4LUPA

Crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
91
structure length
91
Chain Sequence
LTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor
publication title Structural basis for -10 promoter element melting by environmentally induced sigma factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 36
structure length 91
sequence length 91
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4lupA00
5JC1A 3WQQA 4OOEA 2JD2A 3ANLA 4OOFA 4ZQHA 3AUAA 4A03A 4AYSA 5JMPA 1T1RA 1OR7A 1JVSA 2EGHA 2O7GA 1SC5A 4ZQGA 3ZHZA 3UEQA 1MW0A 1ONOA 4Y6RA 1RP3A 4Y6SA 2MAPA 1JGIA 3WQRA 4FLRA 2JCXA 4KP7A 1ONPA 1Q0HA 4CXFA 3CZEA 5JMWA 1Q0QA 3ZHXA 5JBIA 4AICA 2Y1EA 2Y1FA 4ZQEA 1G5AA 4GAEA 5JNLA 2WPGA 2Y1CA 3IIEA 4RCVA 4Y6PA 3UERA 1H3LA 5JO0A 3CZGA 3A06A 3T0YA 1MW2A 1MVYA 3A14A 1ZS2A 3R0IA 4FLQA 3WQSB 1ONNA 1JG9A 2JD1A 2JD0A 2Y1GA 2C82A 2JCYA 2JCVA 3ANMA 1R0LA 3CZKA 4ZN6A 2Y1DA 5JAZA 3AU8A 1T1SA 3UCQA 1K5HA 2MAOA 4Y67A 3CZLA 3ZHYA 3ZI0A 4ZQFA 4FLOA 1MW3A 5DULA 3AU9A 4NQWA 4LUPA 4FLSA 1R0KA 3ANNA 3RASA 1MW1A 1Q0LA 1S46A
chains in the Genus database with same CATH superfamily
4XMXA 4ZX4A 3FTVA 3EBHA 4QIRA 4PW4A 5JC1A 1X3ZA 4DPRA 3WQQA 4R7LA 4OOEA 2JD2A 3ANLA 4OOFA 3CIAA 3FTZA 4ZQHA 4ZW5A 3AUAA 4A03A 2JV7A 4AYSA 3FUNA 3B7TA 3FH8A 3FH7A 2PUSA 3FTWA 3RC8A 5JMPA 1T1RA 2GTQA 4XO3A 2FFLA 1OR7A 1JVSA 2EGHA 2O7GA 1SC5A 4ZQGA 5EV7A 3ZHZA 4MS6A 5HNFA 3UEQA 4XMZA 1MW0A 2R59A 3EBIA 3FUIA 1ONOA 2PL5A 4Y6RA 3FUJA 4BKXA 4XMUA 1RP3A 2DQMA 3FHEA 4Y6SA 4XO5A 2MAPA 4ZQTA 3CXBA 3U9WA 1JGIA 2XQ0A 3WQRA 3EBGA 2HPOA 4QUOA 5AENA 2A7OA 3CHPA 4QPEA 4JNDA 2WZGA 2JCXA 4FLRA 4KP7A 1ONPA 4XN9A 1Q0HA 4CXFA 3CZEA 5JMWA 1Q0QA 1SQMA 3FTXA 4ZX3A 4XNBA 2B61A 1GW6A 4XMTA 3CHOA 4K5LA 3FULA 3ZHXA 4GAAA 5JBIA 3VVMA 3B37A 4AICA 5FWQA 3FTSA 3Q44A 2Y1EA 3FU6A 3FTYA 2XPYA 2Y1FA 3CHRA 4ZQEA 4AR9A 4X2UA 2VJ8A 4XN1A 4AR1A 4ARFA 1HS6A 4PVBA 3RC3A 4AR8A 5HLTA 4ZW8A 1G5AA 4GAEA 4L2LA 5JNLA 2QVWA 2WPGA 2Y1CA 3FU3A 3FUFA 3IIEA 3HW2A 3B2PA 3KEDA 4XN7A 4RCVA 4Y6PA 3UERA 1H3LA 4K5PA 3B7UX 3FUDA 4XN5A 3T8VA 5JO0A 3CZGA 4Q4EA 3A06A 1H19A 3PUUA 3T0YA 4R5XA 4Q4IA 1MW2A 3B3BA 2C5ZA 3JT1A 4XO4A 4ZW7A 1MVYA 3A14A 3B7RL 1ZS2A 3R0IA 3Q43A 3CHSA 2QJ1A 1ONNA 4FLQA 3WQSB 4ZW3A 2PGGA 3FU0A 1SG7A 3FUKA 1JG9A 2JD1A 4K5OA 4QMEA 3FU5A 3CHQA 3FUEA 2JD0A 2Y1GA 2C82A 4FCAA 2ZXGA 2JCYA 2JCVA 1X3WA 3ANMA 4ZX5A 4MKTA 4XMVA 4QHPA 3QJXA 4RVBA 1R0LA 2XPZA 3FUHA 3CZKA 4ZN6A 4K5MA 4XN4A 2Y1DA 5JAZA 4R5TA 5BPPA 2WZFA 2VLAA 3AU8A 4XNDA 2R70A 3B2XA 4XNAA 4XMWA 1T1SA 3UCQA 3JSZA 4XN8A 5HNHA 1K5HA 2MAOA 4Y67A 3CZLA 3VVLA 3ZHYA 3FTUA 3ZI0A 3FH5A 4XN2A 4ZQFA 2HPTA 4ZX6A 4K5NA 4FLOA 4RSYA 2DQ6A 4J3BA 1MW3A 2R72A 2RJIA 3AU9A 5DULA 4NQWA 4LUPA 4R5VA 4ZW6A 4FLSA 4PU2A 1R0KA 5DYFA 3B7SA 5DLLA 3ANNA 3RASA 1MW1A 3FUMA 1Q0LA 3B34A 1S46A
chains in the Genus database with same CATH topology
4XMXA 4ZX4A 3FTVA 3EBHA 4QIRA 4PW4A 5JC1A 1X3ZA 4DPRA 3WQQA 4R7LA 4OOEA 2JD2A 3ANLA 4OOFA 3CIAA 3FTZA 4ZQHA 4ZW5A 3AUAA 4A03A 2JV7A 4AYSA 3FUNA 3B7TA 3FH8A 3FH7A 2PUSA 3FTWA 3RC8A 5JMPA 1T1RA 2GTQA 4XO3A 2FFLA 1OR7A 1JVSA 2EGHA 2O7GA 1SC5A 4ZQGA 5EV7A 3ZHZA 4MS6A 5HNFA 3UEQA 4XMZA 1MW0A 2R59A 3EBIA 3FUIA 1ONOA 2PL5A 4Y6RA 3FUJA 4BKXA 4XMUA 1RP3A 2DQMA 3FHEA 4Y6SA 4XO5A 2MAPA 4ZQTA 3U9WA 1JGIA 2XQ0A 3WQRA 3EBGA 2HPOA 4QUOA 5AENA 2A7OA 3CHPA 4QPEA 4JNDA 2WZGA 2JCXA 4FLRA 4KP7A 1ONPA 4XN9A 1Q0HA 4CXFA 3CZEA 5JMWA 1Q0QA 1SQMA 3FTXA 4ZX3A 4XNBA 2B61A 1GW6A 4XMTA 3CHOA 4K5LA 3FULA 3ZHXA 4GAAA 5JBIA 3VVMA 3B37A 4AICA 5FWQA 3FTSA 3Q44A 2Y1EA 3FU6A 3FTYA 2XPYA 2Y1FA 3CHRA 4ZQEA 4AR9A 4X2UA 2VJ8A 4XN1A 4AR1A 4ARFA 1HS6A 4PVBA 3RC3A 4AR8A 5HLTA 4ZW8A 1G5AA 4GAEA 4L2LA 5JNLA 2QVWA 2WPGA 2Y1CA 3FU3A 3FUFA 3IIEA 3B2PA 3KEDA 4XN7A 4RCVA 4Y6PA 3UERA 1H3LA 4K5PA 3B7UX 3FUDA 4XN5A 3T8VA 5JO0A 3CZGA 4Q4EA 3A06A 1H19A 3PUUA 3T0YA 4R5XA 4Q4IA 1MW2A 3B3BA 2C5ZA 3JT1A 4XO4A 4ZW7A 1MVYA 3A14A 3B7RL 1ZS2A 3R0IA 3Q43A 3CHSA 2QJ1A 1ONNA 4FLQA 3WQSB 4ZW3A 2PGGA 3FU0A 1SG7A 3FUKA 1JG9A 2JD1A 4K5OA 4QMEA 3FU5A 3CHQA 3FUEA 2JD0A 2Y1GA 2C82A 4FCAA 2ZXGA 2JCYA 2JCVA 1X3WA 3ANMA 4ZX5A 4MKTA 4XMVA 4QHPA 3QJXA 4RVBA 1R0LA 2XPZA 3FUHA 3CZKA 4ZN6A 4K5MA 4XN4A 2Y1DA 5JAZA 4R5TA 5BPPA 2WZFA 2VLAA 3AU8A 4XNDA 2R70A 3B2XA 4XNAA 4XMWA 1T1SA 3UCQA 3JSZA 4XN8A 5HNHA 1K5HA 2MAOA 4Y67A 3CZLA 3VVLA 3ZHYA 3FTUA 3ZI0A 3FH5A 4XN2A 4ZQFA 2HPTA 4ZX6A 4K5NA 4FLOA 4RSYA 2DQ6A 4J3BA 1MW3A 2R72A 2RJIA 3AU9A 5DULA 4NQWA 4LUPA 4R5VA 4ZW6A 4FLSA 4PU2A 1R0KA 5DYFA 3B7SA 5DLLA 3ANNA 3RASA 1MW1A 3FUMA 1Q0LA 3B34A 1S46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JC1 A;  3WQQ A;  4OOE A;  2JD2 A;  3ANL A;  4OOF A;  4ZQH A;  3AUA A;  4A03 A;  4AYS A;  5JMP A;  1T1R A;  1OR7 A;  1JVS A;  2EGH A;  2O7G A;  1SC5 A;  4ZQG A;  3ZHZ A;  3UEQ A;  1MW0 A;  1ONO A;  4Y6R A;  1RP3 A;  4Y6S A;  2MAP A;  1JGI A;  3WQR A;  4FLR A;  2JCX A;  4KP7 A;  1ONP A;  1Q0H A;  4CXF A;  3CZE A;  5JMW A;  1Q0Q A;  3ZHX A;  5JBI A;  4AIC A;  2Y1E A;  2Y1F A;  4ZQE A;  1G5A A;  4GAE A;  5JNL A;  2WPG A;  2Y1C A;  3IIE A;  4RCV A;  4Y6P A;  3UER A;  1H3L A;  5JO0 A;  3CZG A;  3A06 A;  3T0Y A;  1MW2 A;  1MVY A;  3A14 A;  1ZS2 A;  3R0I A;  4FLQ A;  3WQS B;  1ONN A;  1JG9 A;  2JD1 A;  2JD0 A;  2Y1G A;  2C82 A;  2JCY A;  2JCV A;  3ANM A;  1R0L A;  3CZK A;  4ZN6 A;  2Y1D A;  5JAZ A;  3AU8 A;  1T1S A;  3UCQ A;  1K5H A;  2MAO A;  4Y67 A;  3CZL A;  3ZHY A;  3ZI0 A;  4ZQF A;  4FLO A;  1MW3 A;  5DUL A;  3AU9 A;  4NQW A;  4LUP A;  4FLS A;  1R0K A;  3ANN A;  3RAS A;  1MW1 A;  1Q0L A;  1S46 A; 
#chains in the Genus database with same CATH topology
 4XMX A;  4ZX4 A;  3FTV A;  3EBH A;  4QIR A;  4PW4 A;  5JC1 A;  1X3Z A;  4DPR A;  3WQQ A;  4R7L A;  4OOE A;  2JD2 A;  3ANL A;  4OOF A;  3CIA A;  3FTZ A;  4ZQH A;  4ZW5 A;  3AUA A;  4A03 A;  2JV7 A;  4AYS A;  3FUN A;  3B7T A;  3FH8 A;  3FH7 A;  2PUS A;  3FTW A;  3RC8 A;  5JMP A;  1T1R A;  2GTQ A;  4XO3 A;  2FFL A;  1OR7 A;  1JVS A;  2EGH A;  2O7G A;  1SC5 A;  4ZQG A;  5EV7 A;  3ZHZ A;  4MS6 A;  5HNF A;  3UEQ A;  4XMZ A;  1MW0 A;  2R59 A;  3EBI A;  3FUI A;  1ONO A;  2PL5 A;  4Y6R A;  3FUJ A;  4BKX A;  4XMU A;  1RP3 A;  2DQM A;  3FHE A;  4Y6S A;  4XO5 A;  2MAP A;  4ZQT A;  3CXB A;  3U9W A;  1JGI A;  2XQ0 A;  3WQR A;  3EBG A;  2HPO A;  4QUO A;  5AEN A;  2A7O A;  3CHP A;  4QPE A;  4JND A;  2WZG A;  2JCX A;  4FLR A;  4KP7 A;  1ONP A;  4XN9 A;  1Q0H A;  4CXF A;  3CZE A;  5JMW A;  1Q0Q A;  1SQM A;  3FTX A;  4ZX3 A;  4XNB A;  2B61 A;  1GW6 A;  4XMT A;  3CHO A;  4K5L A;  3FUL A;  3ZHX A;  4GAA A;  5JBI A;  3VVM A;  3B37 A;  4AIC A;  5FWQ A;  3FTS A;  3Q44 A;  2Y1E A;  3FU6 A;  3FTY A;  2XPY A;  2Y1F A;  3CHR A;  4ZQE A;  4AR9 A;  4X2U A;  2VJ8 A;  4XN1 A;  4AR1 A;  4ARF A;  1HS6 A;  4PVB A;  3RC3 A;  4AR8 A;  5HLT A;  4ZW8 A;  1G5A A;  4GAE A;  4L2L A;  5JNL A;  2QVW A;  2WPG A;  2Y1C A;  3FU3 A;  3FUF A;  3IIE A;  3HW2 A;  3B2P A;  3KED A;  4XN7 A;  4RCV A;  4Y6P A;  3UER A;  1H3L A;  4K5P A;  3B7U X;  3FUD A;  4XN5 A;  3T8V A;  5JO0 A;  3CZG A;  4Q4E A;  3A06 A;  1H19 A;  3PUU A;  3T0Y A;  4R5X A;  4Q4I A;  1MW2 A;  3B3B A;  2C5Z A;  3JT1 A;  4XO4 A;  4ZW7 A;  1MVY A;  3A14 A;  3B7R L;  1ZS2 A;  3R0I A;  3Q43 A;  3CHS A;  2QJ1 A;  1ONN A;  4FLQ A;  3WQS B;  4ZW3 A;  2PGG A;  3FU0 A;  1SG7 A;  3FUK A;  1JG9 A;  2JD1 A;  4K5O A;  4QME A;  3FU5 A;  3CHQ A;  3FUE A;  2JD0 A;  2Y1G A;  2C82 A;  4FCA A;  2ZXG A;  2JCY A;  2JCV A;  1X3W A;  3ANM A;  4ZX5 A;  4MKT A;  4XMV A;  4QHP A;  3QJX A;  4RVB A;  1R0L A;  2XPZ A;  3FUH A;  3CZK A;  4ZN6 A;  4K5M A;  4XN4 A;  2Y1D A;  5JAZ A;  4R5T A;  5BPP A;  2WZF A;  2VLA A;  3AU8 A;  4XND A;  2R70 A;  3B2X A;  4XNA A;  4XMW A;  1T1S A;  3UCQ A;  3JSZ A;  4XN8 A;  5HNH A;  1K5H A;  2MAO A;  4Y67 A;  3CZL A;  3VVL A;  3ZHY A;  3FTU A;  3ZI0 A;  3FH5 A;  4XN2 A;  4ZQF A;  2HPT A;  4ZX6 A;  4K5N A;  4FLO A;  4RSY A;  2DQ6 A;  4J3B A;  1MW3 A;  2R72 A;  2RJI A;  3AU9 A;  5DUL A;  4NQW A;  4LUP A;  4R5V A;  4ZW6 A;  4FLS A;  4PU2 A;  1R0K A;  5DYF A;  3B7S A;  5DLL A;  3ANN A;  3RAS A;  1MW1 A;  3FUM A;  1Q0L A;  3B34 A;  1S46 A; 
#chains in the Genus database with same CATH homology
 4XMX A;  4ZX4 A;  3FTV A;  3EBH A;  4QIR A;  4PW4 A;  5JC1 A;  1X3Z A;  4DPR A;  3WQQ A;  4R7L A;  4OOE A;  2JD2 A;  3ANL A;  4OOF A;  3CIA A;  3FTZ A;  4ZQH A;  4ZW5 A;  3AUA A;  4A03 A;  2JV7 A;  4AYS A;  3FUN A;  3B7T A;  3FH8 A;  3FH7 A;  2PUS A;  3FTW A;  3RC8 A;  5JMP A;  1T1R A;  2GTQ A;  4XO3 A;  2FFL A;  1OR7 A;  1JVS A;  2EGH A;  2O7G A;  1SC5 A;  4ZQG A;  5EV7 A;  3ZHZ A;  4MS6 A;  5HNF A;  3UEQ A;  4XMZ A;  1MW0 A;  2R59 A;  3EBI A;  3FUI A;  1ONO A;  2PL5 A;  4Y6R A;  3FUJ A;  4BKX A;  4XMU A;  1RP3 A;  2DQM A;  3FHE A;  4Y6S A;  4XO5 A;  2MAP A;  4ZQT A;  3U9W A;  1JGI A;  2XQ0 A;  3WQR A;  3EBG A;  2HPO A;  4QUO A;  5AEN A;  2A7O A;  3CHP A;  4QPE A;  4JND A;  2WZG A;  2JCX A;  4FLR A;  4KP7 A;  1ONP A;  4XN9 A;  1Q0H A;  4CXF A;  3CZE A;  5JMW A;  1Q0Q A;  1SQM A;  3FTX A;  4ZX3 A;  4XNB A;  2B61 A;  1GW6 A;  4XMT A;  3CHO A;  4K5L A;  3FUL A;  3ZHX A;  4GAA A;  5JBI A;  3VVM A;  3B37 A;  4AIC A;  5FWQ A;  3FTS A;  3Q44 A;  2Y1E A;  3FU6 A;  3FTY A;  2XPY A;  2Y1F A;  3CHR A;  4ZQE A;  4AR9 A;  4X2U A;  2VJ8 A;  4XN1 A;  4AR1 A;  4ARF A;  1HS6 A;  4PVB A;  3RC3 A;  4AR8 A;  5HLT A;  4ZW8 A;  1G5A A;  4GAE A;  4L2L A;  5JNL A;  2QVW A;  2WPG A;  2Y1C A;  3FU3 A;  3FUF A;  3IIE A;  3B2P A;  3KED A;  4XN7 A;  4RCV A;  4Y6P A;  3UER A;  1H3L A;  4K5P A;  3B7U X;  3FUD A;  4XN5 A;  3T8V A;  5JO0 A;  3CZG A;  4Q4E A;  3A06 A;  1H19 A;  3PUU A;  3T0Y A;  4R5X A;  4Q4I A;  1MW2 A;  3B3B A;  2C5Z A;  3JT1 A;  4XO4 A;  4ZW7 A;  1MVY A;  3A14 A;  3B7R L;  1ZS2 A;  3R0I A;  3Q43 A;  3CHS A;  2QJ1 A;  1ONN A;  4FLQ A;  3WQS B;  4ZW3 A;  2PGG A;  3FU0 A;  1SG7 A;  3FUK A;  1JG9 A;  2JD1 A;  4K5O A;  4QME A;  3FU5 A;  3CHQ A;  3FUE A;  2JD0 A;  2Y1G A;  2C82 A;  4FCA A;  2ZXG A;  2JCY A;  2JCV A;  1X3W A;  3ANM A;  4ZX5 A;  4MKT A;  4XMV A;  4QHP A;  3QJX A;  4RVB A;  1R0L A;  2XPZ A;  3FUH A;  3CZK A;  4ZN6 A;  4K5M A;  4XN4 A;  2Y1D A;  5JAZ A;  4R5T A;  5BPP A;  2WZF A;  2VLA A;  3AU8 A;  4XND A;  2R70 A;  3B2X A;  4XNA A;  4XMW A;  1T1S A;  3UCQ A;  3JSZ A;  4XN8 A;  5HNH A;  1K5H A;  2MAO A;  4Y67 A;  3CZL A;  3VVL A;  3ZHY A;  3FTU A;  3ZI0 A;  3FH5 A;  4XN2 A;  4ZQF A;  2HPT A;  4ZX6 A;  4K5N A;  4FLO A;  4RSY A;  2DQ6 A;  4J3B A;  1MW3 A;  2R72 A;  2RJI A;  3AU9 A;  5DUL A;  4NQW A;  4LUP A;  4R5V A;  4ZW6 A;  4FLS A;  4PU2 A;  1R0K A;  5DYF A;  3B7S A;  5DLL A;  3ANN A;  3RAS A;  1MW1 A;  3FUM A;  1Q0L A;  3B34 A;  1S46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...