4LUSA

Alanine racemase [clostridium difficile 630]
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
382
structure length
360
Chain Sequence
KITVPTWAEINLDNLRFNLNNIKNLLEEDIKICGVIADAYGHGAVEVAKLLEKEKVDYLAVARTAEGIELRQNGITLPILNLGYTPDEAFEDSIKNKITMTVYSLETAQKINEIAKSLGEKACVHVIDSGMTRIGFQPNEESVQEIIELNKLEYIDLEGMFTHFATADEVSKEYTYKQANNYKFMSDKLDEAGVKIAIKHVSNSAAIMDCPDLRLNMVRAGIILYGHYPSDDVFKDRLELRPAMKLKSKIGHIKTIATVPIGYADGFTRIQKNPKVLIKGEVFDVVGRICMDQIMVRIDKDIDIKVGDEVILFGEGEVTAERIAKDLGTINYEVLCMISRRVDRVYMENNELVQINSYLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine racemase
publication title Structural and biochemical analyses of alanine racemase from the multidrug-resistant Clostridium difficile strain 630.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Isomerase
total genus 125
structure length 360
sequence length 382
chains with identical sequence C, D
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 4lusA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 4lusA02
2YXXA 3B8TA 3BTNA 1NJJA 4FS9A 5FACA 1HKVA 3ANVA 1XQKA 2NVAA 3GWQA 4PB3A 1VFTA 3SY1A 2P3EA 2VD9A 4V15A 4LUTB 2PLJA 1L6GA 2J66A 1BD0A 1NIUA 4BF5A 1KNWA 1CT5A 1B54A 3B8UA 3N29A 1TWIA 4A3QA 5FAGA 1L6FA 3LLXA 4LUTA 4ECLA 2QGHA 5GJMA 3R79A 4WR3A 5FAJA 1W8GA 3NZPA 3HA1A 7ODCA 3CO8A 2OO0A 4ILSA 3MT1A 5GJNA 1D7KA 4BEUA 4KBXA 4QHRA 3WQCA 3B8VA 2DY3A 1KO0A 1VFHA 2O0TA 1SZRA 4BEQA 3KW3A 3UW6A 2NV9A 3VABA 3CPGA 3AWOA 1XFCA 4DYJA 3E5PA 4XBJA 2ODOA 3N2OA 3WQGA 3B8WA 1XQLA 3OO2A 1QU4A 3HURA 2VD8A 3WQEA 3NZQA 1EPVA 3WQFA 1TUFA 4BHYA 4LUSB 4ZGYA 5BWAA 5IRPA 2TODA 4LUYA 3WQDA 1VFSA 2RJGA 2ON3A 1HKWA 2PLKA 4Y2WA 1RCQA 4DZAA 4PB5A 4LUSA 5GJPA 3ANUA 3N2BA 3C5QA 3S46A 4PB4A 3AWNA 1SFTA 2SFPA 4AIBA 1FTXA 1F3TA 2RJHA 4XG1A 3E6EA
chains in the Genus database with same CATH superfamily
5HJXA 3WK0A 1GKQA 1GVQA 5AFDA 2WSPA 1RBAA 3VMOA 1QPRA 2PU1A 5J04A 2NT1A 3W7EA 1GOKA 3E2RA 4WSJA 2QZRA 2VMFA 3DH7A 3EOLA 4FXSA 4ZODA 2WBKA 1U1JA 3RJXA 5HWMA 3PM6A 3DFHA 4LAZA 4AHQA 2J8TA 1UP2A 2O9TA 3GR8A 3GH4A 3ZFHA 3TYAA 3S2CA 1PV8A 2A3AA 4F8XA 4UUIA 5DRCA 3CV1A 2NQ5A 1ZBCA 2VNCA 2VRJA 3P2VA 2PDCA 3BLOA 1XYCA 1UKQA 2QPSA 1POJA 1H49A 1O60A 1BKHA 1D3GA 1FCQA 4R5EA 1L2UA 4QM1A 4G7EA 3HTWA 2GQ9A 2Y63A 1I9CB 3WBXA 1GQKA 1TVLA 4HIBA 1V3JA 4LEQA 1WKDA 1FBAA 3MV11 4NP7A 4FXFA 2CLKA 1AQMA 2IPWA 2YXOA 1VPYA 3BICA 2C1HA 1OY0A 2BBFA 1QRQA 4CGTA 2PDFA 3VOIA 1ZU8A 3BCDA 4H3DA 5DANA 3N2BA 5RUBA 3NQMA 4ZCWA 5A8QA 5K9XA 4DJFA 4DI9A 3ABZA 3XIMA 3SAZA 3NO5A 1W6TA 2QHAA 3OG2A 5JU6A 2BMBA 3V0TA 1XIFA 1F76A 1YDNA 4W8BA 1K3UA 1VRXA 4WEVX 3F03K 3O1NA 4UFMA 3AIEA 1DWIM 4KESA 1TJ1A 2NXGA 4MY8A 3CASA 1GJUA 2NSOA 4HOXA 1XCFA 3IGXA 3QMTA 1NOFA 1SU5A 4XD5A 3QJAA 4MWAB 1TKKA 3W38A 3NSMA 4WOZA 2WM1A 3MCNA 3BAIA 3HA1A 3CO8A 2OOFA 1A53A 4OWGA 1TA3A 4X9SA 1GK8A 4V1XA 4MNKA 4HHPA 3VUSA 2Y0FA 4UTHA 4D6EA 1Q6OA 1OCJA 1BSIA 3AWOA 1LQ2A 4GVHA 3MZ2A 3BOFA 1GVRA 2YLLA 4K6AA 1L2QA 3UERA 3W00A 2J24A 1CGWA 3ZT5A 3WN6A 3APGA 3S5ZA 2W4XA 5LHFA 3NSNA 2Z2UA 1I60A 3ABXA 3WQ5A 5I2UA 1W17A 1A80A 3SIZA 3VIOA 4J2PA 1X1NA 2IKJA 4HA1A 2JGYA 5F1VA 2Y8KA 3EXTA 1Z48A 3QTGA 5F1UA 1JPDX 3RAOA 3T4WA 1HJWA 3MYPA 3RRXA 1J12A 3M7SA 1DTUA 4WOQA 3UJ2A 2XFRA 1A3XA 4XKYB 3BLPX 3AZSA 1A0CA 3P3BA 3EWCA 2A5HA 5G4HC 1BWKA 2GFTA 2PDGA 2IPGA 3H23A 3ME3A 3GC2A 5D38A 1FH9A 3XINA 5AHMA 1W9VA 1C9WA 2QCDA 3WD1A 4X22A 4ZO9A 3E0LA 3BMWA 4CNOA 3BQ5A 2HXTA 3II1A 3W7NA 2Y61A 4KFNA 3KBSA 4RDWA 1OG0A 5BU9A 3HG5A 3GXNA 4KMQA 4RX0A 3QEZA 2WVSA 6A3HA 2Y7FA 1W5MA 1E5NA 5CLWA 4DYJA 3P14A 2YBUA 1JF5A 1GHRA 1GOIA 2GOUA 4DJFC 1EEPA 2ZCGA 4C6MA 3W2LA 3NO3A 1F3XA 1LBMA 2TAAA 2ZC8A 1UP0A 3RYSA 1NFGA 3MTWA 1V6YA 2YPIA 1KTNA 3AZTA 2WJZA 2D0FA 4MAVA 2FH8A 1W37A 5D09A 3RPTA 1A5OC 3FW6A 1CTNA 2E5CA 5F4SA 3S42A 2CBIA 1TSIA 3W6YA 3CUZA 3TAKA 1B0IA 2YA1A 1V5XA 3I6RA 1P0NA 4B91A 3ARXA 1A5KC 3UZXA 3GU2A 1QHOA 4Y96A 3H2OA 4L4LA 1F07A 2OYKA 3WDHA 4O1BA 4QDWA 2DEPA 3IAPA 2EPLX 1OEPA 1LBFA 4W89A 3UBPC 1H7XA 1GTEA 5FAJA 4DELA 2JIWA 2DJLA 3PTQA 3SGUA 4QAWA 1PDZA 3CHVA 1OX6A 3RMEA 2VGGA 1QOQA 3B0XA 1F4HA 3A4AA 5DELA 1RJRA 3E9AA 1GPWA 4G6CA 2CNCA 5CG0A 4E8GA 1NARA 4WDUA 5ENLA 3L2MA 3QR3A 5LYRA 3FCPA 1KBBA 3WQ4A 3MS8A 1XLLA 1EOMA 1GOXA 4FSAA 3LG3A 3CM4A 1XH0A 5EBUA 3O7UA 5HDRA 2DSVA 3TROA 2X1TA 2W9MA 1LJYA 3A47A 4QITA 1HT6A 1MZRA 4QE5A 1OFAA 3VAVA 3PB0A 3ZVHB 3Q45A 2VGFA 3KOYA 2DW7A 3GAYA 4UOJA 1TV4A 1VQTA 2DJXA 2XGBA 4IP4A 3I3BA 4C1NA 5BRBA 3C0QA 4OOZA 4XK2A 4C6FA 3G1YA 5HWJA 1S3TC 1C8YA 2PRHA 3KL5A 2FFIA 2X7VA 3EA2A 4LUIA 4UTKA 1LDCA 4FP1A 4FS9A 1P4CA 1UIPA 6ALDA 2BVYA 3CS2A 2A3HA 1M1BA 5F4XA 4O1CA 2RAGA 1GONA 2OVLA 1HKJA 2XH0A 3NVDA 4Q4KA 3UZZA 3PR2A 4Q33A 1XRTA 3QPEA 5G2WA 1DQXA 1REQB 3W87A 1P48A 5LIUX 3DKJA 2QEZA 2VEIA 4L1GA 1XIJA 1JPIA 3LZ5A 1HKKA 4WR3A 1ELSA 4JQ4A 4XISA 5C7VA 3P7YA 1Q4NX 3E2VA 1RR2A 1LLZA 3DYMA 1TRIA 1ZTVA 2VZOA 2DQWA 3PZOA 1BRLA 1MI3A 5B7ZA 2OLSA 1B90A 2DT0A 3IS4A 5FEZA 4CLMA 3BQ6A 2QGYA 1EO7A 2DUZA 2HE5A 4LUJA 4OBSA 4H9XA 2XH2A 1ZPTA 1VFFA 3NOEA 3F4NA 5C2GA 2P8BA 1O7AA 1JIBA 3I3EA 4NASA 4O53A 2OEKA 5KETA 1BFNA 5AKQA 4QROA 4J3UA 2C16A 3T78A 3N25A 4RNHA 1VHNA 3VDAA 4IXXA 2PEVA 3J7HA 3QC0A 3M0IA 1ZAIA 1YXDA 5KITA 1F7BA 5E6YA 1BXCA 3T08A 1YKWA 4ZO6A 1ISVA 4YL2A 4Q8MA 1HL8A 2RDTA 1ISZA 3V3WA 5JUVA 1EXBA 1YXYA 5CC5A 5DN1A 2XUCA 3H4WA 5DCEA 3LBOA 3IWPA 5HUOA 2QT3A 4DM1A 4GX9A 4NX5A 3HMJG 1AVAA 1G94A 1HJXA 3CZJA 4L6OA 5HOSA 2A3EA 3U8GA 1BYDA 2BFGA 1OCNA 1IE7C 3LENA 4TX8A 2ZRUA 1JGIA 4XSLA 4E5TA 1B9ZA 3FGCB 3C2EA 1OJXA 1Q63A 1FCUA 1PIFA 2WHLA 4X3ZA 2C7FA 3WFAA 2WMIA 2XFYA 2I16A 5GVJA 3DFYA 4HGXA 3TTOA 3FSTA 1F6YA 3Q65A 1TZZA 1OFEA 2ZA3A 4JIEA 2QAFA 3KW3A 2YCKX 3TJIA 3UW6A 2YB1A 2YJQA 1E1CA 1XLJA 3N3TA 4L9ZA 1KV5A 4GKLA 2R1KA 5HINA 1MVYA 3TW7A 5BNKA 1E70M 4HA3A 1KWKA 4TVCA 2EPOA 3S47A 3PJXA 1WZMA 3WF2A 3QY7A 3UCQA 3QKZA 1ITXA 4NAFB 3W1AA 3UR7A 2QMJA 3GG0A 3USZA 2Y8VA 2A3CA 1W56A 4A8NA 2Y8UA 4LC8A 2ZE0A 1FP9A 4OT7A 2P0IA 1M68A 4JNMA 3UGVA 1P6BA 1DJXA 3RO6A 3NM3A 1VP5A 4IPIA 1RPXA 3WQWA 4PGLA 2JKPA 4IM4A 1WDWA 3W7LA 4GZJA 1Y7VA 3VMNA 4DRSA 4XO7A 2R8WA 1FY6A 2HV5A 3PZQA 1B1YA 1AA1B 3IJ7A 2VT0A 1EJXC 3V7PA 4OZOA 3NPWA 4GVFA 4IUGA 3PJUA 1ZJAA 2VKZG 3MT1A 1W31A 1O68A 1NAL1 4PE8A 1LT7A 3K8KA 1AH3A 4KGLA 3O07A 3LPPA 2YDRA 1Q5MA 2XN2A 3BURA 4C65A 4NNAA 3ES8A 2E6AA 4NG3A 2C79A 1OFPA 2TRSA 5CPOA 1VENA 4PYSA 2PDUA 2BHUA 1BXNA 2YB4A 1TMHA 1R2SA 4AFYA 1QNQA 2WQPA 2I9EA 2VI0A 3MO4A 2RHGA 4C6CA 3KBMA 3WUGA 3E1F1 4IOTA 3BW4A 3PBUA 4O16A 1QUMA 2GQAA 3GD6A 3C56A 4FO4A 4JQ1A 4UWMA 3RCMA 3USBA 5LGZA 2XGZA 5D2VA 1HO1A 3UJRA 5JH2A 2E0PA 2VFEA 4K8HA 4IJCA 3W83A 4FNUA 4E2DA 4P2VA 1H61A 1HKVA 3PZNA 4UXDA 3OLDA 3DHPA 3FXGA 2EPMX 4XIAA 4LU0A 3TVAA 1UA7A 4DLFA 1YPFA 2QDEA 3QZAA 3KDNA 4XAYA 3HG4A 4U10A 5JIWA 3TN3A 2Q8ZA 1UBPC 3O63A 1LZOA 1KQYA 3DFQA 3DKLA 4UQDA 4BF7A 1EJSC 1LOSA 3OEXA 3OA3A 4UIOA 1RBOB 2X0SA 4JD4A 4D72A 5CAKA 2DH2A 5F2MA 2FQIA 2ABBA 1YEYA 2AQVA 3WDIA 3GAKA 5CBJA 1NSJA 2HS6A 2I14A 2YFOA 1XISA 3ONCA 3E49A 1W3IA 4Q4PA 3BGJA 4L9XA 1FDJA 1DL3A 5CPMA 4TOQA 3LA4A 1GZGA 4NAEB 3BWWA 2JF6A 4I5UA 3G1SA 4MB4A 2XZ9A 1LRTA 5AHLA 4J3VA 1DWAM 1EHAA 2IKGA 2OKOA 2V2CA 4UR9A 3SO7A 2B31A 3IJQA 5EY5A 2NV2A 1IT8A 3TLLA 4HT3A 3UXKA 1IGSA 2PWGA 3MMTA 1EB3A 5EB8A 1QNPA 2WSKA 3O0FA 4JFTA 2ZBTA 4HYWA 4J5NA 4H6QA 1KLZA 1R85A 1JYXA 3S2NA 5D03A 1T0OA 2Y85A 2OWCA 4S39A 2AKMA 2OB3A 3IACA 3POCA 4EVZA 1S2AA 3R25A 4IQEA 4PMZA 1BLIA 5DMNA 2VEFA 2H6RA 3HMCA 4G8TA 2FVLA 5TF0A 1T7LA 4Z2HA 1TZ7A 2XM1A 3N3MA 3NQAA 2JF7A 4LX4A 4KWVA 3E74A 3QHOA 3PUGA 4NYYA 5JBFA 2E6FA 1Z44A 4MWAD 4UFLA 4P7LA 4FOJA 1BHGA 4EOUA 3GE7A 2G3IA 3PWGA 1SR0A 3IGHX 4IFKA 3PBMA 3GVWA 2EJAA 2OSWA 3CL7A 3KZPA 5I7GA 3ZM8A 2XSBA 2DT1A 3AIQA 4ZA0A 4RXFA 4F79A 4MYXA 2FB2A 3WMBA 1V6XA 3ZJ8A 1UZ4A 5FESA 1I0BA 1PIIA 1EJRC 3V75A 2VXNA 4I7WA 2ZKMX 3RIKA 1SZFA 2IKHA 4I7VA 3ATYA 2FDSA 3H2EA 1VEPA 3FHQA 3QSRA 4I5RA 2Z2AA 5A8MA 1LUCA 1MUCA 3ZJ6A 1YX1A 5FIPA 4OHQA 3FN9A 2OX4A 3NO1A 3EKZA 1L0PA 1Q6DA 4ACZA 2ALRA 1ZALA 4J3WA 2PFHA 2BDQA 3C0JA 2FB3A 1QNOA 4DZIA 2VDIA 1XBVA 3FNDA 1IIGA 2JK2A 1ZHAA 5FI8A 1OWQA 1R86A 3MSGA 4BI7A 4XX6A 1EPXA 1QDSA 1JQXA 1UHVA 2PWUA 3VD9A 1TPEA 4CD8A 1Z9AA 3RX2A 1QO2A 2D73A 4JN6A 4RNIA 3EOEA 5AHIA 3REQB 1XGZA 3LQLA 3F4VA 3GR4A 4LCRA 3UG8A 4LS0A 3WY1A 1OF8A 2DZPA 3QYSA 3LOTA 4JTTA 2HBXA 3VKKA 3WNMA 3QM3A 1Q6FA 3ZWSA 3BG5A 4M24A 2WMJA 3RX4A 3A5FA 5KEZA 1R47A 3NSXA 2DUAA 4HU8A 3NA8A 4Q4OA 3S4TA 1KRBC 3SRDA 3N13A 1VCGA 1ECQA 4C5ZA 2F61A 3TFXA 2C91A 3CAVA 4IPJA 1QI0A 1S2TA 3P8IA 4MMWA 4UMBA 3AS3A 1E6XM 2HMCA 1S38A 5D33A 3SECA 3VU2A 4JN7A 3CPRA 3MDUA 2QCEA 3OLEA 4K7YA 5DBUA 1JJKA 4IGHA 1OZQA 3EEZA 4MADA 2J4GA 4M8UA 3A4WA 1C91A 3VE7A 4JTUA 3VTRA 3CZKA 5IFTA 5JBDA 2RDWA 1KCLA 3GRIA 2A21A 5CSUA 1OYBA 2Q6ZA 3CWHA 6XIAA 4Z2LA 3W72A 2ZUUA 3O9NA 3QLDA 3A22A 3N19B 5FJRA 4UTFA 2H90A 1IWPA 4YTRA 5D2YA 4O4WA 3VOCA 1VJZA 2IPFA 4D8LA 3H2CA 3CAQA 1PB0A 1Q7QA 1K9DA 2FZ9A 5T8GA 3BAWA 2B7QA 2Z1KA 2PI6A 2ZRWA 2VUYA 2E68A 3M47A 3KDOA 3BOXA 3OVPA 1FWFC 1VLIA 1LCOA 4CVWA 2NV1A 3NL6A 3M5VA 2GJXA 4YN5A 1P5BA 4XZLX 1JXJA 2YW3A 4US6A 3L5AA 2VVNA 1LTDA 4D6IA 5KMYA 2R82A 4GOAA 3I6TA 4AY7A 1KM6A 5FJJA 3TU9A 1IXNA 3SN4A 3IIVA 3IV8A 3N18A 1JYWA 5FJTA 1KFBA 4FA3A 5DY2A 3BDKA 1MQRA 3N2TA 4W7UA 5KZMA 2FTPA 4REQB 1RUSA 3BJFA 3VCRA 4QSHA 1JCNA 2V63A 5K7JA 3WLJA 2PCQA 1W5PA 1QNVA 5DXYA 2Z4GA 3L67A 4JS3A 1TTIA 2NUYA 3DDMA 3EWZA 3KXQA 3IRSA 3LCFA 3LCGA 4MOZA 1JL8A 3K30A 1TV8A 2W79A 4FLRA 3WNLA 2AOSA 1B3VA 4PODA 3ARQA 1EP3A 4KBXA 2J74A 1F5ZA 5BMXA 4E6MA 3RJYA 3W53A 5FF0A 4HU4A 3MHGA 4J35A 1S1RA 3UEQA 1BVNP 3CAKA 3WD2A 2OFJA 3ARRA 3SURA 4AUBA 1JCMP 1GHSA 4O1DA 1EPVA 2FJKA 2RH9A 4OECA 4O12A 2PD9A 3WNNA 3EXSA 3MB9A 2NLYA 3AHYA 3H12A 3CMFA 2UZ9A 4CQBA 1POKA 5BZAA 1U83A 2WNNA 1AK5A 4UB9A 3AMLA 3RLHA 3MI2A 1VS1A 3SUVA 1XYMA 3HBLA 1OIFA 1QPQA 3P62A 5DCDA 4W5UA 2D2OA 3IRDA 3FK4A 4KCVA 3B4UA 5FACA 2QVHA 2VDHA 2NVAA 3DN5A 3OBEA 3WUEA 4ATLA 1U33A 3NYZA 3WLNA 4JNZA 1VBHA 4IISA 2B7PA 2CWXA 5AC4A 4QLJA 1X8FA 2PDLA 3KLKA 3OOQA 3S6OA 2CEQA 2QXWA 4HCDA 4KRZA 1YDOA 2DPEA 1UR8A 3RDKA 3QHNA 3STFA 1XUZA 3CT7A 1CXIA 5L9FA 2WSYA 4ZFMA 2ACQA 1XR2A 3DCPA 1EEXA 4MB3A 4FX7A 4AISA 4KETA 1TWSA 1OD8A 2EEXA 1J4EA 1O6IA 4PCNA 3I7QA 4DO6A 2WHMA 4BQ5A 3OPSA 3PHAA 3W01A 1UUMA 2ACRA 1EKOA 2VENA 3EMQA 3RO8A 4YJ5A 3UWUA 3L0GA 2HRWA 1E6NA 3UPMA 1OB0A 3UFYA 2GUBA 4GNVA 2IXVA 4I9TA 4U33A 2AL2B 1U1UA 1Q85A 4YWIA 1FH8A 3ZLHA 3L2LA 3G0XA 4HNVA 4GI6A 2ZX7A 4P5UA 5A3HA 4TU1A 3OA5A 2JQXA 3WELA 1ZP3A 1E73M 4P8VA 3CQIA 2QV5A 1EX1A 1JI1A 2V69A 1V7YA 3VFLA 4OU1A 3V18A 1R3RA 2RGLA 1G69A 2PDYA 3GDTA 4L4MA 4H6RA 4ACYA 1NWTA 3THAA 4DAFA 3ID7A 1KFLA 2F84A 4TV5A 1X8CA 7REQA 1PHQA 4JDBA 1KNWA 1BYAA 1B54A 3EX4A 3I68A 3STCA 4AC7C 2REQB 4H8NA 3WLIA 1CXKA 4DNHA 2E8ZA 2Z25A 4LNCA 3PP7A 3CUFA 4GY1A 4O19A 2YCJA 3LPFA 4FR6A 2Y24A 3U7BA 2FZNA 3NG3A 3TLQA 2XIBA 2Q8LA 1XICA 4K3ZA 3AJ7A 5HWNA 1JRBA 1HF6A 4NHVA 2A1YA 4M19A 1A49A 3KHJA 3SDOA 2YL9A 3M5YA 4GMEA 3BK0A 3CV6A 4PN2A 4HSNA 4AVFA 3NDZA 1A5AA 4AZ6A 3AS1A 2GZXA 1GCYA 1DQUA 5I07A 5LNVA 2DZAA 3E38A 5MKGA 3B40A 3M16A 3N4FA 3KUMA 1OVDA 3LGEA 4HPHA 2RJHA 2CFFA 4LYKA 3WLMA 2FTWA 1LL4A 4D6HA 2F6UA 1EJUC 3MANA 2ONEA 1BAGA 3CC1A 1RSCA 3FDGA 4L1XA 1NM9A 5FL0A 4JTDA 1KXQA 4NL1A 2WHKA 4MPKA 5CZJA 1O5RA 3KL0A 5C7HA 2ATMA 4ZXLA 2QDDA 2WMKA 3U7VA 1T99A 1LLWA 4O1EA 1VBRA 1ADDA 6XIMA 3UVAA 3TXVA 3R79A 4W85A 2G4JA 4UBPC 2QCHA 3ALGA 2I56A 4F0LA 1LBLA 4QSFA 4ZOBA 1YPIA 4PTVA 1F8MA 4MYAA 2OT1A 4J1OA 1Y0EA 3WEMA 2VC7A 2CZFA 2G96A 1O94A 1IEXA 3C3UA 1ZNNA 4MPQA 4K8EA 5HMEA 3PZ9A 4AVOA 2BASA 1E40A 5CSSA 4LAUA 1CIUA 2E09A 4B15A 3NR0A 5HULA 1X97A 5I3KA 4JHZA 4H9MA 1ZCOA 5I78A 2KAUC 1BYCA 2PD5A 4BHYA 5CZKA 4DJED 5LIWX 3OU8A 4Q8WA 2EJ1A 3GO2A 3A5VA 3IJ9A 1VFOA 5CPTA 3IIZA 1OD0A 3BL3A 4JBRA 5AC8A 2DSUA 1QNRA 3WLLA 1N82A 1MEHA 4XD3A 2RUSA 1RPKA 3BUVA 3L4ZA 3VKDA 3MQTA 3PSVA 7ENLA 3CEPA 3AMDA 2YKKA 1ISWA 1YLVA 4JTLA 4RV8A 4DY1A 3AFBA 1QR7A 4JTIA 1GZJA 3SFKA 4DNMA 4JTGA 3W88A 3GHSA 4YPJA 3AO0A 2QYGA 2YCIX 4LRSA 3ZO9A 2WNZA 3AAMA 3AMKA 3GUWA 2PUZA 4B4FA 4LAKA 1A47A 1QXLA 4BQ3A 5AYYA 2XM2A 3FYOA 1LWHA 4Q7IA 4NQ1A 5FD0A 4RV3A 3UETA 1CPUA 2HTMA 4OVXA 4JEJA 1U5VA 1UR9A 3ABSA 3C86A 5BOFA 3OZMA 3QY6A 4ATDA 1A4LA 3CMJA 2B7NA 4GGHA 3N15A 2V67A 2V3FA 2PRLA 3SY8A 3N17A 4PEKA 3WBAA 2Q01A 3P0WA 1DHPA 1KXVA 2V5JA 3BLEA 7TIMA 4JTHA 3ARTA 4AW7A 4PB5A 1VC4A 4O11A 3W2NA 4HA4A 3NAVA 1QWGA 4JTAA 2Z6JA 4ADTA 1LQAA 3PF3A 3G18A 3E0FA 4JYEA 3WG6A 2Z28A 3V5OA 4BQ2A 1I2QA 3OGVA 3ZLFA 3F5KA 4JQ3A 1RALA 1PAMA 4AH7A 1OT1A 1BF2A 1KV8A 3G3MA 1K6AA 2GJPA 4KCTA 1VJIA 2E3ZA 5H91A 4DWSD 1J0HA 2O7QA 3G1VA 1H0GA 1PCWA 1EDGA 1R6WA 2E5BA 4AD3A 2O92A 2Z1VA 1E6SM 1PHWA 1YBQA 5FF4A 2R14A 5DQPA 4AHOA 1WAUA 3U5YA 1E6QM 4ML9A 4XVDA 3GH7A 4HK6A 1KXTA 5BCAA 1AQHA 5CAHA 4QNEA 3TOYA 4LVGA 1UASA 3VGDA 5HATA 3BW3A 2ZA2A 1HG3A 2J7HA 2WMGA 5FF3A 3O6YX 3TN6A 4EXQA 5REQB 2NSXA 4LVBA 3VDBA 1QJWA 1UD8A 1YNYA 2E25A 1R3TA 4S3JA 4AD5A 4H6KA 3GUGA 2ZUMA 3FLUA 4KERA 1GWJA 3HG3A 1YYAA 5BRPA 3BAYA 1YMYA 1BTCA 2WZTA 2GVGA 5K4XA 3EDKA 1TTJA 1XRSA 3H7RA 1D7FA 4C6JA 1EC7A 1LWJA 4PUDA 4M0XA 4NNCA 3TYUA 3BLIA 2AL1A 3VI2A 5DXXA 5EGRA 4PBEA 3W7JA 2J13A 3N04A 4HZMA 1P7TB 1T8QA 4H00A 3ANVA 5AC6A 3EYPA 5IXEA 3AXHA 3B4YA 4B3LA 3HQOA 5C2CA 1UWQA 3ZR4A 2QUTA 2XIMA 1F3EA 2Q3RA 4UTUA 3VDGA 3S3GA 3S9YA 1QI2A 1JQVA 2HVNA 3IJ8A 3OJGA 3IJDA 3KHDA 2WKJA 3INPA 2XTKA 1ZUAX 2X42A 1S2CA 2Q8XA 4CUCA 1TVPA 1X39A 4GBDA 1HFBA 4KEMA 4I8DA 3R8HA 2VFHA 3PPGA 2HROA 3FY1A 3MA8A 4DWSA 3VGHA 5CQ1A 3ITVA 2H3DA 3NJ3A 3W6LA 4A3HA 4H6EA 4XAFA 1GG0A 4GZ7A 3EGJA 4C91A 1A50A 4HTYA 3W7QA 1JCLA 3B8SA 4XIMA 3W1TA 3QPZA 3WEOA 1XIBA 1TMQA 3S1GA 4MKNA 4MUPA 3WLKX 3RR1A 2GOKA 5FF2A 1ZFJA 5D2TA 5CEWA 2Z1WA 3NWRA 1TPDA 1IR1A 3H54A 1M3UA 3AWNA 3BG9A 4XWUA 3BLDA 4JCMA 3W07A 4XD6A 2E9MA 4N42A 4Z2KA 1WBHA 5G1YA 3EX3A 1TREA 4QLLA 3AC0A 1QI5A 4GKTA 4HNTA 3R10A 1XIEA 4JTEA 3QBUA 4KQNA 3GNOA 1HJQA 4NI3A 3A6OA 3VIFA 2ZYFA 4QISA 1BSLA 4JTSA 3GG8A 2DQXA 4PTXA 1S5MA 1NQ6A 2X09A 1GW1A 4M7TA 2VZVA 4K8GA 4POCA 4B9YA 3MO7A 2QR6A 4AXKA 4RZ6A 3OG3A 5HK4A 2BG5A 1V4YA 1QWKA 5A2BA 3CMGA 3NGJA 5HAOA 1R3SA 4O10A 3DG7A 1TIMA 3RF9A 2A4AA 4FIRA 3JRKA 1PYFA 1TELA 1TTPA 3WLQA 4OJYA 1AW2A 1XINA 4DUWA 2WVVB 5C8BB 5HANA 4G7EB 5TBOA 2A3BA 1VD6A 4WF7A 1FWEC 4YLWA 2BGQA 5DMLA 4P8UA 1G9HA 3UESA 1UW9A 2XVKA 1O1ZA 3UCCA 1F4AA 5BXTA 4QAIA 1UUQA 4ZVJA 3PZIA 1Z6KA 1JUBA 4PMXA 3MMDA 2GJLA 1VCVA 1FWIC 1Y5WA 2ZXDA 3B3DA 3GM8A 4XAPA 3LSBA 7CGTA 3L68A 3MWAA 3TK7A 3N11A 5CZTA 1QW7A 4O57A 4F0KA 5FA5A 3N2MA 3TNOA 1E6ZA 2GJRA 3EX6A 2WPBA 2VURA 3QC3A 1M41A 1JZ6A 5I5RA 3UG3A 2OYLA 1KFJA 3QV9A 4UFJA 2QJHA 3P61A 4DWSC 2OELA 3FAXA 4ZL1A 1H60A 1VPXA 4M56A 4A21A 3WMSA 4R7JA 4GH1A 4EANA 4GNJA 1MSSA 1UH2A 1V08A 2WC4A 3EKLA 3UWQA 9XIMA 3WFZA 5FJPA 2WJFA 3IVSA 3SEPA 1A5LC 4ZENA 3WH7A 1MRAA 4KEZA 2V5BA 5TAOA 4TVUA 1TFVA 5EYWA 4WJXA 1GEQA 1XHGA 4HCHA 1PL9A 4WK9A 1AL8A 1R87A 4H7ZA 4Q32A 2YDQA 1CDGA 3NNTA 4K38A 3N4AA 4AZCA 3RRAA 4RUBA 3PC0A 2W92A 1UWRA 3DESA 3KFTA 4IJBA 3T2PA 3LM7A 2BV9A 1EJ7L 3LCLA 4IHCA 4BCEA 3TXZA 4IMFA 2PP3A 3W1MA 3M0YA 1B3WA 1W9PA 2V9DA 4ZOAA 4KIRA 3TQ0A 4KWUA 3NQFA 4HP5A 1SW7A 2ISWA 2VOMA 1WXZA 4CU6A 2W61A 3GVGA 3TA9A 3ISIX 3R0KA 5CSRA 3U2ZA 3E02A 5AB3A 2QIWA 7TAAA 3GYCA 2ZTJA 1FWWA 3V0UA 4QJ4B 1W5OA 2PGEA 4PBFA 3QW4B 2X8RA 1K6WA 5H8UA 4FLQA 4OOUA 4MJ4A 5F2IA 5DO8A 4NZ5A 2QJGA 2DY3A 3WK2A 3T0CA 3P5YA 5DY3A 4BEQA 1W2VA 2INEA 4M5PA 2PGFA 1T6MA 3UVIA 4K36A 1PSCA 1TZ9A 2PTYA 3SI9A 4UQCA 1GVYA 4JIRA 1J6OA 3QHMA 2ZC1A 1FKWA 1H41A 2YXGA 2GDQA 4O54A 3HG2A 2XJ7A 5A2AA 3RHGA 2HS8A 1YW1A 1YTEA 3N9SA 2OCZA 3W7PA 1IWAA 5A6LA 5EMMA 4AIBA 2BOEX 3DYPA 2Z2BA 1P0EA 4HPGA 4AQLA 4HTBA 4E8CA 2TSYA 1W1ZA 3AHXA 4H7CA 3WQ8A 1OC5A 3R4IA 4XKYA 1UROA 4E2OA 4GQRA 2V8ZA 4XQ6A 2XGIA 4JGDA 1EHNA 3M0HA 1QPKA 3HGJA 2O4QA 2VQTA 2HPMA 4X2RA 3Q4DA 3LMYA 1TPUA 1SFLA 1DHKA 3W73A 3BG3A 1M03A 3CUIA 3RR4A 2XFFA 1EWDA 1XYZA 5EBAA 1HL9A 1CB7B 4LAMA 1GOQA 3GQYA 3TNBA 2XIIA 2P8CA 5I3GA 4D8ZA 5EMYA 2ODOA 2JKEA 4GYPA 4KWWA 5C9WA 4E4UA 1WE5A 2OZ3A 4AU0A 2BP1A 3VIMA 4YTTA 3MBFA 1FHLA 3RU6A 4I7UA 1FWSA 1VJSA 1LRNA 3AMCA 1AFSA 1R9XA 4JAWA 4NU7A 1TWWA 3AIRA 1NOUA 3CWOX 4OKDA 4EWND 3SCQA 3W3OA 3BPWA 2X1RA 1EP2A 4HMEA 1VYPX 1L8NA 4R9OA 5D9OA 4GYJA 5FJUA 3WUBA 1IT7A 3U2EA 4LEFA 2WMFA 3DIPA 1H5YA 4C1NB 1GTHA 3B8TA 1DWJM 5CPQA 2J6XA 2NQJA 2BB0A 3B9OA 1MW1A 1CENA 5AYIA 4DUOA 4JTCA 4HNUA 1R3VA 1RD6A 1VFTA 3KBJA 3WFLA 1QTWA 4B3ZA 4X61A 4A8IA 4D9PA 1NH6A 2IKIA 1WDRA 4Q7NA 1I8JA 1GW9A 2Q3OA 1TCMA 4RCXA 1CCWB 3FDKA 2NVCA 4IMDA 3BW2A 3T42A 3CPUA 3RU8X 2I7GA 1DIDA 1PE1A 3O3RA 3KBVA 3BH4A 5A6BD 4BEUA 4QJ1A 3VXGA 2WBGA 3DERA 1EQCA 2BY1A 2DDXA 1G4PA 3PBYA 1FHVA 1SJBA 1NP0A 4F9JA 2WC3A 2GVYA 1LROA 5HA7A 4LXFA 3GVVA 3ZQ9A 3WMCA 3S1WA 1F9CA 3L66A 2WC7A 4HKPA 1M7PA 1Q4WA 1RK5A 2CKSA 4FXJA 4ZSUA 4DJDA 5HQEA 1EBGA 4ZOEA 4AIOA 1DEDA 1H7PA 4S3FA 2INFA 1KRMA 3GG1A 2AGTA 5IBXA 1MO0A 1HKWA 1MW2A 2FIQA 2ZXQA 4GX8A 2QF8A 3ZVHA 4B2DD 1W91A 1OM0A 3O16A 1MXGA 4LSBA 2CLMA 1SFJA 3C2RA 3O6DA 2EPKX 4RK8A 4U5KA 2BGNE 2JALA 1EYEA 4IP5A 2J25A 1B3ZA 1I2OA 4S3KA 4R34A 3W7HA 5E70A 2V5LA 3KCLA 4FAMA 1ZP4A 3TDFA 1CXEA 2E7FA 1OHLA 2XFWA 3GFXA 3DI0A 4AG0A 5IHRA 1WZKA 3W75A 4WKFA 3CQKA 5L6UA 3Q94A 1TWIA 2ESCA 4S38A 4GYPC 1TE1A 4IUOA 3WSUA 1REQA 3TC3A 4PMNA 3QQWA 3WLRA 1RVKA 3GW3A 4RZBA 4GFIA 3CGTA 4FI4A 1J5TA 3AQUA 3ZR5A 4PZVA 1W3TA 4CN1A 2AKZA 4H9TA 1MDLA 2NWSA 2D2HA 2NZLA 1P1MA 2R24A 1VPQA 3H7UA 2BY3A 5CGMA 3N1AA 3MUXA 1OFBA 3KX6A 1TUFA 4GZEA 3VGEA 3OZPA 4HHMA 2PTDA 5CC6A 2YR1A 4QEEA 3PWAA 5D02A 2QF7A 2AGKA 5MHBA 1PX3A 5AZ1A 1XI3A 4Y8FA 4FX6M 5KZDA 1SGJA 3ITXA 4FNTA 3MP5A 1V0LA 5HNTA 2B81A 2ISFA 1SFTA 2C14A 3HPXA 2QJJA 1KWGA 2EGZA 2DUXA 4HNOA 3T09A 5CZSA 3W2UA 1UQYA 1X1OA 1M6JA 1KGWA 5FEPA 3T7VA 2OOGA 1EJVC 5JQ9A 3ECQA 1IF2A 4WGHA 3WCZA 1V6UA 3ZSSA 1GYNA 3GC5A 2QJIA 3VDHA 3ALFA 3TJ4A 3MKCA 3CEUA 2D23A 1V93A 3B8UA 3IK2A 4V2XA 4ECLA 4LOCA 1W1VA 5GJMA 3HQNA 1IGWA 1XIHA 1E43A 4ERAA 4ICMA 3NZ1A 1BTMA 4DJDC 4QE4A 3SM0A 3IJIA 3SQSA 3TYCA 3FGCA 4JIIX 2DVTA 1A5MC 3BAXA 3H70A 3PUOA 4L5ZA 3EXRA 5KZEA 5IBXC 2G3JA 1PEZA 3S1VA 2FDMA 3RCNA 5HXMA 2E40A 5K2ZA 5LNRA 3SW6A 1HVXA 1S2VA 1W3LA 2XVGA 2P3ZA 5D32A 4B5XA 4GACA 3U2OA 1HJUA 4ZB0A 3URBA 5K9DA 1PZ0A 5I02A 1DIKA 3OLGA 1UBSA 3TTEA 1W9XA 4IMAA 3E96A 3SGGA 3HQPA 3BC9A 1OIMA 1VEOA 4NAFA 1OADA 3WKZA 2XZ7A 3E6EA 4R27A 2R9RA 1UWUA 1W9DM 1B57A 1XS2A 1EZ2A 1KFEA 1K1DA 5CGTA 3U5UA 5FSDC 4OV9A 3T0DA 3SY1A 1FCBA 3PTMA 4LBRA 3WJWA 1JD7A 2PC8A 1S2UA 4I9AA 4I9JA 3KVKA 1W32A 1I2NA 4NZCA 4QG6A 1Q6LA 4LNYA 4Z2JA 4A05A 3LGDA 1J0YA 1EGZA 3HJEA 1E0XA 3PTDA 2X0HA 2VFDA 3DFPA 3U9IA 3WH5A 3AYRA 2B7OA 3K1DA 1Q45A 5A69A 1U1HA 2PS2A 2WZHA 2Z29A 3CYJA 3VABA 4ZE4A 3FA3A 1I4NA 3NUKA 1R9YA 2FKPA 4QTGA 1K03A 1PYMA 5G1MA 4NYUA 3PFMA 5EMLA 1S2WA 4YMZA 5T9CE 1RZMA 2VJXA 4LQ1A 4C60A 5FF7A 1DIOA 3VNJA 1E3XA 3GC4A 4GINA 3BMVA 1KBLA 5HMDA 3ZYZA 1C8VA 1VRDA 3FYYA 1E9YB 4M80A 4HOZA 4ENLA 3WF3A 1P43A 5C2XA 1A5SA 4UFHA 3L0NA 4YTQA 1FTXA 3EPMA 2DH3A 3TN5A 4LF1A 4WY0A 4FEZA 5E93A 2EPHA 4DO5A 2OX1A 1Q8AA 1R2TA 3L7RA 3KS5A 4C7DA 5LXEA 4GIAA 1HN1A 2CKRA 3W9ZA 1OK6A 1Q66A 4PTMA 3FXYA 5D05A 4Q8NA 3QGKC 5AYZA 2X05A 4AX6A 1E56A 3AZRA 1WUFA 2I9UA 1KB3A 4HZ7A 3AU2A 4E4FA 2Y1HA 4DJFD 1GYMA 3ITTA 1ZGDA 1KA9F 1J9YA 3WJXA 3VDCA 2C8NA 1R0MA 1H7RA 3UXAA 4MZ8A 4D1JA 4UTIA 3S5NA 3N6HA 4CN6A 1H51A 1O1HA 5CPNA 3NEHA 2BNJA 2DORA 3CPGA 2WNQA 3NIYA 4JIQA 3OB8A 1LG1A 3VINA 3T8LA 4JTRA 5M3WA 2J7GA 3QQ0A 5BW6A 2DZTA 3OO2A 8RUCA 4MKVA 4O0KA 4C6QA 2QCNA 5ECVA 5C9RA 3MUCA 3ZVIA 4MNMA 3VYLA 4ZXOA 3BSGA 1WZLA 2J78A 4F2TA 5CBIA 2ADAA 4IG2B 1UG6A 1BVWA 3TMQA 2QMKA 4X63A 1RVGA 4NAEA 3A21A 3QN3A 4KS0A 2ZWYA 4PUEA 3WJYA 4PCFA 4Y9NA 4KWSA 1W9UA 7PTDA 2VUNA 3KBWA 1B3XA 3LI1A 3VZZA 2A6NA 3RM4A 4UCFA 4GQGA 2EKCA 1L6WA 1XIMA 1P1XA 1DE5A 1DQWA 1ODZA 5A8PA 1GVSA 3TR2A 4QEHA 1MFVA 3QYQA 1PVNA 3LU2A 4M81A 3GFZA 2W91A 4UFKA 2J7FA 3CZ8A 3CH0A 4OE7A 1I0DA 1HUVA 2Y62A 1IV8A 2WVUA 2Y5EA 3EWUA 3DBNA 3M0MA 1X38A 2QW5A 1UKOA 2VX4A 1W1PA 5U4NA 2Z0IA 1Q13A 4RDYA 1B3YA 2HBVA 4JY9A 2V3EA 1J6PA 3VKCA 1RCXB 3KS6A 3OIHA 3DAQA 4F4RA 1BGAA 3MYOA 3B9EA 4Q8VA 2O9PA 3QVQA 2HK1A 1OC7A 1JF6A 3ELFA 5CH9A 2E1WA 3PS7A 2V68A 3QV6A 1W3JA 4X60A 3IEBA 1QAPA 4DBDA 2QVNA 3R89A 3LV6A 4NSBA 4A35A 1LT8A 3ZWTA 4E3TA 3T55A 4FNQA 4MDOA 4A8LA 4M6QA 4ZQPA 4PCPA 4LRTA 5FKYA 3RN6A 4UR8A 4X0NA 1SO6A 2A85A 4JHMA 1R30A 1GZ1A 4L80A 2DVXA 4ZB5A 4TQTA 3PWIA 4H8HA 3WF0A 3GU9A 3KEHA 2VEGA 1JDEA 1XG4A 3STPA 3MWCA 1DOSA 2POZA 3EAUA 1QK0A 4NZ4A 3QQ1A 3UWYA 4LS1A 2PMQA 2Z1SA 1WPCA 1J2WA 2WVTA 1DXEA 2KZHA 4LVAA 3QOMA 3THQA 1CGYA 2QCGA 5LIXX 2G50A 4J28A 4UQAA 1US0A 5D8WA 2XVLA 1NFBA 4US5A 5B7YA 4R7OA 2J79A 1I1XA 4DWDA 1DIEA 2IMRA 3XISA 2WSQA 4UOZA 2YZ5A 4XZHA 4AD1A 3WL1A 1LOQA 3RM8A 5IRPA 1IHIA 2YA0A 5JVLA 2JBMA 1C92A 3NTYA 1SZGA 1R38A 4GXWA 2GL5A 3VX1A 2XWEA 3EX1A 4CD7A 1XIDA 4O52A 3CUXA 3SRKA 3STGA 2ZXBA 1WDPA 4A8RA 4OFCA 4WSHA 1ZJHA 5KSWA 2NX3A 5F2GA 2V82A 1O95A 4UQ9A 2FZDA 1JYVA 3EA3A 2PWHA 4FALA 3UA4A 3VE9A 2V81A 3ITCA 4YYCA 4TIMA 4EXBA 5A8GA 3M46A 1HTIA 1CXHA 1RA0A 2J9XA 1SO4A 4MAZA 3TWAA 4A4AA 2CZEA 3EWXA 1UKPA 2MNRA 4KCUA 4IPPA 1OG6A 2YL6A 2BHYA 4GVGA 3RGTA 1VZWA 1L9WA 5GJNA 4GABA 3AYTA 6PTDA 3K4AA 3SCOA 1A0DA 1I2PA 2CBVA 8XIMA 4OV4A 3T0AA 3G24A 4B90A 5BXSA 3W2KA 4YWSA 1KQZA 3VO0A 4XB3A 1M7XA 3VC5A 4YTSA 3TYEA 2G41A 1GQIA 3H2FA 2IUZA 2G4FA 4IZGA 4MM1A 1BVZA 3NVTA 4FF5A 1ZJIA 5DCBA 4YVVA 3HB9A 1D2KA 3C2OA 4EK7A 2VWTA 2QDGA 3H26A 4IFRA 5AZ0A 1XIIA 1NEYA 1IZKA 4L64A 5FEWA 4HPXA 1DJWA 4CNNA 3L4WA 2OQLA 3BO9A 3V35A 5ECUA 1M5WA 4PFHA 1ICPA 3L5LA 2EF9A 1IT0A 3EEGA 4JHOA 5BRQA 2BY0A 2FJUB 3ARVA 1SO3A 3DGRA 1GNXA 2WKLA 1TJRA 1OCBA 2PWVA 1WOBA 1XW8A 4O8AA 3EWBX 1V77A 4GUFA 1KRCC 3T9PA 1AQ0A 1C3FA 3TMLA 4IMCA 4AAJA 1W1A1 4REQA 3TN4A 2FGBA 1TR9A 3S6TA 4PL1A 1UZ1A 3WBEA 1LLOA 3R94A 2Y88A 1A0EA 1SMAA 1XLGA 2WZMA 1J18A 4AD0A 4DLMA 3V16A 5AOUA 2R6OA 3DC8A 3N6QA 3IUDA 3TTSA 4QGCA 3LTYA 3UP8A 8XIAA 3MCOA 3AU6A 4KH2A 4K68A 3LXAA 1JZ7A 1FQ0A 2XIOA 2XPKA 3CHFA 4BR1A 2H3BA 5CSYA 1E0TA 4EKJA 1VEMA 1IEIA 3CQ0A 3DGBA 4HHHA 1ZSXA 3NZQA 3IIPA 5HNRA 3HM7A 2ATSA 2PSNA 3TEVA 3KE0A 2TODA 1UQZA 3W24A 3S2LA 1OGGA 1JCJA 1ADOA 5EA9A 1K4GA 2H9AA 1THFD 5CC3A 1Z8AA 3L23A 4N9BA 1QO5A 3NDYA 3UZYA 4DBWA 1XH2A 2HVOA 1XC6A 3VIGA 1Q6CA 2FH6A 4UNKA 4D8AA 3CHCA 1I45A 2XWDA 1EH9A 3BTNA 7A3HA 4O14A 3CZGA 3W81A 3WUFA 1CGVA 3WF4A 3B04A 3GB6A 3W1NA 4DB7A 4Q4MA 3TONA 2G37A 3W1UA 1RCOB 4C7FA 2DW6A 2GVEA 3DG6A 4DQWA 1J0JA 1DV7A 4HZ6A 4C6DA 4LH8A 4W88A 3QF0A 4GJIA 4FIQA 3GZ3A 4RL3A 4C6LA 4AWEA 2J6VA 4MFDA 3PPHA 5AYBA 5T26A 5BOEA 1S5TA 3VGBA 1ITCA 2WZEA 1M01A 4L65A 4MDPA 3OP2A 3V0SA 1RBLA 5XINA 4BY3A 5M5DA 3VCCA 4CCCA 1TB3A 2E67A 5HPOA 5BYWA 2VVSA 2UBPC 3T2QA 3GNDA 1EUAA 3W27A 1HW6A 3UJSA 3S0CA 4NI8A 5JIPA 3G8RA 3AHZA 3D3FA 3IARA 4JKKA 5I3FA 1E51A 1KLYA 3GTHA 4KFPA 2PDJA 4QRNA 2CLEA 4PB4A 2B0MA 4XKMA 1HKIA 2XYLA 4EF9A 3NGFA 2PGWA 1LORA 4EIVA 1PWMA 3GNRA 2X30A 1EOKA 1KFCA 4YHEA 1JUKA 3LPOA 3HQ1A 4CU7A 4K1GA 2G3MA 3O0KA 3ARSA 4S2BA 4LJ3A 2ZZ1A 2AAMA 5EKYA 4A3YA 3CUHA 4KEUA 3ARPA 4I6KA 4K1WA 1LG2A 3W29A 4DYKA 1ZCCA 2WZIA 1EGVA 1L6GA 4XUGA 2PE4A 4NF7A 1DXFA 1X7FA 3VZXA 1ENUA 3RILA 1CXLA 1EF3A 5FJOA 2QUUA 8TIMA 3UR8A 3SSJA 4DUXA 2DIJA 3S8HA 1TV7A 2QCFA 5AY7A 2REQA 3DFSA 4DUVA 3M0VA 3PJTA 1EZWA 1R5YA 3B9NA 3WH9A 4AIEA 1J10A 4C90A 1SZRA 1JZ8A 1YADA 3VA8A 5I3IA 4B5UA 4R33A 2EKGA 4WDTA 4EPEC 2WO5A 4O15A 3M0KA 3WNPA 4NT0A 4PUNA 2O7SA 3TZFA 2ZXAA 2EQDA 2CU0A 4DIAA 5LKYA 2VZUA 1SSDA 4TX6A 3TJXA 4LUSB 4HVXA 3GR7A 2VTFA 3UWVA 2O4MA 3OQEA 4O50A 1JPKA 2D0HA 2XDFA 8CGTA 3SBFA 5E5CA 4JNYA 1C29A 3SQLA 5I79A 1MFUA 4NNBA 2C0AA 4FK9A 1V6VA 5HR7A 3HV9A 1PS9A 1BWLA 3B9DA 9RUBA 1EX5A 3GNXA 4JY8A 3TC6A 1XM3A 3QW3A 5CPSA 1CECA 4Y8EA 1ZL1A 1XYLA 5BXRA 5I24A 3D6NA 2OQHA 1UR1A 2CHNA 1S3HA 4GQ0A 1V6WA 3SCSA 1W5QA 6TIMA 3HN3A 3CWNA 3CK5A 1JXKA 3PNZA 4PC8A 3T2OA 3ZJKA 1AMYA 4IQLA 2DT3A 3UD6A 3CAWA 4AWUA 2VCAA 1XLCA 2GGJA 2WWDA 2YCLB 1V02A 4NIRA 4Y6GA 3TJLA 4IWWA 4OTKA 2GSHA 3ICJA 4J3TA 3MHFA 2OQYA 3RMJA 1GORA 1QHZA 4QR6A 4F0SA 4QG9A 2J8GA 2VC6A 4ICNA 1UB3A 3UWWA 2PP1A 3UXLA 4HOWA 3L4TA 3KOFA 1XX1A 5FJIA 3DFOA 3YPIA 6REQB 4B9ZA 5E09A 1EO5A 4NZ3A 1FP8A 5BOOA 5GNZA 3H2AA 4Y2WA 5G5IA 3MC5A 1JVNA 3E5BA 1JNDA 1FWRA 3KZSA 4Z0SA 1XSJA 4PSPA 3SJ3A 2CLLA 2X2YA 1U22A 3O05A 1OYAA 3W7GA 3EKGA 3HZ3A 1IIHA 2W62A 2C18A 3KTCA 3TCSA 1FFQA 1G7VA 2C15A 3LI0A 2FZBA 5XIMA 2CYGA 4U3CA 3GWQA 3H4GA 1BF6A 2PU0A 3TQVA 2VD9A 1BWVA 3RXZA 4UR7A 4GQBA 3B06A 1PBGA 4GCAA 1N8IA 3M5XA 2ZZ2A 3T8QA 1S39A 3GLCA 3TV8A 3THCA 3EX2A 2ZX8A 4TXEA 2GVLA 4TV6A 3BXWA 2P5NA 1W2PA 5FOOA 3LBMA 1J01A 4Z1DA 1XUUA 4Z2IA 2YYTA 3JUGA 3V36A 2AQOA 5D9PA 4INFA 3TKFA 4DEFA 4YCOA 2G5WA 1UP3A 3ZT6A 5C9ZA 3AIBA 1OCQA 5H6HA 1XPYA 4HN4A 4IMGA 2CESA 1CBGA 4RE2A 1Z7AA 4H9ZA 3NQDA 4S1FA 3W1XA 1R7OA 4ZEPA 1LRQA 4TVDA 3W7MA 3A64A 4DPQA 3WNOA 3OHMB 4JX4A 1OFDA 2WHJA 2OMAA 2OZ8A 4JIHA 2QCCA 2V2HA 2P10A 3C4UA 4LT9A 1QPNA 4DF1A 2FZMA 2WNWA 1YQ2A 1E72M 1ITQA 3ZT7A 1DWFM 2VRKA 3A9IA 4FNRA 3TAOA 4ML4A 5A6TC 1MMFA 4G5DA 4AWSA 3OZYA 1WDQA 2NT0A 5D2WA 2XN0A 3L4UA 4PB3A 1FXQA 2OZ0A 3G1AA 5K4ZA 2NW0A 2C71A 4V33A 1ESWA 8A3HA 4JKMA 3WL0A 2PLJA 4UTWA 2FPYA 4UTMA 3ITOA 4WXZA 2EG8A 2X40A 4H83A 4G9PA 4LV9A 3PULA 4A2RA 1B9BA 3AXXA 1OFRA 4L6DA 3ITGA 3NM1A 4L7ZA 3BJTA 4L56A 1H50A 1E9IA 2BWGA 3LY0A 4XBKA 1VFHA 4S3GA 4RPPA 1GQLA 4JPGA 1FWNA 3LX9A 1DJIA 1TV2A 1O5XA 2PRMA 1V0KA 3PSWA 4JL2A 4DO7A 3NL2A 1B31A 1BG4A 3VPLA 1M04A 4N6FA 1UWTA 5REQA 4DWSB 4WJ8A 2IQTA 3JZEA 4E0CA 2ACSA 2RJGA 3PZGA 4J7RA 4C7GA 2AAAA 3K46A 1XJBA 3EDDA 4Q6XA 1H7WA 1X1ZA 3UNTA 1HVQA 5I06A 3W22A 2DZUA 3ZJ7A 5IOBA 4ZE5A 2IQDA 5CLTA 1NFPA 3QXBA 4UOQA 4WSKA 4AHPA 1E6PA 2RKXA 4AIUA 3WENA 4WGXA 2Q71A 5HJYA 4WZHA 3TUUA 2GWGA 3S2MA 4DO4A 1N8WA 1GPFA 1RY8A 2XVPA 5LIKX 3AISA 2QNEA 5D37A 1OX5A 3D0CA 1K77A 2PDNA 1TPB1 4MB1A 4R88A 4O1FA 4AB4A 1XDJA 1P0KA 1WZAA 3PFRA 4HMCA 3HF3A 4NJHA 3UJFA 2WPGA 1KM5A 4I90A 2PODA 4QCFA 4L6HA 1H63A 2GK1A 1GKPA 2QDHA 2F8QA 3IUIA 4DF0A 1UA3A 4IX2A 3ARZA 3D47A 4X9YA 1M9HA 2YX0A 1MEWA 2ZOXA 2E4TA 3ZR6A 4M6VA 1BG9A 2G97A 2QCMA 3T40A 1Q8JA 3IK4A 3KCJA 1UOKA 2V5DA 1W8SA 1KXHA 4R3UA 3QZ6A 1R2RA 1K7FA 3KCOA 5BROA 1OX4B 1XDLA 1X6UA 5HMFA 1PZ3A 3VIKA 3LN3A 1VBGA 5A6MA 1OGSA 3PPFA 2IPJA 3CUJA 3HU7A 1RP9A 2IW0A 4GD0A 1Q6QA 1FH7A 2Y2WA 1DXIA 3T05A 4MJMA 4UTWC 4QXIA 1UD5A 4AXNA 4F9DA 1TWDA 5EU9A 3U6WA 1LP6A 2BY2A 1NELA 2B4GA 3UPWA 1CLXA 4H01A 3QRHA 4A6GA 2QAPA 1WUEA 1CZ1A 1TJPA 4AZ7A 4CCZA 4XZMX 4PRTA 3FYPA 3SN1A 5A6AA 3DEQA 3N9RA 1VFMA 5AHNA 2Y6ZA 3CT2A 3EOUA 2UWFA 3UNDA 2ZA1A 3QR0A 4LF2A 2UV8G 3DZ1A 4IPLA 3VKAA 4HU3A 4E2VA 3RX3A 4E38A 3ZXWA 4KKXA 3WYZA 1NWUA 3GFYA 4Q4QA 3GBDA 3S5YA 1BEUA 4Y90A 3GTNA 3CIWA 2FGLA 1PKLA 2HK0A 3HURA 5G4EA 3PG9A 2WJDA 2FVMA 2UY4A 1PIGA 2WANA 3V4BA 4AF0A 4GNKB 4ZO7A 5C9UA 3WQDA 4H9UA 1FVPA 2WVVA 3W7RA 3D3AA 2BGSA 4IJRA 3DFNA 4AZCB 3P8JA 4YYFA 3Q58A 4DXKA 1G7UA 4DPPA 1R3WA 2VZSA 3A24A 4GUJA 3K8LA 4JZ5A 1QK2A 1NDZA 3TH6A 5I03A 3WDJA 4ALDA 1QI4A 3EOOA 2CCRA 2JKAA 2V6AA 4WUIA 2VOTA 4FLOA 2GYIA 3BZJA 1JUEA 1ZLPA 2E77A 3P5ZA 1XQKA 2VRQA 5ABGA 3W84A 4P7RA 5G4WA 4AZGA 2OJPA 1MYRA 3APTA 3G6LA 4MB5A 1ICSA 3MSDA 2PPGA 4B3KA 1S5VA 2NLIA 2XH4A 3R8GA 1CT5A 3LNMA 2VYOA 1UC5A 2A7PA 3KRUA 1VAHA 5CPLA 3SADA 4IIGA 5CXPA 3W25A 1JDCA 4IIDA 1SFSA 3GVQA 3W1RA 1R8LA 1VLWA 2VFFA 3PPCA 1K9EA 1ZAHA 2Y7DA 3R1ZA 3D46A 3E3HA 4JIPA 3UY8A 3LXBA 3QMRA 3KRSA 4CKQA 2X1IA 4HPJA 3KRBA 3E5PA 2ISSA 4W87A 3WQEA 1O5KA 4BFAA 1PJ9A 1SZNA 2J62A 3AJXA 1EIXA 4XAGA 1MDRA 4JTFA 3GVRA 3K8MA 5DFAA 2GSEA 3A23A 2P1FA 1JZ4A 2JE8A 2NQ9A 3IGUA 1JDAA 4GPNA 4WDWA 2WAGA 3T0TA 3Q67A 1CX9A 5LNWA 4XZ9A 2O9RA 1KM0A 4M1RA 4ATWA 2V2DA 2UY3A 3ITYA 1AODA 4JYFA 4O18A 2V5KA 4TR9A 1HP5A 4OQVA 1PKNA 4CCDA 4B5WA 2Z7KA 4HN8A 1JEZA 3VNYA 1AW1A 2X1UA 2GGEA 4OUIA 3GDMA 4MG4A 2I5QA 3RPMA 4QCEA 2V3DA 3NPVA 2PF8A 3BZGA 1TYGA 1Y5XA 1AMKA 3V1PA 2I5GA 2W6RA 4TTUA 1PCKA 1U2YA 2Z1XA 3MMUA 5I23A 5BMWA 3HGOA 2OZTA 3N4EA 3URAA 1EP1A 1UMYA 2VX7A 3RLGA 4QHRA 1ZY9A 4EWJA 2J27A 3K4DA 3L65A 5HBFA 2BVWA 4LGXA 2INZA 4TMBA 1J0KA 2GLKA 2ZUSA 1J5SA 4S23A 3DUGA 7XIMA 4O8RA 2G3NA 4X2PA 2WSRA 4WDXA 3RUBL 1NVMA 3LNPA 5DT7A 4EXAA 3LCWA 3C8NA 5D8ZA 3M0XA 4E8DA 4PFMA 3DYOA 3M6YA 1UD2A 1JZ5A 1ZBWA 1ZAJA 1JULA 3KL3A 3GS6A 4H9VA 4M6PA 4KWOA 2DP3A 3LTSA 2HJPA 4EF8A 4E4PA 3L2IA 4RPQA 5J5RA 4ZO8A 3UYCA 1HQTA 1HJSA 1UMLA 2ZZ6A 4BI6A 1RHCA 4HNLA 4DBSA 2R1NA 2P3EA 5H8MA 1K8CA 3N2XA 3LS9A 4MJZA 3UT0A 2ZRZA 1OFOA 2PTXA 1XLBA 3KVMA 4PUMA 2WWCA 4HYRA 4IXHA 2YOCA 3T1GA 2VX5A 5ABFA 1UPMB 1ZBVA 4RDZA 4A2SA 2WQDA 1V0MA 1ONXA 3NQGA 1TPFA 1E4MM 3BCFA 3GBEA 4GIRA 4CD5A 3FJ6A 2WCAA 1JDFA 3VOGA 2YZRA 3HFYA 3VNIA 5H2ZA 3ANYA 1JFHA 4ZR8A 3VNZA 1DKWA 1XXXA 1JD9A 4CCEA 3KWXA 1FWAC 3PZVA 1LOLA 1WAWA 3VGGA 3PJWA 3LV5A 4HPNA 4IT1A 1CYGA 5C55A 4Z1BA 5GQBA 1WV2A 3LCHA 4AY1A 4GK8A 1G0CA 3LHTA 1YDVA 3PK7A 3JZUA 3R11A 4TUFA 3VIHA 2ZFAA 1GQJA 1LM1A 4QP0A 3VNMA 2CBJA 1W1YA 3UWEA 2GDVA 1HGYA 1UH4A 4ERGA 3VIJA 3H53A 5LSMA 3WX7A 4ORIA 2FLIA 2BXYA 3MHUA 2O56A 3FKRA 1PX8A 3S9IA 4MWAE 2EO7A 1TCDA 2D69A 1XRFA 1B4EA 4I9MA 1X96A 1EF2A 2W3ZA 4HA0A 4LUTB 2J66A 6TAAA 2J7CA 2Z00A 2J9ZA 3RFAA 1US2A 4UNIA 1Q2SA 4N4QA 2QGHA 1BXBA 4I3GA 3W7OA 4N0RA 2TPSA 3VD5A 3V5CA 1NDVA 1U5HA 5EFDA 4AEOA 4W5ZA 5DX7A 1AD4A 4Y9PA 1C8QA 3UXDA 1BYBA 4AZ5A 4U28A 1YHTA 1RD5A 2X16A 1J2BA 3OYZA 1XP3A 2PLMA 4E2BA 4H8UA 4F40A 4O1AA 2VFIA 4L61A 2F6KA 1SMDA 1AD1A 1GVFA 1D8CA 3TWBA 1Q2RA 1DTNA 3WQOA 2W66A 3LQGA 5DMYA 1T96A 3NQ7A 2QV4A 4JYDA 4L4OA 1XCXA 3UG4A 4MSSA 3WJZA 1J79A 4KF1A 3RK8A 4IIHA 2P0OA 4IIEA 2A7RA 1DBTA 2OTDA 3TQKA 5C9XA 1KR1A 5CG7A 3H8AA 3RCYA 4B16A 1X6LA 3LK6A 2J77A 1ZJBA 4ORMA 4XG1A 3KWSA 1TPVA 3URQA 2BS9A 4IIFA 4RKAA 3GIYA 3T07A 2CPUA 1M7JA 1UIOA 5I3HA 1T40A 1YNQA 3LD5A 4GUGA 1E1FA 3SRFA 2E1DA 2F7FA 1E4LA 2QCLA 2J7EA 4GUHA 2HNEA 3EWDA 2DGAA 5F4WA 1XV8A 4Q6JA 5C71A 1DWHM 1CB2A 1KFWA 2OGYA 3THUA 4A3QA 3CTLA 3SB0A 4IQDA 3HOJA 4W9TA 4UQEA 3NEVA 5EL1A 4PL2A 4FOKA 3ERPA 1QCWA 4TTGA 3WF1A 3FS2A 3JW7A 1J0IA 4EACA 3TW6A 3E0IA 3VD7A 2VR4A 1IXPA 1JDDA 1XPGA 4H7VA 1TQJA 4ZQRA 2IXUA 3B8WA 1OK4A 5M03A 1RK6A 1UUOA 5C6MA 1JAEA 4NJIA 4LANA 1K8ZA 2GSJA 3IIOA 1TWZA 3N12A 2CLOA 4MLJA 5TIMA 2XHYA 2XH7A 2ZWZA 5HR6A 3L9CA 1DJNA 3NL3A 1J0ZA 3SR7A 2QPXA 2BTMA 4GQQA 3QKEA 1A4MA 3UG5A 3P93A 4FPSA 3BSMA 4AC1X 2ISVA 5K3VA 1VYRA 4QQ3A 4WCJA 3CQJA 2WCGA 2YDSA 1HGWA 9CGTA 3M44A 1YRRA 3SIMA 2I57A 1VIWA 4ERIA 3RLVA 1IR2A 4GY7A 1OC6A 1NIUA 3NFUA 4XSMA 2ZUTA 5HNUA 2QULA 3B8IA 1F2JA 3TZNA 4EAMA 3VOFA 3LHYA 1K02A 4JQAA 1IXOA 5TQLA 1TIWA 4JX6A 4CN4A 1XG3A 2QUNA 7ODCA 4G7FA 4IL0A 2QLYA 3B0PA 4LBUA 3JR2A 4NY2A 5J5DA 2PDPA 1HX0A 5I0DA 1K4HA 1G4TA 4ZQMA 2QJNA 2Y7EA 1V3KA 4D6JA 4LW7A 4M6UA 2V38A 3H24A 4RE4A 1BGGA 5G2IA 3SSZA 4AWTA 3GXPA 2ISDA 1G6CA 3SFWA 1KM2A 4IL2A 4LUYA 1DJZA 4CQ8A 3WD3A 1PTDA 3DHUA 5I09A 3ANUA 3G6MA 2CLFA 3THDA 3F1QA 3FA4A 4RR4A 4JXCA 3IJ6A 3NZRA 4U4MA 1J8VA 4F2BA 2FHCA 5HMSA 2HPIA 2YXXA 3VIPA 1GUVA 3P67A 3WQPA 4WQ6A 5CCZA 4AEFA 2RGMA 4LYPA 2BXZA 3F7JA 2WB5A 4PUUA 3K13A 2HEJA 3LRKA 2DZVA 4QJ3B 4P7NA 4IICA 1XLDA 3BLKA 3UZWA 4WY0B 2EBNA 3AHTA 3HIJA 3ABQA 1X98A 4JEQA 3TTQA 1EJTC 4UZSA 3QH2A 1Z32X 3PTKA 4F0HA 4NJKA 2ICSA 1OSEA 1OGBA 4GG9A 1NTHA 2PZ0A 2VHLA 3TX9A 4K7VA 3UCDA 4XVEA 2YDAA 2F2KA 5AC7A 1GGOA 1ICQA 1C7SA 3O6CA 3KRZA 1K8YA 4AZIA 4ZQNA 5JMUA 4GO9A 4AVNA 4PCTA 3MVTA 1H2JA 3TSDA 2QKFA 4Q8PA 2VCCA 2WYSA 3VM5A 1TUXA 3TCEA 3VCNA 4XBSA 3DOPA 1SSGA 1QU4A 2YL8A 3UF9A 5IDIA 3LTPA 3MY9A 4IF2A 1FX6A 1B30A 4Z17A 2AMXA 3LPGA 3DX5A 1CGTA 2ZIDA 4P61A 3M07A 3CUGA 3PVFA 2W63A 4CEXC 2JFEX 3ZSTA 3K4WA 1YTKA 2PCEA 5DBTA 3CYVA 2XVNA 3T4CA 3M64A 1V0NA 4FNSA 1C93A 1QHPA 1XCWA 2CXGA 3VNDA 6ENLA 3AI0A 3GYEA 1ML1A 3H7VA 4UC5A 3UZ5A 4AX7A 1F8IA 1QFEA 3NPXA 5A8NA 2C0HA 1AZ1A 1XSKA 4XO6A 1FWBC 4GI8A 3FEMA 1ZBKA 4BF5A 3QGAC 4JL1A 1EJWC 3M41A 3HGSA 4NRSA 3OYXA 5K9CA 3ARWA 3DXIA 3NQVA 1LWIA 2NUWA 5H1WA 1AL7A 3VNLA 1XC4A 3D5HA 1KKRA 3EB3A 3MVIA 4ASTA 1K9TA 4DN1A 5AECA 1R7AA 5ABHA 4RNJA 3WQCA 1JGMA 2C19A 3GTFA 3F2DA 4DAIA 2CXEA 4AYSA 3COTA 1TV3A 1XSIA 4H19A 1W0MA 4DM2A 3L4VA 4Q22A 3BCJA 3L4YA 4MGGA 1TJ2A 1XRVA 2H8ZA 2WOQA 4JTJA 1OFQA 3WLHA 4TMCA 1V3IA 1MNZA 3FJNA 4FMVA 4HJWA 4XTDA 1S1PA 2NWRA 3BLFA 4GH3A 3QTPA 1CNVA 3R0UA 1CGUA 4YVXA 5LHEA 1F6PA 1ZRQA 1MNSA 1KGUA 4JOMA 1PTAA 5BU6A 3H21A 4Y9OA 3G1DA 3FEQA 4RLIA 3U48A 3B0UX 4LYRA 1H7NA 5G2HA 5GJPA 1UR0A 2H8XA 5KZ6A 3GG7A 2CHRA 2OODA 4HCLA 4IG2A 2XISA 3CNYA 2QQ6A 2XSXA 1P0DA 2A6LA 2XIQA 3NQBA 2C1GA 2OO6A 5GNXA 3W7CA 3TR9A 3WH8A 1KCXA 3LEPA 3LHVA 2PB1A 1NWSA 3MUZ1 4YU1A 1UC4A 1RQBA 3RPDA 3I10A 2YIHA 2X2GA 2JEPA 1XDMA 4V15A 1IYXA 1EYWA 2PDKA 1PZ1A 3G3DA 3GHTA 3MMWA 3WD4A 2Z6IA 4C1LA 1E3ZA 1WB0A 2QPUA 4KIEA 1TA3B 1ISYA 1XBZA 2ACUA 3VM7A 2V30A 1WQ5A 3GNNA 4MZYA 1NDYA 3MI6A 3EB4A 3PB2A 1PDYA 3QOKA 1JNEA 2ZDSA 3JU2A 4H8VA 5JH1A 2J8FA 1A3WA 1UJPA 4J2MA 4H9YA 3EDJA 1CLVA 3FIGA 1CW2A 2P76A 1GKRA 1JR1A 2ZQ0A 4HYVA 4G1NA 2IQ0A 3LZ3A 1OZMA 3U3HA 3IAQA 4JX5A 3VOJA 2A3LA 2F2HA 1W3HA 4GLEA 4PR4A 3DENA 3P60A 3TYDA 5EMUA 3ITLA 3OGRA 3EPOA 1UJQA 4IX0A 1J11A 1LL7A 1NU5A 1PUDA 4CQAA 4LC6A 2BLEA 2BVTA 4RW5A 1KCZA 2Q02A 1F3TA 4NX0A 2PBGA 2Z26A 3O15A 1GJWA 1E6RA 3CZEA 1QASA 1BPLB 4MY9A 4J9JA 3VD3A 3P81A 1HIZA 4GZIA 1NF7A 1JPMA 5KINA 1MW3A 3OBKA 4MWAA 1OQFA 4K2SA 3CU2A 2QCDB 4BA0A 1M65A 1BD0A 1Z41A 3CXOA 3SCNA 3A4JA 3G1FA 1RY0A 3QZEA 3IPWA 4D6GA 4IGMA 1Y5VA 1O12A 2OEMA 3I65A 3HGRA 3WLPA 2CLPA 5D30A 2F9RA 5D4YA 2FZ8A 1W8GA 5CKSA 3PN8A 1KM3A 3O2LA 4A3UA 1XBYA 1GOWA 4K37A 1TTQA 2X0YA 3OZOA 4D6DA 2ZZ3A 3G1XA 4Q7BA 2V0TA 4DF2A 1WYIA 3CZLA 3RLUA 1PXGA 2HVMA 1XFBA 4KPLA 4MJ2A 4LBSA 1TJ0A 1B2YA 4L4PA 2J88A 3TFCA 1GOMA 5A6SA 2OSXA 3MKKA 1XD0A 2HE8A 1SM9A 2DU2A 1JZ3A 5B80A 3E12A 3JS3A 3BGAA 3CLMA 2ON3A 3LGGA 2QIIA 4PEEA 1FUYA 1V3HA 4A29A 4QE1A 2E6DA 2MANA 1ONEA 2VX6A 3WO8A 3UZJA 2OYMA 2VZTA 5HJLA 4R85A 1I6NA 4W86A 2WV8A 5E9XA 4JCLA 2R91A 3KTXA 5E6ZA 4AZHA 3LB0A 3SCWA 4XUYA 3CHEA 2KX9A 1AH0A 5A95A 5BXPA 3GW0A 3LDVA 1CWYA 4IH3A 4DJDD 3LMZA 4S3EA 3PAOA 3C0SA 4V28A 3LRLA 4P7QA 1N2VA 4RXGA 1G01A 3BV7A 4GY0A 4B4HA 5IDZA 2X7WA 1V3MA 3GXMA 3H2NA 2DZSA 2XINA 3T0BA 3M1ZA 4LTSA 3P74A 5CZ0A 3W7IA 2A79A 4OGZA 1F3WA 2OXNA 2ZTKA 1YTDA 3CL8A 4BZYA 3QMSA 1E0WA 2L5HA 4R53A 4C6KA 1PZ2A 3VKBA 4PULA 3BLLA 1X6NA 1D7KA 3QPYA 5IM51 4Q8QA 3MPGA 1FWDC 2VELA 3R58A 4N9EA 3HO8A 3P80A 3EA1A 3AS0A 1G67A 3H2MA 4DX3A 1V51A 1XWYA 1XIGA 1TMLA 1U5JA 4WD0A 1FWTA 4NZFA 4M7SA 2R1MA 4QG8A 2VR2A 1SW0A 4GYFA 4C6NA 3V1HA 2P53A 4IMEA 2YGYA 5E0CA 3TIMA 4D6FA 3WQ6A 1XYAA 1W3NA 1E9ZB 3U0HA 4NJJA 1EQPA 1EC8A 4U31A 1WBJA 1JI2A 4PUKA 3OVGA 3HV8A 3M0JA 4Q3MA 3GXTA 5EMKA 4MWAC 4PTWA 3W71A 4PTNA 3EBVA 3MKVA 5D9MA 2HDJA 2W5FA 5AYXA 4P8WA 1XBXA 2BODX 1BKSA 5DEZA 1TX0A 2H9AB 3RG6A 1LYXA 2FMNA 5C5YA 2VO5A 3W26A 1Z42A 2CIPA 2VM8A 3PAJA 3IANA 4WHBA 3AYVA 4W8AA 1SYTA 3G0SA 1RJQA 2E9BA 2RDUA 4HHLA 4NVTA 4GBUA 2HZGA 1KW1A 3BGGA 3BOLA 5FCZA 3BSHA 3SCPA 5XIAA 1F74A 1H4PA 4ONVA 4UCGA 4GISA 2DVUA 5FAGA 2ZRVA 5HPCA 3WMLA 1BRLB 4OUEA 2PP0A 2OO0A 3VNKA 5BWFA 4NRRA 4XZBA 3KTSA 3C2FA 3DI1A 3GIQA 4D6CA 4YCPA 1XH1A 1TPH1 5DMMA 1KTCA 4O17A 3SUTA 4PCSA 2OSYA 4FB7A 2DSWA 1WXJA 1O4UA 3S83A 4PMDA 3EDFA 4GO8A 1Q7MA 1QNSA 3AIVA 3MSRA 1VB9A 3BAJA 4R9XA 1SJAA 4JFVA 4FR1A 4GC3A 3ABRA 2G8ZA 1DYSA 3LHWA 3WNKA 1KBJA 2NVDA 1VF8A 1GOOA 2Z7GA 3A3WA 4AD4A 3EZ4A 1RAKA 2BZNA 4Z2GA 1PKYA 2WW5A 4DHGA 1I75A 1BQGA 2PTWA 2R1PA 4BS0A 1EA9C 1UD4A 4PBGA 4ES4A 3TTYA 1RJPA 3W28A 3W1LA 5IHSA 1FWCC 4PRRA 4C6IA 4ADSA 1PKMA 3R5EA 3FJ4A 4JDYA 1LQ0A 2EAWA 1UZDA 3N6JA 4LV4A 2QS8A 2YBTA 3R43A 1KRAC 4M3PA 4GWEA 2OEJA 4J3SA 2WMIB 1N7KA 4O0ZA 4O13A 4ZQOA 3URNA 4WKHA 1AQFA 1ZQ5A 4H04A 2VCBA 3VKJA 2D20A 3U2CA 4WY0F 1E0VA 1HZYA 3GX9A 3CTTA 1E1CB 2C1IA 3F2BA 1ALDA 3MUIA 1W54A 3M0LA 2JEQA 3OW1A 1Q6GA 2BSLA 1MW0A 4PMUA 1JAKA 1VBUA 4J40A 4W93A 3F2CA 1GQNA 1F05A 2NV9A 2DZWA 3BJSA 4LS2A 1XFCA 3WJSA 4P7OA 2PWEA 3GTIA 5M17A 3GH5A 1SW3A 3NQ2A 3WK3A 1RV8A 3CHDA 1KD0A 1LL6A 3L5MA 3LHZA 2I5IA 1F61A 4F3HA 1SZEA 3B0VC 2YL5A 3EMCA 4QDPA 3U4AA 5I3JA 1GVOA 3CIVA 3GDKA 3MU7A 1ADSA 3WD0A 3IVTA 4HSHA 3MP3A 1E0UA 3ES7A 4ZOCA 4UTTA 3W0KA 1MUWA 4DBEA 1YPXA 2FMOA 2PLCA 4ZMGA 1JG9A 3G1HA 1WO2A 2PDWA 4HB7A 4PSRA 1XGDA 3SY5A 1GEHA 3O6AA 4CU8A 4WKAA 1NDWA 5CJNA 4MZ1A 3HJZA 2NQZA 4YVPA 1D8WA 1WA3A 3OHIA 4HQVA 1E4NA 1XL9A 4KT2A 4RDVA 1FDZA 1QMLA 4C6OA 5HQLA 1YNPA 3WBYA 3MDWA 1UWIA 1ZZMA 2OWWA 2Z24A 4EPBC 1Y65A 1XKYA 4PMQA 3WK1A 5LNUA 3NXFA 3CL6A 1D3CA 2W27A 5I00A 3N29A 2YA2A 3LSCA 3GXDA 3KBNA 1JCYA 1UOZA 4GC4A 4Z1AA 1E71M 1E55A 6CGTA 1XLHA 4N4PA 1SJDA 4KCWA 5HQMA 4CD6A 2HCVA 4H4IA 4UQBA 1QBAA 2GQ3A 4ILSA 3RM9A 3ZZ1A 1W9BM 3AROA 2CBUA 5DLCA 3DG3A 3W7DA 2PC4A 3S1XA 4V1YA 3VFCA 2WK2A 2NXIA 1H0IA 4Y7EA 2GDUA 4F66A 3PBWA 2D2JA 4LYQA 5E1QA 2ZUNA 3MP4A 3W6MA 4RZ5A 3IV3A 2ZX9A 1L8PA 3MSYA 4B92A 2WM0A 2CWNA 4PTDA 3LHUA 2ZZ5A 2E9LA 3N9KA 4LUSA 1WNOA 2F6XA 4BQ4A 5LNSA 2TYSA 5PTDA 4O28A 4J3ZA 1WXYA 5I77A 4FOUA 4JFUA 4O0QA 3NYDA 2EG6A 1UR3M 4WJEA 5JXQA 3GSMA 4U2ZA 1Z89A 3HPFA 1SUXA 2TMDA 4H2HA 3NOYA 3LLDA 1H1NA 2ASHA 4AEEA 2VFGA 1TO3A 3JVAA 1V03A 2J7BA 3FSUA 3R12A 3CJPA 3W37A 4IGNA 2VGIA 3PY2A 3WLTA 2FVKA 4GIYA 4GRSA 1ME8A 1UZHA 1EWEA 1O66A 3W86A 2W0UA 5EPDA 3KVLA 1IEVA 2IS7A 3L12A 1AJZA 4RE0A 2Q09A 3PZMA 4B5SA 1FRBA 3ABOA 1DE6A 4CVUA 4F2UA 1GT8A 3OQ8A 5LGXA 2D22A 4UTTC 5HNNA 4J4KA 2HISA 4KGJA 4GI9A 2RDXA 2JIEA 3UGRA 4C6EA 2YCLA 4ZTYA 3QGVA 3FX4A 1KKOA 3OIXA 4PA8A 3KP0A 3M4HA 1XLFA 4NXKA 4N9CA 4LFYA 3UU0A 1IZCA 1FXPA 3DECA 2E28A 1MXSA 3H55A 3MUY1 4ZZ9A 2ZADA 5D04C 5D2XA 2OLAA 1KCKA 6REQA 1HO4A 1JPHA 1KGXA 5AVNA 2CHOA 1FOBA 2FYMA 5AN7A 2ZRXA 2BX7A 3LUTA 4EPDC 2Y70A 1KM4A 2RFGA 3K1GA 2ABAA 3R2GA 1QOPA 1A3HA 3QLLA 1WCGA 4KW2A 1FA2A 1B3OA 1QW8A 4JTQA 2GPTA 2FFCA 3P6LA 1H5VA 2NXHA 3NZGA 3QV8A 4NKCA 1EXPA 3BV4A 1DJHA 2V3GA 3WQVA 2X1SA 5IFPA 2PTZA 2WLZA 4F0RA 3M7WA 3M5ZA 3LLXA 4DJEA 1QPOA 4D1IA 5AHFA 2Z27A 4QBXA 3S9ZA 2OGJA 2DFAA 1HNYA 1EGMA 3WDPP 1IXQA 5GNYA 2BVDA 3OBAA 5G1TA 2VGBA 4IFKB 4MFEA 2WLYA 2WKGA 4B5NA 2DT2A 1ISXA 4HSOA 3I7RA 3WEZA 1QVBA 1SVDA 1EUNA 1ME9A 1VBJA 4S3CA 3QV7A 1UKSA 4YNGA 5LA0A 1XD1A 1B5TA 5LIYX 1UWAA 2PLKA 4XZIA 1WP6A 2ZICA 2FGZA 1WKYA 1QBBA 3R8RA 2BXVA 4U5IA 2OLHA 1LUCB 4US5D 1QI3A 3FOKA 4S3BA 2E8YA 4PUWA 4PRWA 3FV9A 3RNDA 2MUCA 4YHGA 4AMCA 1NJJA 1S5WA 4PH6A 4ACZB 3ZOAA 4Z08A 4D71A 1WKFA 2GVJA 1V02E 2XSAA 3G2GA 3AYSA 2PWFA 1UR2A 2EPNA 3H22A 1XGEA 4BK9A 3WIJA 1MEIA 4LY4A 4XTIA 2O9OA 1H1YA 4HU0A 1E4IA 3E0WA 1JCXA 2CITA 4W7VA 3PNUA 1ME7A 3VX0A 2D1ZA 4W84A 4N6EA 1QATA 1KFKA 2VEKA 3TW9A 1FWJC 4S3AA 4LY8A 4LCSA 3AICA 1T5AA 2GK1B 3CLWA 4H1ZA 1NY1A 4HJFA 5AC5A 3CB3A 1S5NA 1AUSL 3PG8A 3KP1A 3TE9A 3GDLA 4C1KA 1T8XA 4ZBCA 4HMDA 4RZ4A 2D2GA 2OWXA 4KRUA 1P6WA 3I4EA 2VC9A 1XLAA 2D3LA 4G56A 4BJHA 4I6VA 3OGSA 3VMPA 2J75A 3R13A 3GDRA 1FWHC 2VEPA 3NQ6A 3E0VA 4Q8OA 5AHEA 1OABA 2GUUA 2ZRYA 3M43A 3VIIA 2ZZ4A 5AVHA 3G22A 4Q8TA 4DJEC 1SJCA 1TVNA 2V5CA 3HFTA 2A7NA 4QX4A 1V7AA 3I3DA 3UQNA 1N55A 3QR1A 1YE6A 1V6TA 4HK5A 4NUWA 1VYSX 3EDEA 3UWZA 3I4KA 4Z1YA 3AUJA 4DXVA 4G1KA 4H2CA 2Z1BA 3FVMA 2AMGA 5CGQA 4F0MA 3NQ8A 4KRTA 2PDIA 3REQA 3W1QA 3C2YA 3BAKA 1G1YA 4LVDA 5A8OA 1XLIA 2PAJA 4N9DA 3OVQA 4CQCA 4HMNA 3SUUA 3SJNA 3LRMA 1Q6EA 4GVIA 4LB4A 3GKFA 4BWLA 1DJYA 2PURA 3ARUA 3TOPA 2E5DA 1GVIA 4C6BA 3KVJA 3WLOA 3APYA 5A94A 3N2OA 1UYQA 3SN0A 3FAWA 4Z0JA 3OVRA 1QOXA 1FCVA 2GJXB 3HPAA 3ZLGA 3FA5A 2CZVA 3VOHA 1JCTA 2VEMA 4RW3A 1E9LA 3GK0A 4GXMA 1CXFA 3MCMA 3AUOA 1WDDA 3FVDA 4HZ8A 1EBHA 1OINA 4PMOA 1OX4A 3DC0A 3S46A 3W02A 4AF0B 3V5FA 3ZMRA 5LA2A 4WVXA 3F5LA 5A1AA 4Y9MA 4N2YA 4DZ5A 2PDQA 3ENLA 3KOWA 3AALA 4O4VA 3LXCA 2PDXA 4UMCA 3LLFA 1OF6A 1E15A 3H6OA 3GXFA 1VFUA 1C9DA 1U30A 3AXKA 2EHHA 4Y9AA 3U4FA 3TYZA 3IVUA 4EP8C 3VVGA 1N8FA 3S5SA 1R46A 4CNPA 4HK7A 4S2CA 1CEOA 1MXDA 2POTA 3B9AA 5ABEA 4ZB2A 3SCVA 4PMJA 2OT0A 4AY8A 5SWUA 2C6QA 3UR2A 2VL4A 1MZHA 3BMXA 5U7SA 1P6CA 4ZTXA 1XYBA 4MNJA 4UZUA 1TG7A 2WJEA 2XN1A 3WLSA 5J8LA 3M0ZA 3PBGA 3R0DA 3P82A 4CNSA 2DSZA 3M9YA 3RITA 4S3DA 4EAYA 3KOXA 3ZS4A 3HPSA 1Z3NA 2EG7A 3FHAA 1A5BA 1RCQA 3GDBA 1KBKA 4I8YA 1A5NC 1YXCA 4MNLA 1GVEA 3VK5A 5F2LA 3TSMA 4GGBA 3KAOA 1WOAA 9XIAA 3M6DA 4QFUA 4NXSA 1IEWA 4XAZA 5FSEC 4KFOA 4ZQCA 3A12A 2GGHA 3SQMA 2OR2A 4B5VA 3SCUA 1W5NA 3SUWA 4R7WA 4YTUA 1XF0A 3K5XA 1EFZA 4LALA 2JGQA 2C13A 1I2RA 4JFSA 3NQEA 4U3AA 4WLCA 3S1UA 1AJ0A 4OBTA 3POHA 3S6DA 3SRHA 4BWLC 3OTRA 5C70A 5A6JA 2XG9A 1CLKA 3SCTA 3TSBA 1DWGM 4C6PA 4CNTA 1EA0A 5A2CA 3NZPA 4QJ5B 1R3QA 5CC7A 1NF0A 1TPWA 3WDQA 2QUVA 3CO4A 4LVFA 4DXXA 1QT1A 5DF0A 4UTLA 1TRDA 3EPNA 2FHFA 4AD2A 1DJGA 3WZ0E 1G4EA 2QJMA 4GA8A 3WQGA 1RXOB 3A3XA 4UTJA 1MQPA 2VD8A 1TR1A 2ZVIA 4RE3A 3AHVA 2OKTA 1X7IA 3H4XA 4JFWA 4JR5A 2ANUA 4CNUA 4M82A 4URIA 2GWNA 2A0NA 3GKAA 4WIWA 1VGAA 3K2GA 4BI5A 1NP2A 4MIMA 3I6EA 1PO9A 3UR5A 1JYNA 1SO5A 2A2IA 5TNVA 3WDRA 2PGRA 4GFSA 3AOFA 3B05A 1TE6A 1LF1A 2P50A 4KEVA 4TO8A 3SCRA 3NCOA 4M1BA 7REQB 4J27A 3GNPA 3MW7A 4ICCX 2LLEA 4NZJA 1D3HA 3ATZA 3LERA 1VH7A 1T41A 3FFSA 3AXIA 1YDYA 2X41A 3QSTA 4XZNX 1IEQA 3IUHA 5HUPA 2CLIA 4Z42C 2VWSA 1KC7A 4QNWA 1ZENA 1ONRA 4FZIA 4D2JA 4A22A 1I1WA 5ABFB 1HXJA 5DT5A