4LUPA

Crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
91
structure length
91
Chain Sequence
b'LTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRLEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor
publication title Structural basis for -10 promoter element melting by environmentally induced sigma factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 36
structure length 91
sequence length 91
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4lupA00
1MW2A 2JCVA 1K5HA 3ANLA 4Y6SA 3CZKA 4Y67A 3AU8A 4Y6PA 1Q0HA 1MVYA 4OOFA 1H3LA 2WPGA 5JNLA 3AU9A 2JD2A 5JO0A 4ZQHA 3ZHXA 4FLSA 1R0LA 3WQQA 1Q0QA 3CZEA 1OR7A 1ZS2A 1ONOA 1G5AA 4AICA 1T1SA 1JGIA 3AUAA 3UEQA 3IIEA 3ZHYA 1R0KA 4OOEA 2MAOA 2JCYA 3T0YA 1JVSA 4NQWA 2JD1A 3UERA 1MW3A 4AYSA 1T1RA 3CZGA 3WQRA 3UCQA 4ZQFA 4RCVA 1ONNA 2Y1EA 4CXFA 4FLOA 3ANMA 2Y1CA 1MW0A 3ZHZA 5JAZA 1SC5A 2C82A 4GAEA 3ANNA 1JG9A 2Y1DA 3WQSB 2JD0A 4Y6RA 4FLQA 2EGHA 2Y1FA 3ZI0A 5DULA 1Q0LA 1MW1A 1RP3A 4ZN6A 5JMWA 1ONPA 5JMPA 5JC1A 4LUPA 4FLRA 4ZQGA 1S46A 3A14A 3A06A 3R0IA 2JCXA 4KP7A 3RASA 2Y1GA 2MAPA 2O7GA 3CZLA 5JBIA 4A03A 4ZQEA
chains in the Genus database with same CATH superfamily
1MW2A 2DQ6A 4XMTA 3B2PA 2JCVA 3FUHA 1K5HA 3B3BA 1H19A 1HS6A 3ANLA 2R70A 3CZKA 3CXBA 4Y6SA 4R7LA 4XN2A 3B7UX 3JSZA 4Y67A 3AU8A 4Y6PA 1Q0HA 3EBIA 1MVYA 4XNBA 4Q4IA 4XNDA 2R59A 3FH7A 4R5VA 4OOFA 1H3LA 2JV7A 2WPGA 4ZX6A 5JNLA 3AU9A 2JD2A 2XPZA 3CHSA 5JO0A 4ZQHA 3RC3A 1GW6A 3ZHXA 2B61A 4FLSA 5EV7A 4XO4A 2C5ZA 3RC8A 2HPOA 1R0LA 4XN9A 2ZXGA 4FCAA 3FH8A 2WZGA 1Q0QA 3FTVA 3WQQA 3CZEA 4K5NA 4K5PA 4AR8A 1OR7A 1ZS2A 3FU0A 4MS6A 4DPRA 4XMZA 1ONOA 3B7RL 1G5AA 4AICA 4ZW5A 3CHQA 3B37A 2XPYA 3FTSA 1T1SA 1JGIA 3AUAA 3FULA 3Q43A 4XMVA 3UEQA 3FUFA 3IIEA 3ZHYA 4ZX3A 4QIRA 1R0KA 4OOEA 4ZX4A 2MAOA 4QPEA 4XMXA 3B7SA 2JCYA 2HPTA 3FUEA 3CHOA 4QMEA 3T0YA 2PGGA 1JVSA 4K5LA 4NQWA 4XMUA 4K5MA 4XNAA 5HNFA 2JD1A 3UERA 4PW4A 1MW3A 4JNDA 4AYSA 1T1RA 3B34A 3CHPA 4R5XA 4BKXA 3FTZA 3FU3A 3CZGA 4XO5A 4ZW7A 3WQRA 3UCQA 3Q44A 3U9WA 3FTWA 4ZQFA 4RCVA 1ONNA 3FU5A 4ARFA 3JT1A 2QJ1A 2Y1EA 4L2LA 3QJXA 4AR9A 4CXFA 4FLOA 3ANMA 2Y1CA 4XN7A 3FUKA 1MW0A 3B2XA 4K5OA 2A7OA 3EBGA 3FTXA 4ZW6A 3CHRA 3ZHZA 5AENA 4XN4A 2GTQA 5HNHA 5JAZA 1SC5A 4PVBA 2C82A 4GAEA 5HLTA 1SQMA 3EBHA 3FTYA 4ZW3A 4ZW8A 3PUUA 2RJIA 3KEDA 3ANNA 1JG9A 2Y1DA 3FU6A 2QVWA 3WQSB 5BPPA 2JD0A 4Y6RA 3FUMA 2PUSA 2DQMA 3CIAA 4FLQA 3FUDA 4RVBA 5DLLA 2VJ8A 2EGHA 2Y1FA 4XO3A 4J3BA 3ZI0A 5DULA 1Q0LA 4R5TA 1MW1A 3B7TA 1X3WA 1RP3A 4ZN6A 4QUOA 4XN5A 4PU2A 5JMWA 3HW2A 4XMWA 4AR1A 1ONPA 5JMPA 1SG7A 5JC1A 3FHEA 3FTUA 4FLRA 2XQ0A 4ZX5A 4LUPA 4MKTA 4RSYA 3FUJA 4ZQGA 1S46A 3A14A 3FH5A 4XN8A 3VVLA 3A06A 3R0IA 2JCXA 4KP7A 2R72A 2PL5A 3FUNA 4ZQEA 4Q4EA 3RASA 2Y1GA 3VVMA 4X2UA 4ZQTA 2MAPA 2O7GA 5DYFA 1X3ZA 2VLAA 3CZLA 2FFLA 3T8VA 5JBIA 2WZFA 3FUIA 5FWQA 4GAAA 4A03A 4XN1A 4QHPA
chains in the Genus database with same CATH topology
1MW2A 2DQ6A 4XMTA 3B2PA 2JCVA 3FUHA 1K5HA 3B3BA 1H19A 1HS6A 3ANLA 2R70A 3CZKA 4Y6SA 4R7LA 4XN2A 3B7UX 3JSZA 4Y67A 3AU8A 4Y6PA 1Q0HA 3EBIA 1MVYA 4XNBA 4Q4IA 4XNDA 2R59A 3FH7A 4R5VA 4OOFA 1H3LA 2JV7A 2WPGA 4ZX6A 5JNLA 3AU9A 2JD2A 2XPZA 3CHSA 5JO0A 4ZQHA 3RC3A 1GW6A 3ZHXA 2B61A 4FLSA 5EV7A 4XO4A 2C5ZA 3RC8A 2HPOA 1R0LA 4XN9A 2ZXGA 4FCAA 3FH8A 2WZGA 1Q0QA 3FTVA 3WQQA 3CZEA 4K5NA 4K5PA 4AR8A 1OR7A 1ZS2A 3FU0A 4MS6A 4DPRA 4XMZA 1ONOA 3B7RL 1G5AA 4AICA 4ZW5A 3CHQA 3B37A 2XPYA 3FTSA 1T1SA 1JGIA 3AUAA 3FULA 3Q43A 4XMVA 3UEQA 3FUFA 3IIEA 3ZHYA 4ZX3A 4QIRA 1R0KA 4OOEA 4ZX4A 2MAOA 4QPEA 4XMXA 3B7SA 2JCYA 2HPTA 3FUEA 3CHOA 4QMEA 3T0YA 2PGGA 1JVSA 4K5LA 4NQWA 4XMUA 4K5MA 4XNAA 5HNFA 2JD1A 3UERA 4PW4A 1MW3A 4JNDA 4AYSA 1T1RA 3B34A 3CHPA 4R5XA 4BKXA 3FTZA 3FU3A 3CZGA 4XO5A 4ZW7A 3WQRA 3UCQA 3Q44A 3U9WA 3FTWA 4ZQFA 4RCVA 1ONNA 3FU5A 4ARFA 3JT1A 2QJ1A 2Y1EA 4L2LA 3QJXA 4AR9A 4CXFA 4FLOA 3ANMA 2Y1CA 4XN7A 3FUKA 1MW0A 3B2XA 4K5OA 2A7OA 3EBGA 3FTXA 4ZW6A 3CHRA 3ZHZA 5AENA 4XN4A 2GTQA 5HNHA 5JAZA 1SC5A 4PVBA 2C82A 4GAEA 5HLTA 1SQMA 3EBHA 3FTYA 4ZW3A 4ZW8A 3PUUA 2RJIA 3KEDA 3ANNA 1JG9A 2Y1DA 3FU6A 2QVWA 3WQSB 5BPPA 2JD0A 4Y6RA 3FUMA 2PUSA 2DQMA 3CIAA 4FLQA 3FUDA 4RVBA 5DLLA 2VJ8A 2EGHA 2Y1FA 4XO3A 4J3BA 3ZI0A 5DULA 1Q0LA 4R5TA 1MW1A 3B7TA 1X3WA 1RP3A 4ZN6A 4QUOA 4XN5A 4PU2A 5JMWA 4XMWA 4AR1A 1ONPA 5JMPA 1SG7A 5JC1A 3FHEA 3FTUA 4FLRA 2XQ0A 4ZX5A 4LUPA 4MKTA 4RSYA 3FUJA 4ZQGA 1S46A 3A14A 3FH5A 4XN8A 3VVLA 3A06A 3R0IA 2JCXA 4KP7A 2R72A 2PL5A 3FUNA 4ZQEA 4Q4EA 3RASA 2Y1GA 3VVMA 4X2UA 4ZQTA 2MAPA 2O7GA 5DYFA 1X3ZA 2VLAA 3CZLA 2FFLA 3T8VA 5JBIA 2WZFA 3FUIA 5FWQA 4GAAA 4A03A 4XN1A 4QHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MW2 A;  2JCV A;  1K5H A;  3ANL A;  4Y6S A;  3CZK A;  4Y67 A;  3AU8 A;  4Y6P A;  1Q0H A;  1MVY A;  4OOF A;  1H3L A;  2WPG A;  5JNL A;  3AU9 A;  2JD2 A;  5JO0 A;  4ZQH A;  3ZHX A;  4FLS A;  1R0L A;  3WQQ A;  1Q0Q A;  3CZE A;  1OR7 A;  1ZS2 A;  1ONO A;  1G5A A;  4AIC A;  1T1S A;  1JGI A;  3AUA A;  3UEQ A;  3IIE A;  3ZHY A;  1R0K A;  4OOE A;  2MAO A;  2JCY A;  3T0Y A;  1JVS A;  4NQW A;  2JD1 A;  3UER A;  1MW3 A;  4AYS A;  1T1R A;  3CZG A;  3WQR A;  3UCQ A;  4ZQF A;  4RCV A;  1ONN A;  2Y1E A;  4CXF A;  4FLO A;  3ANM A;  2Y1C A;  1MW0 A;  3ZHZ A;  5JAZ A;  1SC5 A;  2C82 A;  4GAE A;  3ANN A;  1JG9 A;  2Y1D A;  3WQS B;  2JD0 A;  4Y6R A;  4FLQ A;  2EGH A;  2Y1F A;  3ZI0 A;  5DUL A;  1Q0L A;  1MW1 A;  1RP3 A;  4ZN6 A;  5JMW A;  1ONP A;  5JMP A;  5JC1 A;  4LUP A;  4FLR A;  4ZQG A;  1S46 A;  3A14 A;  3A06 A;  3R0I A;  2JCX A;  4KP7 A;  3RAS A;  2Y1G A;  2MAP A;  2O7G A;  3CZL A;  5JBI A;  4A03 A;  4ZQE A; 
#chains in the Genus database with same CATH topology
 1MW2 A;  2DQ6 A;  4XMT A;  3B2P A;  2JCV A;  3FUH A;  1K5H A;  3B3B A;  1H19 A;  1HS6 A;  3ANL A;  2R70 A;  3CZK A;  3CXB A;  4Y6S A;  4R7L A;  4XN2 A;  3B7U X;  3JSZ A;  4Y67 A;  3AU8 A;  4Y6P A;  1Q0H A;  3EBI A;  1MVY A;  4XNB A;  4Q4I A;  4XND A;  2R59 A;  3FH7 A;  4R5V A;  4OOF A;  1H3L A;  2JV7 A;  2WPG A;  4ZX6 A;  5JNL A;  3AU9 A;  2JD2 A;  2XPZ A;  3CHS A;  5JO0 A;  4ZQH A;  3RC3 A;  1GW6 A;  3ZHX A;  2B61 A;  4FLS A;  5EV7 A;  4XO4 A;  2C5Z A;  3RC8 A;  2HPO A;  1R0L A;  4XN9 A;  2ZXG A;  4FCA A;  3FH8 A;  2WZG A;  1Q0Q A;  3FTV A;  3WQQ A;  3CZE A;  4K5N A;  4K5P A;  4AR8 A;  1OR7 A;  1ZS2 A;  3FU0 A;  4MS6 A;  4DPR A;  4XMZ A;  1ONO A;  3B7R L;  1G5A A;  4AIC A;  4ZW5 A;  3CHQ A;  3B37 A;  2XPY A;  3FTS A;  1T1S A;  1JGI A;  3AUA A;  3FUL A;  3Q43 A;  4XMV A;  3UEQ A;  3FUF A;  3IIE A;  3ZHY A;  4ZX3 A;  4QIR A;  1R0K A;  4OOE A;  4ZX4 A;  2MAO A;  4QPE A;  4XMX A;  3B7S A;  2JCY A;  2HPT A;  3FUE A;  3CHO A;  4QME A;  3T0Y A;  2PGG A;  1JVS A;  4K5L A;  4NQW A;  4XMU A;  4K5M A;  4XNA A;  5HNF A;  2JD1 A;  3UER A;  4PW4 A;  1MW3 A;  4JND A;  4AYS A;  1T1R A;  3B34 A;  3CHP A;  4R5X A;  4BKX A;  3FTZ A;  3FU3 A;  3CZG A;  4XO5 A;  4ZW7 A;  3WQR A;  3UCQ A;  3Q44 A;  3U9W A;  3FTW A;  4ZQF A;  4RCV A;  1ONN A;  3FU5 A;  4ARF A;  3JT1 A;  2QJ1 A;  2Y1E A;  4L2L A;  3QJX A;  4AR9 A;  4CXF A;  4FLO A;  3ANM A;  2Y1C A;  4XN7 A;  3FUK A;  1MW0 A;  3B2X A;  4K5O A;  2A7O A;  3EBG A;  3FTX A;  4ZW6 A;  3CHR A;  3ZHZ A;  5AEN A;  4XN4 A;  2GTQ A;  5HNH A;  5JAZ A;  1SC5 A;  4PVB A;  2C82 A;  4GAE A;  5HLT A;  1SQM A;  3EBH A;  3FTY A;  4ZW3 A;  4ZW8 A;  3PUU A;  2RJI A;  3KED A;  3ANN A;  1JG9 A;  2Y1D A;  3FU6 A;  2QVW A;  3WQS B;  5BPP A;  2JD0 A;  4Y6R A;  3FUM A;  2PUS A;  2DQM A;  3CIA A;  4FLQ A;  3FUD A;  4RVB A;  5DLL A;  2VJ8 A;  2EGH A;  2Y1F A;  4XO3 A;  4J3B A;  3ZI0 A;  5DUL A;  1Q0L A;  4R5T A;  1MW1 A;  3B7T A;  1X3W A;  1RP3 A;  4ZN6 A;  4QUO A;  4XN5 A;  4PU2 A;  5JMW A;  3HW2 A;  4XMW A;  4AR1 A;  1ONP A;  5JMP A;  1SG7 A;  5JC1 A;  3FHE A;  3FTU A;  4FLR A;  2XQ0 A;  4ZX5 A;  4LUP A;  4MKT A;  4RSY A;  3FUJ A;  4ZQG A;  1S46 A;  3A14 A;  3FH5 A;  4XN8 A;  3VVL A;  3A06 A;  3R0I A;  2JCX A;  4KP7 A;  2R72 A;  2PL5 A;  3FUN A;  4ZQE A;  4Q4E A;  3RAS A;  2Y1G A;  3VVM A;  4X2U A;  4ZQT A;  2MAP A;  2O7G A;  5DYF A;  1X3Z A;  2VLA A;  3CZL A;  2FFL A;  3T8V A;  5JBI A;  2WZF A;  3FUI A;  5FWQ A;  4GAA A;  4A03 A;  4XN1 A;  4QHP A; 
#chains in the Genus database with same CATH homology
 1MW2 A;  2DQ6 A;  4XMT A;  3B2P A;  2JCV A;  3FUH A;  1K5H A;  3B3B A;  1H19 A;  1HS6 A;  3ANL A;  2R70 A;  3CZK A;  4Y6S A;  4R7L A;  4XN2 A;  3B7U X;  3JSZ A;  4Y67 A;  3AU8 A;  4Y6P A;  1Q0H A;  3EBI A;  1MVY A;  4XNB A;  4Q4I A;  4XND A;  2R59 A;  3FH7 A;  4R5V A;  4OOF A;  1H3L A;  2JV7 A;  2WPG A;  4ZX6 A;  5JNL A;  3AU9 A;  2JD2 A;  2XPZ A;  3CHS A;  5JO0 A;  4ZQH A;  3RC3 A;  1GW6 A;  3ZHX A;  2B61 A;  4FLS A;  5EV7 A;  4XO4 A;  2C5Z A;  3RC8 A;  2HPO A;  1R0L A;  4XN9 A;  2ZXG A;  4FCA A;  3FH8 A;  2WZG A;  1Q0Q A;  3FTV A;  3WQQ A;  3CZE A;  4K5N A;  4K5P A;  4AR8 A;  1OR7 A;  1ZS2 A;  3FU0 A;  4MS6 A;  4DPR A;  4XMZ A;  1ONO A;  3B7R L;  1G5A A;  4AIC A;  4ZW5 A;  3CHQ A;  3B37 A;  2XPY A;  3FTS A;  1T1S A;  1JGI A;  3AUA A;  3FUL A;  3Q43 A;  4XMV A;  3UEQ A;  3FUF A;  3IIE A;  3ZHY A;  4ZX3 A;  4QIR A;  1R0K A;  4OOE A;  4ZX4 A;  2MAO A;  4QPE A;  4XMX A;  3B7S A;  2JCY A;  2HPT A;  3FUE A;  3CHO A;  4QME A;  3T0Y A;  2PGG A;  1JVS A;  4K5L A;  4NQW A;  4XMU A;  4K5M A;  4XNA A;  5HNF A;  2JD1 A;  3UER A;  4PW4 A;  1MW3 A;  4JND A;  4AYS A;  1T1R A;  3B34 A;  3CHP A;  4R5X A;  4BKX A;  3FTZ A;  3FU3 A;  3CZG A;  4XO5 A;  4ZW7 A;  3WQR A;  3UCQ A;  3Q44 A;  3U9W A;  3FTW A;  4ZQF A;  4RCV A;  1ONN A;  3FU5 A;  4ARF A;  3JT1 A;  2QJ1 A;  2Y1E A;  4L2L A;  3QJX A;  4AR9 A;  4CXF A;  4FLO A;  3ANM A;  2Y1C A;  4XN7 A;  3FUK A;  1MW0 A;  3B2X A;  4K5O A;  2A7O A;  3EBG A;  3FTX A;  4ZW6 A;  3CHR A;  3ZHZ A;  5AEN A;  4XN4 A;  2GTQ A;  5HNH A;  5JAZ A;  1SC5 A;  4PVB A;  2C82 A;  4GAE A;  5HLT A;  1SQM A;  3EBH A;  3FTY A;  4ZW3 A;  4ZW8 A;  3PUU A;  2RJI A;  3KED A;  3ANN A;  1JG9 A;  2Y1D A;  3FU6 A;  2QVW A;  3WQS B;  5BPP A;  2JD0 A;  4Y6R A;  3FUM A;  2PUS A;  2DQM A;  3CIA A;  4FLQ A;  3FUD A;  4RVB A;  5DLL A;  2VJ8 A;  2EGH A;  2Y1F A;  4XO3 A;  4J3B A;  3ZI0 A;  5DUL A;  1Q0L A;  4R5T A;  1MW1 A;  3B7T A;  1X3W A;  1RP3 A;  4ZN6 A;  4QUO A;  4XN5 A;  4PU2 A;  5JMW A;  4XMW A;  4AR1 A;  1ONP A;  5JMP A;  1SG7 A;  5JC1 A;  3FHE A;  3FTU A;  4FLR A;  2XQ0 A;  4ZX5 A;  4LUP A;  4MKT A;  4RSY A;  3FUJ A;  4ZQG A;  1S46 A;  3A14 A;  3FH5 A;  4XN8 A;  3VVL A;  3A06 A;  3R0I A;  2JCX A;  4KP7 A;  2R72 A;  2PL5 A;  3FUN A;  4ZQE A;  4Q4E A;  3RAS A;  2Y1G A;  3VVM A;  4X2U A;  4ZQT A;  2MAP A;  2O7G A;  5DYF A;  1X3Z A;  2VLA A;  3CZL A;  2FFL A;  3T8V A;  5JBI A;  2WZF A;  3FUI A;  5FWQ A;  4GAA A;  4A03 A;  4XN1 A;  4QHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...