA 3D69B 1H3VA 3O2WH 4XVUC 4IRSA 5GRVL 1U0QA 2GYSA 1WWAX 5ICZA 5A2FA 2ZCHL 4Y4FB 3MUHL 3DO7A 2W1NA 35C8H 3C08L 3SDXB 5I6XC 4M5YH 4Q6IC 4IM8A 1NFIB 1SBSL 2D03L 5CD5C 4UI2A 1INEH 8CGTA 1VFOA 5IQ7H 3BPCA 2HFFB 1FH5L 1TMCB 2IALA 1DUZB 2LVEA 4JAMA 4X4YA 5SWZE 5BOPA 2WWMD 4HWEL 4PR5B 3WHXB 1CFNB 4S1RL 4U31A 2F9BT 4GSDL 2HLAB 2QQLL 2EICA 1OTTD 4HK3J 3IRZA 4DUVA 2E27H 2DLTA 4GKSB 3MV7E 3GO1H 4X9HA 4NQCB 2NY3C 4EXKA 2JCCE 3EHBC 1R3KB 1SJVA 1JGDA 5FGCB 2BHUA 1JJUA 1UB6B 5F93C 5I1LA 1MHCA 3B5HA 3ILQC 3GJEA 2M8XA 4YC2B 1DSFH 4ZSOE 1F58L 1GH7A 3BD5A 5D2LE 1UJTA 2W9EH 5EU6B 3VXPA 5IOPA 1JPGB 1MIMH 3WDIA 1YPZE 3G9VA 3ZZ1A 5K33A 4Z9KB 2MCPL 2CLZB 3O3BA 3ZHDA 1TETH 4N5ED 3SEPA 1F13A 1WIOA 1QZ1A 2ORBL 5IHZB 4M7ZC 3ZT5A 4Y16C 5DJYA 1E27A 4JQXA 4QRSA 2UWEF 3AS3A 1FAIH 1H3PL 2NQCA 1CGXA 3TYFA 3QHFH 3DVIA 4O2EA 4XP9H 3HMWL 4NT6B 1X5LA 5BRZA 4NGHH 3GGWB 4APQD 3S4SG 3I84A 1JWSA 1HHHA 2DLFH 3JWNC 3BPOC 1HSAB 1EHLL 1G9MH 1TDQA 4IRJC 5BJTA 1N0LA 1VFUA 4RCAA 3BZ4B 2ARJB 2DTML 3HKFA 1FG2A 5E8NB 2BNRB 4C4KT 1Q94B 3WFBL 2R9HC 3WN5B 3IAQA 3TBTA 1RIVL 1A2YB 1A7QL 3OJDB 1NDGA 5EBGA 4LCWD 5CUSH 1SQ2N 1GXEA 4P3CL 1AR2A 2OJZH 5C0BE 3HAEA 4X5XB 2YPLE 3Q5TA 2PCPA 4YGVB 1N8ZB 4JRYB 4OB5L 1KELH 3PL6B 3QULB 4G9FE 2GTWA 1I1AB 3H6JA 4OV6F 5TJWK 4I3GA 5EO0B 2DQUH 5GS0D 3T0EA 1NC2D 4X9IA 2PW2B 4IOFD 3G6AA 4L4JA 3V6ZA 3G08A 4K07A 4S0SD 5AUMB 1JZ8A 2DD8H 1VERA 3BN9C 2QADB 3AY4C 4OCLC 1HHGB 3QIUD 1MFDH 1QBBA 1T83C 3GK8L 4TNVF 1A3RL 5B8CB 3RTQD 5SV3A 1CE1L 4J1UA 5DUPL 3T8XA 3BPCB 2EXYD 4W68A 1RZJH 3PL6D 3TVMD 2D31B 3NH7L 1CF8L 3HRPA 3JUZA 1ZT4B 2NY7H 3H9SD 1INQA 4WCYH 4XCEA 1JPTH 1MUJA 5ICZB 1FVEA 1RFDL 1RZFL 4W6YB 1WQVT 3PGCA 4CMMB 3ZTNH 3U48A 1X5YA 4OLZH 1FDLL 3MUZ1 3I6GA 1IAKA 1N5AB 2AXHA 1AE6H 4K3JH 4BFIA 2AAVA 2BVOA 3T4AA 4GMTL 1F4YL 3H9ZA 4X8JA 4OZFG 1K85A 4HJJL 4O5LL 2X41A 4PJ9D 2NW3A 4XMLL 2HLFD 2R15A 3Q5OA 2W9DL 5AEAA 4Y1AA 3FT2A 3NABL 4HUWB 1YYLH 3WNOA 5IROA 1IGYB 3DSFH 3SCMD 3OJVC 5EZIL 1T5XB 5J6HA 2BOCB 3STZB 5IW1A 3TNMB 5EUKB 1JCKA 4XBGA 4MLSA 4QTHB 3D39E 3C5JB 3P73B 1WF5A 2AV7A 2I9LB 4I77H 2NY0B 4LVNB 4YZFF 1ZKAA 5IV2A 4XXCC 3EYOB 1G7HB 4TSAL 4OLUL 4WO4D 5BOZG 1JE6A 3QEQD 5HGHB 3MRLA 1JPSH 2CLVA 3ZSSA 4ERSL 1U93A 5J13C 4PRHD 5H2BA 2O5XH 5FUCC 3QDMD 2NPLX 3O6KL 3CFEB 3MOAH 3ZHLA 3LV3A 2AKRA 5C9JA 4LLQB 3DURB 4HFWB 3O4LD 5DRNB 5L0QC 1CLCA 4Y4FD 1NBYB 1OP5K 5F9OH 4HZAA 1YMMB 2Y06H 4RZCB 5E8PB 1FCGA 1YEFL 4OQTH 2EEAA 3F12A 5E9DD 3LKOA 4AQOA 3ARDD 2GJZA 5D7IB 4XH2A 4KRPD 3N9GH 1RZJL 5CJXA 2IANE 2NY3D 2VAJA 4UMGA 5DJCB 1NMAL 2MKLC 3TBYB 3R1GL 1INQB 5DJ2B 1D5IL 1PKOA 3B6SA 3IDMB 4K7PX 2BY2A 4LDOB 5FB8A 5ID1A 1GPOL 3CSGA 6CGTA 4NHUA 3VWJB 3H9HA 4QHLA 5I30L 4GG6B 5DEFB 1WWCA 2Y6SC 3I9GL 2H2SD 1T7YA 4QRPB 2WM0A 4MNQA 3SOBH 4D3CH 3V7AE 1QSZA 2AK4B 5JIKA 4U1HA 3DX6B 1OQOA 3RJDA 4XMKL 4LHQB 3CX5J 1GHFH 2WSKA 4OCWH 5DQDL 1WZKA 1Y18B 2Z31B 1HHGA 3GIZL 3VE0B 2UZYB 5MERA 5AZ2L 3S4SA 1W72B 4XCFL 4XVUD 3PIQA 3AXLA 1EAPB 2P8MA 2W60B 4FXGA 3VFTA 1BBJA 3MODL 2BDNH 5E8EB 1IAIM 5HDBE 4X6CA 3X3GL 2V7HA 2P43B 1YEDB 5FUZH 4M8QA 2BVUA 2DQHL 3QWRA 4OGZA 2PCPB 1RMFL 4YDVB 4YGVA 3SN6N 3BYYA 2UUDH 3O8XB 4BQBA 2Q86A 5HYEA 5E4EB 2MPAH 5IW3A 5BV7L 1VKXB 1PKQA 3BVNA 4MA7L 3TWCH 1F5WA 1F4WL 5D1QD 2J4WH 2XWJA 1P6FA 4PJCE 1U8IB 4Y5VA 2OQJB 4ENEC 3C6LC 2Y36H 5CJXC 3GI9L 3QFDB 5A2LH 5C0CD 5FDWA 1LP9F 3QG7H 4N9OB 2IPUG 3ROLA 1KCSL 4DOHE 4Z7OE 1NCTA 1W8NA 4O2EB 3ZSTA 5HVGB 4XP6L 4QRUA 4UU9B 4HIXH 1KIQB 3ARED 1CDBA 1MIML 3V52L 5D6CA 32C2B 1MRCL 3BIBX 3DJ9A 1R5IA 25C8L 1LHZA 3V79C 2VH5H 4OQTA 2APBA 4WHDA 4D0CB 5HHQA 4DGVH 3DGGB 5I0DA 2VLRB 5KVMC 1AD0B 4FZEH 1B9ZA 1UXSA 2FJGB 4RAHA 1FYTE 2OI9C 4YFDB 3O45B 4YHPA 2FYYA 3RWGB 1A7PL 2ZCLL 2V2XB 1QVOB 5CMAB 4NNXA 4KTDL 4F3FA 4ZD3H 4LLVA 4NIKB 2BY3A 2DWDB 3C2SA 3WEXA 2J6EA 3JWDC 2Z31C 3WUWG 4X6EA 1XFPA 4FZ8H 5LG1A 1JFQH 4PJFA 2GTZB 2VXSL 4PR5A 3VWKC 1CD9B 4M1CC 2F15A 1IEBA 4IJ3B 1QFPA 5IR1A 1A4KA 3SGJC 2EDOA 3QBTB 3EHBD 4RFOL 2GK0A 2C3VA 2ERJB 4FTVB 5BRZD 2VDKL 4CW1B 2B4CC 2R0KL 2YD3A 2X4NB 1B4RA 1RD6A 4L3CB 4N0YH 4YNYB 5IB1A 3WKML 4L9LA 3V5HA 2Y25A 1H8NA 1YMMD 3GB7A 4WFFD 5T3ZD 4O2FB 4JFHE 1EZVY 1J05B 1CZ8L 2AJ3A 3OZ9H 4DKFL 1H3GA 1BFVH 1Q9OB 3UTTE 1DFBL 4NKIL 2P5EE 3MODH 1E4WL 2FX9L 2Q6WA 4ZAKC 3VG0L 4TUJB 1U3YA 4ODUA 1ZLWK 3M1BA 4ODSL 1XAUA 4UOW0 4DN3H 4G80B 4J6RL 3QPQC 4FNLL 1X3DA 3INUH 4GLRI 5HHXL 3UAJD 3SJVD 4JZNA 5EIVA 5SWSD 3RHWK 4JN1H 5E94A 5FA3B 1U8QB 1VGEH 3ULUC 3L9RB 4XC3H 5DWUL 3RL1B 1CDJA 2HFEA 4WEUD 5JXEC 1F3RB 5KS9B 3QP3A 3WS3B 5FCUL 2X42A 1BJ1H 3BWAB 5J1AB 1VHPA 4F33A 3BEVA 3SDYL 5IK3A 4MXQC 1T5XA 3PL6A 1SY6L 3DGGA 1M71B 4L9DA 4J3XA 4PJDE 1ZT7A 3WFHA 1MCWW 1FPTH 2C3XA 2DLIA 4NJAH 5JHDD 4D9QD 5D6CB 4NZDA 1TVBB 32C2A 4X5WB 5BMFH 1LO2H 5DGQA 3HMXL 2V17L 1BJMA 1RUQL 2EDJA 3HR6A 3EDFA 1XF5B 3KXFE 2XPGA 4C56B 1OT1A 5E56A 5C0AE 3V5DB 3LN4A 2HFTA 1J9CT 1T22B 2DWEB 4I3RL 5KZCB 1KB5A 1BEYH 4YK4B 2XN9E 2B2XL 4M43L 4U7MA 4AL8H 3MBED 5CINL 2UZXB 3QI9D 4QF1A 3ULUE 3ARXA 4ODVL 3FO9A 4XRCA 2VXUL 4CMMA 2IBZX 2BXZA 2ID5A 4K94C 4OCYH 5GZOD 5EZLA 1LO0L 2BRRL 4ZPTA 2V7HB 3O2VL 4OD2B 3ARTA 4WUUE 1J0ZA 2RGSA 4M1DH 4N8VG 5KG9A 4XBPB 4OUUB 4M1CD 1MQKL 4LF3A 4XCCL 2OTPA 2D2OA 4LPXA 4UILH 4WI4A 1H15B 1HH6A 4PFEA 3UBXG 2W0FB 4LU5L 4BJLA 3RL1A 2FBJH 1I8LC 5IVOA 3TA3B 2P45B 4YFEA 5GRUL 2RFXA 4GKSA 3SDCA 1A0QL 2FRGP 2HT4D 2KPNA 3T3MF 4E41D 4H8WH 5I1GH 5F21B 1LP9B 5D96B 4FMKA 5HVWA 4WHTB 1RJLA 1JGEB 1QBLH 4KDTC 4JDVA 5CD3B 2ZUQC 4HIEB 5I1JH 1BD2A 1IT9L 2EDNA 1PX4A 2UZIL 3VH8A 1F4HA 4KTDH 5A2IH 1EO5A 4WGWB 1MQ8A 3O41B 1H3TA 3MUGB 5KW9H 4LPUA 3QULA 4Y4FA 1LO4H 3WNPA 3S37H 3V4VL 4QCIA 2GJZB 2W0LA 3UZVB 4IHOB 3ARDA 1E4XH 3GSOA 4XPTL 1JRHI 1AP2B 1OL0A 1YEJH 2YK1H 4L8SB 5I76A 3GMOB 4APQB 1S7WB 5T1LD 5J9PB 3HG1D 3BZFB 1U8NB 4G7YL 1YEEH 3MTRA 3T2PA 3PGDB 5LQBL 4OLEA 4LLQA 4JVWA 3C5ZB 3NIGE 5DRNA 3BPNC 3L6FA 1G7JB 1MJ8H 1P4LB 5C6PB 1E4XI 1FZMA 5K59E 2YPVH 2FBOJ 2G60L 4NQVA 4HHAB 4JDZA 3T2NH 1JGVL 4ISVA 4TVPE 4JFOB 4AENB 4PGCA 5ADOH 2Z91A 3FJTA 5FYJL 5I8OH 4ALAL 3ILPB 4M7JH 5A1AA 4BELD 4X4ME 3JTSA 1KEGL 2O5ZL 4C59B 2PW1B 1OAQL 4MXVF 4LSSL 5EUOF 4PBXA 3U9PH 4PJCF 1F90L 1IGMH 4NQCD 4ODBD 4PJAF 2UUDK 3MV9D 4OZIF 3MV7B 1OAXL 5E6ID 2VITA 1TJGL 4CADA 5KSVB 3HN3A 4LLUB 4KQ3L 5IQ9B 2P46B 3BEWB 4IS6B 2YSSB 1WT5C 2YPKA 1IFHL 3TF7C 5CZKA 3G5VA 1TVHB 1JGVH 2JB6B 1Z9OA 2KDGA 4TUJA 3HHRB 4WV1A 5LVEA 1JZ3A 3LAFA 4TQEH 2R29H 1CTOA 5ESAA 1S9XB 4PREA 5C0CA 3CFKA 3VXME 2CJUL 4PG9B 3LEYL 2XA8H 4WU7B 3SDDC 2ATPB 1YJDC 3MRPA 1N64L 5I17B 4WVRA 3EAKA 5E1HB 4C4KO 4IEFB 4L8DA 3RVTD 4J23A 2UYLA 5CGYD 1T7VA 4HEPG 4L3CA 1A1NA 5C07E 3N50A