4LUSA

Alanine racemase [clostridium difficile 630]
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
382
structure length
360
Chain Sequence
KITVPTWAEINLDNLRFNLNNIKNLLEEDIKICGVIADAYGHGAVEVAKLLEKEKVDYLAVARTAEGIELRQNGITLPILNLGYTPDEAFEDSIKNKITMTVYSLETAQKINEIAKSLGEKACVHVIDSGMTRIGFQPNEESVQEIIELNKLEYIDLEGMFTHFATADEVSKEYTYKQANNYKFMSDKLDEAGVKIAIKHVSNSAAIMDCPDLRLNMVRAGIILYGHYPSDDVFKDRLELRPAMKLKSKIGHIKTIATVPIGYADGFTRIQKNPKVLIKGEVFDVVGRICMDQIMVRIDKDIDIKVGDEVILFGEGEVTAERIAKDLGTINYEVLCMISRRVDRVYMENNELVQINSYLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine racemase
publication title Structural and biochemical analyses of alanine racemase from the multidrug-resistant Clostridium difficile strain 630.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Isomerase
total genus 125
structure length 360
sequence length 382
chains with identical sequence C, D
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 4lusA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 4lusA02
2DY3A 2RJHA 3NZPA 5FAGA 1HKWA 4V15A 5FAJA 2VD8A 4XBJA 3HA1A 4BEUA 3CO8A 3AWNA 2P3EA 3B8TA 1TWIA 3GWQA 5FACA 1SFTA 3HURA 1L6GA 3S46A 1VFSA 4AIBA 4XG1A 2NVAA 4LUSA 3E6EA 3N29A 3AWOA 1NIUA 1B54A 4ZGYA 1QU4A 5GJNA 3UW6A 4FS9A 3B8VA 2VD9A 3LLXA 1XQLA 2QGHA 3CPGA 1XQKA 1BD0A 3E5PA 3WQDA 3OO2A 3WQFA 3SY1A 5GJMA 2PLKA 4PB3A 3B8UA 4PB4A 1D7KA 4LUTA 2O0TA 4BHYA 2ODOA 4ILSA 3C5QA 1TUFA 3MT1A 1CT5A 1FTXA 5IRPA 2TODA 2RJGA 3NZQA 3WQCA 1W8GA 2SFPA 3ANVA 4QHRA 4KBXA 2OO0A 3B8WA 3N2BA 3KW3A 3N2OA 4LUSB 4WR3A 1NJJA 1KO0A 5GJPA 5BWAA 1KNWA 1SZRA 1XFCA 4BEQA 1HKVA 4DYJA 1RCQA 1VFHA 3ANUA 1VFTA 3BTNA 2J66A 1L6FA 3R79A 4PB5A 3WQGA 2PLJA 1F3TA 2NV9A 4LUYA 7ODCA 4LUTB 3WQEA 4DZAA 4ECLA 3VABA 4Y2WA 1EPVA 4BF5A 2YXXA 2ON3A 4A3QA
chains in the Genus database with same CATH superfamily
1HQTA 5M2FX 4C6EA 3S83A 1YDYA 3DFQA 3DKJA 2KZHA 3KE0A 4TU1A 3UYCA 2OGYA 5C5YA 3KEHA 4B3ZA 1GTHA 3B8TA 4IHCA 4AY7A 4GVIA 1LG1A 4XZWA 2WHLA 2IS7A 3BSHA 3NQ2A 4KFOA 4FX7A 1K4HA 1QXLA 3S9YA 5I78A 3TWAA 2V0TA 3S1VA 3TROA 4PRTA 1AQ0A 1XD1A 3LGEA 3G22A 4JPGA 3WJSA 3NCOA 3HPFA 3BG9A 1OYCA 3HFTA 4C6BA 1YBQB 4EANA 2VWTA 1CXEA 2WMGA 5AY7A 3T08A 1JDCA 4S3JA 3ITTA 1O5XA 1E0WA 1TKKA 3MW7A 3DFPA 4JTKA 3OG2A 3M0XA 1MW0A 2JKAA 4KT2A 3LN3A 4JDBA 1K9DA 1NWRA 4J7RA 2TSYA 4ZFCA 3MVTA 1Y65A 1XIMA 4BQ4A 3NL2A 3W2JA 1AW2A 3H22A 4LAMA 1ZU8A 3LCXA 5KSWA 1MI3A 1XH2A 4DHGA 5TNVA 2X1SA 1MFVA 3NTYA 1LJYA 4DXKA 2A3EA 2GGEA 1DEDA 4H4IA 3IK4A 3PG9A 3QKEA 4E3VA 1OFDA 1KWGA 4CEUC 2A2IA 4Q4KA 1A0CA 2QKFA 3DI0A 1VH7A 2ZBTA 4HA3A 3TQKA 3TN5A 1JFXA 2WVVB 4DF0A 3S0CA 4DO5A 3UXLA 4FOUA 1T5AA 3C56A 1KR0A 5DMNA 1EJSC 3SBFA 3RLHA 4R33A 4YTSA 3VZZA 1F76A 1C3FA 1AL8A 2OEKA 3B8IA 3GXFA 1IZKA 2INZA 2LLEA 4PB3A 3W24A 1TTQA 3AIWA 2V6AA 1WUFA 3GQYA 5LHEA 3WK3A 2D24A 5AC5A 1UA7A 1Z48A 4RPQA 3WFAA 4I8DA 2EGZA 2YLLA 5HNUA 3ZJ7A 3ZSTA 2DQXA 4Q8OA 1OQFA 1YLVA 5G4WA 2Y24A 3RX4A 3M4HA 3U57A 4R53A 5HWMA 4QNEA 3FVMA 1SZRA 2QV4A 3NYZA 4CD7A 2P8CA 3SGZA 5E6YA 4FLQA 1XIDA 5I6SA 3SCVA 3EWBX 3WUGA 2V8ZA 2A1YA 4HJFA 3SADA 1XLJA 3WEOA 1XV8A 3GO2A 4IF2A 2QUVA 3KWSA 1Y8BA 3PWAA 2TRSA 3PJTA 2NV2A 3I6RA 1YBQA 1DHPA 1NAL1 4US5A 3A24A 3WLTA 3RLGA 3OHIA 2VGBA 3EXRA 1DXIA 4DWSC 2NQLA 1AD1A 1S5WA 4QJ5B 1XLHA 4AIEA 2OSXA 1XLAA 2J7DA 3I7SA 4F9JA 4AUBA 1K02A 3ALGA 4P61A 3KRSA 4JGDA 1GVFA 1XW8A 3ZLGA 3QW3A 1ZAIA 3WKZA 4ACZB 3TAOA 4JKMA 1F07A 3QTGA 4XVDA 3FFSA 1Q6QA 4MB4A 4M80A 4MPKA 1QW8A 3ZXWA 1TZ9A 2YDSA 3GIQA 4FR1A 2QV5A 4O1EA 3ES8A 2BB0A 2BY3A 3ONCA 4UZUA 1OB0A 4W85A 4M56A 3EA3A 3SFWA 2WVUA 3C3UA 2VQTA 5D32A 5HAOA 5LIXX 5A6BA 4HOZA 3P74A 5M1TA 1RY0A 2A3CA 3S1GA 5AN7A 3TTSA 3ARWA 5GJPA 3BW3A 3VOJA 5CGMA 1IGWA 2WVVA 4QG6A 1GVEA 1PKMA 1RR2A 1W3JA 3EYPA 4L9YA 4U31A 4HMNA 4E4UA 1G4EA 1LBLA 1Z8AA 2NX9A 1XIEA 2CPUA 3ARRA 4GZIA 3CV1A 4JXCA 2J9ZA 2CXEA 5BXTA 2A3HA 3EMZA 1K70A 1XYAA 2WSQA 4E3TA 2RJHA 1ZB5A 1QK2A 3T8LA 3N3TA 1O12A 2CETA 3BMVA 4P5UA 1HG3A 3S8HA 3UG4A 4GZ7A 2WB5A 4H8HA 3Q65A 4H9UA 1U83A 2FFCA 2NQJA 3CUIA 4XAFA 1SR9A 4QJ3B 1WYIA 2JK2A 4C5YA 1M7PA 3MI6A 2VEKA 3AIUA 2YX0A 4M1RA 2CZFA 1KM5A 3VIFA 3E0WA 1EUAA 3HJEA 2VGFA 2DVXA 1XQKA 2FB3A 2BY0A 2VZOA 3VOCA 1P0KA 4L4LA 8XIMA 4Q3MA 2ZZ7A 4F0SA 5T91A 1RZMA 5FJIA 1K8CA 4TR9A 2XN0A 4N4QA 3EWWA 4NZ4A 2WANA 4LXFA 1K8XA 2D73A 1QO2A 4DBWA 4QLJA 1Y5XA 4IJBA 3VMPA 1G4SA 1AD4A 5LA2A 1KNWA 2GVEA 1PV8A 1AQFA 4C6NA 4KMQA 1JYNA 3GC4A 3CPRA 4LGXA 5A95A 2ZCGA 4Z0JA 1RVGA 1FH9A 5CSSA 1FP9A 3M6DA 3M5YA 1TFVA 3F5JA 4NYUA 1MZHA 1A47A 1YPXA 4ACZA 2QAFA 2OXNA 4G1KA 1H7XA 1PL9A 3ELFA 1W2PA 4AIOA 1TTJA 2EJAA 2XISA 3GXDA 2WJEA 3NQ7A 1HZYA 2FZ8A 1LQAA 3BZGA 1IGSA 1TWSA 1QPOA 1OC6A 1O94A 1TV5A 3MQTA 5I3GA 4GZJA 4KW2A 3AWOA 4QDWA 4O1CA 4Y8FA 2ZE3A 3MBDA 4GINA 4M19A 3M6YA 3W02A 3L4WA 3N6HA 4GFSA 1P6WA 2X05A 4IJRA 2FFIA 3AMGA 1UD6A 3O6CA 1LOLA 2PA6A 2FJKA 4FMVA 3TN4A 3VCCA 2OELA 3KRUA 5CJNA 3WH8A 2PDHA 3WLRA 5EYWA 4YHEA 3PVFA 1HJQA 1WV2A 4E2DA 1HW6A 3WLNA 2WMKA 1EGMA 4FK9A 4BJHA 4B5WA 1W5QA 4UTWC 1EBHA 1GQJA 4MPQA 4ZB0A 2FTWA 2EPNA 3RO6A 1SO6A 2XIBA 4IPIA 4PUDA 3CHVA 1PVNA 1XD0A 2Z1XA 4W86A 3MI2A 4RNFA 3QYSA 5A8NA 4HMCA 1B3XA 4HYWA 2CBJA 1KCZA 3WF1A 5LA0A 3ISIX 3QOMA 3AIQA 3MV01 4WQ6A 1LTDA 2C7FA 1EYEA 2ZOXA 1DQXA 3ERPA 3V35A 2QJHA 3IGXA 1SJDA 3EKGA 4CD8A 2EPLX 3F7JA 2QUTA 4NZ1A 4NJGA 4KCTA 2PDPA 2WSRA 3GG1A 3UWZA 3NPWA 3H54A 3IACA 2YKKA 5PTDA 2ZWZA 3RCYA 2P3EA 5JBEA 3THUA 5CPNA 4GFIA 5I02A 1VFSA 2VR2A 4AIBA 2R91A 1XISA 5EBUA 2H8XA 4IMAA 4DB7A 4D9PA 3F4DA 1KB3A 4GXMA 4ICMA 2I5QA 4X60A 3APGA 3HOJA 4CNNA 1WO2A 4C65A 2AGKA 1CENA 4HZ6A 4MYXA 5E93A 4OGZA 1J0IA 4PUUA 3WD3A 3HPZA 2E4TA 4DBEA 4TVUA 5EMKA 3CQIA 3T44A 1E4LA 2RDTA 1V8EA 1OSEA 3MHUA 1A4MA 3ZR5A 2HVOA 5CZTA 3CJPA 2YBVA 3RX3A 3T1GA 4A8RA 1D3HA 2ICSA 5KEZA 3PZVA 4S3CA 1LCOA 4NSBA 2C19A 4FNUA 2GQ9A 4R9XA 2Y70A 3FW6A 3EB2A 2NXGA 1U33A 3GVQA 1EEPA 2QMKA 3L4ZA 3LXAA 4WJEA 2J7GA 3CZGA 4C7DA 4JQ1A 1ZNNA 3RR1A 3IUDA 4NZ5A 3N73A 1SMDA 1TV7A 1PAMA 1HKMA 4XUGA 2VL4A 3NA8A 1BYDA 4I6VA 1AMYA 1UR2A 1WA3A 3W87A 4EPEC 3QLLA 1M1BA 2DVTA 4U3AA 3GHRA 3DKLA 2VRJA 1BWLA 2WNQA 3O8AA 4IISA 4BKNA 1W37A 3OHMB 1KR1A 2CCRA 1WZAA 1B3YA 3DEQA 1LLOA 1E40A 2G8ZA 2TAAA 4AD4A 2QULA 4OU1A 5E09A 4B3KA 2XGBA 1OF8A 2ATMA 2DT0A 2HMCA 4XSLA 3JW7A 4IP7A 2XN1A 1JL8A 3PULA 4ZZ9A 2X2YA 1OGBA 3IJQA 3S1UA 3HTWA 3LENA 4J28A 3BW4A 2F84A 4CCEA 1IEVA 2ZDRA 1IE7C 5BXRA 3I3BA 1Z42A 2XG9A 2VR4A 2ALRA 1EJXC 5FL1A 3M41A 4IIEA 1GZJA 5CSUA 1TPB1 4M3PA 1Z7AA 2QQ6A 4RDYA 4DX3A 1GPWA 1WAWA 3B9AA 3R0UA 4JL2A 3EX3A 2QPSA 3APTA 4MY1A 1R7OA 4N9DA 5I24A 1QUMA 1DWJM 2NLIA 2G3MA 1YRRA 1MWOA 4F8XA 1JDFA 3W28A 4UOQA 5LXXA 2OO6A 1JDAA 1TJRA 4JYFA 3IANA 4UFMA 1J0YA 1MZRA 3SUSA 2QVNA 3QN3A 4DWSB 2DZWA 1NFGA 3CT2A 3VKAA 3TXZA 3XIMA 5EMLA 1L6WA 3K46A 5A6TC 4GNKB 4RW3A 3T0AA 4DZIA 2W0UA 3OA3A 4W4QA 1UASA 5SWUA 3H53A 3H23A 2VFDA 3SURA 3HMCA 1KFKA 3BLPX 1E72M 3UA3A 1LF1A 1OD0A 3OZOA 1XH0A 3MPGA 1UYQA 4LB3A 3N4FA 4K3ZA 3TYAA 5A8OA 4PC8A 4PCNA 3NZQA 2F6KA 1JZ5A 1ODZA 3BAYA 5I3HA 4QHRA 4ATWA 4CN6A 3N13A 2D2HA 3N2OA 2DZUA 4UQCA 1DV7A 3FSUA 1V03A 3T8QA 1BTMA 3WJZA 2BX7A 2XVLA 2E09A 4G56A 2VFIA 3TLQA 3ZO9A 3BLIA 2FVKA 2ZA3A 3G0XA 4ATLA 3ZMRA 1RQBA 2G37A 1SU5A 1LQ2A 2PGWA 3V7PA 3BDKA 1GVQA 4ICNA 1VJSA 3OPSA 4MMWA 1AJ0A 1Q45A 4DZAA 1QI5A 5CAHA 3L2LA 3ZWTA 1R3RA 5K9DA 3AUJA 4CLMA 1GW9A 3P82A 5H1WA 1S2UA 5CPLA 5DN1A 3STFA 4H8NA 1WDRA 3AICA 1F61A 1M3UA 1ZAHA 1UUMA 1EHAA 2XIJA 4I90A 1QDSA 1V6YA 3MSRA 3TW9A 3RNDA 3BK0A 3U7VA 4UTFA 1QOXA 2FJUB 3VGEA 1HJUA 1QMLA 3V4BA 4FLOA 1CPUA 1UR8A 2Y89A 1A5MC 3P80A 4ZO8A 3W6LA 3HG2A 3AS0A 3B04A 3VMNA 1JCTA 4X2RA 2FZNA 2NW0A 4D6FA 3PZNA 3IV3A 3E96A 4B4HA 3VD9A 4C6PA 3EZ4A 1MRQA 1PDZA 5CBIA 3M0JA 2O92A 3IGSA 2ZZ3A 4GC3A 1W9VA 3EA1A 5JXQA 3W25A 3S2JA 3N04A 4N02A 5DBUA 5F1VA 4Z2LA 3EEZA 4DWSA 2AAAA 3LZ3A 1AQMA 4JX4A 3WDRA 1V0MA 1ZALA 3BPWA 3PR2A 1XRFA 3W81A 5JIWA 1DWHM 5GVJA 3W7LA 2FIQA 4Q33A 3VD4A 4LSBA 1J6PA 3LQLA 2FGZA 3BCFA 3A3WA 1M65A 3N3MA 3T07A 3VM5A 3R4IA 1CTNA 5BMWA 4IX0A 3V0SA 4AX7A 4H9YA 3AWNA 3SCRA 3ZVHA 3MI3A 4JYEA 1A5SA 2ACUA 5LNRA 2AKMA 3W2UA 4UTIA 4KRZA 3QHOA 4IIFA 4MVAA 1R5YA 4X3ZA 1LRQA 3KCOA 4GGHA 5JVLA 1I0DA 3I4EA 1A5CA 3QR1A 5CGTA 2PURA 1VGAA 5A8PA 2Q8ZA 3EX4A 4KH2A 2EEXA 3UEQA 4AYSA 5C2XA 4K7YA 4Z1CA 4H9MA 2DUAA 2PDIA 2A3BA 3KVMA 3AOFA 4AEFA 4W93A 2I9UA 4Q7BA 3A22A 3NQAA 3P93A 3M64A 3AZRA 3GVGA 3A3HA 2VCBA 4W5ZA 4PMQA 4YHGA 2HK0A 2PDYA 3QGKC 1GVIA 4YMZA 2PF0A 3D3AA 2GJRA 1KO0A 3QF0A 2W92A 3WN6A 1V3KA 3PZ9A 2PWDA 2Y8KA 2BWGA 3KM8A 4GI8A 3E2SA 3QV9A 2E5DA 3W4RA 3NO5A 5D4YA 3WLLA 3PPGA 3SQMA 2CLFA 6XIAA 3VX0A 2NV9A 4XZBA 4DEFA 4NAEB 4ZBCA 4FALA 2ZXAA 3WEMA 4A05A 4AD2A 4E2VA 1EC7A 1RJQA 4RE0A 3WEZA 1SFSA 4HA4A 4PCSA 4PUEA 2VD8A 2NX1A 3W1NA 3U4AA 2J77A 3FA4A 4DLMA 1NARA 4CU7A 1YTEA 1F6YA 1S3HA 1QK0A 2Z1SA 3POHA 4X0NA 4W87A 1JPDX 5ABEA 4QIUA 1YADA 4GMEA 3BV7A 4LRTA 4S2CA 2CFFA 1BG9A 2NUXA 4J40A 3ORWA 2JEQA 3C8FA 1AG1O 2A79A 4IQEA 3S1XA 3LTYA 2QJNA 4HCDA 5EBAA 2Q01A 1NELA 4IQLA 3K5XA 1WBJA 4UTKA 5GNXA 3LB0A 5HR6A 2DP3A 4U28A 1NSJA 2QJMA 3CXOA 4L56A 1C9DA 1UWAA 4B92A 4RW5A 1QI3A 2J75A 1V6TA 2PSNA 2NX3A 4Q8MA 2CHOA 1XG3A 3QY8A 1PEZA 3N9RA 3S47A 3T42A 3CYVA 3BV4A 1GT8A 3SW6A 1FDJA 4Q8QA 3T4WA 3ABQA 2BZNA 1CX9A 4IT1A 4DJDD 3NXLA 2NT1A 4KERA 4IMCA 2R8WA 2Y85A 1V0LA 5A6MA 3LMZA 4DUXA 2E8ZA 2Y88A 2OX1A 4B2DA 3LNMA 4JQ4A 5BRBA 4HNCA 1OIFA 1ME8A 3I65A 4KQNA 3G0UA 3TCEA 3VFLA 1W5NA 4H8VA 4ERIA 4C6LA 4D8AA 4GO9A 4MUPA 3W22A 2J79A 4OKDA 2HBXA 4UTWA 3ARYA 5HBFA 4EKJA 1US0A 5HR7A 2Y4SA 3M5VA 4NI8A 4JFVA 2QUUA 1J0HA 4ADTA 1TPEA 3B4YA 1OFPA 2VJXA 3T2PA 1JYXA 3LHVA 3WQ4A 1WPCA 3TFCA 5I03A 3BL3A 3G1SA 3WY1A 4WGHA 3HG4A 1X6UA 3BLKA 3PP7A 4NAEA 2PD9A 3PSVA 3MDUA 4A2SA 3K13A 2X0YA 5A6AA 4GYJA 2Z00A 1PO9A 1JQVA 2G4JA 3GTXA 3C2YA 5T9CE 4UQ9A 3SN4A 4CQ9A 3RMJA 1E1CA 5CKSA 5AVNA 4HCHA 4JTGA 2FDMA 3N17A 1GQLA 1UKSA 2C6QA 2AMGA 1AZ1A 3OBAA 3OBKA 3PG8A 4FX6M 2RGLA 4PUJA 2R1PA 4WKHA 6CGTA 1E9IA 1H50A 3WLMA 2UV8G 1PZ1A 2IQDA 4NJHA 1X97A 4H83A 1OINA 4JICA 1HJWA 3UESA 4AU0A 1V3MA 4UNLA 4QCFA 2V5KA 1EPXA 1SQ7A 1T99A 3RFAA 4LF2A 4GQQA 3NPUA 3R25A 1AUSL 3MP4A 4R5EA 2PRHA 3ZJKA 2PD5A 5HMDA 1W5MA 4NZFA 3LHUA 3VIHA 2KX9A 1MXGA 1FWFC 2GDQA 3C52A 1NWTA 3WBAA 5I2UA 4MDOA 3UNDA 3N29A 3WBWA 1PUDA 4QNWA 3VNMA 1PHQA 5IDIA 1X98A 2NXIA 3PUGA 4LW7A 3I3EA 4M24A 3CV2A 1NOUA 3GDTA 3LV5A 4BCEA 4LS1A 1JGIA 2PI6A 4E2OA 4FP1A 4HNOA 4LYQA 2PP1A 4B5SA 1PWMA 3W70A 3P5ZA 1TV4A 3WELA 3PAJA 1X6NA 3SFKA 3M1ZA 4IXXA 4PZVA 1VIWA 1NP2A 2CW6A 5DY3A 3URQA 4WIWA 3C4UA 4GY1A 1E5NA 3OQ8A 4MIMA 3W26A 2XZ7A 2DZAA 4EWJA 1XLEA 1HNYA 2OT0A 2DVUA 4O4WA 2HRWA 3NXFA 1R2TA 1NFBA 4HQVA 3T09A 1MUCA 8CGTA 1NFPA 1JEZA 3GLCA 4IUOA 2WLZA 3K4AA 5I77A 1JGMA 3WQEA 2QT3A 1UKQA 4F2UA 1H51A 1A80A 3MWCA 1M68A 3HO8A 4BK9A 3SO7A 1DPMA 2XM1A 3GY1A 3GU2A 4JKKA 3Q4DA 2PP3A 3I10A 1KXVA 3W1LA 5CC3A 4D1IA 3IIXA 3GUGA 4PMDA 1GOWA 3GXNA 1EA9C 3URBA 5JBDA 5A5WA 3WF3A 2ZVRA 3W1RA 4IUGA 4QFUA 4AWUA 1XBVA 2IKGA 1AQHA 1W56A 2YZ5A 3AO0A 3AXKA 1Q5MA 1UJPA 4O54A 3AIVA 3LLXA 3PJWA 1UP3A 4AD5A 3EKLA 6REQA 1XGDA 3BJSA 4HTYA 4GUFA 4FXRA 3SZ8A 3TNOA 3HGOA 1JZ3A 1PTDA 2DU2A 2ABBA 3MT1A 4GIEA 1XSKA 4FZIA 1FX6A 2ZVIA 1BAGA 1XLLA 2INFA 1HO1A 2OWXA 1E9LA 3GDMA 1I9CB 3ATYA 4I5UA 4XZLX 3TOYA 4JTUA 1TPH1 3NL6A 3ECQA 1HGWA 4O13A 5FESA 3BTNA 5BXSA 1NWUA 2H9AB 3XISA 1GOOA 4DM1A 1H1YA 3N1AA 3CLWA 3C2EA 1S2TA 5C9UA 5REQA 1RVKA 3ZT5A 3EB4A 1TPVA 1XIBA 1JPHA 1A5NC 4LBRA 3NQDA 4MWAE 5G2IA 3W73A 2OQYA 1DTNA 4W8LA 5T26A 3EEGA 4D6IA 1EZWA 1OCNA 9CGTA 4LS0A 3M9YA 5IXEA 2VC5A 3F4VA 4L65A 1XYFA 2HQAA 5FJRA 3IJ9A 5FF4A 3OGSA 2BV9A 4W89A 4JIIX 2VP8A 3TCSA 1F5ZA 4DPQA 3GNPA 3B3DA 3QEZA 3B8VA 1ZBVA 4HCLA 1R2SA 1V7AA 3WBXA 3LM3A 3WQDA 3WDPP 2NWRA 3OZMA 5J04A 5CXPA 3N2TA 2PDUA 4TX6A 1OM0A 1W17A 2GUUA 1KQYA 4MLJA 3WNPA 2WZTA 5BNKA 1NM9A 1ZL1A 4PFMA 4HN8A 4HJWA 3NSNA 4ZXLA 2VX4A 1Q6CA 4PL2A 1NTHA 3BSGA 2WVTA 4MNLA 5XIAA 4F0HA 1CGWA 1WUEA 4NUWA 4K1GA 2ZWYA 4M7TA 4CQCA 1FWEC 1EGZA 2OQHA 4NYYA 1QBBA 1HP4A 5D9MA 2VEIA 1VHCA 1VCGA 3HV9A 1OGGA 3OVPA 4D6GA 4A29A 5MF5A 1H49A 5DCBA 3R8HA 1A5AA 3EWZA 2W6RA 1J5TA 1E0UA 2P5NA 1F3EA 4AAJA 4OFCA 1MW2A 3BE7A 1TO3A 3W6YA 3DCPA 1B3WA 1F2JA 3QFWA 2V5CA 2B0MA 4PBFA 4JHZA 4XKYB 1Q6OA 2XGIA 3MSYA 1KFBA 4UFLA 1FA2A 3UETA 2DSZA 3SY8A 2O7SA 3CEUA 4EXAA 2G50A 2PDWA 3U2ZA 2BGNE 4GNJA 4R34A 3O05A 1P7TB 2E5BA 4JFWA 2PP0A 3G24A 3DFHA 3N18A 3NL5A 3ZLHA 1OFRA 4E0CA 2P0IA 1R8LA 3BO9A 1JNDA 2H9AA 4YWSA 3R2GA 4AIUA 4HT3A 3KVKA 1AW5A 2PLKA 1M6JA 3B8UA 3EX2A 3HIJA 3THCA 1K7FA 3RR4A 2DW6A 4B4FA 3RX2A 4FF7A 1XDLA 3A9IA 3O6AA 3AS1A 1A3WA 2E6DA 4Q4QA 5L6UA 3RN6A 3U4FA 5IHSA 1AL7A 4Y9OA 1S2CA 1ZTVA 4KF1A 4R7WA 4CQBA 4MJ2A 2Y7FA 3QV7A 1L8PA 3O15A 2YZRA 4H1ZA 1E6SM 1GGOA 2IPFA 3BG5A 3NQFA 2GFTA 4X0VA 4O11A 5HULA 3JZUA 4KPLA 5DRCA 5AYXA 4UMBA 3G2GA 2GVGA 4GXWA 1FWTA 3GS6A 2ZRUA 1U5HA 1OC7A 1OZMA 3W2NA 2WJFA 3DECA 4JQAA 1KBKA 3V5CA 3AJXA 2E6AA 1UR4A 4GKTA 3VCRA 4FB7A 1B3VA 1V6WA 5D2VA 4K2SA 3L21A 1EXPA 4JQ2A 1MEIA 3MY9A 3GW0A 1C91A 2ZXQA 5CQ1A 5BZAA 5BRQA 1G67A 4UBPC 4YCOA 1R87A 5A8GA 1XCFA 2IUZA 5F2LA 3NJ3A 1X6LA 1VBUA 3VDHA 4UR7A 5D38A 3CZLA 1DQUA 1MQQA 3WG6A 2X40A 2O4QA 1K03A 3KDOA 4KKXA 4GYFA 1L6SA 3EX1A 2G3IA 2GOUA 5A6LA 2VVNA 3P14A 1B30A 1GOMA 2XU2A 3L0GA 3RDKA 1TREA 1E6PA 2V5JA 4C1LA 3EMQA 1B90A 1EJTC 4A2RA 4WXYA 1ITXA 1M41A 5ABGA 3WLKX 4ICCX 4WRHA 4PUNA 5KMYA 3OODA 4IL0A 5B7YA 4J35A 3B97A 5FEWA 4IX2A 3UZWA 2B81A 5LIUX 1WZMA 3B8WA 3QV8A 4XKYA 3A4WA 4PMJA 3UXKA 1JPKA 3HG5A 1QHZA 3MC5A 2ALDA 4L1XA 5TAOA 3FOKA 4JTLA 1LORA 2AL1A 1P7TA 1A5KC 3GBEA 1HJVA 1RALA 3UVIA 2IPGA 4HPNA 4NJKA 1ZCOA 1KGXA 2NVDA 4GD0A 1XGEA 5I06A 2R6OA 3DU0A 4P2VA 4H00A 2VRQA 4CNTA 3EA2A 3TJ4A 1H5VA 3C3NA 4QBXA 2VX5A 4AD1A 4M6VA 2PTYA 5HOSA 3QSTA 3CB3A 1XIFA 1J12A 2WYSA 3PBWA 4MKVA 2EPHA 3WDQA 2DGAA 4PE8A 3UCCA 2PDQA 2OKTA 4Q8PA 3LCLA 3VGBA 3ITVA 4GQGA 4ML4A 1RY8A 1W3HA 3GNNA 4RKAA 3LRMA 3WD2A 5K9CA 3QRHA 4GIRA 1G0CA 4MDPA 2YIHA 1XPYA 2QCEA 3BAJA 2ZXDA 1BRLB 3V36A 1AK5A 3D0CA 2XWEA 2VVSA 4KIRA 5TBOA 4Q8TA 2WLYA 3OZPA 4LTSA 1PZ3A 2TODA 1KBJA 1FWCC 3RLVA 3BJFA 1KTNA 1A0DA 3PTKA 3RHGA 4BWLC 3O0FA 2XFWA 3E0FA 2GJLA 3LOTA 2W79A 4HA0A 4NXSA 2FHCA 4MWAA 3EMCA 3TSMA 2XIQA 4N7QA 1PXGA 1V4YA 5FSEC 3PM6A 3UY7A 1LL7A 3RF9A 5IBXC 3VNLA 1YPIA 4XSMA 3VGGA 1BF2A 1BKSA 4NG3A 2D0FA 5G5IA 1OFAA 3CH0A 4RZBA 3RXZA 1EJWC 1EKOA 3GIPA 3MMUA 2YW4A 2FPYA 4GQBA 3B4UA 3PK7A 1Q2RA 3WLPA 5EGRA 3LGGA 4LC8A 2OOGA 3CC1A 4TXEA 4UIOA 3VNDA 1CGXA 4REQB 5AOUA 1R2RA 1V0KA 1OT2A 1XUZA 4HZ8A 4R88A 1ZJAA 3ARZA 3UR7A 1KM3A 3SY1A 1KFCA 3F4NA 3S2NA 2Y62A 1I2RA 1RBLA 2QYGA 3WFZA 1QHOA 2Z2BA 4J3ZA 2ACRA 1TR9A 1GKPA 2PWHA 4NX5A 5AC4A 2DIJA 1OCQA 1E4MM 1RK6A 1GZ1A 3MUZ1 1QNOA 1K6AA 4I6KA 2DH2A 2OSYA 1FP8A 1GJUA 4C6OA 4LS2A 3AS2A 2ISWA 3NOYA 1H5YA 3A3XA 4BI6A 3PWGA 4C6DA 5D9NA 1XIHA 1K77A 2WK2A 3WNNA 3LD5A 4Q7NA 4RL3A 5HNNA 3FYPA 3KS6A 3EXTA 2D22A 1I0BA 2DDXA 3ARUA 4WSJA 3SN1A 1KFLA 1BRLA 3FHQA 3H7VA 1L2QA 4C91A 1TJ0A 1TVLA 4YVXA 2TPSA 5DMYA 4Q6JA 1V02A 4JBRA 4YTRA 3WNKA 2J8GA 3H12A 4FIRA 3UJSA 1P0BA 1JIBA 2UY2A 3OYXA 2WWDA 1A53A 1SR0A 3F1QA 2YOCA 1LWIA 2FGLA 1TZZA 3M44A 3XINA 4RK8A 3WQ8A 2VXNA 4PTVA 4RE3A 4LCSA 2XZ9A 3IIVA 3VDGA 2QGHA 3PUOA 4JN8A 3K4DA 1FWIC 3EX6A 3WQFA 4W7WA 1X7FA 3DHDA 5AHLA 2VTFA 1JG9A 1UCWA 3MKVA 1WB0A 2J78A 2Y8UA 3UPMA 1XG4A 1VKFA 5D09A 3E0LA 1V5XA 3KP1A 1KV8A 2AQVA 4IP4A 3QR0A 2ONEA 3FJ6A 1HVXA 3KCJA 1TB3A 1YXDA 3G8EA 4LQ1A 4DF1A 3FS2A 3KTCA 4GH1A 1VRXA 4MOZA 5ENLA 1GVSA 4BEQA 4FX8A 2GVYA 3ZOAA 4M81A 1VS1A 3M0VA 3H7RA 1L8NA 2O9PA 2IQTA 3ARTA 1PYMA 3U48A 4AEEA 4PMNA 3TONA 3FDGA 4DLFA 1OCBA 2ZUVA 4UTJA 4MNJA 3PNZA 3REQB 3II1A 5CG0A 5F4XA 1GOIA 5JMUA 1WQ5A 3A64A 1XBXA 4WF7A 2OZ8A 1ONRA 4LU0A 4JTTA 4E5TA 2ZZ1A 5CZ0A 5EMJA 3FKRA 3WSUA 2QPXA 4ZQCA 3WMBA 3C8NA 1EJRC 4JTHA 3G1DA 4GJJA 2YW3A 2D3NA 1GVRA 2BXZA 2H8ZA 2TYSA 4UQAA 3SSZA 2C13A 5CSRA 1GYLA 1ML1A 4JHMA 4C7GA 3VNZA 3LPGA 1EDQA 4OVXA 3VDAA 2CZEA 2WM1A 1ONXA 1A0EA 1BSIA 3GRIA 3OB8A 3OIXA 2POTA 3GAKA 3NYDA 5FJJA 1IIHA 3VILA 3JU2A 1W9UA 3UWYA 2ZYFA 3UT0A 4YYCA 2ZC1A 1F3WA 4V1XA 4PH6A 3DG7A 2NUYA 3PPFA 4AYGA 3AXIA 3AMLA 1YE4A 2QS8A 1UIPA 4MYAA 2PLJA 2DPEA 3O7UA 2Z7KA 4XBKA 2D2OA 4PMRA 3WJYA 2YL8A 4GC4A 1H7OA 3B8DA 3FNDA 3BH4A 1PX8A 4DZ5A 5I0DA 1JVNA 1OGSA 4DRSA 3WENA 3H21A 2GSJA 3ARQA 4ZCWA 1CXIA 1Q65A 2X1IA 4AH7A 1S2WA 3VOIA 5CG7A 3ZIZA 1XYBA 2OZ0A 3CQJA 3CIWA 1UPMB 3QQWA 2NVAA 2R1KA 2CBUA 1RP9A 4C60A 4FAMA 1E15A 2GOKA 1EA0A 1R30A 4PMXA 5C7HA 4HK5A 4MZ8A 4Q8VA 3VU2A 4DNMA 5BMXA 4CN1A 2F6UA 1NDWA 3BJTA 3NM1A 4IICA 5LZLA 3I3DA 1POJA 3HZ3A 5G2HA 3SCPA 4D6EA 3CTLA 1NQ6A 2DORA 1PTGA 2BOGX 5LNUA 4U5KA 2BHYA 1GQKA 3REQA 3V18A 1YKWA 2REQB 2B7NA 3W7IA 4YLWA 1JCYA 3QYQA 2YDAA 2PB1A 1JAKA 3TC7A 4DJDC 1DIEA 1TPWA 5FF0A 3LRKA 5DFAA 3M47A 1IEWA 3S2MA 5A2AA 3KZPA 2JGQA 1CXKA 4IIBA 3TN6A 2CBIA 2EG8A 1ZENA 1EFZA 1SYTA 2HS8A 2WOQA 3GC5A 1V3LA 3VX1A 2Y8VA 2HROA 4O17A 5I3DA 1ADSA 2OLSA 5T9BG 3CV6A 4OUIA 3LCIA 3KBWA 4L4MA 1EO7A 3C6CA 2NLYA 2P50A 2PWEA 3EPOA 1GOXA 1WXZA 2A7PA 1GJPA 2G3NA 3BVJA 3T78A 4OWGA 4JQ3A 1TUXA 4LAUA 4CCZA 3W83A 1FWGC 4Z1DA 1C8QA 1YDOA 4UTMA 5GJNA 2PDLA 3GE7A 5KZEA 1HO4A 3W2LA 1MNSA 2JEPA 4TUFA 3GFYA 5FOOA 1XYZA 4QP0A 1ZBCA 2CITA 3N2MA 4EOUA 1OVDA 4NX0A 3D46A 2P10A 1T8XA 2X09A 2C1GA 1PIFA 2EG6A 3AI0A 1D9EA 2FHBA 4TMCA 2HTMA 2E25A 1ZRQA 4PRRA 2F7FA 4XQ6A 2WZEA 5EFFA 2WKGA 2ZZ6A 4LUSB 3W72A 1HKKA 5HANA 1SO5A 4MF4A 2ZICA 3LV6A 3LS9A 4P7OA 1E6QM 1NF0A 5EPDA 3NDZA 2ZX7A 2J24A 3L68A 1KTBA 1F73A 4MUZA 4BY3A 4FSAA 1PSCA 4LUTB 3N19B 4R27A 1XJBA 4XIMA 3U8GA 4AVNA 4WLCA 5DRIA 3B40A 2GWNA 3GX9A 3AISA 4UUIA 1HVQA 4LY4A 3T0BA 1EC9A 2REQA 3H2OA 2V67A 3SCQA 1W91A 2QCHA 4B9ZA 4AXKA 1KBBA 4NIRA 2OEJA 2X7WA 3NEHA 5LXEA 2Z27A 5HMEA 3W0KA 5F7UA 4KESA 3N14A 4JCMA 1ZGDA 3DH7A 4ERAA 2ATSA 3W75A 4OV9A 1SUXA 5HWJA 4PMUA 3TXVA 4CGTA 1YNQA 2QW5A 4URIA 3BURA 1VFUA 1TV8A 4YVVA 1G7UA 4TTUA 2BHZA 5IM51 3GM8A 1E70M 4K7VA 3RYSA 4M6PA 5GQBA 1OWQA 4ZSTA 4O10A 2HSAA 5KZ6A 1KXHA 1RPXA 1JULA 4EF9A 3G3MA 1OYAA 3UD6A 4AY1A 3G0SA 1GPFA 4RXFA 2XFFA 5DF0A 1EWEA 3LCFA 2BMBA 3GBDA 4US6A 4QCEA 1P0NA 3KX6A 3B9EA 4DELA 2FLIA 3KL5A 1Q8JA 2WCSA 4WSHA 2EAWA 2C0HA 5HQLA 4WGXA 3UPWA 2FH8A 2W27A 1UHVA 3C0LA 1PPIA 5HK4A 1HKWA 4TVCA 1PIIA 3W7OA 4Q6XA 3CUZA 2DZBA 4BWLA 3RPDA 2GGGA 6PTDA 5D05A 1SZFA 3UNTA 4INFA 4LUSA 4YWIA 4S2BA 4EIVA 3QMTA 2Y7EA 1FKWA 2QDGA 2ZFAA 1X38A 3W86A 1M03A 1U2YA 1ECEA 1PCKA 5LNSA 3LPFA 2ZX6A 3CMJA 4LRSA 4TOQA 4IFOA 1PWLA 5IBXA 2NQHA 3M0ZA 1BVWA 1GONA 4LUTA 2AQOA 2PDFA 4EK7A 4H7VA 4BI5A 1H09A 3E2RA 1UD5A 3RJYA 4KEMA 4W7UA 1WCGA 4C6FA 2B7QA 4XAZA 1EJ7L 2J8FA 3TMLA 2ZUTA 1I1XA 3IGUA 1R3QA 3UJEA 3TYDA 5JIPA 4LAZA 3LCWA 3WUBA 4YPJA 4XAYA 1EP3A 1FDYA 3KP0A 3F03K 2BVTA 4A22A 4IXHA 2C3ZA 5H8MA 3B8SA 4J9JA 4JS3A 2E1DA 4UCGA 1CDGA 3IVUA 3VYLA 3S2CA 4CNOA 1DIDA 1IEQA 2DV0A 1BXBA 4BR1A 2RAGA 4IIHA 2E67A 2VGIA 3MSGA 3BSMA 6TAAA 3JUGA 3TKFA 3EOOA 3PF3A 4U2YA 1VIZA 4OE7A 1YEYA 3LLDA 2GPTA 4DJFD 2Z29A 1YPFA 2WQPA 5AZ0A 1Q13A 4UFHA 4JEQA 1WXJA 4IFKB 4NU7A 4JTEA 3GU1A 1OADA 1RH9A 3BC9A 3SRKA 2A21A 2VC6A 1R85A 2GVJA 2GVLA 3V1HA 2A3LA 2FZDA 2PDKA 2YA2A 3NL3A 2PZ0A 1UBPC 4FXJA 1F9CA 4GUGA 3BW2A 2BXYA 5TD4A 2Z6IA 1BPLB 3V0TA 2OODA 3T2OA 5M03A 4PGLA 3NIYA 3QC0A 3LG3A 1KLZA 4X63A 1GHRA 3KHDA 1ICSA 2OU4A 8A3HA 1NOWA 1J9YA 1UG6A 5BYWA 2UWFA 3WMSA 1X7IA 3WF0A 4S3GA 4S38A 1GOKA 5GNZA 1OABA 4IFRA 2YL9A 4Q8NA 4NAFA 3RK8A 3NSMA 4XD5A 1WOAA 1Y7VA 3TE9A 1MXDA 2YL6A 3B03A 3SAZA 4B5NA 4IMFA 2FZBA 5A8QA 2ASHA 4ORIA 3HU7A 1GWJA 5FAGA 1PS9A 1W32A 2X1TA 1UR1A 1XFBA 4E4FA 5CPTA 4UR9A 3S6TA 1YIXA 3RM9A 3R0KA 3P84A 3WK0A 1KWKA 1H7RA 3RIKA 4FO4A 3S5ZA 1KM1A 1P0EA 3Q67A 4PL1A 1Q85A 1LL4A 1CI1A 4NVTA 2V3EA 3BMWA 1DP0A 4ZGYA 5AZ1A 3RMEA 4CQDA 1BG4A 1A4LA 3G6MA 3UA4A 1DXEA 4F2TA 1VEPA 3SJNA 3EB3A 3M5XA 2WBKA 3NOEA 5FKYA 1U1HA 1YX1A 3N34A 4LNCA 5CPOA 3ARVA 5HATA 4M8UA 4JD4A 4GH3A 3QY6A 3JS3A 4PMVA 2GJPA 5DANA 3ZT7A 1VJIA 5BXPA 1T0OA 3SQLA 1QATA 3UU0A 2DZPA 2Q3RA 2AL2B 2ZRZA 3UZ5A 1WDPA 3W9ZA 3FN9A 4JR5A 3TMQA 3IRSA 3WLJA 4J3UA 4UCFA 6ENLA 1R9ZA 4JIRA 2Y5SA 4NY2A 3B05A 4HPJA 1CXLA 1UZDA 3ZJ6A 4PTNA 1EUNA 1GEQA 3BLFA 3ZLFA 2ZXBA 2BTMA 2CZ5A 3IJ7A 4IFKA 2CLHA 4QISA 4LJ3A 1F3TA 2R24A 5M17A 2J9XA 4DI8A 4Y9AA 4MWAD 1TQXA 3KCLA 3LGDA 4M6QA 1GQIA 3WDHA 5EFDA 3VK5A 4WDTA 4RR4A 1FWHC 3CHFA 5LIYX 3TR9A 1UWQA 1I60A 5IOBA 4Z42C 2ZC8A 3WD0A 2O4MA 3DG6A 4RDWA 1UWTA 1ZSXA 2BHUA 1SFTA 1M7JA 3EPMA 3BQ6A 4JZ5A 4JIQA 1KC7A 3UGRA 2VCCA 3AHZA 4XAPA 4WOQA 3UVAA 4QXIA 5DELA 4FOKA 3SUWA 4CU6A 1BVZA 1RCXB 2HJPA 3KOZA 2P8BA 3LTPA 3M0IA 3U2EA 1TWZA 4BZYA 3I7QA 1DOSA 5F2MA 1EZ2A 1O1ZA 2G97A 3M46A 3NM3A 4AMAA 3AYRA 4RXGA 4F66A 1O1HA 4JTQA 2HNEA 4HZMA 5FJPA 3EWUA 3BGGA 4CQ8A 4PODA 4GKLA 3BMXA 3OBEA 1P1MA 2AKZA 5D30A 2QAPA 3QY7A 1XICA 2P3ZA 3FVDA 3IJIA 1CNVA 2VEMA 1TV3A 3DFSA 4GCAA 3ITGA 3AFBA 2RGMA 2PTWA 3BZJA 2VEGA 5FEPA 2Y7GA 2QHAA 2QR6A 3B0XA 1YTKA 4EE9A 1HF6A 3LSBA 2VZVA 1Q66A 5AHNA 3BAWA 4HOWA 5C6MA 1W9XA 1MYRA 3AHTA 3K2GA 2FQIA 3P0XA 9XIAA 1V3JA 2E3ZA 4BI7A 3VMOA 3PJXA 2QXWA 1KM4A 4G5DA 5AHMA 2MUCA 2AL2A 3TC6A 3ZVIA 2YCIX 1POKA 1TWIA 3DHPA 3K30A 3L0KA 4AZCA 2XVPA 2ACSA 3TA9A 1MMFA 5KZMA 4GUHA 4UTLA 4DJDA 1B1YA 4CEXC 5LKYA 2GQ8A 1AZ2A 1YTDA 4HYRA 3CPGA 4WX2A 4HVXA 1IR1A 3ZR6A 1BXCA 2HS6A 5C0QA 4DAIA 3KTSA 3HQNA 3VUSA 3DESA 2VELA 1PB0A 4V2XA 3ITOA 1XRVA 3VI2A 1VFOA 1TV2A 1R3WA 1C93A 1XIIA 3QKZA 4XISA 5TF0A 3KXQA 2PDCA 3CZJA 4OTKA 3TTQA 2PTXA 4U4MA 3UZYA 5K9XA 4UC5A 3W71A 3COTA 3S2LA 1OX4B 3NR0A 1Q8AA 2V2CA 2PGRA 1JCXA 3CQKA 1P43A 4CD5A 1GNXA 1US3A 3W1AA 2BG5A 1ISXA 2PBGA 4WDUA 5I09A 3VIGA 3PNUA 3M07A 4GY0A 2J7EA 5CJ5A 1K9TA 1ZJBA 4UZSA 2XYLA 4Q22A 4YL2A 2UY5A 2CWXA 1JZ6A 1KLYA 3KWXA 4HNUA 1W3TA 2ZRYA 4KWWA 3GTHA 4D8ZA 2FGBA 5IDZA 3AMKA 2DSWA 3TQVA 1T41A 3LPPA 3LI0A 1Q6GA 3LX9A 1KM6A 1UQZA 4UWMA 3NNTA 3KOFA 5BU9A 2BVDA 3CMFA 1WZLA 3CUFA 3ZZ1A 1EHNA 1R6WA 4ZXOA 3M43A 2UBPC 3TZFA 1CCWB 1KTCA 2C1HA 3W7HA 3LBCA 5CEWA 2BY2A 3N2CA 3CZ8A 2J13A 2D0HA 1EO5A 3VD7A 3E2VA 5JH2A 3A6OA 2CXGA 4ES4A 2VDIA 3VCNA 1UBSA 2OG9A 3KTXA 4WDXA 4G9PA 4YU1A 2QMJA 1CXFA 3LDVA 4WDWA 2QCCA 4Z08A 3DC8A 1DJQA 1XBZA 3RM4A 3CWOX 1QPRA 4AZBA 5CBJA 3RRXA 4FI4A 1DVJA 4O1DA 4JYDA 1G6CA 3OYZA 7TAAA 5A2CA 3VOHA 2YYTA 1J4EA 5D03A 3MKCA 5F2IA 1G1YA 2ZRWA 4M51A 1KFWA 3MUY1 3MANA 3AXXA 1U30A 3UWQA 4LBSA 1XM3A 1QW7A 2QLYA 4AW7A 1VPXA 3R7MA 4CU8A 3GG7A 4Z2HA 1TRIA 4U2ZA 3NG3A 3T05A 1I2OA 3HQOA 1BTCA 2VMFA 4ALDA 4CVWA 1OX4A 2QCNA 3WD1A 4YVPA 3WDIA 4DYKA 4DJED 5TQLA 3VIJA 3FIGA 1UP0A 3O9NA 4EF8A 1J8VA 1MDLA 4IIDA 3CZKA 4CVUA 1E71M 4LV9A 3VIOA 5AHEA 3FGCA 3VDBA 4DUVA 1YW1A 3SY5A 4QE5A 4UQDA 3TWBA 3HBLA 1GG0A 4MGGA 3NFUA 1HFBA 5BWAA 1V0NA 1N8FA 5HJXA 1RCOB 2HNHA 4AISA 3VKBA 1M5WA 3KZSA 3TQPA 4GIYA 1YHTA 3M0YA 4PMYA 1W9BM 3WLHA 2R9RA 4W88A 3UCDA 4F4RA 4RNHA 5FJTA 4L9XA 2ISDA 3SCOA 1C9WA 1RBAA 5C8BB 3SUTA 1QOPA 3KBVA 5FL0A 1ICQA 2ZKMX 5KTLA 3W74A 1RJRA 4ZEPA 4HPHA 1JXJA 1ZHAA 4PMOA 1E3ZA 4GY7A 2ZTKA 1Y5VA 4LB4A 1XLDA 2PODA 1QR7A 1RHCA 3G5EA 2A5HA 4XZ9A 2E7FA 4KWUA 4QJ4B 5CAKA 3DIPA 3DGRA 2J88A 1TX2A 1ZCCA 2FZ9A 2B7PA 4HU0A 3CAKA 1HL2A 4MJMA 1B54A 2QJGA 3MDWA 4IPLA 3PBGA 1B0IA 3ID7A 3W7NA 1DJGA 4A8LA 4NXKA 3RO8A 4ZQPA 3CUHA 3PZUA 3FSTA 1W8SA 4HHHA 4IWWA 3VUPA 1XCXA 3AHVA 3U7BA 4ATDA 1U22A 3EOLA 3DAQA 1V08A 2CIPA 2XSAA 1CGYA 2VZSA 1Q6DA 2VC7A 1LUCB 4P8UA 1KBLA 3IRDA 4V1YA 5C55A 1VFFA 4UB9A 2Z28A 2Z1KA 4O1FA 4J3TA 1GCYA 1R0MA 2OPJA 3C2FA 2ABAA 1SJBA 1K3UA 3DZ1A 1Q6EA 3S5YA 2PDNA 4ZA0A 1P6BA 3HGRA 3T9PA 1A3HA 1A5UA 1XS2A 1DJYA 3CGTA 3AIRA 3AU2A 2Y0FA 1CGTA 4OIFA 3EGJA 2YFNA 3VNJA 3TYEA 4PSPA 2QF7A 2WMIB 4PR4A 1JCLA 1FRBA 3FEMA 5K4XA 5J5DA 4Q4RA 5LNVA 3DFOA 3WMLA 1A5BA 2IKJA 1W1VA 2PGEA 1TA3B 4XD4A 5CJMA 5D2WA 1M7XA 4B16A 2CESA 3BUVA 5ABHA 1LLWA 4F9DA 5FACA 1JDEA 4I3GA 1ONWA 1WDWA 3GYEA 1GKRA 3G8RA 1Q6FA 3P8JA 1K7XA 1JCMP 4S3KA 1O5KA 3QTPA 3O06A 1X8CA 2J27A 4A4AA 1F8IA 3A4JA 5KETA 1JQXA 5G2WA 1VYPX 3FDKA 1RA0A 1SFJA 3S5SA 4JCLA 1B3ZA 1BWKA 1QPNA 4HK6A 4EWND 1SM9A 3MSDA 4GISA 3VNKA 4ILSA 4KIEA 1I1WA 2X42A 1TUFA 1REQA 4EAMA 4ADSA 1E43A 3CT7A 2RUSA 4W8BA 2OO0A 3M0KA 5C9WA 4F0KA 4H2CA 1YE6A 1Y0EA 2Z1BA 1V93A 3EDJA 4L7ZA 1VCVA 2Z2UA 3HF3A 4DYJA 1IXOA 4JL1A 5EL1A 5HINA 4N4PA 5HJYA 2INEA 1EGVA 1XLCA 4A3HA 1MW1A 3W7JA 3W7DA 5DCDA 2WXDM 2Q8LA 3KDNA 4IGSA 2BLEA 1YNPA 3JRKA 3CK5A 1VCFA 4MKSA 4M7SA 5LSMA 1DJXA 3H6OA 4RE2A 2YXGA 1TMLA 3DN5A 4QSHA 4HK7A 3G1XA 1LUCA 3H7UA 4HU4A 3GC2A 1GW1A 2QNEA 4R3UA 2WNNA 1AJZA 3EOEA 3VGDA 3OOQA 1JPIA 2EPMX 1QU4A 2E77A 7REQA 2NQ9A 1H1NA 2A6NA 3GZAA 3VGHA 3G1FA 4X61A 2PDBA 5CZJA 3HGSA 1NDZA 5JU6A 3S5OA 2WMIA 4JTDA 3SIMA 2PDGA 2CLLA 4TV5A 2D1ZA 3A9BA 1DJZA 1AW1A 2QEZA 2R1MA 4LCRA 1W31A 2RJGA 4S3BA 3IVTA 1TA3A 5A1AA 5CC7A 1MFUA 1IV8A 5CGQA 3RITA 2A4AA 3MUXA 1VYRA 4O8AA 2ZX9A 3ITLA 3NGJA 3KOWA 1IIGA 3CTTA 4HGXA 4GJ1A 1JYWA 4HD5A 4AZ6A 4GXPA 3QPZA 3RCMA 1BWVA 1T40A 2CZVA 3UCQA 4ERGA 3F5KA 2Q6ZA 4OECA 1W1ZA 2DIEA 3R43A 2WC3A 2X0SA 5CCZA 2VKZG 4WKFA 2YLAA 1SGJA 1HL8A 3IVSA 3QH2A 4J5NA 1U1JA 4MFDA 3E3HA 2H90A 4QEEA 4AWSA 1QBAA 2VENA 1FFQA 3NSXA 2XFYA 3S46A 3GG0A 1NDVA 1B4KA 1MUMA 1T7LA 1IYXA 2W61A 3WL1A 3OVQA 1IXQA 2WJDA 3TSDA 1DE5A 1VZWA 3ZVHB 3LEPA 2VHLA 3E5PA 4W8AA 4NKCA 2OJPA 3TIMA 3W1PA 3F2BA 1VLIA 3VO0A 1DORA 4DIAA 2P0OA 4RV8A 1WDQA 3W7MA 5I5RA 1VENA 3AJ7A 4XZIA 4H6EA 1MXSA 2R14A 1UJQA 4AD3A 2ZTJA 3G1HA 4JNMA 3L23A 3LTSA 4AVOA 5D2TA 4UOJA 2GLKA 1DXFA 1QTWA 1FCBA 1H7NA 1FWNA 2YSWA 5DBTA 1RQEA 1I4NA 1SSDA 1TJ1A 1J96A 1UA3A 3VGFA 1BSLA 1VPYA 4ZOEA 1UMYA 3NZRA 2AGTA 2X8RA 3F4CA 3K8LA 4K6AA 1B5TA 2D69A 3AHYA 4XO6A 3W76A 3L65A 4TQTA 3CB8A 2VEPA 1XI3A 1H1ZA 3AMCA 5BU6A 1MNZA 3IPWA 2GJXB 3PZIA 1ITUA 2IXVA 4M1BA 1C7SA 1K8ZA 5CLTA 3L5AA 4BS0A 3EWDA 5HUPA 2OEMA 1G7VA 1F3XA 7A3HA 1QNVA 5E1QA 3HV8A 4WEVX 3P0WA 2L5HA 4DAFA 3W7CA 1RBOB 2JQXA 4LNYA 3WQVA 5D02A 3KLKA 4UQEA 4FNTA 2XH0A 4Y6GA 3MCNA 4K36A 2I14A 4PTXA 3SN0A 4M5PA 3LUTA 4O16A 3NPVA 3PBYA 3LBOA 3C0QA 4ZO9A 1HX0A 1KXQA 2GYIA 3R10A 4H7CA 4LH8A 4O18A 4QE4A 2XDFA 2NT0A 1OX6A 1OFOA 4LAOA 1BF6A 1L0PA 2DEPA 1UWSA 4DI9A 2PDJA 1FWWA 1GVOA 1XFCA 1VAHA 2VZTA 3N9SA 5H6HA 4FF5A 3OIHA 1KKOA 2C0AA 1VFTA 4B3LA 2BS9A 4NHVA 3D3FA 4FNPA 4H41A 1VB9A 4DNHA 1OIMA 5DQPA 3UWEA 3CZEA 3GAYA 2R1LA 4FNRA 1PX3A 1L9WA 4IMGA 1ZQ5A 4HA1A 2F2KA 4D6DA 4CKQA 1FXPA 1BYAA 2VNCA 2V38A 1KD0A 3KBJA 3BAXA 1I2PA 5C9RA 4DJFC 4QEHA 3QGVA 4AZ7A 3W27A 3BCJA 3RJXA 1G01A 2JIWA 3KBNA 4MADA 7PTDA 3CPUA 3QC3A 3H70A 1J18A 3TTYA 2A7RA 1FBAA 3NEVA 2C71A 3ABOA 4P8VA 4XB3A 4Y9MA 5C70A 3PB2A 4LC6A 3DX5A 3U3HA 4Z17A 3USBA 2NWSA 3GFZA 1AMKA 2O0TA 2FHFA 4O4VA 1A50A 1VHNA 4FLRA 1KGUA 1UC5A 3O16A 3SR7A 2BY1A 3AYVA 3ZS4A 3TUUA 3B9NA 1BXNA 5AFDA 1OFEA 4ZSUA 2GJXA 5H8UA 1XPGA 3PZTA 4N6EA 1YNYA 1B9ZA 3DHUA 2CLMA 5DO8A 4OBTA 5JH1A 4QLKA 1EP1A 4AC1X 4A35A 2Q09A 3QVQA 1X39A 4YJ5A 4Z0SA 5CPQA 1E1CB 1S5TA 2B4GA 2BXVA 2W5FA 3N9KA 3PFRA 3AQUA 1FQ0A 4I5RA 5AB3A 3UG3A 2BVWA 4J2PA 3WJWA 4C1NB 1LG2A 2XSBA 2RKXA 3L2IA 3Q94A 3AS3A 4LCQA 1ZFJA 5DMMA 4LVFA 1UR9A 4BQ5A 2XVNA 1TVPA 3VM7A 4CUCA 4GVGA 3QR3A 4WZHA 2BDQA 3N11A 1C8XA 5D9PA 5EKYA 4XD6A 4UTTC 4GX9A 3BANA 5HJLA 3VC5A 5G4HC 4GZEA 1EDGA 3HQPA 3UJ2A 1TR1A 9RUBA 2DW7A 1LP6A 2Z24A 3GVRA 5HQEA 1JXKA 3KL3A 2PC8A 1ZUAX 4AHPA 4ZQOA 3CYJA 4OT7A 3PBVA 3GSMA 3P2VA 4HOXA 2GJNA 4GABA 2DZTA 5BROA 7ENLA 3CNYA 1A3XA 2OVLA 3CLMA 1GYMA 4X9SA 5K2ZA 4ZE5A 1V51A 2OX4A 5C9ZA 3MWAA 3E38A 4E6MA 1UP2A 2PU1A 2W63A 4A21A 4QTGA 4GYKA 4M82A 1LLZA 1N7KA 4GGBA 4F0LA 1UUQA 4H9XA 1EC8A 1XDMA 1FWSA 5F2GA 2UZ9A 1CW2A 4WHBA 1UZHA 4QQ3A 2QDHA 2DZSA 3QSRA 1XIGA 1OCJA 3NDOA 4MZ1A 4L64A 1Z41A 5D2XA 1MDRA 4X22A 2YYUA 1O5RA 3NPXA 3R8GA 1IT7A 3R11A 2YCLA 2YCEA 2JKPA 4OUEA 4AF0B 2Q71A 5LIKX 1GTEA 4MWAC 4P8XA 2E6FA 3BQ5A 1YDNA 4LBUA 3LU2A 3VABA 5CC6A 1H2JA 3AIEA 2DSKA 4PBGA 4DM2A 5D37A 4JHOA 1ISYA 1G4PA 5CZKA 4NNCA 3JVAA 3IS4A 4ROPA 1R47A 1VR6A 4MTVA 4L6OA 1FXQA 1RLDA 4NRRA 3RAOA 4QDPA 1WBHA 2E68A 3LPOA 2EBNA 3ARPA 3UP8A 4DQWA 4DBDA 5H8PA 3A47A 5A94A 2PEVA 2JF6A 2YJQA 3AAMA 2XJ7A 4EXQA 3P5YA 3IWPA 4C1NA 1JF5A 3R5EA 2BOFX 4B5VA 4A3YA 1TZ7A 1SPQA 2Y1HA 1XGZA 2P76A 4CD6A 6REQB 4N2YA 3WQOA 2IKIA 3C2OA 2IKHA 1R7AA 2FPTA 4J3WA 3MZ2A 5G1YA 3CQ0A 5A6JA 3DFNA 3GR8A 3IJ8A 1MRAA 5E0KA 2J6VA 1G5AA 4GJIA 2EPOA 4DPPA 1XXXA 4UMAA 2EG7A 3GU9A 4NI3A 1ODUA 2OQLA 5BOEA 1JJKA 1E73M 2WNWA 1WKYA 4L4PA 3PN8A 1QRQA 4MG4A 1MQPA 1EIXA 3VIKA 1DJWA 4C6CA 1VLWA 4K68A 1XLBA 2V68A 2OT1A 5AYIA 1FWRA 1XIJA 3GG8A 5JBFA 1CLXA 2HZGA 3LCHA 2V3FA 4A3QA 3RPTA 2WHJA 4FA3A 1RPKA 3O63A 1KRAC 3R1ZA 3AROA 3UY8A 4I9TA 3RU8X 1OF6A 3PZGA 5REQB 4L6HA 1BFNA 1N2VA 2NQZA 1J0ZA 1JRCA 1O68A 4ML9A 1RP8A 2D0GA 9XIMA 1QAPA 1OD8A 3VIMA 3GXTA 3LHWA 1CWYA 3STPA 1O6IA 2XH7A 4HNLA 2CEQA 2W62A 1R3SA 3TN3A 4QS5A 2W66A 1FCQA 3DFYA 2HISA 3DC0A 3VIIA 5D8WA 1ZJHA 1MVYA 2E9MA 2YCKX 3B06A 4AF0A 1H0IA 3Q58A 1GHSA 3ANYA 1TPC1 2XH2A 4TVDA 2A7NA 5T8GA 4KWVA 1S3TC 1J5SA 2WZMA 4GRSA 5IFTA 1J0JA 4AVFA 2HCVA 4UFIA 3QHNA 4O14A 2VQUA 3GDKA 2VC9A 3PJUA 4D6JA 2PFHA 4LT9A 5CC5A 1S2AA 1DBTA 4IOTA 5I07A 3VINA 3C86A 3OGRA 3W82A 1EOKA 2P88A 3GB6A 3PS7A 3H4GA 4DBSA 3CIVA 3S6OA 3WD4A 2FMOA 1KM0A 2WMJA 4JX6A 2ZZ5A 5I3KA 2OOFA 3MCOA 2WAGA 3WLSA 2C16A 5G4EA 3FJNA 2V30A 4Z1AA 3EDFA 1E3XA 3WQ5A 1E51A 3ICJA 3N2XA 2FVMA 3FXYA 2I56A 2Z2AA 3QMRA 2CLIA 5FD0A 1QFEA 4GG9A 2ZADA 5BOFA 3LK6A 4IGMA 4KEVA 3OU8A 1R86A 3MO4A 5C9XA 2DQWA 1V3HA 2GQ3A 3H2MA 2O9RA 2OCZA 3G77A 3TJLA 3CS2A 5K3VA 1LRTA 4H04A 3IJDA 4G2DA 2W9MA 3BAKA 1SZGA 4WOZA 3C5QA 1M7OA 1R46A 3A23A 1WZKA 2JBMA 2Z7GA 4HZ7A 1F7BA 4LUJA 4KCUA 3HB9A 3L5LA 3TFXA 4D6HA 3N2BA 1TPDA 4JNYA 3PZOA 2JKEA 1F74A 2YR1A 4LYPA 3W7QA 4Y7EA 2QVHA 1W3LA 4QX4A 2XUCA 1I45A 1FKXA 2FKPA 1XC4A 3S9IA 4Y8EA 2WWCA 4L80A 2ZIDA 2WPBA 1UB3A 1L2UA 2QGYA 4AXNA 4PN2A 4UNKA 2QUMA 4K38A 4GUJA 5EY5A 3IAQA 1Q7ZA 3PSWA 4HKPA 3W1MA 1UQYA 2A3AA 2E6YA 4NZCA 4XKMA 1ITQA 5RUBA 1JZ7A 1B3OA 2FVLA 2VFHA 1CGUA 5HNTA 3O0KA 4NF7A 5H2ZA 5KINA 4OOUA 2X1UA 3VZYA 2XSXA 4HSHA 3M0LA 2FTYA 4DJEC 3CO4A 3LA4A 4AHOA 4YTUA 1UOKA 4LALA 5C2GA 3BLDA 4XTIA 1Z89A 6A3HA 4YS1A 4YYFA 1JCJA 1R38A 3ALFA 4AWEA 3O07A 4KETA 4QS6A 1MO0A 3SEPA 1EJUC 2DJXA 4PULA 2VFEA 4ORMA 3KAOA 3UGVA 1VFMA 1SO3A 1Z44A 2J47A 4DXVA 2OTDA 4C6KA 4O0QA 2QJJA 5FIPA 3INPA 8TIMA 5FJUA 4LEQA 3AXMA 3NQ8A 2WVSA 1TIMA 5I3FA 4L6DA 3ZM8A 1VEMA 1HL9A 4WY0F 1TVNA 3BOLA 4AZGA 3CAQA 3SUVA 3PBMA 1HXJA 2UY4A 1YXYA 3GVWA 3NWRA 3L5MA 3NZPA 1CECA 3HJZA 1X1NA 4ADUA 4D8LA 5FEZA 1Z32X 3P60A 4ZL1A 4NP7A 3P61A 1Z3NA 3ABSA 1PHWA 4GK8A 3IIZA 3G6LA 3TYCA 2WSYA 2WCGA 2IXUA 3BWWA 3P8IA 4ENLA 1VBRA 4WVXA 4LANA 2OKOA 4MLRA 3PTQA 3SQSA 4QG8A 3GD6A 3DDMA 3B9OA 3CHDA 1ENUA 3W7KA 5GJMA 1ADOA 1HTIA 1E0VA 1QASA 2V3DA 3YPIA 2VUNA 3R12A 3GH5A 4QR6A 1J11A 4G6CA 1W8GA 4NJIA 2DUXA 3M5ZA 3VE9A 3W1QA 4AD0A 2QCLA 4NASA 2J74A 4ROQA 3W29A 1TCMA 4GVFA 3GNXA 4WR3A 4DJFA 3IAPA 3UWVA 2PDMA 2HXTA 4IGHA 3K4WA 4AEOA 1MEHA 4OOZA 1BKHA 2CLOA 1E6ZA 4MWAB 3ES7A 2WBGA 1DWIM 1TE6A 1XDJA 4BF7A 2V9DA 2BGQA 3MV11 3GIYA 3U6WA 2DY3A 1V79A 3KFTA 2ZE0A 1AODA 3RGTA 3PB0A 2G95A 3ZT6A 7CGTA 4KFPA 1GZGA 2HDJA 4MJZA 2ZUSA 4ZQNA 3U2OA 1H7PA 2WZIA 1K9EA 3QPEA 1W1A1 3A5FA 1HKJA 2C8NA 2DSUA 1E4IA 3LM7A 1E5JA 4HMEA 3BOFA 4I7WA 2HVMA 4GNVA 1UH2A 2OWWA 4ZTXA 3LQGA 1RJPA 4G8TA 2V69A 1XX1A 3MJMA 1QNPA 3WNMA 2QJIA 4OBSA 4UTUA 3TU9A 1ELSA 4O12A 2VRKA 3L4UA 4GBUA 1UIOA 2G0WA 1LDCA 3WQWA 3VVGA 3WH5A 3F4WA 2I9EA 5EA9A 3VPLA 1V6UA 3DBPA 3SRHA 2ZRXA 4C6IA 4DVOA 3QFEA 4UTTA 1TIWA 4QG9A 1AA1B 4G7FA 2NQ5A 4Y90A 3DXIA 4N9EA 2FTPA 4O28A 3W2KA 4CQAA 3DBNA 1UOZA 4KS0A 5AYBA 4GIAA 2WV8A 3GK0A 4IMDA 2QIIA 1J2BA 4HU8A 4LV4A 1FWBC 1EH9A 4KEZA 3L4YA 3MP5A 4ZB2A 1C8VA 1ZP4A 2ZQ0A 2WHMA 4RDVA 4LPCA 3PZQA 3MUIA 3WLOA 5ABFB 3U5YA 4HIBA 2WC4A 4P7NA 3VE7A 1WKDA 4A3UA 3CL7A 4RNJA 3MMWA 4Y9PA 1P0DA 2YBUA 4DZHA 3DGBA 1EYWA 2PCEA 2G3FA 1ICPA 1SJCA 1BYBA 2XN2A 4XAGA 4K39A 2ZA1A 4NRSA 4P8WA 4RX0A 4JIPA 3QZAA 5E9XA 2DH3A 1E0TA 1W5PA 1ZBKA 2XINA 4MB3A 5A2BA 3VD3A 1LQ0A 3EWCA 3UR8A 3MKKA 2ACQA 1MW3A 2X30A 2V82A 3FK4A 5E70A 3LHYA 1C90A 1VYSX 3MTWA 2XVKA 4O19A 1UWIA 3UJRA 2IPJA 1KBIA 3RPMA 4A8IA 4XD3A 4BQ3A 3WLQA 4OHQA 2HK1A 3LHTA 1P6CA 2A0NA 1X96A 3DFTA 3WBYA 3GYCA 1M53A 3W1TA 4I7UA 3SRDA 1Z6KA 4PUKA 1KCKA 4MFEA 3KL0A 1H0GA 3S9ZA 5EMUA 1TJ2A 4F40A 2R82A 4K37A 4HPGA 5U7SA 1M9HA 5XIMA 2J66A 1KFEA 4HHPA 2PRMA 3KOXA 1TTIA 4ASTA 2OZ3A 1FVPA 2EXOA 4WK9A 2ON3A 2XIIA 2VCAA 3Q2DA 5I23A 1B9BA 1CB2A 1S46A 3UXAA 3PHAA 1UPPA 1RD6A 1UD2A 3TK7A 6ALDA 3KHJA 3I68A 3PANA 5I00A 3V75A 1ESWA 5E5CA 1H3GA 1TX0A 4LAKA 3MU7A 2PAJA 1UR0A 1C7TA 3ZYZA 1XYMA 1GUVA 4QJ1A 4AC7C 1OFQA 1W2VA 3FHAA 3WK1A 5F4WA 4ZENA 3WF2A 1BVNP 3CAWA 3HGJA 1EQCA 2Y5JA 3ME3A 2VYOA 4MY9A 3W1UA 2J25A 4JN6A 1TYGA 1V6VA 1M04A 4FNQA 3W7EA 3CUGA 3W1XA 5ABFA 1SW3A 3VC6A 1H4PA 1DJHA 3I6EA 2G3JA 1E55A 1TMHA 3ANVA 5I3JA 2CHNA 3O6DA 1UD8A 1UD4A 3CL6A 1KV5A 1EDTA 4B15A 4IQJA 2XTKA 3VTRA 1CLVA 3R6IA 4IPNB 2DSVA 4RNIA 4H6RA 1QO5A 1LM1A 1QI0A 2BP1A 3HFYA 4WSKA 2CKSA 1WDDA 4YN5A 2CBVA 3AYSA 3T55A 3MO7A 3PAOA 4IPJA 2ZUNA 4ECLA 3FYYA 2A85A 3AHXA 1EF3A 3ARSA 2YXXA 4GACA 2FMNA 4XZNX 5I79A 1KCLA 5E9AA 5U4NA 4O0KA 1YQ2A 3UF9A 3P81A 1OT1A 3W7GA 1ZAJA 4GLEA 1JD9A 5CBBA 4JNZA 4U5IA 3UYIA 5HQMA 4YCPA 1SMAA 2JF7A 4EPBC 2W91A 3E6EA 5DX7A 2JFEX 5K7JA 5FCZA 3SRFA 3UW6A 3G1VA 4F79A 2DJLA 4S1FA 4Z2IA 2FYMA 4DYEA 4IM4A 1XKJA 2YDRA 4TX9A 1W54A 1PBGA 4G7EB 4PEEA 4BHYA 1GQNA 5AHIA 3NQEA 3GUWA 3P6LA 3B9DA 1QWKA 5DT5A 3ENLA 2GGJA 1GOQA 3E1F1 4DO7A 3L2MA 3QXBA 4YTQA 2XVGA 4XO7A 1Q63A 3W84A 1OFBA 1ZBWA 4KCVA 2E0PA 5FI8A 3V16A 1PZ2A 3BXWA 2J8TA 2QCFA 2J6XA 5HA7A 1N55A 2EHHA 5MKGB 3IK2A 3CL8A 1L6FA 1VPQA 4Q4MA 3MUAA 3K1DA 2PGFA 1RQHA 5CZSA 5I7GA 3STGA 1FOBA 2CKRA 3NQ6A 4Y2WA 1W1PA 1JPMA 4K8GA 3SECA 3GDRA 2YCJA 2BVYA 4KRUA 3R8RA 2VFFA 3SSJA 1CIUA 4HMDA 2XPKA 4MSSA 1AH3A 1LT8A 4IG2B 4DY1A 1Q4WA 3TH6A 4LOCA 4KEUA 3UG5A 3IUIA 4H7ZA 1IZCA 7XIMA 2WQDA 1QPQA 3E0VA 3PUEA 3OEXA 3CUJA 2CLPA 3SCTA 1IQ8A 4NILA 4X9YA 4LY8A 3EDEA 3TTEA 2PTDA 1TMQA 2D2JA 3CWHA 1TPFA 3TNBA 4K8HA 2CHRA 4F48A 3C0JA 3WQCA 1O60A 3VIPA 1NOFA 2HXUA 2WM0A 1RA5A 2E8YA 3TW6A 3TX9A 3O6YX 1PZ0A 1SVDA 5DT7A 2X7VA 5AC8A 3STEA 1B57A 4ZO7A 3EOUA 1VBGA 4DJEA 4WD0A 1NQKA 4LVBA 3LYEA 5D04C 1Q2SA 2PMQA 1EXBA 4V27A 4HHLA 3MJYA 3HM7A 4A8NA 4WY0B 4D71A 3LZ5A 5HUOA 4G7EA 3R13A 2YA0A 1ZZMA 3M7WA 8RUCA 5LGXA 1TPUA 3GH7A 2VFGA 3HA1A 4GOAA 4HP5A 3M16A 2I16A 1D3GA 3BARA 1W1TA 3L4XA 4XG1A 4ZB5A 4JTFA 3AZTA 1H63A 4H01A 1KW1A 2V63A 5FF3A 4NQ1A 1WX0A 1JUKA 1YXCA 4HYVA 4D2JA 1EL3A 3APYA 5MKGA 1E6NA 3W2MA 3T81A 3V1PA 3GW3A 1GJWA 4L5ZA 1R9YA 2VURA 3A4AA 3V5OA 1FTXA 4XK2A 1E9ZB 2DFAA 4US5D 3HMJG 4DUOA 3QBUA 1S39A 3W88A 1VBHA 1JI2A 1G69A 3CBWA 4GCXA 3H4WA 2WPGA 3FLUA 1E9YB 1QI2A 3SB0A 1VP5A 4QITA 3TR2A 4IG2A 3G1RA 1V3IA 1VFHA 5FF7A 4Z2JA 3TLLA 4MB5A 1G4TA 3R79A 5BWFA 4J4KA 5JQ9A 3Q45A 2WMFA 1I6NA 2BODX 3UBPC 4JTJA 4M0XA 1ZY9A 3N4EA 3KBMA 1OEPA 1T96A 1O4UA 3GXPA 1US2A 2VR5A 4XIAA 3GXMA 4P7RA 4XBJA 4MNMA 4PFHA 5A6BD 1GKQA 3N4AA 3HN3A 1SW7A 5DY2A 3MYOA 4WJ8A 2MNRA 1NIUA 5BCAA 2EO7A 4U3CA 3FY1A 1ALDA 4TIMA 1XC6A 4L9ZA 3WLIA 3R89A 1F6PA 1QVBA 3QPYA 3PTMA 4FXFA 3TVAA 4D72A 4Q4OA 3CWNA 4E38A 5C54A 1HKIA 1FWJC 4HPXA 3S5NA 3PZMA 2HPMA 4DWDA 3AIBA 4WY0A 4F0MA 5HXMA 3ABZA 1DWGM 1PDYA 2D3LA 4NNBA 4EP8C 3T2QA 2G4FA 3SGGA 1JYVA 3FA3A 4WKAA 2GGHA 5GNYA 3EWYA 1XP3A 5DEZA 2XGZA 2Z0IA 2Q8XA 4BF9A 1GYNA 3OQEA 4L1GA 3S6DA 3ARXA 3WO8A 1W3NA 1LWJA 3L9CA 3SUUA 3GHUA 4D6CA 2JE8A 2BFGA 1IEIA 2OYLA 3P67A 4V33A 4PEKA 3NQGA 4GWEA 2FZMA 4LFYA 4LVAA 2YDQA 4CD4A 1S5VA 3K1GA 4GE8A 4RE4A 3K8KA 3LXBA 3C0SA 2R94A 2VGGA 3BG3A 1LOSA 2QPUA 1NY1A 4OQVA 4NJJA 3BGJA 4RV3A 4TX8A 5ECVA 2W67A 1PE1A 1PTAA 2F61A 2XIOA 3UWUA 2GDVA 3CO8A 1Q3NA 1VF8A 3ZR4A 3CM4A 4UFKA 1B31A 1WXYA 2BBFA 4G1NA 1I75A 1W0MA 5KITA 1NF7A 1UROA 3NVDA 1W1IE 2GDUA 3RM8A 2WW5A 2E5CA 3VZXA 4ZOAA 2I5IA 1KM2A 2F6XA 5GPRA 1N8IA 3LERA 3NDYA 3VKCA 1KA9F 1EEXA 3GNRA 5A8MA 3QZ6A 3MMTA 1R9XA 2QZRA 3GKFA 1ZPTA 4L1WA 2W3ZA 5ABTA 2YFOA 3T0DA 1CB7B 4B9YA 3WK2A 2V2DA 3W85A 1IXPA 3GZ3A 4W5UA 5LYRA 4H2HA 4CNUA 1YDVA 3WQPA 2TMDA 1WOBA 1DJNA 3UZXA 4AWTA 5J5RA 1W5OA 3E9AA 1BHGA 1XSJA 3OG3A 2RDUA 2PTZA 2OZTA 2C15A 1X1OA 1O5QA 2VT0A 4LUYA 3MVIA 5HWNA 3G3DA 4AY8A 3WUEA 4IZGA 3N6QA 4PUWA 4ZOCA 2PE4A 3KRBA 1XL9A 3ZWSA 1C8YA 4ZR8A 2WSKA 4PUMA 4PCTA 2ESCA 3KS5A 1W6TA 4JKLA 4XWUA 3QGAC 3TAKA 3L4VA 1JDDA 4NAFB 2GSHA 2WJZA 3AMDA 4BEUA 4IL2A 5DCEA 4XX6A 5J8LA 1QOQA 4JOMA 2C18A 2RH9A 4ZTYA 3LI1A 2Z6JA 2V5LA 1IT8A 4ZOBA 3NQBA 4M6UA 3F2CA 3P3BA 1RV8A 1Q4NX 3M0MA 4FS9A 1MSSA 3IUHA 3WQ6A 4LUIA 5B7ZA 4GBDA 3VXGA 3S4TA 2I5GA 3UXDA 3J7HA 1JFHA 4GUIA 2QIWA 3MHGA 1RXOB 2HPIA 1LZOA 2WHKA 4Z2KA 3T40A 1QWGA 2QCMA 1B2YA 1E1EA 3FXGA 2X0HA 5HPOA 4FXSA 1Q7MA 4LEFA 4H9ZA 1QNQA 1VJZA 4PTDA 1IWBA 4XZHA 1UW9A 4WXZA 3TDFA 4N42A 3W53A 3HPAA 2RDXA 4S39A 3MMDA 2PWUA 2F2HA 2PS2A 1XBYA 3TTOA 1UWUA 1XCWA 2HWGA 1OK4A 1QT1A 1RUSA 2XIMA 4B91A 1OHLA 1JF6A 1UKPA 4S3EA 5E6ZA 3GHTA 4S23A 4TTGA 4MAVA 4J1OA 4IJCA 4ACYA 3MHFA 4JIHA 4FLSA 4JIEA 4UOZA 2VEFA 3PPHA 1MEWA 2J62A 2PBOA 4XUYA 4K1WA 3OTRA 3POCA 2C14A 4IMEA 4H3DA 4N9CA 2GUYA 1J93A 1B4EA 1O7AA 1FH8A 1PX4A 1DQWA 3E2QA 2V81A 3IIPA 4ZFMA 5DXYA 4C90A 2XH4A 1TQJA 2NUWA 4PCFA 3SCNA 2GGIA 3NZ1A 4BA0A 4DO4A 4ONVA 3F5LA 4PRWA 3OVRA 1D7KA 1IR2A 2CC0A 3IGHX 3OJGA 3EBVA 4EVZA 3W00A 3UERA 5MHBA 1S38A 1FHDA 2Q02A 3BGAA 1ISVA 2PWGA 2F8QA 3EPNA 3VKJA 1OBAA 3T7VA 4KBXA 3WBEA 2OSWA 2CLKA 1XUUA 1OG6A 5K4ZA 4O1BA 1V02E 2OMAA 4E8CA 2VOMA 3TA6A 1E6XM 4Q8UA 1ZJIA 3MA8A 4HNNA 1Z69A 2F38A 5CH9A 2FPVA 3QHMA 2X1RA 1SSGA 3D5HA 4UXDA 4I9JA 4DN1A 2W4XA 7TIMA 1W9PA 2VX7A 2OLHA 1JUBA 1X1ZA 4WUIA 4IH3A 3CHCA 4MJ4A 1XLFA 3CIXA 3H26A 2F9RA 2Y5EA 1HN1A 3E49A 5LA1A 3GH4A 3EDDA 3NZGA 1QI4A 4B5UA 4V15A 5FAJA 1Z9AA 4LX4A 4XTDA 1LYXA 2I1OA 1P48A 2WMHA 3GR4A 1V6XA 5F4SA 4NT0A 4RZ5A 1AFSA 2HE8A 3OW1A 3R0DA 2QCDB 1LOQA 3H2AA 4LYKA 2ZX8A 2Y6ZA 3L12A 3FAWA 3DYOA 1K8YA 4O0ZA 1FHLA 4FHAA 4UFJA 4GO8A 2QDDA 2EJ1A 3V0UA 4AZCB 3NGFA 3OO2A 1A49A 1J6OA 1LWHA 3KRZA 2J7BA 1HP5A 1C92A 2EPKX 3RILA 2Z4GA 4JFSA 1CT5A 2BASA 4V28A 4GX8A 4ZE4A 4RUBA 5AVHA 1F4AA 2ANUA 3L4TA 3W38A 1KXTA 3E5BA 3TZNA 3QW4B 4IQDA 4PCPA 3P62A 1BGGA 3SM0A 3UG8A 3DYMA 3GDBA 5D2YA 1OG0A 1TELA 1IWAA 2YPIA 2QCGA 1IZJA 4MM1A 4GYPC 4QM1A 4XV0A 4PTMA 1W1YA 1AJ2A 4LYRA 4ZMGA 1TTPA 1WE5A 3RU6A 3LMYA 2V5BA 4GI9A 2GK1B 4C7FA 4N0RA 3FKKA 4I8YA 2Y2WA 4QLLA 3N15A 3TQ0A 1ISWA 1P5BA 1XYLA 2V3GA 3CAVA 3GWQA 3SDOA 1K9FA 3C61A 2VDHA 4TO8A 1IEXA 1DHKA 3FJ4A 2NXHA 1JZ8A 1UZ4A 3B0YA 4JEJA 2E9BA 1ME9A 3WDJA 4RPPA 1FDZA 3G18A 2ISFA 1DIKA 3AC0A 2EF9A 4RJEA 1YYAA 1KKRA 5L9FA 4UTHA 1GORA 1H60A 1DL3A 1FWAC 5FSDC 2J7HA 4MHBA 5G1MA 3E12A 1OYBA 1CLKA 2MANA 3GHSA 5EMMA 4FR6A 2ZUWA 3KW3A 3I4KA 4JTSA 2YA1A 4GI4A 4EPDC 3A21A 2IMRA 3UJFA 2QCDA 1FUYA 1TJPA 4C1KA 4YNGA 4TV6A 4JY9A 5AECA 2P1FA 5D33A 2VO5A 1RAKA 1OZQA 1AVAA 1H62A 3ZJ8A 1E0XA 4YTTA 3W01A 2Y7DA 3FJLA 1JUEA 1CEOA 1XSIA 3CHEA 4MZYA 4O52A 3NQCA 3OLIA 2IW0A 3LHZA 3VDCA 1ONEA 1UH4A 3KVLA 3E74A 3EWXA 5FF2A 3ONBA 1U1UA 1HIZA 1Q7QA 4MAZA 3N25A 4BFAA 3JZEA 1FCUA 3W6MA 3S42A 2C1IA 3P7YA 2Y61A 3SCSA 1FCVA 4QROA 3W7RA 3W23A 3IJ6A 3HURA 4DWSD 1BQGA 1XWYA 4XVEA 1PYFA 2CERA 1BGAA 3TYZA 1HJXA 3WL0A 4AFYA 5EU9A 5LGZA 2WSPA 3ABRA 3W7PA 1FHUA 1XLKA 3R58A 4XBSA 2Z1WA 3STCA 4M29A 1CXHA 2I57A 2D23A 4MB1A 4POCA 2GK1A 3T4CA 1DJIA 1EIBA 4IP5A 1UKOA 4I9AA 3EXSA 3SJ3A 4PSRA 3A12A 5I3IA 1KRCC 1SW0A 2SFPA 3JR2A 4A6GA 3BAIA 4QRNA 4NL1A 1JZ4A 4AX6A 3SI9A 3VOFA 4C6JA 3FGCB 4AG0A 2PWVA 1CGVA 3A4XA 3B0VC 3VNIA 1NEYA 1VRDA 3NQVA 2ZZ4A 3EDKA 1LRNA 4KWSA 4RLIA 3VOGA 4CNPA 3HPSA 1PKNA 4FOJA 3F2DA 1JR1A 3WH9A 4A3RA 3GDLA 2DT2A 1PKLA 3M0HA 4ZODA 3CMGA 4R7OA 2X16A 3URNA 1Q6LA 1TE1A 4YXGA 3HQ1A 3DYPA 1DYSA 1S5NA 4QAWA 3H2FA 5A69A 3BLLA 4W9TA 3PTDA 2GUBA 4HN4A 3V5FA 4JN7A 1E56A 3WMCA 5E0CA 1I8JA 1UKTA 1BEUA 3CASA 3FEQA 3GR7A 2BNJA 2WZHA 4PA8A 2H3BA 1KQZA 3GNOA 4C5ZA 3NO1A 1EF2A 1NDYA 1U5JA 1XRTA 2J4GA 1R3YA 5H91A 4W84A 2AMXA 3RLUA 3BLEA 1KCXA 1J2WA 1VQTA 4QDMA 5AC7A 3S3GA 4I5XA 1NJJA 4NZJA 4OZOA 2YBTA 1TSIA 2VOTA 2H6RA 1VD6A 2OB3A 3OVGA 2I7GA 4QGCA 3U5UA 2GQAA 2NVCA 1E4NA 3SGUA 3LXCA 4JAWA 3PC0A 1QJWA 2KAUC 3THAA 4PYSA 3DOPA 3UXIA 1EOMA 1E6RA 2RHGA 4BF5A 5FEXA 3OLGA 3VKKA 1UR3M 3KBSA 5AYYA 3SIZA 1QCWA 4GPNA 4N6FA 4QSFA 1K7EA 1XF0A 3H55A 4Y96A 4E8DA 1Y5WA 1THFD 6TIMA 2J9YA 4REQA 5D8ZA 5CPSA 1TWWA 3CV7A 3QOKA 1S1RA 3CUXA 2XWDA 3DERA 2RDWA 5BW6A 1AH0A 1K4GA 1SFLA 2PCQA 4B2DD 3Q37A 4CNSA 3L67A 4YIWA 3DENA 1J01A 5LNWA 4EPKA 4LVDA 2ODOA 2CYGA 2XM2A 3MCMA 1EX5A 1KFJA 1H41A 1IHIA 1EQPA 1EP2A 1DKWA 4MY8A 2NV1A 2Q3OA 5CLWA 3H24A 1ZLPA 4PBEA 3ITYA 3WUFA 3H2NA 1QPKA 2VUYA 1ZP3A 1WKEA 1M01A 3PFMA 1ECQA 4R7JA 4AQLA 1G94A 1REQB 4QE1A 3I6TA 3ITCA 1CYGA 3AUOA 4HU3A 4FEZA 5C2CA 5C7VA 2G96A 1GVYA 4O53A 2PDXA 3FX4A 1HKVA 2VDGA 4JTRA 4WCJA 2G5WA 2NZLA 1WKFA 2AAMA 4QQUA 2Z25A 5CPMA 5F1UA 4NNAA 2FDSA 2OR2A 1EPVA 2ISVA 4IGNA 1CZ1A 1PJ9A 3CEPA 1V7YA 4HNVA 4JTAA 5DMLA 2E1WA 2GZXA 1MQRA 1QHPA 4S3FA 1XHGA 2FB2A 3D47A 1UZ1A 4AZHA 3W3OA 1DIOA 3WH7A 1W3KA 3H8AA 3TYBA 2BOEX 1BYCA 2ADAA 3PPCA 4S3AA 1UUOA 3NUKA 2OGJA 4C6QA 4EAYA 1BQCA 2OYKA 4O50A 3KUMA 3VFCA 2WNZA 3IJLA 1UH3A 3TW7A 1TG7A 1ITCA 3WCZA 2PF8A 4AZ5A 3WF4A 3CU2A 3LNPA 3SCUA