4LUPA

Crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
91
structure length
91
Chain Sequence
LTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for -10 promoter element melting by environmentally induced sigma factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords RNA polymerase sigma factor
total genus 36
structure length 91
sequence length 91
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4lupA00
3CZGA 3AU8A 1MW1A 5JBIA 1RP3A 1OR7A 3A06A 3ZHZA 1JGIA 4Y6RA 3ANNA 4Y6SA 4FLOA 1SC5A 1R0KA 4OOEA 1MW0A 1S46A 1ZS2A 1Q0QA 3R0IA 2Y1CA 3ZHYA 2JCXA 1MVYA 1JG9A 2EGHA 3ANLA 3WQRA 2JD1A 1JVSA 3WQQA 2C82A 4OOFA 4KP7A 1Q0LA 2O7GA 4Y67A 4GAEA 5JAZA 1G5AA 3UERA 3UEQA 2JCVA 1Q0HA 2JD0A 4RCVA 1ONOA 3IIEA 3ZHXA 4FLRA 3ANMA 1R0LA 3A14A 4ZN6A 2Y1EA 1H3LA 4FLQA 4ZQEA 5JNLA 4CXFA 4LUPA 3WQSB 3UCQA 3CZKA 4Y6PA 4ZQFA 4AICA 1ONNA 2MAPA 1MW2A 4ZQHA 5JC1A 1MW3A 2JD2A 2JCYA 4AYSA 3RASA 1ONPA 3CZLA 5JMWA 5DULA 2WPGA 3CZEA 2Y1GA 4A03A 4FLSA 3AUAA 5JO0A 3T0YA 1T1SA 1K5HA 4NQWA 5JMPA 1T1RA 4ZQGA 2MAOA 2Y1FA 3ZI0A 2Y1DA 3AU9A
chains in the Genus database with same CATH superfamily
3CZGA 3AU8A 4QIRA 2WZGA 3B7TA 4GAAA 2DQ6A 1MW1A 4DPRA 3FH5A 1RP3A 3B7SA 4K5LA 4R5TA 5JBIA 3FTZA 3FTSA 3FH7A 4MKTA 2VLAA 3FTVA 3JSZA 1OR7A 2R72A 3B7RL 2XPYA 3A06A 4XMXA 4QMEA 3ZHZA 1JGIA 4Y6RA 2A7OA 3ANNA 4Y6SA 4FLOA 1SG7A 2ZXGA 1SC5A 2R70A 3FU3A 1R0KA 4OOEA 4ZX6A 1MW0A 3FUFA 4ZW7A 3B2XA 1S46A 1ZS2A 1Q0QA 3R0IA 2Y1CA 3FTWA 4XO5A 3ZHYA 2FFLA 4XMTA 2JCXA 2JV7A 4ZW6A 3EBGA 1HS6A 1MVYA 4XN4A 4XN2A 2XPZA 4ZX4A 4XNAA 4ZW8A 4ZX3A 1JG9A 2EGHA 3JT1A 3ANLA 5FWQA 3FTXA 3WQRA 4ZW5A 2JD1A 3FUDA 4RVBA 1JVSA 3WQQA 2C82A 3FU0A 4R5VA 3QJXA 4ZW3A 2PUSA 4XMUA 3FTUA 4K5NA 3EBIA 3B37A 2XQ0A 3FULA 3FU5A 4AR8A 4OOFA 3FUJA 2RJIA 2WZFA 4KP7A 1Q0LA 4XMVA 2VJ8A 2O7GA 4Y67A 3CHSA 4GAEA 5JAZA 4L2LA 3HW2A 3FH8A 3EBHA 3FTYA 3PUUA 4FCAA 2DQMA 1G5AA 4Q4IA 3UERA 3UEQA 2JCVA 1Q0HA 2JD0A 4XNDA 3B3BA 4RCVA 1ONOA 3IIEA 3ZHXA 2PL5A 4FLRA 3ANMA 1R0LA 3A14A 4ZN6A 3VVLA 2Y1EA 1H3LA 4XMWA 3B2PA 4FLQA 4XN1A 4ZQEA 5BPPA 2HPOA 4K5OA 4K5PA 3VVMA 4PVBA 5JNLA 4CXFA 4LUPA 3CHQA 4XN9A 3WQSB 3UCQA 5AENA 4RSYA 3CZKA 4Y6PA 5HNHA 4ZQFA 4XO3A 4AICA 1ONNA 2MAPA 3FUNA 4MS6A 1MW2A 4ZQHA 2B61A 5HLTA 3T8VA 5JC1A 1MW3A 1X3WA 2JD2A 2JCYA 4XNBA 3CXBA 5DLLA 3RASA 4AYSA 2C5ZA 1ONPA 3B34A 4J3BA 4R7LA 4ARFA 1X3ZA 1H19A 2PGGA 3CZLA 5JMWA 3Q44A 3FUKA 4K5MA 4QHPA 3FUHA 4XN7A 5DULA 3U9WA 2WPGA 4Q4EA 3CZEA 4PU2A 4AR1A 1SQMA 4X2UA 2Y1GA 4A03A 4FLSA 3CIAA 3AUAA 3FU6A 5DYFA 5JO0A 3RC8A 3T0YA 3B7UX 1T1SA 4ZQTA 4XMZA 4AR9A 1K5HA 3KEDA 4NQWA 4XO4A 3FUEA 3Q43A 5JMPA 1T1RA 4ZQGA 4QUOA 4ZX5A 1GW6A 3CHOA 4BKXA 4R5XA 3CHRA 4XN8A 2MAOA 2Y1FA 2GTQA 4PW4A 5EV7A 2HPTA 3FUIA 4JNDA 3FUMA 5HNFA 3CHPA 3ZI0A 2QJ1A 2Y1DA 4QPEA 3AU9A 2R59A 3FHEA 4XN5A 3RC3A 2QVWA
chains in the Genus database with same CATH topology
3CZGA 3AU8A 4QIRA 2WZGA 3B7TA 4GAAA 2DQ6A 1MW1A 4DPRA 3FH5A 1RP3A 3B7SA 4K5LA 4R5TA 5JBIA 3FTZA 3FTSA 3FH7A 4MKTA 2VLAA 3FTVA 3JSZA 1OR7A 2R72A 3B7RL 2XPYA 3A06A 4XMXA 4QMEA 3ZHZA 1JGIA 4Y6RA 2A7OA 3ANNA 4Y6SA 4FLOA 1SG7A 2ZXGA 1SC5A 2R70A 3FU3A 1R0KA 4OOEA 4ZX6A 1MW0A 3FUFA 4ZW7A 3B2XA 1S46A 1ZS2A 1Q0QA 3R0IA 2Y1CA 3FTWA 4XO5A 3ZHYA 2FFLA 4XMTA 2JCXA 2JV7A 4ZW6A 3EBGA 1HS6A 1MVYA 4XN4A 4XN2A 2XPZA 4ZX4A 4XNAA 4ZW8A 4ZX3A 1JG9A 2EGHA 3JT1A 3ANLA 5FWQA 3FTXA 3WQRA 4ZW5A 2JD1A 3FUDA 4RVBA 1JVSA 3WQQA 2C82A 3FU0A 4R5VA 3QJXA 4ZW3A 2PUSA 4XMUA 3FTUA 4K5NA 3EBIA 3B37A 2XQ0A 3FULA 3FU5A 4AR8A 4OOFA 3FUJA 2RJIA 2WZFA 4KP7A 1Q0LA 4XMVA 2VJ8A 2O7GA 4Y67A 3CHSA 4GAEA 5JAZA 4L2LA 3FH8A 3EBHA 3FTYA 3PUUA 4FCAA 2DQMA 1G5AA 4Q4IA 3UERA 3UEQA 2JCVA 1Q0HA 2JD0A 4XNDA 3B3BA 4RCVA 1ONOA 3IIEA 3ZHXA 2PL5A 4FLRA 3ANMA 1R0LA 3A14A 4ZN6A 3VVLA 2Y1EA 1H3LA 4XMWA 3B2PA 4FLQA 4XN1A 4ZQEA 5BPPA 2HPOA 4K5OA 4K5PA 3VVMA 4PVBA 5JNLA 4CXFA 4LUPA 3CHQA 4XN9A 3WQSB 3UCQA 5AENA 4RSYA 3CZKA 4Y6PA 5HNHA 4ZQFA 4XO3A 4AICA 1ONNA 2MAPA 3FUNA 4MS6A 1MW2A 4ZQHA 2B61A 5HLTA 3T8VA 5JC1A 1MW3A 1X3WA 2JD2A 2JCYA 4XNBA 4AYSA 5DLLA 3RASA 2C5ZA 1ONPA 3B34A 4J3BA 4R7LA 4ARFA 1X3ZA 1H19A 2PGGA 3CZLA 5JMWA 3Q44A 3FUKA 4K5MA 4QHPA 3FUHA 4XN7A 5DULA 3U9WA 2WPGA 4Q4EA 3CZEA 4PU2A 4AR1A 1SQMA 4X2UA 2Y1GA 4A03A 4FLSA 3CIAA 3AUAA 3FU6A 5DYFA 5JO0A 3RC8A 3T0YA 3B7UX 1T1SA 4ZQTA 4XMZA 4AR9A 1K5HA 3KEDA 4NQWA 4XO4A 3FUEA 3Q43A 5JMPA 1T1RA 4ZQGA 4QUOA 4ZX5A 1GW6A 3CHOA 4BKXA 4R5XA 3CHRA 4XN8A 2MAOA 2Y1FA 2GTQA 4PW4A 5EV7A 2HPTA 3FUIA 4JNDA 3FUMA 5HNFA 3CHPA 3ZI0A 2QJ1A 2Y1DA 4QPEA 3AU9A 2R59A 3FHEA 4XN5A 3RC3A 2QVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZG A;  3AU8 A;  1MW1 A;  5JBI A;  1RP3 A;  1OR7 A;  3A06 A;  3ZHZ A;  1JGI A;  4Y6R A;  3ANN A;  4Y6S A;  4FLO A;  1SC5 A;  1R0K A;  4OOE A;  1MW0 A;  1S46 A;  1ZS2 A;  1Q0Q A;  3R0I A;  2Y1C A;  3ZHY A;  2JCX A;  1MVY A;  1JG9 A;  2EGH A;  3ANL A;  3WQR A;  2JD1 A;  1JVS A;  3WQQ A;  2C82 A;  4OOF A;  4KP7 A;  1Q0L A;  2O7G A;  4Y67 A;  4GAE A;  5JAZ A;  1G5A A;  3UER A;  3UEQ A;  2JCV A;  1Q0H A;  2JD0 A;  4RCV A;  1ONO A;  3IIE A;  3ZHX A;  4FLR A;  3ANM A;  1R0L A;  3A14 A;  4ZN6 A;  2Y1E A;  1H3L A;  4FLQ A;  4ZQE A;  5JNL A;  4CXF A;  4LUP A;  3WQS B;  3UCQ A;  3CZK A;  4Y6P A;  4ZQF A;  4AIC A;  1ONN A;  2MAP A;  1MW2 A;  4ZQH A;  5JC1 A;  1MW3 A;  2JD2 A;  2JCY A;  4AYS A;  3RAS A;  1ONP A;  3CZL A;  5JMW A;  5DUL A;  2WPG A;  3CZE A;  2Y1G A;  4A03 A;  4FLS A;  3AUA A;  5JO0 A;  3T0Y A;  1T1S A;  1K5H A;  4NQW A;  5JMP A;  1T1R A;  4ZQG A;  2MAO A;  2Y1F A;  3ZI0 A;  2Y1D A;  3AU9 A; 
#chains in the Genus database with same CATH topology
 3CZG A;  3AU8 A;  4QIR A;  2WZG A;  3B7T A;  4GAA A;  2DQ6 A;  1MW1 A;  4DPR A;  3FH5 A;  1RP3 A;  3B7S A;  4K5L A;  4R5T A;  5JBI A;  3FTZ A;  3FTS A;  3FH7 A;  4MKT A;  2VLA A;  3FTV A;  3JSZ A;  1OR7 A;  2R72 A;  3B7R L;  2XPY A;  3A06 A;  4XMX A;  4QME A;  3ZHZ A;  1JGI A;  4Y6R A;  2A7O A;  3ANN A;  4Y6S A;  4FLO A;  1SG7 A;  2ZXG A;  1SC5 A;  2R70 A;  3FU3 A;  1R0K A;  4OOE A;  4ZX6 A;  1MW0 A;  3FUF A;  4ZW7 A;  3B2X A;  1S46 A;  1ZS2 A;  1Q0Q A;  3R0I A;  2Y1C A;  3FTW A;  4XO5 A;  3ZHY A;  2FFL A;  4XMT A;  2JCX A;  2JV7 A;  4ZW6 A;  3EBG A;  1HS6 A;  1MVY A;  4XN4 A;  4XN2 A;  2XPZ A;  4ZX4 A;  4XNA A;  4ZW8 A;  4ZX3 A;  1JG9 A;  2EGH A;  3JT1 A;  3ANL A;  5FWQ A;  3FTX A;  3WQR A;  4ZW5 A;  2JD1 A;  3FUD A;  4RVB A;  1JVS A;  3WQQ A;  2C82 A;  3FU0 A;  4R5V A;  3QJX A;  4ZW3 A;  2PUS A;  4XMU A;  3FTU A;  4K5N A;  3EBI A;  3B37 A;  2XQ0 A;  3FUL A;  3FU5 A;  4AR8 A;  4OOF A;  3FUJ A;  2RJI A;  2WZF A;  4KP7 A;  1Q0L A;  4XMV A;  2VJ8 A;  2O7G A;  4Y67 A;  3CHS A;  4GAE A;  5JAZ A;  4L2L A;  3HW2 A;  3FH8 A;  3EBH A;  3FTY A;  3PUU A;  4FCA A;  2DQM A;  1G5A A;  4Q4I A;  3UER A;  3UEQ A;  2JCV A;  1Q0H A;  2JD0 A;  4XND A;  3B3B A;  4RCV A;  1ONO A;  3IIE A;  3ZHX A;  2PL5 A;  4FLR A;  3ANM A;  1R0L A;  3A14 A;  4ZN6 A;  3VVL A;  2Y1E A;  1H3L A;  4XMW A;  3B2P A;  4FLQ A;  4XN1 A;  4ZQE A;  5BPP A;  2HPO A;  4K5O A;  4K5P A;  3VVM A;  4PVB A;  5JNL A;  4CXF A;  4LUP A;  3CHQ A;  4XN9 A;  3WQS B;  3UCQ A;  5AEN A;  4RSY A;  3CZK A;  4Y6P A;  5HNH A;  4ZQF A;  4XO3 A;  4AIC A;  1ONN A;  2MAP A;  3FUN A;  4MS6 A;  1MW2 A;  4ZQH A;  2B61 A;  5HLT A;  3T8V A;  5JC1 A;  1MW3 A;  1X3W A;  2JD2 A;  2JCY A;  4XNB A;  3CXB A;  5DLL A;  3RAS A;  4AYS A;  2C5Z A;  1ONP A;  3B34 A;  4J3B A;  4R7L A;  4ARF A;  1X3Z A;  1H19 A;  2PGG A;  3CZL A;  5JMW A;  3Q44 A;  3FUK A;  4K5M A;  4QHP A;  3FUH A;  4XN7 A;  5DUL A;  3U9W A;  2WPG A;  4Q4E A;  3CZE A;  4PU2 A;  4AR1 A;  1SQM A;  4X2U A;  2Y1G A;  4A03 A;  4FLS A;  3CIA A;  3AUA A;  3FU6 A;  5DYF A;  5JO0 A;  3RC8 A;  3T0Y A;  3B7U X;  1T1S A;  4ZQT A;  4XMZ A;  4AR9 A;  1K5H A;  3KED A;  4NQW A;  4XO4 A;  3FUE A;  3Q43 A;  5JMP A;  1T1R A;  4ZQG A;  4QUO A;  4ZX5 A;  1GW6 A;  3CHO A;  4BKX A;  4R5X A;  3CHR A;  4XN8 A;  2MAO A;  2Y1F A;  2GTQ A;  4PW4 A;  5EV7 A;  2HPT A;  3FUI A;  4JND A;  3FUM A;  5HNF A;  3CHP A;  3ZI0 A;  2QJ1 A;  2Y1D A;  4QPE A;  3AU9 A;  2R59 A;  3FHE A;  4XN5 A;  3RC3 A;  2QVW A; 
#chains in the Genus database with same CATH homology
 3CZG A;  3AU8 A;  4QIR A;  2WZG A;  3B7T A;  4GAA A;  2DQ6 A;  1MW1 A;  4DPR A;  3FH5 A;  1RP3 A;  3B7S A;  4K5L A;  4R5T A;  5JBI A;  3FTZ A;  3FTS A;  3FH7 A;  4MKT A;  2VLA A;  3FTV A;  3JSZ A;  1OR7 A;  2R72 A;  3B7R L;  2XPY A;  3A06 A;  4XMX A;  4QME A;  3ZHZ A;  1JGI A;  4Y6R A;  2A7O A;  3ANN A;  4Y6S A;  4FLO A;  1SG7 A;  2ZXG A;  1SC5 A;  2R70 A;  3FU3 A;  1R0K A;  4OOE A;  4ZX6 A;  1MW0 A;  3FUF A;  4ZW7 A;  3B2X A;  1S46 A;  1ZS2 A;  1Q0Q A;  3R0I A;  2Y1C A;  3FTW A;  4XO5 A;  3ZHY A;  2FFL A;  4XMT A;  2JCX A;  2JV7 A;  4ZW6 A;  3EBG A;  1HS6 A;  1MVY A;  4XN4 A;  4XN2 A;  2XPZ A;  4ZX4 A;  4XNA A;  4ZW8 A;  4ZX3 A;  1JG9 A;  2EGH A;  3JT1 A;  3ANL A;  5FWQ A;  3FTX A;  3WQR A;  4ZW5 A;  2JD1 A;  3FUD A;  4RVB A;  1JVS A;  3WQQ A;  2C82 A;  3FU0 A;  4R5V A;  3QJX A;  4ZW3 A;  2PUS A;  4XMU A;  3FTU A;  4K5N A;  3EBI A;  3B37 A;  2XQ0 A;  3FUL A;  3FU5 A;  4AR8 A;  4OOF A;  3FUJ A;  2RJI A;  2WZF A;  4KP7 A;  1Q0L A;  4XMV A;  2VJ8 A;  2O7G A;  4Y67 A;  3CHS A;  4GAE A;  5JAZ A;  4L2L A;  3FH8 A;  3EBH A;  3FTY A;  3PUU A;  4FCA A;  2DQM A;  1G5A A;  4Q4I A;  3UER A;  3UEQ A;  2JCV A;  1Q0H A;  2JD0 A;  4XND A;  3B3B A;  4RCV A;  1ONO A;  3IIE A;  3ZHX A;  2PL5 A;  4FLR A;  3ANM A;  1R0L A;  3A14 A;  4ZN6 A;  3VVL A;  2Y1E A;  1H3L A;  4XMW A;  3B2P A;  4FLQ A;  4XN1 A;  4ZQE A;  5BPP A;  2HPO A;  4K5O A;  4K5P A;  3VVM A;  4PVB A;  5JNL A;  4CXF A;  4LUP A;  3CHQ A;  4XN9 A;  3WQS B;  3UCQ A;  5AEN A;  4RSY A;  3CZK A;  4Y6P A;  5HNH A;  4ZQF A;  4XO3 A;  4AIC A;  1ONN A;  2MAP A;  3FUN A;  4MS6 A;  1MW2 A;  4ZQH A;  2B61 A;  5HLT A;  3T8V A;  5JC1 A;  1MW3 A;  1X3W A;  2JD2 A;  2JCY A;  4XNB A;  4AYS A;  5DLL A;  3RAS A;  2C5Z A;  1ONP A;  3B34 A;  4J3B A;  4R7L A;  4ARF A;  1X3Z A;  1H19 A;  2PGG A;  3CZL A;  5JMW A;  3Q44 A;  3FUK A;  4K5M A;  4QHP A;  3FUH A;  4XN7 A;  5DUL A;  3U9W A;  2WPG A;  4Q4E A;  3CZE A;  4PU2 A;  4AR1 A;  1SQM A;  4X2U A;  2Y1G A;  4A03 A;  4FLS A;  3CIA A;  3AUA A;  3FU6 A;  5DYF A;  5JO0 A;  3RC8 A;  3T0Y A;  3B7U X;  1T1S A;  4ZQT A;  4XMZ A;  4AR9 A;  1K5H A;  3KED A;  4NQW A;  4XO4 A;  3FUE A;  3Q43 A;  5JMP A;  1T1R A;  4ZQG A;  4QUO A;  4ZX5 A;  1GW6 A;  3CHO A;  4BKX A;  4R5X A;  3CHR A;  4XN8 A;  2MAO A;  2Y1F A;  2GTQ A;  4PW4 A;  5EV7 A;  2HPT A;  3FUI A;  4JND A;  3FUM A;  5HNF A;  3CHP A;  3ZI0 A;  2QJ1 A;  2Y1D A;  4QPE A;  3AU9 A;  2R59 A;  3FHE A;  4XN5 A;  3RC3 A;  2QVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...