4LUCA

Crystal structure of small molecule disulfide 6 bound to k-ras g12c
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
168
structure length
168
Chain Sequence
MTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
molecule keywords GTPase KRas
total genus 60
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lucA00
2D62A 4HI0E 1YJ5A 4DJTA 4FXPA 1ZRHA 3QXSA 1TMKA 4F38A 3W3ZB 3KJIA 5HTKA 1Q0UA 3PV0A 1GNQA 2XNDD 2ZR9A 2OM2A 1VHLA 5DN6A 4CRWB 2YOHA 2A7QA 3B6EA 1W0JD 4F7WA 2PZGA 3PFIA 5CB8A 4AWXA 3F5FA 2QP4A 3R7WB 3MWLA 2EYUA 1UPTA 4PO9A 3C7KA 3K8YA 1E3MA 3BBPA 1W46A 2QORA 2XAUA 3CZQA 1F5NA 5IRCD 2ZM5A 1SVMA 2C5LA 4GOJA 1CR4A 3E1SA 4BEJA 4HSEA 3UMSA 4NYIQ 4HB4A 3SE0A 1XPOA 1DAHA 1P6XA 1SKYE 2F1HA 3K0AB 5FBWB 3Q7QA 4RFSB 1WF3A 3BH6A 3AGQA 2AL7A 2UZIR 4ESHA 4R98A 4Q7KA 1DELA 4B3FX 3U6KA 2RGCA 1E9AA 2V9PA 4HZIA 2WJYA 4NPHA 1FNNA 3IQWA 4XSHA 2JLUA 1Z83A 2FF7A 3QXCA 4F4CA 4KFSA 5KNCA 4B76A 1R8QA 1Z0IA 1OH5A 4JLAA 1XXHB 3EZ7A 5AR1A 1SGWA 1Q57A 1NLZA 1EFRD 4MUAA 3RAPR 1GKUB 2AXPA 3IGFA 1KZ7B 1KMHB 3KKNA 3RRYA 3R7WA 3OIWA 1MO5A 4B71A 2QENA 4LPKA 1T5IA 1E0KA 4QOSA 5LDDC 3CIOA 1T3LA 3ETLA 3P27A 2CLCX 2GJAA 1RRCA 5LD2C 3N5CA 4GOXA 3LV8A 3CZPA 4ON9A 4NL4H 1AN0A 3RANA 1UBGA 1Z6AA 1U0LA 1JR3A 5AJXA 3BB1A 3ZGXA 2HV8A 3UG7A 1CXZA 1UDXA 3MMPA 5EZ5A 4EDHA 4AYTA 1GP2A 2LKDA 3THYA 4FMBB 2A3RA 3AVQA 3CONA 4QHYA 3OEHA 1HH4A 2W6JA 2ZI9A 3V00A 2PX3A 4B73A 3JZMA 3LX8A 4CIDA 4GFDA 2BM1A 4P4SB 3D7MA 4RKFA 3PITA 1MO6A 3THYB 3IO5A 4M1YA 1X6VA 5EXTA 4B3CA 2GCNA 5LB2A 1R8SA 1ZUIA 4DLZA 2ONKA 3KDSE 4PQYA 1SHKA 4DRZA 1R0XA 3PEUA 5F3WB 2ZS7A 4IOKA 4M0LA 5D3MA 3FMFA 4QNMA 1OXXK 2O0JA 1FZQA 2V6IA 2WKRA 3AVPA 2AKAB 3Q3JB 4HUQA 4Q9KA 5C4GB 5P21A 4DSUA 1KO5A 4ZV4A 1E2HA 4CT4B 2WWFA 1G7TA 3CNLA 4WW0A 2HT6A 1SVIA 2P5TB 2Z83A 3KX2A 4U7DA 4B74A 4LY6A 1FP6A 2ZR7A 2PZFA 1Z3IX 2E1RA 3F8TA 3NKVA 3I73A 4M1WA 2IWRA 5BN4A 4Q1EA 1QG2A 3IEUA 1DVRA 2N46A 4TT3A 3AVTA 4LJ5A 2EWVA 2QT0A 5K8TA 5F9FA 2DWQA 3ZH9B 3ZZ0A 1DAKA 1U8ZA 2WWXA 2RHMA 2IXEA 3THWA 2EFHB 1RFLA 2AR7A 5IK2A 3RS5A 4A8JB 4IW3B 2J0VA 1SXJE 4PSVA 4BGDA 2WAYA 2JDID 1I4LD 4TT3D 1PUJA 2XZPA 4B34A 2FMXA 4B47A 3IUYA 4JJZA 4IKEA 1XBTA 1SXJC 3PXGA 2P0EA 3WYGA 3RSOA 1MT0A 2QAGA 4QG7A 4UNPA 2WWGA 4BUJA 2GK6A 3DVLA 2J7PA 2BJVA 1E1QA 2OXRA 2WWYA 1J8YF 1LTQA 1CP2A 1KIMA 2BC9A 2CCKA 4MKHA 3VKWA 5ELXA 1T6NA 2IYQA 3FFBA 4LHWA 5FPHA 5CYPA 3GLIA 3TR5A 1ZC3A 1W4AA 1G8FA 4BASA 3QG1A 1KJWA 121PA 4G1UC 3PCRB 1E4YA 3OE7D 4NCKA 1OH7A 3MD0A 1KJZA 5CM8B 4CEIB 4ZCIA 3VX3A 3T12A 3X1XA 1VG9B 2YYZA 3EIQA 4KV9A 1K8RA 2O8FB 2ZR0A 4KVGA 3QQ5A 1OE0A 2FWRA 5TMPA 3K0SA 4UNQA 5KHOC 2QTHA 4IOMA 1KI6B 4V03A 2ZPTX 1B0UA 2ORIA 5JEDA 1DAMA 4M2LA 3N70A 5FR1A 4XVUA 4V0ME 3AKDA 3BD9A 2OXCA 1I2MA 4FMCF 2J59A 2JA1A 3DM9B 4GZMA 3VMFA 1TADA 4Q4AB 3U3RA 1NMXA 3IBGA 2QSYA 2HCJB 5CLQA 2ZYWX 1G7CA 1RYHA 3IBYA 4EPWA 3HU3A 3SHFA 2PEZA 1QHYA 2H7VA 4WXRA 1O3YA 3LA6A 4Q48A 3W5IA 3MG9A 3UG6A 1CS4C 1E94E 1YZLA 4IDHA 5JLJA 3U5ZB 1YR6A 2ZRHA 1L4YA 5EE9A 3U6BA 5CDFE 2P5SA 4NH0A 1M8PA 2QRNA 1P60A 3R20A 1D5CA 1G18A 3SFVA 4NP6A 1AIPA 1FFHA 2ZRNA 1ZW6A 3KUCA 3TW8B 2WSMA 1EX6A 3EIEA 1HEIA 2FSIA 4M1OA 4B43A 5EP4A 4B6EA 1COWD 5F98A 1GTVA 1H8EA 2KB0A 4Q4JA 3QE0A 2PT5A 4DHEA 2BBTA 1XJCA 5JCPA 1ETUA 3THOA 5JS8A 3VHLB 4EAQA 2FDCA 1NVWQ 1FX0B 1CU1A 2VP2A 3K0CA 1Z6YA 2J0UB 4D0NA 4DDTA 4NHOA 2I1QA 3PQCA 2J0SA 5BYJA 1E2JA 4BLRA 4TQ9A 4JLJA 4POAA 2ZAMA 1S4QA 2QI9C 5ANRB 4FMDF 5EP1A 1YR7A 4ILEA 4OQXA 1X8LA 4C2UA 1M7HA 3CH5A 2OEPA 4JBXA 4BWYA 1K5DA 5LB4A 4Z1MD 1NG9A 4DLRA 3EIHA 1E0AA 1P75A 2H57A 3TUIC 4YQFA 1AQYA 1KO1A 2ANCA 4PPQA 3AKEA 1H65A 1XTQA 2JLVA 3CX7A 1G5TA 2PJRA 3NIBA 2JLYA 4Q1BA 1E96A 4LHXA 4I99A 3RC8A 3ASYA 3LBIA 4Q21A 3TGPA 1Z28A 2ANBA 2XX3A 1TU4A 3WMEA 2ZI6A 1GRNA 1N6NA 4URZR 3M1IA 5HE8A 4D4LA 2O8BB 1KZGB 1F48A 4AURA 2RGEA 4C0AC 2XTNA 2PMKA 1UBEA 1B23P 2CE2X 3O8BA 3ADBA 1U8YA 3FDIA 4WIAA 1Z0DA 2ZRMA 1E9EA 1QHIA 1UJ2A 2A5JA 2F1RA 2ZTSA 4GRAA 3NBZC 3VQTA 1ZD9A 2ZJYA 3VR3A 4ABYA 2ZE8A 3THXA 1YR9A 4RVCA 1N25A 1OYWA 2ZRDA 1G3RA 2GAAA 1AM4D 3NG1A 3SU8A 4DDVA 1SVOA 4TYPA 4B3GA 2A78A 4MYUA 1AA9A 1IONA 4KSBA 4PQRA 1JR6A 1DO0A 2ZUDA 4M1SA 1XJQA 1XMVA 4NONA 5JJIA 1VMAA 2IYSA 3LX5A 4U02A 3U3JA 3VR5A 5C1BA 1KSJA 3D6TB 3TSWA 5KTYA 3ZLJA 1SXJA 1A4RA 1RJ9A 4CT5A 5GJVC 4MRPA 3W6OA 3GFOA 1S1MA 2R2AA 4Q4JB 2JGNA 1P9RA 4KHZA 2CK3A 4M9ZA 2FOLA 4TMWA 2ZRCA 2WPDD 3NH9A 3CB4A 1W2GA 2DY1A 5J4VA 3RHFA 2Q9AA 3WRYC 4EFMA 2WMNB 3C4JA 2GF0A 2BV3A 5KDLA 3ECCA 1GITA 3RSLA 3WBKA 1Z2AA 2H92A 3BJIC 3M6AA 2KE5A 3TUZC 5HR5A 1ZCAA 4TLAA 1P2TA 2IHYA 2C04A 1WE2A 3OIUA 1G3UA 1T91A 1A5TA 1E99A 2FPMA 2CCJA 1MABA 2ZJOA 3GLGB 4LV6A 2R6CA 2ONJA 3OAAA 3V9PA 2DB3A 1KSHA 4Z1MA 4PFSA 4EPRA 1YZUA 3LVQE 3NHBA 4CDGA 3G5UA 3HWSA 3MWJA 4AI6A 5J5CA 1G7SA 2HJVA 5L8VA 2Z5FA 1NVVR 2GTPA 4MKFA 2DFLA 1TNDA 2H1LA 3TW4A 1E9SA 3NC1C 2WAXA 5AWFC 2ODEA 3EASA 4Q9LA 1TF5A 4IVQA 3CF6R 4Q03A 2ZS8A 5AJWA 1E69A 4FCTA 2XXAA 4PPGA 4QM7A 4DLXA 4QGAA 3R8FA 1YRAA 2ZITA 4C3ZA 2W58A 4Y0VA 1ZUHA 2BEKA 4IVPA 5EUMA 4MQBA 5JECA 1W4BA 1YZTA 1V43A 3EPHA 2ZANA 4R7ZA 3NEYA 2LCFA 3P26A 4LPSA 4NKRA 5FOVA 3TR0A 4K46A 3A8TA 5FTMA 1TQ2A 1XZPA 3H0KA 2E9SA 2Z4SA 4LZZA 4LYAA 3GD7A 2DPXA 2JDIA 1CULC 2LWIA 2W2TA 2I4IA 4Q9HA 5JFGA 2EFEB 4G0NA 3CNNA 1LV7A 1ZC4A 5D3MB 4D0GA 3PR1A 1SVWA 2QQEA 5JJLA 3KB2A 1FNMA 2VF8A 2YOFA 1IOZA 2OCBA 2DFTA 2XOKD 1Q1BA 1GM5A 4MITA 2GETA 2ZYTX 2YV5A 1YHNA 3TVTA 1T0HB 2Z43A 1E2FA 2NO6A 3L0PA 1Z08A 5AUOB 3VU9B 3KQNA 3KXLA 2ZXUA 1UKYA 1RPZA 1ZCBA 3Q9LA 3P4YA 5EE0A 1EXMA 5B30A 4BZXA 2XOKA 3U44B 4NDZA 3NBYC 1XCMA 5EUQB 5KSOA 1FTSA 3LRPA 1GAJA 4CEJB 3THXB 4P32A 3WMFA 3G0HA 2XZLA 4PC7A 2IHBA 2CBZA 5JCZA 1MO4A 4DIEA 1EWRA 5JHGB 4A15A 3QPWA 2YZ2A 1RYFA 3ZD7A 4XD7D 4LJ6A 4DUGD 4GPTA 1II0A 2QY9A 1S1CA 1QHXA 1I4DD 2QG6A 4GSYA 1WQ1R 2ZI7A 3LY5A 3RS3A 3EX7C 1S2MA 3O8CA 5IF9A 2GF9A 1OHHA 4JVMA 2NZ8A 4TL7A 1L8QA 4XH9B 3RLFA 5BW8A 1N6PA 4IDNA 4Q9IA 3GJ4A 2IYXA 4C0KA 2ATXA 1JI0A 4A36A 1EFHA 2DHRA 1QHNA 4W9MC 4URYR 2E87A 3X1YA 3GPLA 3QXHA 4QGGA 1XTJA 1C1YA 3IPYA 4BFTA 1T3HA 2MSEB 3AVUA 1TUIA 3MCAA 3CBQA 4G5RA 3K70D 4Q4LA 1W48A 3EXAA 3HR7A 3HYRA 4KODA 2V7QD 3QOFA 1XDBA 3GJ0A 3QIAA 2O52A 2OBLA 2ZYUX 4QJ5A 1KK2A 1US8B 1OIVA 3A4MA 1W2HA 2NO9A 2BHRA 2O0HA 1XCGB 3VFDA 4TTRA 5G3YA 1AS2A 4W5WA 5AJZA 4C0SA 4KO8A 2R65A 3V4RA 3UIEA 1ANKA 1BYIA 4LV8B 2J0UA 5B2ZA 5CIWA 1WBBA 5L3RA 3QF4B 2F6RA 3B1VA 5E4FA 2WMOB 1BIFA 1N0UA 5FOWA 2F43A 2D7DA 3BE4A 4RD3A 3K9LA 4RCYA 4D2IA 2B8WA 4GI7A 2WJGA 5M04A 2H17A 1E2LA 2FEOA 2WWIA 3LQRA 3K9NA 3GJ5A 1VIYA 2ZAOA 4JVSB 1IY0A 2ZU6A 2R62A 2W6IA 5E95A 2CHGA 4FI3C 1S8FA 2AK2A 1W5TA 2BOVA 4DCSA 1MR3F 1S0UA 2GWHA 2CJWB 4IOJA 3AH8A 2PX0A 2QRZA 3I32A 2GK7A 4Q00A 5IT5A 4JKIA 3AKCA 5GVRA 4LGMA 3TSZA 1G41A 3CRVA 3KQHA 3SR0A 3VHXA 1Q1QA 3VR6A 1F60A 3M0EA 2CJWA 3P1JA 1G6OA 4D26A 2FJUA 3KJEA 4GP6A 4EFLA 4TSFA 2IYZA 4XTCS 5AK0A 2ERXA 4B6FA 3LO5A 3BAFA 4DCUA 3GJXC 3KL4A 4ZIRA 5IK2D 5FL3A 3IIMA 4FINA 4RZ2A 4P4TA 2BJWA 4ZCMA 3MWKA 2P3SA 3BH0A 4LHZA 2OHFA 1R6BX 3H84A 4MRSA 4EUNA 1OFIA 3AP3A 3BFXA 1FL9A 1GKYA 4OHXA 4LJAA 2WIBA 3RDPA 1KI2A 1WCV1 5DI9A 2QBYA 1XD2A 1II8B 3RYTC 4DCTA 4B3BA 5JRZA 3KQLA 3CO5A 4MKGA 3QVVA 3QNUA 2DFNA 1U9IC 4JLOA 1SXJD 5H8WA 4EPVA 2X19A 4LYHA 5DISB 3N2EA 4OK3A 2G0NA 1FP7A 1X3SA 1U94A 2HUPA 4GT1A 4WAUA 2WM9B 1FMJA 2GILA 1XF9A 1Q22A 2WPDA 3H4MA 4DB4A 2OCPA 4NTZA 1AJEA 2TMKA 4JZKA 3SJBA 1G21E 3GLHB 2ZRAA 4XOIA 2JATA 2CL0X 1TEXA 3P4XA 1R4AA 3RWOA 3OEHD 3ZYCA 2FG5A 1NJFA 4NE2A 2FGJA 2GRJA 1Z0KA 3TAHA 4EJSA 1S9HA 3BGWA 1ESNA 2EFGA 2ZU0C 1E1RA 1D2EA 2PBRA 5CLLA 1C4OA 3ZVLA 3Q5EA 4GMXA 1N5LA 2DWPA 1GWNA 3LW8A 2Z6VA 2R6AA 4JSYA 3SC3A 2C8VA 2GKSA 4CW7A 3C5CA 1ZVQA 4D82A 1JAHA 1Q20A 4JIMA 2JASA 5FI1B 5FI0B 3QXXA 3SYKA 4YLGA 3GLHE 5E7MA 2QN6A 4AYXA 2P2LA 2VIIA 2RAPA 1JEDA 3K0EA 2QBYB 1KKLA 2YC4C 3QVUA 1SKYB 2WOOA 4AC9A 1ZM2A 1W47A 2NQ2C 3RS2A 4PC1A 2CNWA 4A0FA 4KLZA 3EPLA 2K5UA 4DSTA 1UDWA 1SVSA 1FUUA 4A0HA 2IWHA 2WWWA 1F2UB 4TLCA 2WHXA 1E6CA 3EG5A 5K8LA 1FQJA 2KBEA 1DS6A 4BZQA 4RY2A 3K0FA 2IS6A 2XSZA 4Q66C 3WNBA 2IXGA 2CVFA 2ZJAA 4I1SA 3RS0A 1QHSA 2V55B 2FFBA 2ZIAA 1T8TA 3TUJC 4PX9A 2XNSA 1R0WA 2RMKA 4KVAA 3FE2A 4XIGS 1SXJB 3T1TA 4U5XA 2VBCA 5CM9C 1P9NA 2RB4A 3ICQB 2DWOA 2XSZD 2RGNA 1X86B 1GZSA 1QHHA 4DWJA 1MRNA 3PG5A 2IYLD 5BXQC 1XWIA 3QUSA 4HB3A 5HKKA 2A5GA 4E5UA 3OZXA 3BB4A 4MYHA 4TL9A 1JJ7A 3S1AB 4HATA 5TY0A 3SQWA 2A5YB 2C9YA 1HTWA 1JEEA 3C14C 5SZJA 5C18A 2IS4A 4LK2A 4C0HA 1KKMA 1W0JA 4NYMQ 4TZ0A 5KOYA 4C4PA 2NZJA 1XEWX 2IYYA 1G1MA 1GSIA 1JQLB 1KDOA 2GHIA 4QJ4A 4YDHB 3EZ6A 4HAVA 1G5PA 2P6NA 3TMKA 3U2QA 3WHKA 1YVDA 4PSAA 3HYTA 3UMRA 4UXIA 2BVNA 5JS7A 3AQ4A 1E2MA 3TLXA 3TRFA 4QKQA 2VHJA 5KNBA 1VG8A 3K0AA 3FMPB 4RFVA 2ZRKA 1NY5A 2VF7A 4TMZA 2L0XA 3Q72A 4M22A 2ATVA 2CEAA 4JKYA 2QA5A 4TLBA 3CH4B 4LJ4A 4URWR 4ZDWA 4OI1A 4F4JA 2O8EB 3CPJB 4L9WA 2FNAA 3L0OA 3VAAA 2BMJA 1HT1E 3IHWA 4UNSA 1G19A 4U00A 4EPXA 4TTQA 2CK3D 3FB4A 4JLPA 4YDSA 3SJAA 4DCNA 3AF1A 3NXSA 3OF5A 2YC2C 1Y63A 1KOFA 2XNDA 2ODNA 1P61B 5DN6D 2BM0A 3O8RA 2VP5A 1QZXA 5J4KA 1KMHA 5EXPA 4ZI2A 4IDOA 3CLVA 3P32A 3T06B 3DPUA 2XITA 2OLKA 3U44A 1VCMA 4OJQA 4Q7LA 1UADA 3SYLA 3CR7A 2JLXA 5FPSA 1R5BA 2OFOA 5EE1A 1H8HD 3EWAA 5CDFA 3S1AA 5KSZA 1KY3A 4GL2A 1K5GA 2OT3B 2PLFA 3WHLA 1N3BA 3VKHA 4ZO4A 1U81A 5FTKA 4KCGA 2QAGC 4JVLA 5CIQA 2GXAA 2NTYC 3NC0C 2ZVPX 3LFUA 4V0MA 4WA7A 4A2WA 1GILA 4BLQA 4NYMR 2BMDA 2N42A 4HAYA 3AV0B 1LVGA 4QRHA 3J81k 5FUWA 3PUVA 4LI0A 4M9QA 1OKKD 1CJMA 2HLDD 3PEWA 5FOTA 1S9DA 4LJ9A 3LNCA 1KAOA 4AD8A 1E2DA 4IXMA 1QBKC 4B32A 5J4YA 1E9FA 1NVUQ 3CWZA 2HT1A 1E9CA 5JBQA 2OLJA 1A2KC 4LJYA 1NLYA 2KBFA 3IDQA 1LW7A 4BQSA 1N5JA 3QF7A 5GVSA 1KI6A 5CJPA 2WSSD 3KTAA 2F55A 3CRMA 2VHUA 4H1UA 1IN4A 2H5EA 3OIVA 2LKCA 3EZ9A 4PHFA 4RKEA 5EZ6B 2GZHA 1YKSA 1BYUA 1Z22A 2R44A 1L2TA 4CEIA 5DSZA 1VDZA 4TLDA 3ICEA 1N0WA 1JQJC 2VEDA 4PZZA 1EWQA 2YWFA 5FTNA 2ZRPA 1NL3A 3MJRA 2WVJA 2PT7A 4OQLA 2P6RA 3PEVA 5DIFA 3Q5DA 4V0KA 2J9RA 3PVSA 4KLNA 1CJTC 3ZS8A 5BN5A 4OKSA 1W49A 4MRNA 4MRVA 4PHHA 3WBJA 1AKYA 2V7QA 4GBMA 3X2SA 2OG2A 4EPTA 5J4HA 1GOTA 3W6PA 2FE4A 1KY2A 1TUEA 1PLJA 4RD4A 1ZU4A 2MMGA 1Q12A 4AK9A 2QMOA 4YXWD 4PHGA 2JJ1A 2RGNC 2VSFA 3KTAB 1R7RA 3AVXA 1JALA 4HLDA 3IEVA 4JYBA 3G82C 5J40A 6Q21A 2Q3FA 4R9UC 1P2VA 5LPNA 3RC3A 2W83A 1TAGA 2YNMA 1DTSA 4KYUA 4LWZA 4RD1A 4EQ6B 2QGZA 3K09C 4ZKDA 1D9ZA 3H2YA 3KQKA 1BMFA 2OAP1 3RABA 1XNJA 2C95A 3QBTA 4HEJA 1D8TA 3FHOA 3NBXX 4QBIA 3TBKA 5KDDA 3GP8A 1G17A 2B7CA 4C9BA 1N2CE 3LW7A 1EGAA 4BFVA 1L7VC 5DLQC 4GP7A 3GLIE 1G3MA 4US2R 2X1VA 2C98A 1WBDA 2RGDA 1EESA 1IJEA 3O47A 4O2RA 1UBFA 4QNRA 5TDHA 3V4FA 3FOZA 1IXSB 4BRWA 3DZDA 5AUQA 1IXZA 2Z0MA 2F43B 3A1VA 4XWAA 3K1JA 4FMCB 1KSFX 1JPJA 4LBWA 4CEJA 4CZ2A 3W8RA 1II9A 4M1MA 2J46A 3QXJA 4QBHA 3RRNA 5FBLB 3MGCA 1ZM4A 4HLUC 1O87A 1ZM7A 1KJYA 3EZ2A 2QM8A 4DT1B 4DLWA 4A92A 2ZROA 4A82A 4CEHA 1SKQA 1J90A 1LF5A 1GL7A 2GEDA 4DT1A 1AS3A 2CXXA 1ZMXA 3TSOA 1DG3A 1KGDA 1NP6A 1DO2A 1NKSA 3EWSA 3HR8A 2ZS9A 1OIWA 1CLUA 4AIIA 2IW3A 4BFSA 4I1OA 1DPFA 1NF3A 4HB2A 3VNUA 4YMWA 2JJ1D 2AD5A 2A2ZA 4G01B 2WJHA 1OV4A 2BEJA 1YZQA 1XTKA 4DSNA 4UNRA 2WBLC 4PC2A 4QXAA 4DEXA 2O5VA 1M1YE 3U3KA 2O8DB 1TU3A 2GNOA 3BRWD 3UWKA 1A82A 2VO1A 1XD2B 2FA9A 2R6GA 1EFRA 3B8HA 1Z29A 3GLFA 4K8OA 1Q1ZA 2WKPA 2WWHA 3W8NA 3TNFA 3GCGA 4LBVA 1Q21A 4JS0A 4DVGA 3GLGE 2IXFA 2HEIA 2SHKA 2UVQA 2W2VA 3T5GA 2QQ0A 3LBNA 3CWQA 1OFTA 1FTNA 4A2QA 4H9GA 2ZRLA 2A30A 1YR8A 3W3AA 5TXGA 1LFDB 3U60B 3MSXA 2FZ4A 1E2NA 2AD1A 1BOFA 4M1TA 4TL8A 1OIXA 3L2OB 1FW6A 3NDPA 1G291 5DE3A 5CK5A 3GJ7A 2W6ID 3ZIAD 5JI3E 4Q02A 4M21A 3EC2A 4MUBA 3QI2A 1XEXB 2IEYA 2WOJA 3QPUA 4JSTA 3AKYA 3LXRA 3QBVA 4BRUA 1JXMA 2BMEA 3DHWC 2BCGY 4NYJR 3K09A 1U2RA 2CL7X 2QMEA 4WBSA 4EKDA 2WIAA 5CK4A 4D4MA 1G7RA 4I4LA 3E70C 5L3QB 1TF7A 3QKTA 4Q9JA 1SVKA 1Z6GA 1MKYA 1BS1A 1ONBA 1WXQA 2OBNA 3QKUA 2NPFA 4BEBA 2XTZA 3TE6A 1WMSA 3O8DA 2QGNA 4NYJQ 1P3JA 4C2TA 4DBLC 2G6BA 1CR2A 4KU4A 3AGPA 2PCJA 5EXXA 421PA 3NBFA 1OB5A 1NMYA 2GEVA 1H8ED 3B1YA 2IL1A 4QBFA 5BQ5A 3UK6A 3AUYA 5AUPB 4QBGB 2IUUA 1MH1A 3GFPA 3T15A 1G6HA 1GKIA 5B64A 2G77B 5G40A 1E2IA 3FKQA 5D3QA 4F4IA 5TB5A 4TMKA 2A5DA 1IM2A 1ZYUA 4D0LB 4OL0A 1UBCA 4PAMA 4BLPA 1SVLA 3AM1A 1Z2CA 3DM5A 2ORWA 3VR1A 3PJRA 4D81A 2NOAA 5JRJA 1RW4A 3GJ8A 1D9XA 3HDTA 4KYIB 4LSGA 1T5LA 4BFYA 2JJ2D 3L0SA 5LD2B 5GADl 5IHPA 3FWYA 2C96A 5UKDA 4RD2A 4UNNA 5EE3A 1IN7A 3C5HA 2GZDA 3AVYA 1NVVQ 2IYUA 1HY3A 4LV5B 2ZVQX 2ZSDA 4ITRC 1ZNZA 4C0LA 3SFZA 4XWKA 2J1LA 3C41J 4JLBA 4IJMA 1XFAA 4N1AA 1KYIA 1I2DA 3ADKA 4M1KA 2Q9BA 4LRWA 4MRRA 4OHVA 4RSGA 4A1FA 1GG2A 1GNPA 2YHSA 4MKIA 1OFUX 1G8YA 3NH6A 4NU0A 4DXAA 2GXUA 4JLMA 3TAUA 1CTQA 2V8OA 2ZQ5A 1HA3A 2IF2A 3UPUA 1RRPA 1E2QA 3DO6A 2HF9A 4KSCA 1XXHA 4TQAA 2HDNB 2F3RA 3CM0A 4LYJA 4V0OA 2BWJA 1BO6A 1MABB 1Z47A 5FBRB 4A4DA 4OHWA 1RC8A 2ERYA 4HAUA 4HLUA 5HE9A 3B9PA 2F3TA 5SZIA 3CPHA 1J8MF 3AF4A 5HCIA 3W90A 1D2MA 2BBWA 2ZSAA 4WXPA 2KSQA 2EW1A 4C7OB 2R8RA 1XMIA 4D80A 1RE0A 3K9GA 3OHMA 4M9XA 4IVRA 4PO8A 1QRAA 1DE0A 5G41A 1VYTA 5TV2A 3BIFA 2NO7A 3B1ZA 1DAFA 3CRW1 3N2IA 4LDJA 4S2EA 1PV4A 1MO3A 2CDNA 1XJ0A 4H1VA 4LBZA 4CYMA 3TQCA 2VL7A 2BCJQ 4DDUA 3K70B 1E9RA 3PUWA 2NG1A 4QFMA 1E1QD 4A6XA 2ZYVX 2QU8A 4DZZA 1F2TB 5EXSA 2YOGA 4KBGA 1A1VA 4KFRA 4ZDIA 4KAXA 4OQFA 1TTTA 3TIFA 4QM6A 1E2EA 2Q6TA 2ZJZA 1GIAA 4OQMA 4M53A 3KFVA 3FTQA 1KDRA 1ZAKA 4DLYA 1CR0A 2HYDA 3U7EB 2D2FA 3KXIA 5FTJA 2A9KA 2PMDA 1OKKA 4Q18A 3B7GA 3DKPA 3I61A 4JL5A 2YINC 4HUTA 4K81B 1KI9A 2ZSFA 3QPVA 4XD7A 4C30A 4DUGA 4Z8XA 1ZM3A 3TQFA 5H1YA 1N6KA 1IXRC 1DAGA 1JR3D 3QKRA 1NSFA 3FVQA 1U9IA 3I5XA 1X8JA 2O8BA 1VCOA 4QGFA 2CLSA 1FQKA 3QEJA 1KI1A 4Q7JB 4EQ6A 2D7CA 4JBYA 4B48A 3SJZA 4PPFA 3HPQA 4BFXA 2QPOA 4A2PA 3NEJA 4NCNA 5G3ZA 2ASEA 3TH5A 3T34A 2AKYA 2ZETA 1GDDA 1NSTA 2J5XA 1H8HA 2OCYC 2WJIA 3WYFA 5JZVA 5J4LA 1KI8A 2IS1A 4QHSA 4DKXA 1P2UA 3LLMA 1VYVA 2QP9X 1OB2A 4JLDA 3MLEA 5L3SA 2XGJA 4LBYA 1G16A 1G9XA 1P4SA 2G88A 1LY1A 2ZRGA 1NRJB 1E79D 4G5QA 1IHUA 1KAGA 4R2IA 4Q1CA 4F92B 3SQXA 2B21A 2F7SA 2G0TA 4WZBE 2XTMA 5AJYA 3T61A 4HDCA 5C46F 1TF2A 2CMKA 4CGZA 3U61B 1Y3AA 4NCHA 2C2HA 4N3NA 1MV5A 1E2KA 4KFTA 3E5HA 1KK0A 4B2IA 5FOXA 1CR1A 2YVUA 1F2UA 1XMSA 2F1JA 2ZRBA 3EZFA 5FH9A 2IX3A 2FFAA 1VIAA 1DBSA 2PJZA 1SQ5A 3MUFA 3ZDQA 4AKGA 4Q19A 3FYHA 5G53C 2VTKA 4HZUB 3EC1A 3K53A 1XEXA 3MRSA 2VQSA 4DDWA 2WJJA 3WRXC 3SNHA 4RZ3A 2P6UA 1VCNA 4OHYA 1VTKA 1W0KA 1NIJA 1VG1A 2VA8A 2EWWA 3BK7A 4V0LA 1E2PA 3CRRA 3NTUA 3SN6A 3LDAA 4LHVA 1AK2A 3CKLA 4URUR 3TK1A 4AG6A 2QUZA 3UATA 3WP1B 4F93B 2F9MA 4JLVA 1P62B 1E32A 2OV2A 5EP3A 4UQOA 1HYQA 4Y0AA 4HB0A 3THWB 2ZE7A 3OIYA 2FSFA 1Z0AA 1Z0FA 2BDTA 1Z07A 4KI0A 3B1XA 1N5IA 3HPRA 5KSPA 3DZ8A 1GFIA 4JLNA 3NWJA 3U4QA 4PANA 2MMCA 3R9XA 1Z0JA 3FPAA 1FOEB 1D6JA 4DB2A 4BFWA 1GL9B 2VP9A 2CNWD 4MGYR 4ZI3A 1P9WA 4J0QA 1M7BA 3M4YA 3SYNA 1S3GA 3WYAA 4HLCA 3SOPA 4D4JA 1DAEA 4HUQB 2ODWA 3F3YA 1EFCA 3DL0A 1G64A 3R9IA 2P65A 1L4UA 4L15A 2ZRIA 2J3EA 3FHCB 1W36D 5K8IA 2IEZA 1CF4A 1NBMA 4IHQA 3U7GA 4US0R 4BLSA 1DEKA 4LHYA 4TWZA 5IDVA 4F91B 2JLWA 1ZJ6A 4O0MA 1BH2A 1NBME 3GLFE 3B82A 2V54A 4B2PA 1V5WA 3BORA 1US8A 1VECA 4OYHA 1SZPA 4Q1DA 2FX3A 4LJ8A 2PZEA 4BFZA 4EJSB 2ZRJA 1NY6A 1QF9A 3FGNA 4Q01A 2VHQA 1TQDA 1OT3A 621PA 5L3SB 3FMOB 3U3OA 4R71A 3X1ZA 5KO2A 3K9HA 5JSZB 2IBMA 4OQNA 3EARA 4Q4AA 3A1SA 4YONB 2QT1A 1KNQA 2DYKA 2KWIA 2VPPA 3A58B 4XVQA 3T5DA 2O8CB 2YJTD 5TARA 2PCLA 3SBDA 5FOUA 1JJVA 2IYRA 5DHFA 2RGAA 4B44A 3GLFB 4OK6A 4RD0A 1U8AA 5FPTA 3ZZUA 4ARZA 3W34A 2DFKB 3KFXA 1RRGA 5KYKA 4FCVA 2VSXA 2J0QA 4JYCA 1P7CA 2W0SA 3L8YA 3JZAA 1M2OB 4HDQB 4E09A 4E22A 1C9KA 2XB4A 3CNOA 4QL3A 3DEFA 2XJ4A 3I1FA 3NVAA 3KB1A 4XSGA 2HF8A 1HQYE 1N6HA 1OJLA 4HYYA 4PXAA 4PZLA 4CEHB 1F2TA 4Z54A 3DMNA 3PUXA 5AJVB 2EQBA 5A5GA 4LUCA 4IRUB 4X8LA 1Q1EA 3SDZA 2I3BA 1DOAA 4AY2A 3BC1A 2JLRA 2ZREA 4NCJA 1GRRA 4OHZA 4RFSA 2ZI3A 3FKSD 1W4CA 2QMUA 4KJZA 3W9YA 1CEEA 2QAGB 1CJKC 4JLKA 4PAOA 1CRPA 4TMVA 1KMQA 1KI3A 1XX6A 4RD6A 3LBHA 1GUAA 3CW2A 3WP0A 5JI2E 3X1DA 1UKEA 4D4KA 3TJZA 1KI7A 3B60A 4ERNA 1N6RA 1EG7A 1QVAA 3K0FB 1YQTA 3CPEA 2PEYA 3GJ3A 2QE7D 1G4AE 1P2SA 4DEYA 4NCIA 4QGHA 2ZJ5A 1OYYA 2GCPA 2ODBA 3E2IA 3BERA 3CF0A 3OEEA 1KSGA 5GJBA 1OFHA 3SS8A 1U0JA 3OE7A 3WNCA 1YU9A 4DLUA 1KDTA 3MJHA 3ND9A 5CYOA 3LVRE 2FN4A 2CE7A 1I4TD 2D74A 2O8CA 3DKVA 3PUYA 3OEED 1ZIPA 2WV9A 3FMIA 3ZD6A 1XXHE 1NIPA 1U99A 3F0TA 1M6NA 3HJNA 4IEIA 3Q85A 4LC1A 1NG1A 5E7IA 2IS2A 3R8CA 721PA 3A37A 3WNDA 4P4SA 4BLOA 4C0BA 4LC0A 4PR0A 1F3OA 2OSBA 4V02A 1XD9A 2EVWX 1RVDA 2REOA 3GEHA 4MDFA 2BKUA 2CLDX 5DH9A 2GJ9A 3HU2A 5KPDA 5FTLA 2OFXA 2AWOA 2VSOA 2C78A 2FGKA 5DI3B 1TPZA 3C15C 2G3YA 4UJ5A 1RKBA 4AKHA 1E2GA 2H18A 2JCSA 2JIZA 4HLQB 4TLEA 4AKEA 4B2LA 3QG5A 1JNYA 1IBRA 2WKQA 3QENA 3REGA 3UMFA 3CF2A 3D31A 2IC5A 4A8JC 3KKOA 2RH5A 3I5YA 1W44A 5JWHA 5AUNB 5J47A 3IPXA 1G20E 5LBIA 1YZNA 5JMTA 1IY2A 2G1KA 2J87A 1PZNA 4LOAA 1PUIA 4NYIR 4JT2A 4OBEA 2D4HA 3CUEF 1HV8A 2JIZD 4OI2A 1Q3HA 5FFMA 3QKSA 5FUXA 1CJVC 3LQQA 1OHHD 3I3SR 5H68A 1EFUA 2OO7A 1DG1G 3QKSB 5TVKA 4EPYA 4M9SA 4TYYA 1SHZA 4L4UA 2GZAA 1XD8A 1XTIA 4IFBA 1XTRA 4A9AA 4B3DA 3B2EA 1W0KD 5GJCA 2FPKA 2W00A 4FN5A 3KKMA 3ZZTA 1OLOA 3GLIB 1S3SA 2V6JA 4EFNA 4URVR 1VCIA 2ZUCA 4LJ7A 2R6DA 5DHAA 4QC2A 2OBMA 4IXNA 3LH5A 2FEMA 4WZ6A 3OFNA 1OXVA 3AF3A 4JT4A 2JLSA 3I8XA 1N6LA 3QSYA 3DDCA 1XPUA 3DOFA 4G5SA 1ZBDA 3BB3A 4E07A 1RRFA 3C8UA 1NNEA 2AHOA 1LF0A 3BS4A 3T1OA 4M8NE 3ASZA 3CX8A 2W0MA 4BZPA 2YWHA 3U3MA 1ODFA 1PVOA 1NN1A 1X1RA 1GVNB 1NN0A 3H1TA 4MDEA 3WMGA 3QEOA 4P0TA 2VHTA 3B9QA 2AFHE 5KU1A 2QTVB 2C77A 1UKZA 4D25A 3SJCA 2ZRFA 1TX4B 2JAQA 1TEVA 2Q0HA 2FZLA 1JBKA 2NO0A 4MYTA 4ZKEA 1LNZA 3B5JA 4YMTA 1TQ4A 4L16A 2ZJ2A 4M4SA 3SZRA 1Z6XA 1HUQA 3LLUA 1XTSA 5FUVA 1ZD8A 4TN1A 1SULA 4DLTA 2FSGA 2JJ8A 4JVNA 2GXQA 1CRQA 4XJXA 1XMJA 3QF4A 3PIRA 4HAXA 3FFAA 1AGPA 4ZCLA 4Q1AA 3D8BA 1KI4A 5HPYB 5B57C 1P73A 2HCBA 1AQUA 2QAJA 2HXSA 5FBQB 3JVUA 2VYFA 2WICA 4MH0R 2HXYA 1OH8A 4I1UA 2VLIA 2G83A 1KTVA 2XEXA 3A36A 5E7JA 2G9NA 1ESMA 3L8ZA 3RRMA 5KSYA 1IN8A 1QHGA 2W6JD 3AF2A 2ZSEA 1ZNWA 3IQXA 2FH5B 1QG4A 1M74A 2UKDA 1JB1A 1T9HA 3KJHA 3CR8A 5FPYA 1XZQA 1DARA 3CX6A 1WDTA 1MOZA 2RHDA 2X2EA 4Q1FA 4S35A 1W5SA 1T3SA 1ZNYA 4O25A 3PEYA 2QROA 1R0ZA 1ZP6A 1P72A 1Z06A 1U90A 1GL6A 2WJVA 3EW9A 1AZSC 2IUSA 2AXNA 3ADDA 5K8UA 1W1WA 2V1XA 2ZI4A 2QL6A 5EJEA 1X1SA 4CF7A 5L3VA 3REFA 4P31A 2HJGA 2Q3HA 4XWOA 1COWA 1T4GA 2NGRA 5EQTA 4LYFA 1E4VA 4PQFA 1KNXA 4ZPXA 1A2BA 1IJFA 4C0QC 2GDJA 4A6PA 4TMTA 2OCAA 2F1IA 3Q7PA 3SEAA 3NHAA 4YC7A 1AGRA 4GMDA 4RJLA 3KKPA 3UWOA 2WTUA 2BBSA 2GJ8A 3DOEA 3ADCA 3VNVA 2VHCA 221PA 4RZXA 3RWMB 1P5ZB 2ZE6A 3VR4A 2VP0A 2IA5A 4ACBA 3L82B 4ZDJA 2Q3MA 3KQUA 2QPAA 3EPKA 3D3QA 3B13B 4ESVA 4Q4HB 3GFTA 1BMFD 4W7SA 4DLSA 4Q5IA 1NN3A 1VYUA 3FKSA 2OILA 2BBOA 1JXOA 1NVXQ 3SHWA 2J7KA 3ND8A 1VPLA 5KNDA 4TYNA 5DGXA 3A4NA 1CJUC 4LCBA 4FCWA 2I1VB 4FW9A 2J41A 1R10A 5SZKB 4X8MA 1G8PA 3AB3A 5CB6A 2QNRA 1LB1B 1Z63A 4PTLA 4II7A 1MRSA 2RGBA 1G3QA 1ZU5A 4ACAA 4HAWA 521PA 4KBFA 1RJ9B 2GAOA 2ORVA 1XEFA 4JBWA 4OJKA 2IYVA 2GA8A 2C9CA 3NDBB 3L0IB 2J45A 1JAIA 2AFIE 5FUYA 2REBA 2B8TA 1ZM9A 2ZEJA 4L9SA 3WXMA 2F9LA 1OH6A 2GVZC 2ZUBA 1AS0A 4PHTA 4G5GA 4KXFB 3I4LA 4TTPA 4PSKA 1QHHB 1EX7A 4EIWA 1OSNA 1OW3B 4L8GA 3B1WA 1EK0A 1UEIA 1TQ6A 1NKTA 4MGZR 4DLVA 1DADA 2DR3A 3AP1A 4IFEA 4PZYA 3IHLA 1OPXA 3GMTA 3SBEA 3EAQA 2BIFA 2B7BA 3EA5A 4CVNA 4PO1A 1PJRA 1Z6TA 3L43A 1XPRA 2FV8A 4JMPA 2CL6X 4PAQA 1G4UR 2IYTA 3A1WA 2XZOA 4ZDKA 1UAAA 4Z51A 2BKEA 4PC6A 3R9WA 4BFUA 4YMUA 3QY0A 1KHTA 2OZEA 2PL3A 1LS1A 5JJKA 4TYWA 3U4QB 2MSCB 2C03A 1IQPA 1E9BA 4GNKA 3GEIA 2IF0A 2O8DA 4I81A 1D2NA 1VKJA 2HLDA 4C7OA 2Z4RA 2VP6A 4P33A 2EYQA 3KJGA 4RCZA 1KO7A 5DO9A 5EE5B 2YKGA 1UFQA 1W36C 3TVDA 2XXAB 5BYKA 2Q9CA 2ZJBA 2B6HA 3GQBA 2ZE5A 3PUZA 1S96A 1YZKA 1N5KA 2A5FA 1WB9A 2DBYA 1IN6A 1J99A 1R0YA 2GESA 1FUKA 3LWNA 3KZ1E 4PPNA 4OK5A 3T1QA 2JLZA 3KKQA 2FFQA 3OAAD 1J7KA 2OFWA 4MGIR 821PA 1M7GA 3A1UA 2FSHA 2ZSBA 3A6PC 4TQUS 4D6PA 2XJ9A 2D06A 4UJ3A 4A8JA 2BMFA 4Z8YA 4AG5A 4W5JA 1AKEA 4GDFA 1LS6A 5FOSA 1W4RA 1OXTA 2RCNA 1IAQA 3AUXA 5DNYB 1ZINA 5F9HA 2Q21A 4E03A 2AN9A 2NO1A 4QJ3A 1UF9A 3GLGA 1RZ3A 1NMZA 3KXKA 4UKDA 4JL8A 1NN5A 1F6BA 1ZD1A 1GRQA 4I1VA 1VHTA 3KUDA 4B75A 3SI7A 2GBLC 1HQCA 3BH7A 1M34E 3RS7A 5FPKA 4B3XA 1W36B 2R6FA 1G8HA 1N6OA 2IUTA 2JJ2A 3B78A 4TMXA 3B85A 4US1R 2C9OA 4GZLA 2AWNA 3ZQ6A 4URXR 1KO8A 3IKJA 3VR2A 8OHMA 4A0GA 1E0JA 1IY1A 1E9DA 2OESA 5JWOA 3RRZA 3JVVA 2H8KA 4FIDA 5EP2A 4UXJA 5FL7A 2KJQA 3QKRB 5JWRA 2QSZA 3IIJA 2WSSA 4A0RA 4QHTA 5A0FA 3VTKA 2IYWA 2QTFA 3C16C 2IT1A 4NZYA 2D3WA 2QM7A 3I72A 3I62A 1DAIA 1WP9A 4P4UA 5F2EA 3ZVMA 1XEWY 1E98A 1G3IA 4AYWA 1ZIOA 2VP4A 4BECA 2J7PD 4GOKA 1NI3A 2V4ZA 4DC9A 4DCVA 4L5BA 5H70A 4O3MA 2GVDC 1X8KA 3ONWA 2H16A 2CVHA 1E0SA 1II8A 4OI0A 4X8HA 1CIPA 2O8EA 3AVWA 4PC3A 5A4JA 2XB2A 5JSZA 1RIFA 1NBMD 3VU9A 1T0JB 3U7HB 3I92A 1J2JA 3ZQJA 1A7JA 2VH5R 4V0NA 2CHVA 1HT2E 2X8AA 4YXWA 1N6IA 1UKVY 3GJ6A 3LAWA 4N0EA 1FPMA 2C99A 3DMDA 4P3YA 1G5RA 5CITA 2DCUA 1FMLA 1R5NA 3T35A 3U7FB 2MSDB 2CCGA 2QEQA 1KO4A 2EU8A 2AK3A 4FWIB 2VRWA 4R2HA 3MWYW 2RKOA 2FFHA 3HP1A 3OESA 4XVRA 1KDPA 1XCPA 4Q47A 1OF1A 2JEOA 1W7AA 4O2LA 2QP3A 4B33A 1K6MA 3UKDA 4IDQA 1GNRA 3EPJA 3P20A 5BN3A 4LX0A 1ELOA 3H86A 1QDEA 3HU1A 5DYIA 4ASUD 1R2QA 2V1UA 5E3HA 1R5OA 4KITB 1XU4A 2CHQA 4YMVA 3ZJYA 3EA0A 3ZS9A 5KDOA 4ARZB 3CRQA 1KK1A 1YE8A 3ZVRA 4DIDA 2Y8EA 1J70A 1N0VC 1UM8A 3ZIAA 4OI4A 1PLLA 3OFND 1IN5A 2NPIA 3BOSA 3GEEA 3A1TA 5FR2A 2FPLA 3RVBA 2NIPA 4W5HA 5HCNA 5C4MA 2YWEA 1Q44A 5FL7D 1Q3TA 2QE7A 4TYQA 4BLTA 3UXMA 3BFVA 4JJKA 3T1VA 2RGGA 3WY9A 5L3QA 4TZ6A 2ZJ8A 2GCOB 1ZUNB 2O8FA 2G1JA 1U98A 2YWGA 3K70C 2X77A 3AP2A 2P67A 1JR3E 3RS4A 2GJSA 1ZNXA 1PLKA 2OUKA 4WOPA 5DI3A 3GLHA 5JEEA 2JLQA 4XTRA 2GBLA 4FD2A 3AVVA 4MA4A 2AX4A 2N1BA 3AEZA 2PLRA 1TL7C 1QVRA 4UXHA 3BXZA 1OXUA 4WZAE 3TKLA 5B58C 3VKGA 1E1RD 1WRBA 5KUTA 3AVOA 1E79A 2QMHA 3Q8XB 4BE7B 5HZKA 2GEUA 1CBUA 3FHTA 1XP8A 2PH1A 3I8SA 2KI5A 1YRBA 1EFTA 2X2FA 1VG0B 3K0CC 3IILA 4B35A 1G8GA 1XRJA 5FBVB 1JPNA 5GJWC 3LXXA 4IEEA 1FX0A 2EFCB 1HE1C 1U0HC 2O0KA 4G3XA 1T8UA 1WA5A 3UANA 3AF0A 4BPBA 2REXB 4C0JA 1HE8B 4YMSA 5CJ2A 3LD9A 5SZHB 4N0DA 1YZGA 3BWDD 3IIKA 5BWMA 4AKIA 1XB2A 3BFKA 2RGXA 4G5OA 1JECA 1HURA 4Q4HA 4ZIRB 4ASUA 4Q7MB 1BKDR 1NJGA 2GJKA 1UEJA 2OAQ1 4TSFD 2QZ4A 4MGKR 5C2JB 4HDOB 4JL6A 4HAZA 4MYCA 3IO3A 4DSOA 4IDPA 4X8OA 2EFDB 2WZQA 3ZVNA 2FU5C 1NLFA 2V3CC 4FMDB 1OXSC 2IK8A 2GXSA 3MAAC 3A4LA 3RNLA 3VX4A 2ZI5A 1CKEA 4RZUA 2D2EA 4FWTA 2NMVA 4TL6A 2B92A 3QJYA 4HZUA 3W6NA 1AZTA 2R9VA 2GCOA 2QPTA 2W2XA 5JHHB 5DYGA 2OE2A 2UZ3A 4IOLA 4KFUA 1Z5ZA 2ECKA 3PENA 4EJSC 3MFYA 1Z8FA 4WVFA 4NMMA 5HZHA 5KPJA 2HYIC 5HKKD 4NBSA 3W5JA 3X1WA 1KK3A
chains in the Genus database with same CATH superfamily
5KYXB 3HGMA 4FSDA 1JLHA 2C3YA 13PKA 4F38A 3GD5A 1ITZA 4W9RA 4CN8A 3PS9A 5ALIA 4JASB 2Z6UA 5AKHA 2IOYA 3EGWA 2OM2A 2X2OA 1BJKA 3BCUA 3QVOA 4NI5A 2YOHA 3KBOA 3OY2A 1EDEA 3P9RA 1N78A 1U2DA 3B6EA 1SQ0A 3CH6A 4FX2A 2YJ4A 5IFKA 2RHOA 3L8DA 2AEFA 3NRJA 4KE6A 3F5FA 1FLAA 1Y34E 2AC7A 2YCLA 5ALYA 3NC4A 3R7WB 1GSHA 3D7NA 1UPTA 3IAXA 1L7EA 5HGJA 2NYAA 4JA0A 1YB5A 1OZHA 3WRXA 5DASA 4EUKA 1SQSA 1UIMA 5CVTA 2C5LA 5AI5A 4H15A 2CEKA 4PINA 1G6Q1 1KZ1A 4KRXA 4NYIQ 5JSKA 1MIHA 3SSMA 3PHHA 1XZJA 5K3BA 4J4BA 1O7JA 3DBLA 3Q7QA 5DGDA 1XMOB 2LD4A 2R8YA 3BIWA 4YY3B 3BJMA 1YVRA 2A88A 2I4NA 4ESHA 1PT6A 2RBKA 4U4AA 2RGCA 3NAMA 2V9PA 4BS9A 2DVMA 1P3Y1 2V9ZA 2ID8A 3FSEA 2JLUA 2HI0A 1Z83A 4OAQA 4ND4A 2PTHA 4KFSA 2P27A 3C0KA 1QK3A 2GUWA 4B76A 1GARA 3PYXA 5I6DA 1OH5A 1VA5A 2BZ0A 1Q57A 1MG0A 4HS4A 3BDIA 2GPTA 1VGQA 3DMTC 3I04M 3L7KA 1IDOA 3AINA 4GI5A 2C57A 3Q1KA 4YUVA 1KMHB 3BF7A 1LPAB 5FO1A 1K86A 2GN4A 2ZYHA 1G2QA 3RRYA 5K6AA 4AJHA 3L6EA 4OQ4A 2X9VA 2QENA 3HZHA 4LPKA 1E0KA 2ZB4A 5E6UB 4Y2JA 1Q95A 5LDDC 1QQ5A 5HJEA 1Q16A 4JOCA 1PTJC 1XQ1A 2FAXA 3P27A 1GN9A 1OAOC 1PP4A 3WGZA 3N5CA 4BKMA 5CXSA 1D6MA 3BMCB 4EUEA 3ORHA 4PYRA 1R6TA 2HADA 4NL4H 1DCTA 4AVYA 2AR9A 1UBGA 1WP4A 1U0LA 1Y8RA 2C5BA 2WSIA 3L0DA 4O1HA 4X00A 2L18A 2LV8A 1ADCA 1RQRA 3ENQA 5AJUA 1UDXA 3MMPA 3HBAA 1F6WA 4AYTA 4DWWA 1OFGA 1Y4UA 3GCZA 1C3EA 2ZKIA 4AL4A 2GK4A 3JQ8B 1HH4A 2BFOA 1JHZA 2W6JA 4Y1RA 2FN8A 3JZMA 3LX8A 3WB0A 4GFDA 1P9LA 4P4SB 4CIDA 1C9DB 1VA4A 3PX2A 1AKUA 4DY6A 3IO5A 3MLAA 4M1YA 4JYPA 5EXTA 4RXUA 1V47A 3WQBA 3Q41A 3WRVA 3M83A 1RZVA 2PH3A 5IEBA 4EHJA 2H07A 1JU4A 1M2WA 1CVRA 4EG8A 1FU7A 4K9OA 3HB9A 4M0LA 2PUDA 1YC2A 5D3MA 4TZTA 5C3UA 4D9KA 3EY9A 2H4XA 1L4FA 3ASVA 4M38A 1QTNA 4QU9A 4MK4A 3B9BA 3ZKWA 1Y7LA 3Q3JB 4Q9KA 2C0PA 3V33A 4YWHA 4K87A 4JB0A 5JSYA 2PYIA 1QH9A 2I87A 3GRPA 1G7TA 3L46A 3PWTA 2Z83A 3KX2A 4WW0A 5DP2A 3RUIA 5JAUA 1VP3A 1FP6A 1QIIA 5KB3A 1JIKA 5TSDA 4JLUA 1Y9EA 2IOFA 3HVIA 3F8TA 4DDKA 4DMKA 3IUJA 5JCXA 4MS1A 1AX9A 3TQOA 1QG2A 1A9XA 3ITDA 4TT3A 2G06A 5DU2A 2SNIE 2ETVA 3T7KA 3OIDA 4QFDA 5AJTA 4F3RA 3ZH9B 9LDTA 4IIJB 3MHPA 3ZH2A 4E4YA 3UBMA 3OTGA 4MR7B 4EELA 4C4YA 2EV9A 4YCNA 2B0JA 4GLFA 1RFLA 2SCUA 3EISA 1HNXB 4PSVA 1ZNQO 4JYZA 5JD4A 3PQFA 3V3TA 2FSVC 3B38A 4G9GA 3S4YA 1I4LD 4B34A 1PUJA 2XZPA 1JIUA 2FMXA 4H4DA 3AJ9A 5F1KA 4JJZA 3QM1A 2FY8A 4B47A 4IKEA 1ZN8A 3BHMA 2AZTA 3IYLW 4MRMB 1PX0A 3WYGA 1SQGA 4LOLA 3CLUC 1QX3A 4DNQA 2KHZA 4R2JA 3KWFA 3EUWA 4HN9A 1WCXA 4Z9YA 1EWTA 2I5PO 1QTRA 5JYEA 1LC3A 1T4MA 2Q0XA 1AA6A 4B4WA 2CV0A 1S2IA 1FFWA 2BC9A 2ERCA 4MKHA 3VKWA 3JSAA 4LG1A 1NR1A 3WJ1A 2D0DA 3FF1A 4MWOA 4A16A 5HJ5A 4UBMA 1USKA 5CVCA 3UOAB 3ZTWA 1I1QB 5C7LO 2J48A 5HXAA 1ZC3A 1HBJA 2DGDA 1DINA 2VXCA 1UJCA 4C21A 3T8YA 4Q24A 2KW5A 2ZIFA 2Y9PB 3FNHA 3ICPA 3ITEA 3OE7D 3QFHA 1M2OA 2O1EA 2H2WA 5I7OA 3VZSA 3VX3A 3N2YA 1VG9B 2YYZA 3C5EA 3X1XA 5DW0A 4ARAA 4D79A 4A5OA 1AQ6A 3SPXA 3COJA 2ZR0A 4KVGA 4OSEA 3BF8A 1AKMA 4EX6A 5FLYA 1PK7A 3VISA 2R4UA 1JA1A 4KBYA 4JD5A 4RHFA 1KI6B 1CQIA 5U4QA 4HDMB 1NBOA 4IGKA 4C0WA 3K6RA 3PFFA 1DAMA 5KMGA 2BEWB 3PC2A 3X2EA 4ZMBA 2J5BA 4V0ME 5HM6A 3AKDA 3PQ4A 2IZ1A 4W82A 1DDGA 3E2PA 2J59A 4UEJA 5IAGA 5FFFA 2BDEA 3DM9B 4JI2B 1M54A 5NULA 4PBRA 4MKRA 3VPDA 2ZR8A 4BBJA 2Z5LA 4B79A 3AYZB 3BWMA 4FLMA 4Q4AB 1GAQA 1UINA 3AEQB 1G7CA 1RYHA 4RNCA 3IBYA 5EMJA 4YAKA 1RYBA 1XYYA 1QHYA 4WXRA 1MLDA 1QOZA 3RKSA 4F5DA 3LA6A 2XPCA 2WYIA 3G0BA 4DIUA 1B76A 5JOQA 3OEWA 1OBCA 3TCKA 4NXMB 1E20A 3K6SB 1USIA 2ZYAA 2QGFA 3FNRA 1YR6A 4XJSA 1G2OA 2HK7A 4IF4A 5TGZA 1MHTA 1L4YA 3A7DA 2R5NA 1WUYA 4ZOCA 2P5SA 4NH0A 4CIBA 1H2FA 1NFFA 5CDFE 1U28C 3R20A 3HJFA 1P5JA 5IZCA 2HR1A 1DJLA 3AETA 2D6FA 1FFHA 2OZPA 2ZRNA 3PIDA 4NVRA 1GT91 3KUCA 1N77A 2PPLA 3JQ9A 1HEIA 4B43A 5GQSA 4GYYA 1D04A 2WJZB 4E21A 5EP4A 4RQUA 1COWD 2Q29A 3GT0A 3I05A 4PZUA 1UC5B 3I6IA 1DCKA 2YWDA 1WXFA 4I4IA 5A4FS 4DHEA 5B4TA 2PXXA 3GG2A 1NBHA 3AJ8A 2QT9A 1W85A 1K8ZB 1FNDA 1MEOA 2L2QA 3GGDA 4OHCA 1A71A 3KV1A 4QTTB 5CYFA 5DX1A 4EAAA 2RHHA 4G84A 4R40A 4U9HS 4DDTA 4NHOA 1LI5A 4TUYF 3WGVA 1K2WA 2J0SA 3IV6A 3G2JA 4OLHA 5D86A 5BYJA 4OTZA 3INRA 4TQ9A 3SZGA 3MBOA 4YMLA 4GU5A 4PAGA 1Q6ZA 1S4QA 2R4TA 3DHNA 1Z5NA 1AH2A 3ASUA 1AURA 4MV3A 4EB6B 2XW6A 5EP1A 1YIOA 5JH7A 2A0FA 5EC8A 2I80A 4C7BA 4LA4A 5B1EA 4BC0A 1M7HA 1MU0A 4UAUA 5JXGA 4C2UA 2HA0A 3CE9A 3CMCO 3K8OE 1Y82A 1P75A 4QGBA 1RU3A 3D8SA 3KE8A 5EJGA 3ZLTA 4YQFA 3EMDA 3HUFA 3VDNB 4IM7A 1J22A 4PPQA 4XEHA 4G0OA 3NIBA 4EKIA 2JLYA 1E96A 1E7QA 4Y2GA 3WL5A 4FS8A 4I99A 3NHKA 1ILEA 1RQLA 1TDJA 1Z28A 2PT6A 1TU4A 1UOEA 2C5SA 2CJXA 2XX3A 2PAAA 1QAMA 3H4IA 3WMEA 2ZI6A 1GRNA 3DBLB 1NBIA 5HRCA 3R3UA 2WD7B 2ZOSA 1NQXA 1U5CA 2FWBA 2OHVA 1MO2A 3JRXA 3KLPX 3KQQA 4IDGA 4RGQA 2FLKA 2O8BB 1TMOA 4GPIB 5DGIA 2ZPUA 1XZLA 5DDIP 2PMKA 1RWPA 1V41E 5JDCA 2XUDA 5EQDA 2O20A 3H2IA 1I5OA 3ADBA 2HPZA 4RPLA 1PK9A 2O4UX 1JT2A 3NM5A 2VPWA 4ITRC 2BISA 4GRAA 1NYQA 1UJ2A 2A5JA 2BN4A 1TA9A 2G9ZA 2F1RA 2P2GA 3NBZC 2WPNA 4PNPA 1YR9A 4F2WA 2D4AA 3S0JA 1JSCA 4P35A 1N25A 5LZ9A 1V1MA 3IPCA 1AM4D 3NG1A 5DVZA 4CCYB 1SVOA 1VGRA 4B3GA 2A78A 5KX5B 1NXSA 2FHPA 1IONA 3KJFA 4KSBA 2IHVA 3WLIA 4BYGA 1QP0A 2DBQA 3AF5A 3K5IA 2XBUA 2PSEA 5CNIA 1DO0A 4R2KA 3R41A 1VMAA 2IYSA 1PR0A 3AONB 3LX5A 4U02A 3VR5A 5CDGA 1Z17A 1KSJA 2WIKA 3D6TB 3UJAA 4ZI2A 3QE9Y 4QUBA 2XYGA 1SXJA 4WY2A 1ZA1A 2AVDA 4MRPA 5KYXA 4I1RA 3P19A 3GZTB 2JGNA 1PAUA 2P9QA 4KHZA 1ISHA 3DQQA 2ZRCA 3HO1A 1TGVA 2PQMA 2C8KA 2G5TA 3OEYA 4KL8S 2GNPA 4DLPA 4INZA 2JJMA 3AG6A 4M89A 3OVMA 2V58A 3ZWBA 5CBPB 2DY1A 1DBRA 1RMTA 2C1ZA 2Q9AA 2YZNA 3GJQA 2WMNB 3C4JA 3MJSA 3MWFA 5CPBA 4AJIA 4JI6B 3EXHC 1PGPA 2B8JA 4OYLA 3ECCA 3WYNA 4E0BA 5BQFA 2PSHA 4MUHA 4LS3A 4F8EA 1QRDA 1SRQA 3NGMA 3BJIC 1VPWA 1PTKA 2PU7A 2WC1A 4LXUA 3DTNA 1SG0A 3TX6A 2VJPA 3UJ9A 2C04A 3T9EA 5BSWA 5JQWA 1WE2A 3UHJA 5B3AA 1A5TA 1QDLB 4CKZA 3EF0A 1I2CA 3DC2A 1DKLA 2QRLA 2X1HA 1L7MA 5KKCA 5FA5A 4B6SA 2AZ4A 2DB3A 3PC6A 1KSHA 1ZGHA 1W1UA 3T4XA 5CM2Z 4EPRA 3NHBA 4RE6A 1J56A 4S04A 1Z7EA 3HWSA 3MWJA 4AI6A 1GA6A 1UBRS 2AYZA 2WFMA 4CI0B 4RIHA 3SQLA 4BN5A 3VC7A 3LUDA 3NYQA 1TF5A 1VRVA 2R25B 1GDTA 3A9VA 3KSDO 2ZS8A 4YRMA 2WM8A 5AJWA 2P30A 4PGFA 1ZL0A 4ZAYA 2CFOA 5EIWA 5TX7A 5EKTA 3UXEA 3OWOA 1JDBB 1OBHA 2XA9A 4MA5A 4BWFB 4C3ZA 4LF9B 4P0QB 4KQFA 1CSEE 1DGQA 3VSBA 4BATA 3DSRA 3E7XA 3HV2A 4Z4HA 3N9IA 2EEPA 3SE7A 1KYZA 1V43A 1XT6A 3R76A 1OAOA 2XAAA 3P26A 4NKRA 4HAOA 5FOVA 2ZWPA 3SIRA 3DF9A 3G6KA 1RHUA 4C04A 1OBFO 1XZPA 1UZUA 2E9SA 4LYAA 4S1OA 5DCYA 4YPFA 2JDIA 2P4HX 2W2TA 4P53A 1C4WA 2EKBA 4RVHA 4Q9HA 4DAEA 3SXUA 3PVCA 3VPSA 4ENPA 3OJ0A 1HOXA 1K88A 3FLAA 5DNWA 3TN7A 3KB2A 2VF8A 2OCBA 1VZ3A 1UDRA 1M2FA 2X5JO 3IDOA 3ME5A 5C1PA 1B15A 3WYDA 4S1WA 5TJ9A 1L5WA 5L7YA 1Q1BA 4MITA 2B3DA 3RG2A 1MPXA 1NQVA 1WSWA 3Q4GA 3T3MB 4DRXB 1EAYA 1QGYA 1VLVA 3L0PA 1DKQA 2BW0A 2GM5A 4D9FA 1RPZA 2CLKB 2ZXUA 3EGDA 1ZCBA 3S2YA 1EXMA 2WEKA 4J4HA 4Y6OA 3KLOA 4M0CA 3D8NA 3U44B 1J2EA 1XRMA 3E4DA 4RMHA 3ZX5A 1VMIA 1FTSA 2BFFB 3LLCA 3L92A 4CEJB 2PRKA 2Q41A 2QUAA 1R9NA 3IDAA 4R8RA 4GI2A 2P41A 4ZAFA 2XZLA 2JGKA 3LVBA 5KTMA 1DP4A 1NVGA 2FQ1A 2UU9B 4A15A 1MO4A 4H4CA 1FDIA 2PO7A 4L27A 2WUGA 3ODPA 5E4YA 2WU4A 5CW2A 4KRFA 4XD7D 1YS6A 4E7OA 2X4LA 4DUGD 1RCTE 2HQ1A 2LZ0A 1S6YA 4BVFA 5DN9A 3LHIA 4C08A 1VSTA 1XUOA 3O3OB 1I4DD 4GSYA 1WQ1R 2ZI7A 3LY5A 4OP3A 2IFTA 3A1NA 3OQHA 4XVHA 1LBIA 1NAHA 2BGJA 3QXGA 1S2MA 4H1TA 4R51A 1WU7A 2R8EA 5IF9A 3E7WA 4KWCA 2NZ8A 4MVJA 1JSZA 2IP1A 2XUAA 4JP1A 3WLHA 4DIMA 1X1CA 3C6KA 1N6PA 3GJ4A 1D6NA 1VJCA 2XZDA 3AG5A 4O5OA 4BQPA 3FSGD 5BP7A 4A36A 3L7NA 1C9MA 1ZGGA 1UFKA 2CMHA 4NMHA 4CT0A 4QT4A 1DWOA 3GPLA 2UYYA 1E1LA 1KEPA 2OO3A 1C1YA 5AYVA 3QW4B 3IPYA 3TTVA 5HDQA 4RF5A 1M2HA 1I0IA 2PBZA 1QFJA 1ISGA 2A9OA 2MIIA 2VK8A 3JPWA 3MEQA 5ALZA 5DRYA 1POWA 1P4JA 1JMYA 1RI4A 1T3HA 2MSEB 5FX2A 2YW9A 1TUIA 2C42A 4TWBA 2PMBA 3UFXA 5TE9A 3AR2A 1JV2B 3DXZA 3EXAA 5HOQA 3HYRA 1OU0A 2A0YA 3NFYA 4KODA 4DS3A 3IUEA 3WA7A 3GJ0A 4I5IA 2O52A 3EUEA 1U3TA 3NUZA 4G0ZA 4FC7A 2RBGA 3PPYA 5H0IA 3JVEA 3LUPA 4CMIB 4CV2A 3IQGX 1S7GA 1W2HA 3MT9A 2XECA 3QUBA 3EDMA 3OURA 4HVCA 1IVYA 1XCGB 4E2FA 1ZK0A 1T5SA 4MVWA 1QU2A 3EQ6A 2XVXA 4L8WB 1U8CB 4ZVRA 4EMBA 7AT1A 2R65A 3UHFA 2EKLA 3VSAA 1YNOA 5IMBA 2P9CA 4UMVA 5ECDA 4XIJA 3T3EA 3MINB 1JT9A 4DIOA 1YT5A 2FP4A 1C9JA 2LDBA 2NVOA 2VUHB 4FYXA 4MSUA 1DKRA 1CQPA 1GUDA 3P2JA 4P3PA 4Y30A 4ZJPA 3TI7A 4NZPA 2ISSD 3BE4A 2GPYA 1QUEA 2NX2A 3K9LA 4BY9E 3WGHA 5I47A 3AY6A 1Q7GA 4O33A 1PVVA 3T5TA 5M04A 1QKIA 1IPHA 2IHTA 2WJGA 1RWMA 2PYDA 2XMQA 4YO8A 5JTUA 4OLAA 1VIYA 2ZAOA 1SCBA 3L0ZA 4JVSB 5CVJA 1HF3A 2W6IA 3V2GA 4FI3C 3R7AA 1W93A 3P96A 3DLIA 4K3VA 1WX1A 5C81A 4PNZA 2JBAA 5ERXA 2Z04A 3H65A 1W5TA 2BOVA 3KLBA 1XJWA 3NM4A 5MHTA 3I32A 2AH5A 4WGFA 4Q00A 3LUKA 3AKCA 4LGMA 1YZHA 3CRVA 1YS1X 1DBVO 1RBQA 5GGYA 3KQHA 2CJPA 4I66A 3VHXA 3ZJTA 1F60A 2FX5A 4A73A 1G6OA 4K6OA 4W5OA 3KJEA 3IV7A 4GP6A 4LF7B 1GG5A 2IYZA 3GUUA 3IODA 2I78A 4P93A 4DQLA 3K6KA 1X7HA 4NOJA 4NG5A 2Q5HA 3BMCA 3EBOA 1UP6A 4MB2A 3T5MA 5JO0A 2BJWA 3ZCSA 1SFRA 4GL4A 3SOZA 5K4HA 3MWKA 1REQA 2EGGA 3BH0A 3G8CA 2ZVJA 2OHFA 1R6BX 1EBUA 2H85A 3LIPA 3LZCA 1H9BA 3P4UA 1DFHA 4MRSA 4HTFB 4YCDA 5TQ2B 1HXHA 2YDXA 5TQVA 1CY2A 2WIBA 1UCFA 3LLVA 3R6TA 3M3PA 5AM0A 1QDUA 1MAAA 1WCV1 2H29A 3OC0A 2OLEA 2RHCA 2WU3A 1Z8DA 1VSVA 3MWEA 3OLZA 4HFMA 4O63O 4YAEA 4ZHSA 3DV0A 3QWBA 5JRZA 1WDMA 3KQLA 2GPBA 1CETA 1HEUA 4AXBA 3QVVA 3OCWA 4W63A 2DCMA 2OGUA 4JLOA 1M75A 2R66A 2X8WA 2P40A 3GRKA 2X19A 5BV0A 1CY6A 1HDYA 3N2EA 4R69A 4OK3A 2G0NA 2YVAA 3MVEA 5D8DA 5ARCA 3AOGA 2J3HA 2HUPA 3OJEA 4M1ZA 2WM9B 3ZDBA 4UOQA 5AHKA 4H6XA 4NTZA 2PT9A 1F2VA 2TMKA 2Y1XA 4EG0A 4QQRA 3OX1A 2HA6A 3SJBA 3ZUGA 4LXIA 2WG1A 2PKYX 2H1RA 3CVOA 5F2OA 4DR6B 2PX6A 3PDIA 3PTLA 4JCCA 1R4AA 5FWYB 4BP3A 2ZCUA 1CX9B 3OEHD 3VZDA 7ADHA 2WU0A 3KAKA 4B31A 4OFWA 3GOHA 4QPJC 4I9UA 1YQXA 4C5AA 4NE2A 2FGJA 4Z49A 1Q0RA 3VH4A 1U7UA 4X60A 1A9XB 4BO5A 1SHLA 1T6XA 3EODA 2E85A 1Z88A 5EVCA 3OJOA 1NXVA 2ZU0C 1JZTA 2B61A 1GTZA 2PBRA 1YQ9A 1IHYA 3H1PA 3OMLA 4J2OA 2H4ZA 3LUAA 4X6YA 1U5AA 3T0GA 1N9ZA 1E6WA 3OM8A 4H0CA 3IJ5A 1SUCA 2ZSIA 4CGYA 4HPXB 5FKJA 2PXCA 3H5LA 3HBJA 5BVHB 4JP8A 4ZOLA 4X64B 4YRPA 1ZVQA 3B70A 4CM4A 4D82A 3K7EA 4B7AA 1BD3A 4O4HF 1SHTX 1T2UA 3DMTA 2QN6A 2ILVA 4YLGA 5E7MA 3TIVA 3AW8A 5P8WA 2OAGA 4DR7B 2YC4C 2C2WA 2QS9A 3C48A 2ID9A 1VL0A 4G0QA 2HHHB 5CLGA 4NU6A 2ZK7A 3CIFA 3CCFA 1YQQA 3RS2A 4PC1A 4EHKA 3HCAA 4KJXA 2ORYA 4KLZA 5CLHA 2JFBA 2P9TA 1UDWA 4KUHA 3ZY5A 1OC2A 4CQMB 1PW7A 2AMJA 3FVTA 4RL4A 2J9YB 4A0HA 1HDRA 2AJCA 3QBDA 5KYUA 3TEJA 2MJLA 4D8XA 1JDVA 1G1AA 3NPAA 4QD3A 4TLCA 5I7VA 2R60A 4DJEC 3DGEC 1CRWG 4P9NA 2D1QA 3QVSA 1NOKA 2OWDA 4H1HA 4K26A 2WD7A 1PF7E 4KAAA 4I1SA 4CM1A 2E2WA 4ZJZA 3OZTA 3H9JA 5BURA 5KYWB 2ZSKA 1G59A 1T1EA 1R6DA 1SURA 1Z5UA 1ZGAA 2V55B 1OT5A 1VLZA 2PWZA 2BFDB 4RADA 1NXOA 4PX9A 3TUJC 5JLAA 4HEQA 2RMKA 3TRIA 1P9NA 4JJFA 1FFGA 1XVVA 1Q91A 4JGIA 1GGFA 3JARA 3ICQB 4G4GA 4OAPA 5KSYA 4KMMA 1F0PA 3GZJA 3U37A 1C2YA 3BBLA 5HK9A 1IQUA 3L6DA 1T0UA 4WY8A 2IYLD 3TTYA 2JAUA 5JYBA 1CERA 3RUEA 3MWEB 3NB0A 1J2TA 1LRKA 4D3YA 5BW5A 4KO3S 4E5UA 3W8DA 3BB4A 1V7PC 3I9JA 3D4IA 3S1AB 1EQ2A 1WKCA 3E7DA 1R0SA 1V35A 5TY0A 3HFGA 5HF6A 1NNUA 2C9YA 4D42A 3Q3CA 3SQWA 3DDNA 1DL5A 4Z0HO 4PLYA 2EBFX 3TAXA 4CMEA 5E2IA 3KOUA 3RTBA 1CK4A 2CNLA 2DT5A 3H9EO 3K2EA 4NYMQ 4C0HA 2VS1A 5JTTA 3S1SA 3KNZA 1MGPA 4MDHA 4MVJG 4YQEA 4RLHA 3U1TA 3HZOA 2HX1A 2NZJA 3OZDA 3W4IA 4C4PA 1RKQA 2D5AA 2IYYA 3FJYA 1KDOA 1P1IA 3I30X 4NICA 4HNHA 3PR2B 1Y42X 1QRTA 1MX3A 3TLCA 2NM0A 2AG0A 3FPHA 3IOYA 1HG0A 4HAVA 3ZD8A 1QVWA 3TMKA 3PXXA 1YVDA 1BU8A 2Q5JA 2X8LA 3UMRA 4R9VA 1RT9A 2QYTA 3Q11A 3TRFA 1FRQA 4HKTA 1IZYA 1YQUA 1GY8A 1NQ5A 4TS1A 2FMIA 2ZRKA 1Q7CA 1ZHOA 1N5MA 3KKKA 4M22A 2I6XA 3WSTA 2ATVA 2G1PA 3OE4A 2VK1A 3PF9A 3Q10A 4WFJA 3TBHA 1X74A 4AKSA 3ZHTA 4IL5A 3NBUA 4URWR 2I9KA 4E30A 1B16A 1DQYA 2HH9A 2FNAA 3L0OA 3OC6A 4HQ0A 4MQFB 4KFCA 2BMJA 3DV9A 1I6MA 3FB4A 2O14A 4JLPA 3K2QA 4FFBB 1G38A 3GP5A 4BMYA 1IPFA 4MWZA 5CVDA 2VPTA 2YC2C 4RTQA 1KOFA 3SX4A 3PJEA 4HDNA 2EJVA 2KM1A 4X95A 5LA6B 4BJ6A 2KPOA 3CPSA 4X93A 2BM0A 3O8RA 3E22A 2VP5A 3F9RA 4RZQA 4CM3A 5HS4A 5J4KA 4PSCA 4FZVA 3HB7A 1UBOS 1F6DA 1YUBA 5EXPA 5FORA 5HG0A 3ROQA 2FTKE 4F4DA 2GN8A 3DPUA 4LZLA 4W1SA 3SYTA 1BKSB 2X8BA 1WB5A 1F4VA 3ETDA 1M1NA 1D1TA 2G4LA 2X1MA 1UADA 4OJQA 4MDYA 3X44A 1JUDA 1P1FA 5FPSA 2OFOA 3EXG2 3EWAA 4FFOA 1KVSA 5EE1A 5KSZA 1KY3A 3PI7A 3H6GA 4GL2A 1O9HA 2PLFA 5D5QA 4RU1A 4BBPA 4WH0A 5DHPA 1N3BA 1T2EA 4ZOLF 1E5VA 3CLKA 3GH3A 1DIBA 3L1IA 2PUAA 4KCGA 7REQA 1KJQA 1EWKA 2GXAA 2NTYC 3LDFA 4PE5B 1W8DA 2PBLA 2WYUA 4MI1A 2ZVPX 1ACLA 4ZN6A 3LFUA 3BZWA 4V0MA 5KCMA 1RPJA 4GPD1 4BLQA 1HFJA 1JQ3A 2BMDA 1UKBA 2N42A 4QRHA 1O96B 2H4WA 4IDBA 1M9NA 3UB3A 1JPUA 3D4NA 2Y68A 4PBSA 3KPWA 3AI7A 3TB6A 3HBLA 1G98A 5LWHA 4IXMA 2Q7XA 4B3JA 4ZPJA 1XSEA 5HIIA 4XB6B 1E9CA 1ZVVA 2WG0A 3L02A 5IDWA 3KOOA 2Q2WA 1FRVA 1R18A 3U39A 1G0OA 1MNAA 2WUVA 3C2QA 3UV6A 5BV7A 2KBFA 1EK1A 3VKVA 1QFMA 2JFUA 1GU1A 4C1BA 5HW0A 1LW7A 5CTJA 1VIDA 2O57A 2SKCA 3GCDA 1IOWA 2JAXA 4L73A 3G49A 2OK7A 4GMKA 3CRMA 2VHUA 3M34A 3HN6A 3K1AA 2H5EA 2RHTA 3EDRA 1EI9A 3PVZA 3URKA 4E6PA 3L7IA 4EYSA 2JKZA 2R44A 1IEQA 4J49A 4GMHA 3PQEA 4YQZA 1ETHA 1M2JA 1VDZA 3QE4A 3UAVA 2VH2A 1N0WA 1WHSA 2WAAA 1NWCA 1GPLA 2YWFA 3AY0A 3NLLA 4FSHA 2ZRPA 4XPIA 3HY3A 3VYSB 4CHTA 1HMPA 3RVMA 1M6YA 2AF4C 5AT1A 2Q45A 2PWBA 2WT8A 5HJ7A 3SZMA 5DBOA 2P6RA 5FXMA 4CV0A 4PYOA 3LOUA 1CJTC 1RPAA 3A6DA 3FWKA 3HNOA 4IIHA 5DEIA 4BC1A 4RTOA 2P4EA 1P5HA 1Y6JA 1SUIA 4MRNA 1NPDA 2HL6A 4O2AF 2EW8A 3X2SA 2O2SA 2G1UA 1BA3A 1L5NA 1O95C 2FE4A 1TUEA 1DTEA 1PLJA 1W581 4YI3A 4YJ3A 2MWMA 2MMGA 1TIPA 1Q12A 3SHTA 2QMOA 1OLSA 1HLGA 4JJGA 4ENUA 3DDUA 2D8MA 1KDZA 1LPMA 2JJ1A 1JHYA 5FNVA 5LQDA 4PV7A 5SYAA 4X62B 4C4TA 2VSFA 3KTAB 1DQRA 1PJCA 1YQEA 2QJFA 3R7BA 1H1LB 5J9FA 3HNRA 3G82C 1M5UA 1UWCA 2YDYA 4BKOA 2CMDA 3BAZA 3N53A 3RVQA 3ZK9A 2Q3FA 1Y7HA 2D54A 3EG9B 1P2VA 3FZNA 1X8XA 4R9UC 4CLEA 1GPH1 2YNMA 4GXQA 5KZMB 5K0NA 4KIFA 1G5HA 3CY6A 3F67A 4B5LA 1JX6A 1VJ0A 3H8VA 1Y33E 2BM8A 3TTXA 2QGZA 3K09C 1J4AA 1D9ZA 3VO2A 4G0WA 5LU8A 2OAP1 3H8JA 3LT4A 1XNJA 1EFLA 2KS6A 4BEWA 1CUFA 1ZSNA 3G0OA 4A5SA 4HEJA 3W79A 3FHOA 5J2TB 4IY1A 4CMEC 2XXJA 1YXMA 2FP4B 5CAEB 4V39A 3USES 2N47A 5BW4A 1NXXA 3EGCA 3MA0A 4BFVA 4GP7A 3GLIE 3ESQA 3RC2A 4TV9A 4L4YA 5IUKC 4BZWA 4DM3A 3RQIA 4OMUA 3ZUPA 1EESA 5ALTA 1R6AA 1LDEA 3BWCA 3COYA 3IQEA 2VT2A 3HM2A 4U1RA 4ZT7A 4D9IA 3DG9A 4PRZA 3GL9A 4HQRA 5LKRA 4LJRA 1WV1A 1HNWB 3LA8A 1UM9A 4ZA2A 4ZT5A 3C8MA 3RTAA 5T4HA 4EYQA 4MQMA 4U3JA 4MWCA 3W2FA 4BRWA 1IXZA 2Z0MA 5JH7F 1L3BA 2BEVA 1MFPA 2G8NA 2GK3A 5K2OA 3VR5H 2ZZNA 4XWAA 3UFXB 1THMA 4J0JA 4QFCA 4RH0A 1NQWA 2C82A 3R0QA 2IKQA 4GPZA 4HAIA 1ZIYA 3ORYA 3M6WA 3ZE6A 1ECJA 5FBLB 1Y4AE 1ZM4A 3ETGA 1O87A 5JS1A 2QM8A 1BHJA 1ZQ1A 3QVWA 4MVJD 4GXNA 3T7IA 1YZVA 2ZROA 2VQFB 4MVCA 4U63A 1KDYA 1XA3A 4A82A 4QBKA 1IOVA 4I50A 4ILKA 4TWIA 3NHYA 3NW9A 2GM3A 2VDJA 1LF5A 4PIPA 4DT1A 1BE6A 4WASA 3U3XA 1M0EA 4O2BA 4EW6A 1TCCA 5JXWA 2ZZMA 4L08A 3ORFA 3RVSA 2ZUWA 3HR8A 3CX3A 2VR1A 4QDXA 1U7WA 1Z2PX 4PEVA 2RBEA 5LP6B 5DWVA 2IW3A 4BFSA 4UBJA 1EX9A 3PHLA 1I4EB 1DPFA 3OKPA 1QGOA 2JH9A 2PX5A 2AD5A 4R7GA 2WJHA 3A6GA 4BMVA 3TGWA 1S2OA 3DCJA 4ID9A 1JKFA 3FDZA 3PGA1 3LL7A 3EVDA 4RQBA 1LLDA 2C3MA 3U56A 5BN5B 3W7BA 1THTA 3B8HA 1EFRA 4PZDA 4V3CA 5BVHA 3H5AA 3GLFA 2VQDA 4K8OA 4D8TA 2WWHA 3AILA 3W8NA 3QU4A 3TNFA 4AWAA 1A4IA 1EEHA 3DWGA 1I8TA 3GNQA 4DVGA 3GLGE 3M4JA 2A0XA 5BPHA 1T5TA 3ISTA 4WSOA 4BWVA 2QQ0A 3LBNA 5BVGA 4OHKA 2EG5A 5LXTA 2HFJA 1MN6A 1GFWA 2O8NA 4KH0A 3RUFA 4MEAA 3EVEA 4HMQA 1LFDB 2FZ4A 1E2NA 5AKEA 5IJ9B 2VATA 4FEAA 4B3MB 3NV7A 2X0RA 3HHEA 2XNKA 4M55A 4M1TA 2VF2A 1KJJA 1EJ0A 1F3LA 4TL8A 3LPCA 4NV3A 1FW6A 3SZ3A 3AESB 1ZCFA 3GJ7A 4IS3A 1UBUS 3IP1A 3DWIA 3GG9A 3VVBA 3WIDA 3ZIAD 3IEMA 1T15A 4J3FA 1Z4QA 1QPBA 1XEXB 3F2VA 4UUNA 1R12A 1WDWB 1YCFA 1W75A 1O94C 2WOJA 3IAFA 3AUKA 3LF2A 4DMFA 4DMRA 5BT8A 1R00A 2BMWA 1Q6YA 2A33A 3CG4A 2BMEA 2HMYB 3FPLA 5EQJB 3WFIA 1YK0A 4HF7A 3K09A 2CL7X 2I3AA 2QMEA 5G0SA 2HRRA 4BQRA 4X3CA 1WPRA 2Z9BA 4D4MA 4I4LA 4AUKA 4WZAA 4JB3A 4KQKA 1BS1A 1ONBA 1WXQA 2NPFA 3GDGA 5IU6A 2XTAA 2P2NA 1SKAA 4ETWA 2CLMB 3WLPA 5A3RA 4FKMA 2QM0A 5E2BA 4PGHA 4EYGA 1F4PA 2HMTA 2G6BA 1X2EA 2PCJA 3AGPA 3B8EA 5EXXA 1O95A 2J4CA 3NBFA 4EF6A 3EXIA 3QEBZ 3BE6A 3CSSA 1U2TA 1H8ED 2GEVA 3B1YA 3T7DA 3TMYA 2OGTA 3ZW7A 4MVJF 5AUPB 1XQYA 1H4SA 1TMGE 3WFZA 1MH1A 1RIIA 3CLTD 3T15A 3X2FA 1GKIA 2XOEA 2G77B 3NJ4A 2OZLA 5D3QA 3AIKA 4ENQA 3OTIA 4PG4A 4Q6BA 1YAJA 2Q28A 3K9BA 2YXNA 4QVGA 4DA8A 4RENA 4KMRA 4RZHA 4P54A 3GEMA 2OR3A 3B3AA 1TZ2A 1K7FB 1IM2A 1Z73A 1ZYUA 2A5DA 5IP5A 3SHVA 5BUZA 1JG4A 1UBCA 3O2NA 1Z2CA 2YQZA 3HLYA 4Y2YA 4AS3A 3G9TA 1GPDG 2OCDA 4BV8A 2FG6C 2QMQA 2NOAA 3TWOA 1D9XA 3HDTA 1G5FA 1QVVA 4LSGA 1T5LA 1DHRA 3DE6X 5LC1A 5LIRA 3L0SA 2Q5FA 2AJLI 5BR7A 2OTCA 2AEMA 1KEVA 5UKDA 2C94A 3OPYI 1SJ9A 2GO1A 4P7GA 1HY3A 4NBUA 4MKIA 2ZSDA 4RORA 2G07A 3SXPA 3R6LA 5EHIA 4A26A 4B4VA 1TIBA 4C0LA 3C41J 2P5UA 2ZUEA 4IJMA 1XFAA 2VZ8A 2R79A 4KRYA 1I2DA 2F17A 2VK2A 5IDYA 4MAMA 4LRWA 4A1FA 4RSGA 2B1JA 1FNSA 2YMQA 3LK6A 4QYXA 5A3SA 4BVBA 3OZWA 1GNPA 3DKIA 4IWYA 2DTEA 3BKWA 4RDIA 4LQCA 4NU0A 1ICIA 3I2GA 2YMPA 1CTQA 4F9GA 4BNJA 4EY7A 2JZNA 1RRPA 2DKNA 1RWBA 2HF9A 2R00C 4KSCA 1XXHA 3AFMA 3LSYA 2F3RA 3AEUB 3CM0A 3DBHB 4XB1A 3UH1A 5A4KA 3RYFB 3BWXA 2H5IA 4OHWA 2O1XA 1RC8A 1XWWA 4RAQA 3D4PA 3UUGA 5HE9A 1ZEMA 4K9DA 4KW7A 1JW9B 2ZIXB 5SZIA 5HCIA 3AF4A 4QBTA 3I9MA 2HLHA 2ZSAA 4WLOA 2EW1A 2J8ZA 2R8RA 1OD6A 3C85A 3HJBA 3L6BA 3PFNA 3RO7A 3ZHYA 2QTWB 5U4XA 1GFZA 1B6RA 4PW0A 2HKIA 2FUNB 2FPIB 5HQJA 1DE0A 3VDQA 4D0RA 1M1XB 1VYTA 2IYPA 4ND6A 5TV2A 2CZCA 3BIFA 3PC8A 4CG3A 5IJ0B 4ZHQF 4KQJA 4LDJA 4XQ0A 1MO3A 5GJBA 4J07A 2P7HA 2CXTA 4RCVA 3LDGA 2GZ1A 4K9SA 3ZN2A 1ACMA 2VQ3A 4KGDA 4DDUA 3DMHA 3DJYA 1IQ0A 4D97A 1A8PA