4LUSB

Alanine racemase [clostridium difficile 630]
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
382
structure length
373
Chain Sequence
KITVPTWAEINLDNLRFNLNNIKNLLEEDIKICGVIADAYGHGAVEVAKLLEKEKVDYLAVARTAEGIELRQNGITLPILNLGYTPDEAFEDSIKNKITMTVYSLETAQKINEIAKSLGEKACVHVKIDSGFQPNEESVQEIIELNKLEYIDLEGMFTHFATADEEYTYKQANNYKFMSDKLDEAGVKIAIKHVSNSAAIMDCPDLRLNMVRAGIILYGHYPSDDVFKDRLELRPAMKLKSKIGHIKQVEPGVGISYGLKYTTTGKETIATVPIGYADGFTRIQKNPKVLIKGEVFDVVGRICMDQIMVRIDKDIDIKVGDEVILFGEGEVTAERIAKDLGTINYEVLCMISRRVDRVYMENNELVQINSYLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical analyses of alanine racemase from the multidrug-resistant Clostridium difficile strain 630.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Isomerase
molecule keywords Alanine racemase
total genus 122
structure length 373
sequence length 382
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
B PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 4lusB01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 4lusB02
4KBXA 1EPVA 1FTXA 3WQFA 3NZQA 4Y2WA 4BHYA 3CO8A 2NVAA 4LUSB 3HA1A 4PB4A 3B8UA 1QU4A 3AWOA 2OO0A 2DY3A 4A3QA 1XFCA 3MT1A 2NV9A 3B8VA 5GJMA 1D7KA 3N2BA 5GJNA 2QGHA 3NZPA 1L6FA 1SFTA 4BEUA 4ECLA 1HKVA 1RCQA 1TUFA 3LLXA 1KNWA 1VFHA 3ANVA 2VD9A 1VFTA 4LUSA 1HKWA 2SFPA 3N2OA 1NIUA 4AIBA 7ODCA 1BD0A 3UW6A 2TODA 3C5QA 4PB3A 3E6EA 5GJPA 4LUYA 4ILSA 3B8TA 1W8GA 2RJHA 4XBJA 3GWQA 3WQEA 2YXXA 2ODOA 4DYJA 2RJGA 2PLKA 4LUTA 2VD8A 3ANUA 1F3TA 1VFSA 1B54A 3R79A 4ZGYA 3B8WA 5FAJA 4LUTB 1SZRA 2ON3A 3N29A 4XG1A 1XQKA 1XQLA 3AWNA 1TWIA 4BEQA 1KO0A 2PLJA 3VABA 1L6GA 3BTNA 3WQCA 1NJJA 2J66A 2P3EA 3SY1A 3CPGA 4V15A 4DZAA 3WQDA 4WR3A 4QHRA 1CT5A 4PB5A 5BWAA 3HURA 3S46A 3KW3A 5FAGA 4FS9A 3OO2A 5FACA 4BF5A 3E5PA 5IRPA 3WQGA 2O0TA
chains in the Genus database with same CATH superfamily
2WMIA 3MYPA 1FTXA 2EAWA 3G1FA 5C55A 5DF0A 1J4EA 2JE8A 3PP7A 4Z2GA 4XSMA 3B8UA 2V5DA 1QUMA 1O95A 3KCJA 4BQ4A 1OF8A 4Y8EA 4QJ3B 3S2MA 4DJEC 2HE5A 2CCRA 3L0KA 2VX7A 4NJHA 2Y61A 3BV7A 2DDXA 3BLLA 2ZOXA 3S2JA 2XH4A 3PBMA 3B0XA 4HPGA 1KCXA 3WF1A 2Y24A 3R5EA 4Q8OA 4RDWA 3T0CA 4ENLA 3W1TA 3D6NA 5JXQA 5F4XA 2R14A 3L9CA 3LERA 2IQ0A 1Y8BA 4PH6A 4EF8A 2CBJA 1DQUA 4IQDA 4AISA 1UP0A 2NXGA 1KBJA 4PFMA 1MVYA 2G41A 3H23A 1S46A 3S5SA 5JQ9A 4PUWA 2WSRA 3WF0A 4DN1A 1CT5A 3Q45A 5MHBA 3B06A 1HUVA 3VZXA 4JNYA 3IUIA 4E2OA 1M5WA 3S2NA 2Z4GA 4TVDA 3B97A 4O16A 4V1XA 8TIMA 3FYOA 1IWBA 4RPQA 4TXEA 2G0WA 1UWTA 1PJ9A 1V4YA 1Z8AA 3MQTA 5CPOA 3UWYA 3ARSA 1ME7A 2G5WA 2XIBA 3KWXA 3TTEA 2CWXA 2XDFA 4AMAA 1JCJA 1GOXA 1R2RA 2UV8G 1SW0A 3FOKA 3FGCB 4GINA 4B2DA 1D2KA 3UD6A 2E09A 4DEFA 4X22A 3W22A 3NTYA 3HG4A 2YBUA 2BY3A 2RUSA 3B9NA 5IM51 1W1ZA 1C8XA 2WO5A 3BGGA 4PMXA 4M24A 3Q2DA 4A8IA 1PKNA 4AC1X 1GOIA 4IQJA 4FNPA 4HIBA 4IPJA 2ADAA 3CU2A 3H2AA 4J5NA 3PS7A 3GXFA 3H4WA 4ERAA 2V38A 1IGSA 4KFNA 1GVIA 3PSWA 1GEHA 4UFHA 5DMMA 3GYCA 5HANA 3CM4A 2GGHA 3PJWA 3WX7A 1I6NA 3WSUA 5A6BA 3PSVA 2VFIA 1LJYA 5HMDA 4BY3A 2PI6A 1OK4A 1RV8A 3PB0A 1PE1A 1OC7A 4EK7A 1OY0A 4H3DA 2Z27A 5HULA 4GI9A 3NQ7A 2DVTA 4LVGA 3TTSA 3PNZA 1XBXA 4I5UA 5FF0A 4OZOA 3DFHA 4QR6A 1S1RA 4M7SA 1QT1A 5EMUA 1T6MA 2D24A 4US5D 3SIMA 3EWCA 5FJIA 2Z24A 5A6MA 2CBVA 4DI8A 4N9CA 5DANA 4XK2A 4C1LA 1H7OA 3W70A 1G94A 1MXSA 3FSUA 1NAL1 1SU5A 5I07A 5EU9A 1Q6GA 3DFTA 4EXAA 4UXDA 2YLAA 3ZLGA 3D47A 3O7UA 4J28A 1A4MA 4HSOA 1IV8A 3EXTA 5FCZA 4WDXA 3QBUA 2V0TA 3RRXA 2C6QA 5A6BD 5CG7A 3PUGA 2HNEA 4LCRA 1DJNA 1XD1A 1VH7A 3BCDA 3RLHA 1L6WA 4ICNA 2WJFA 3I4KA 3BTNA 2OZ3A 3DDMA 1W1IE 2P76A 2QV5A 1MUWA 4UC5A 5CC7A 2YB1A 4JICA 5D2XA 4J40A 4BI6A 4Y6GA 1JPDX 4A6GA 1JDFA 3UG5A 3PZUA 3B0UX 1TO3A 1GHSA 3PVFA 2VFDA 2B7PA 5AFDA 5EB8A 4XBKA 3WQGA 1IZKA 2HVOA 4B4HA 2Z1SA 4UQBA 1XSKA 1W9BM 3S1UA 3ECQA 3BOLA 3OYXA 1A0DA 4GI8A 1QI2A 4L56A 4IMGA 3OOQA 4EPBC 2R91A 4MJMA 1PX4A 1O94A 1AL8A 4DO7A 3BOXA 4PTNA 4M5PA 4FIQA 2BWGA 3GY1A 1NP0A 4RKAA 3IIXA 4BEUA 3AU2A 4UR8A 3R25A 4MWAD 3LLXA 3HTWA 7A3HA 2BXZA 3AIQA 1NEYA 4Y90A 2OXNA 1LQAA 4IUGA 1Q6CA 1OFQA 1J79A 1L2UA 4A3UA 2ZXBA 4Y9PA 4JY8A 2PLKA 3PZ9A 1BYAA 4AXKA 1V3MA 4ORIA 1V0KA 1DJGA 4NJGA 2PP0A 4AZ5A 2C3ZA 3TC7A 1TWIA 2DSZA 3O9NA 4XWUA 3FXGA 3M7SA 5DO8A 2A21A 3GW0A 1W5MA 1A3WA 4P5UA 2XVGA 3EX3A 2Z1KA 4DZAA 4MTVA 3T4WA 4IIBA 2PTZA 2EG8A 3NQMA 4F8XA 4R9XA 3GVGA 2FQIA 4E3VA 5CC3A 1KRBC 3GR7A 2JF7A 3BLDA 4IJBA 4AD5A 2EPMX 1W1A1 4ZVJA 3AS2A 2A79A 1PHQA 4JIIX 3PB2A 4C5YA 1TPB1 2DORA 1M6JA 2XZ7A 3KBJA 3ZR6A 4L6HA 3VCCA 1OK6A 4E4FA 1KWKA 8RUCA 1DXFA 4AVNA 7REQA 4MJ2A 4BI7A 1SJAA 5A6TC 4A35A 2ZVRA 4MB1A 4J4KA 4INFA 1JGIA 1S2AA 2GJNA 4GIAA 5D30A 1E3XA 4GABA 1D8CA 2PLMA 1Q13A 2WVSA 4I7UA 2XWDA 3O0KA 3G3MA 3LHVA 3TR9A 3B8TA 4Q4KA 4NI8A 4WXZA 1E70M 3ARRA 3SEPA 2XPKA 3WY1A 4IPPA 4C1NA 3GU1A 3TZNA 4IOTA 3DI0A 1NFGA 3WCZA 3U2CA 1QNSA 1SZRA 4QIUA 5XIMA 1ALDA 5H1WA 4KF1A 4Q4RA 3GXPA 2JIEA 1T41A 4BWLC 3AIWA 3FIGA 4J3XA 4O0QA 4Y7EA 4ERIA 3RCYA 5FJOA 1ZBCA 1FDYA 3U7VA 1EF3A 1PXGA 1XWYA 3EX1A 3QHNA 4ATDA 2Z1WA 1T0OA 3Q67A 4L9XA 1FBAA 1K9TA 2EF9A 2YL9A 4FXRA 4AUBA 3AUOA 5ABHA 2CHNA 1JCXA 4PSRA 3DN5A 2FKPA 3NZQA 3NPWA 3W28A 2NXIA 3CMGA 2FMNA 2GOKA 1TVNA 4KWUA 1HVQA 3Q4DA 4UUIA 2G97A 4WY0F 1QWGA 1XYLA 4B5XA 2W92A 4WJXA 3HPSA 2VRQA 3NQAA 4I7WA 2YCKX 4JL2A 2EPLX 5C9ZA 1FA2A 2FHBA 4PBFA 2GDVA 4FSAA 3G6MA 4A2RA 4G2DA 2J8TA 1W9VA 3QHMA 1FXPA 1Y5VA 2PLCA 2J24A 1GG1A 1LCOA 4E6MA 3A3HA 4R9OA 2B0MA 3CIVA 2G4JA 3A5VA 3VOIA 4CQ8A 4GNVA 3LGGA 4XZIA 1HZYA 3KRUA 3B0YA 1XLHA 5AC6A 5CC6A 2WVVB 3LMYA 2GJXB 3G8RA 2GK1A 3WJWA 3AWNA 4I6KA 1VFLA 4EOUA 3LHZA 1JPMA 3WD2A 4IMAA 4WQ6A 4ZQRA 3WD3A 3TTQA 4S23A 2XGIA 3BICA 2PRLA 5HJXA 5I3HA 5MF5A 4PTVA 4F0MA 2DSUA 3O0FA 3FX4A 3WD4A 1GUVA 2VNCA 3QMRA 1Y5WA 4JX4A 4FNUA 3THDA 4JEJA 3RIKA 5CKSA 1F2JA 2WKJA 1H61A 1TWWA 4Z1AA 4LEFA 3BK0A 3DFYA 2WOQA 2TMDA 4YL2A 3MO4A 5CBJA 4QG8A 1PL9A 4JS3A 2WPGA 3L2MA 1KBBA 5D38A 2YL5A 1TMQA 4H7VA 4PMJA 2WNZA 1MEWA 3CZ8A 4JFWA 5FSDC 3S1WA 4UQCA 2VZOA 3IJ7A 2QUTA 2X0HA 2XSBA 3AMDA 1BVWA 4IFRA 1XRFA 3B8SA 2EEXA 3BGJA 4KMQA 1VPYA 1CLVA 1WZKA 5BXRA 1AVAA 2D2GA 4HK6A 1XISA 1LT7A 2FTPA 2VDGA 4HA1A 3MMDA 3PTMA 1LQ0A 4LUTA 3EKZA 3WEMA 3ZO9A 5GNYA 1ZZMA 3W2JA 3A23A 4D6HA 3VUPA 5F1UA 4HU4A 4HA0A 3W74A 1RP9A 4ZR8A 1VPXA 3WELA 3T81A 4MJZA 5I00A 3C8NA 1LOSA 3WG6A 1NU5A 4PCSA 1J5TA 1A3HA 3VNYA 1XR2A 4EF9A 3STGA 1Q6OA 3MUIA 4XAZA 1MYRA 5JVLA 2XN0A 2J9XA 5TF0A 4TVCA 4RV8A 4WX2A 4ZXLA 1UC4A 3WQDA 3H7UA 1E4LA 1A5SA 5AN7A 2YZ5A 4YTUA 1W3IA 4Q4MA 4U31A 3U5UA 3QGAC 1CXEA 2Z6JA 2EKCA 3TP4A 4NJJA 4LAZA 2VR4A 2JALA 3KM8A 1AODA 3W07A 1M41A 2J88A 2ZYFA 2YB4A 3LRKA 5JMUA 1CXFA 1KM3A 3OGRA 1KBLA 4MPKA 2VUYA 4AIOA 1RJQA 5KMYA 3MU7A 4P61A 3UR8A 2VR5A 3NZPA 4XD4A 3C3NA 3A3WA 4MNMA 3L4TA 1WXZA 1AJZA 1PB0A 1GG0A 4V2XA 1FCBA 4M6PA 1BSIA 5AYZA 1N2VA 3ARYA 4FP1A 4K3ZA 1W3LA 4GA8A 1CEOA 1C92A 2BMBA 4I7VA 2O9PA 2PWDA 3EA2A 4O18A 3W01A 1RPXA 2R1MA 4KRTA 1KM0A 5B7YA 6REQB 1R9YA 2ZA2A 3NSMA 1P0EA 3P0WA 3ARQA 4FXJA 4DJEA 3P5YA 5I5RA 4KEVA 4ZODA 1MNZA 3M43A 1UR2A 2ZQ0A 2F2HA 2J66A 1H4PA 4KWVA 3F4NA 1UZ1A 4DXKA 1VS1A 3ES7A 1AQ0A 4AD1A 1OQFA 3WNMA 4H9MA 3O16A 2QJNA 2DIEA 2GDQA 2AOSA 3OLIA 1XXXA 2NX9A 3KAOA 1C8QA 3BSMA 4GQQA 1QMLA 1E6NA 2YA1A 5DT5A 3M07A 2VKZG 3BSGA 3MKKA 1TE1A 1QU4A 3WBYA 2Z2BA 4UTKA 1PV8A 3W75A 4A3QA 1W37A 3T08A 3UXDA 5HXMA 2PTWA 3GAKA 1AQFA 2QJIA 4WY0A 1OG6A 4JTTA 3NO1A 3URBA 4GC4A 4U10A 3M0IA 2RGMA 2ISSA 1YX1A 5HNRA 5LIXX 4WDWA 4CD8A 5HK4A 1OYBA 1B9ZA 3LCGA 4HTYA 3WQEA 4EPDC 4JTJA 5J04A 2DJLA 1UOZA 3VZZA 4F0HA 1W1B1 4O8RA 5F4WA 3F2DA 4DJDC 1JDAA 1DHKA 4NNAA 2A3BA 5L9FA 1TWDA 2XVPA 5IHSA 2ON3A 1XIBA 4ZEPA 2HBVA 3ZWSA 1V8EA 5HJYA 2BHZA 1A49A 3M0XA 4JN7A 2PDBA 4JDBA 3GG0A 1NDZA 1QHZA 5HA7A 2YDRA 3N6QA 2OOGA 3TONA 5T26A 4HTBA 3SCWA 1TWSA 1XCFA 1R7AA 1CXLA 1XP3A 2AQWA 3KEHA 4DWSD 2E6AA 1V93A 3K1GA 4GJJA 3E2RA 3ZOAA 5ABFB 4HU0A 4Q32A 1ZL1A 3CAKA 3P8JA 1P4CA 3IJDA 1KFKA 4IGMA 3HIJA 1XS2A 2MNRA 1XM3A 2ACUA 4TU1A 1KQYA 3CGTA 1BF2A 2F7FA 5LSMA 1KGUA 4KS0A 2ZA3A 5JBFA 4U3AA 4DY1A 4ALDA 1QI4A 3OP2A 2OKOA 4ACYA 3BV4A 1Q3NA 4X2PA 4MB5A 3OVRA 5LHFA 1UUMA 4O12A 3WNLA 1XD0A 3A47A 3CZLA 3OZMA 4C6BA 3TN5A 1GVYA 1EZWA 4RW3A 4IJCA 1E0UA 4BZYA 3W7NA 3IACA 1VBGA 3AIBA 3VU2A 3HJZA 3AIVA 1BGGA 3T44A 4YN5A 3ARXA 2FH8A 3L12A 7PTDA 2Y89A 4KCTA 3GZ3A 3R13A 3GIQA 3GR4A 2Q8LA 4K38A 1ECQA 2NLYA 1O6IA 1YKWA 4IP4A 1ECEA 1YW1A 3TUUA 1T40A 3S1XA 5BOEA 3LI1A 2BHUA 3EB2A 1J0HA 3WD1A 1EC8A 2PDNA 2GQAA 1W9PA 2KX9A 2PBOA 4WKFA 2ZRVA 1M9HA 4KBXA 2E6FA 3WQFA 1VRXA 4NRSA 2VEMA 2JKAA 2GPTA 1EOKA 1UG6A 2Z00A 2X09A 3LNMA 4RE4A 3V7PA 5CJNA 3WJXA 1TPDA 4GLEA 4S3FA 1TPEA 4DAFA 3MT1A 1OZMA 3R8GA 3EKGA 1MRQA 3VMPA 3O6AA 4DNMA 3WF4A 1MUMA 2D0HA 4W8AA 3SCOA 5C70A 1LUCB 7ODCA 1Y65A 4D8ZA 3MUY1 3SCVA 4YTSA 2B7OA 2I5IA 2J74A 3LXAA 2A3AA 3QPZA 1KWGA 2DUXA 2VWSA 3UNDA 3UT0A 3BLPX 4CNSA 3G1DA 2VI0A 2OX4A 2QZRA 3CQHA 1JYNA 3GC5A 2DT1A 4JKKA 3DC0A 3P81A 5CPSA 2FH6A 3VOCA 1PKMA 4CVUA 1R3YA 3N4AA 4F9JA 3EWZA 5C71A 4UTIA 3MW7A 4H8HA 1HXJA 2WHJA 1H5YA 1QAPA 5JH1A 2CLFA 2WC4A 5BWAA 1T99A 3IEBA 1ZJAA 3K13A 3QFWA 4H2CA 8A3HA 3QKZA 1L2QA 2HS6A 2I7GA 3TA9A 1PS9A 2J7BA 1I75A 3HPXA 1CENA 2YZRA 3PPCA 4AIEA 3HZ3A 1Q45A 3DHUA 4AYGA 2DY3A 1A3XA 3H53A 3GS6A 3QC3A 3M44A 3MWAA 1B2YA 2X2GA 1J6OA 3W7JA 3RLVA 1R9XA 3N25A 4HSHA 4O53A 3TQVA 1K6WA 3PTKA 5FJTA 9XIMA 2V82A 3GH7A 3RUBL 2WKGA 3DU0A 3QY8A 3LNPA 1JRCA 1JZ3A 5LYRA 4GKLA 4KEMA 4MF4A 5D2YA 4JGDA 5D33A 2QCLA 1S38A 3SSZA 3ITLA 1BXNA 3W7IA 1R87A 1B54A 4UTWC 2PCQA 3L67A 1ZP3A 2PU0A 4HD5A 5G4EA 4FALA 4Z42C 3ABZA 3MSYA 4KEZA 3CEUA 1QCWA 4QEHA 4R7JA 4V1YA 3VGHA 2V3DA 1XYCA 3UJEA 4F79A 3O05A 4QISA 4NIRA 4PRTA 1KM2A 3CPGA 2VENA 3C61A 1SM9A 4ZB0A 3VMOA 3N9SA 1ZBWA 2DSKA 3UPBA 1KM1A 4B16A 3P60A 3NQVA 3CLWA 1L0PA 9CGTA 1KLZA 4ZE5A 5CPQA 4IFKA 1FWBC 3MB9A 3MKVA 1UP3A 2CZFA 1KCZA 3N2TA 2AKMA 4MB3A 1G69A 3TW6A 4IISA 4NZJA 3M4HA 4M19A 2QJHA 2PUZA 3W83A 1TX0A 1H7NA 3CYJA 2A2IA 3CZEA 5D04C 3V4BA 2ZE3A 1DWHM 5FF2A 5HNUA 4Q7BA 4HCLA 3GTFA 4PCFA 4YYFA 4ZOBA 3UWUA 4E0CA 4JTIA 1P0NA 1LRNA 2VOMA 2Y7EA 4UMCA 3W7LA 4B9ZA 3N34A 4JZ5A 4AWUA 1E6RA 4IGHA 4B15A 3AJXA 4MLJA 1QOQA 4JQ1A 4I6VA 2HJPA 5F1VA 3W71A 2RFGA 1C3FA 4ZOAA 1E4IA 1VBRA 1W3KA 4GIEA 4NSBA 3HMJG 1F4HA 2YBVA 4POCA 2CLHA 2NUWA 1FCUA 2DUZA 2C8NA 4D6FA 2XGZA 1VENA 3UXAA 3WQVA 1XV8A 3GDTA 1NY1A 1XYAA 3HPFA 1QBBA 4FO4A 4J2MA 1ADSA 2E40A 1R3SA 5I3IA 1P43A 2P88A 4GY0A 3URQA 4DIAA 3KZPA 4XD6A 1BRLB 5LNWA 1H1YA 3VNMA 3A3XA 4KFOA 4UR7A 2WJZA 5H2ZA 1IXOA 1I0DA 2EHHA 4PL1A 5D32A 3L7RA 3W72A 3FDKA 3HA1A 1C29A 4KFPA 2YDAA 1E5JA 2C18A 4QDPA 2XVNA 2ZWYA 4JFSA 2RAGA 3L4ZA 4A3HA 4PTXA 5GPRA 1GEQA 4PCPA 4QAWA 3U0HA 3UR2A 1G67A 4YVPA 4ZO9A 2QIIA 4K36A 4IHCA 1XRVA 4QSFA 4I5RA 1ITUA 1J10A 3VCRA 3FVMA 2OWXA 1MDRA 1QASA 1EP3A 1V6YA 2YXXA 1YPXA 3TYUA 4F2TA 4AY7A 4MOZA 3WLSA 1F3TA 3N9KA 5FEXA 5EFDA 3ZLHA 2OWCA 1IT8A 1OGSA 3WKZA 3KXQA 6REQA 5CH9A 3VD4A 3NFUA 3W1UA 2V67A 4I3GA 3O63A 1CZ1A 1YDYA 1F3EA 4EXBA 4PMNA 3APTA 2WK2A 3S42A 5I03A 2JKEA 4MFDA 4TX9A 1B0IA 4LC6A 2X1UA 3C2RA 4B5WA 4PCNA 2BXYA 4EKJA 1V08A 3WDRA 2CHOA 1Q65A 4XISA 4Z1CA 2HVMA 3EOLA 3CV6A 1E1FA 4C6KA 2PU1A 1F7BA 2MUCA 2OWWA 1OFAA 2OLAA 3ABOA 3ZFHA 4V33A 4LALA 3VIHA 4BK9A 1YE6A 4BR1A 3BAXA 2NX3A 1EA9C 4H9ZA 1K8XA 4IMCA 3OHIA 2WCSA 4GXWA 4JYFA 1HP5A 1UWIA 2V2DA 4X3ZA 3ES8A 3LBCA 3OEXA 3QZ6A 3EDJA 3MSRA 3R8HA 3VPLA 1J0ZA 3MSGA 1Z7AA 1NWUA 4GY1A 3T0DA 3MP5A 4XSLA 1MW3A 4P8XA 3PZIA 3ANUA 4W88A 1ISVA 4D71A 3KHDA 1DQWA 3HQNA 1EJUC 1OVDA 6A3HA 4D8LA 1JQVA 2EJAA 2VXNA 1FDJA 3AS0A 3H2FA 1Z42A 1RVKA 1TJRA 4AX6A 3VKJA 4AHPA 4UQEA 4V27A 1KB3A 2O9OA 1DBTA 3W7QA 3QLLA 3BCFA 1ZBVA 5CGTA 1PDZA 3DBNA 3CHVA 2QCDB 2A3CA 2DZUA 8XIMA 3WBEA 2EPHA 3USZA 1E51A 4EIVA 1JUBA 3A6OA 1NELA 3AICA 4MWAB 3SURA 1B3VA 4GVIA 1VJIA 2QCDA 4H6EA 4LXFA 3FA3A 1V0LA 5JH2A 3P67A 1AW5A 4MKVA 2TRSA 2P8BA 3BCJA 2VC9A 1VHCA 3GO2A 5DX7A 4WD0A 4NJIA 4I9JA 3CUXA 4XO7A 2BVTA 3PZQA 3VO0A 2OSYA 2XSXA 3RMEA 4NZCA 4JIHA 1KBKA 3WDHA 5A8OA 2BY0A 3H7VA 4JN6A 5M3WA 1A5MC 5D37A 3ANVA 3KOZA 4FPSA 4O52A 4KRZA 5EFFA 2PZNA 1Q2RA 2PDUA 3LUTA 3N2CA 5IFPA 3LCWA 1VLIA 1XJBA 4YXGA 3T0TA 4MKSA 2ODOA 4DYJA 1I1WA 2PDXA 5BROA 4WSHA 3WBXA 1JAKA 2C15A 3N19B 3NEVA 5H8MA 2QT3A 4DQWA 3NQBA 2VGFA 4XG1A 3EPNA 3QJAA 2W3ZA 1S5VA 4C60A 1GK8A 5DCDA 1RA0A 4CNNA 5CGMA 3QC0A 1ITCA 1JDEA 1GPWA 3NZ1A 3FEQA 1TKKA 5E9AA 1TTPA 1TV2A 5IBXC 1A5AA 4LYQA 2P1FA 3C0SA 2IKJA 1I2PA 2YXGA 1S5NA 3RF9A 2ATSA 4XTDA 4C6LA 2GUUA 4L4OA 1XF0A 3VA8A 2HWGA 3WO8A 3H2OA 3P84A 4MWAC 3R0UA 5BOOA 1LT8A 1GVFA 1VKFA 4QE1A 1TV5A 2ICSA 3U2EA 1O60A 4NZ1A 1GJWA 2WNWA 3M0VA 5LGXA 3K4DA 3AU6A 4PL2A 6XIMA 2H8XA 1JJKA 4GX8A 2ATMA 2BASA 4M0XA 1R3QA 1B9BA 1QATA 1H09A 2HQAA 4DYEA 4HOZA 3WLHA 4EXQA 1GQNA 2TODA 3U7BA 2REQB 4OVXA 2NW0A 3SQMA 1OZQA 3L65A 2ZZ5A 5K9XA 4HHMA 2FJKA 1ITQA 1R3TA 1E1CA 4L5ZA 2LLEA 4LYPA 3SUSA 3PY2A 1QHPA 3KDNA 3PULA 1A4LA 4BI5A 4ATLA 5JIPA 4AQLA 1M7OA 1UROA 2J79A 1SW7A 3GUWA 1OCQA 4GIYA 3UWQA 1E9YB 1PCKA 2Y88A 3KVKA 4G7EB 3OTRA 1X6NA 2OU4A 3VM5A 1GQJA 2Q01A 1VBUA 3KWSA 4ZQOA 3NYDA 1FFRA 4RDYA 4JX6A 3M0KA 2E9BA 3NZRA 3FAXA 4NILA 1X98A 4QSHA 1MNSA 3K5XA 4FA3A 3BZJA 4EANA 3HGRA 2ZX9A 5IRPA 5HMEA 3T6CA 2QQ6A 4TTGA 3W88A 1R85A 3ZSTA 2X42A 4XZBA 4RE3A 3TTOA 1YHTA 2PSNA 2PEVA 1IEIA 1US2A 4NG3A 4A21A 3RX4A 3URAA 2F38A 3OG2A 3LLFA 1Q6EA 3PPGA 1NQ6A 3GIPA 2IPGA 3N2BA 2GDUA 2DZPA 3R12A 4JPGA 5AHFA 3QW3A 1LBFA 3HQOA 5EL1A 5I0DA 1P6CA 2O7SA 4IMFA 4PC8A 3PBWA 3UYCA 3C86A 3EMCA 4H6QA 2V5KA 4PA8A 5I77A 2UY4A 2BY1A 5D2WA 3DEQA 2YYTA 5C7VA 1CECA 3MA8A 1EJRC 4AY8A 1RQHA 5LA2A 1LG2A 4LB4A 3GVWA 2Y63A 4JEQA 3BQ5A 3PZNA 3W1MA 1ZS2A 4P7RA 3CB8A 4WDUA 4X0VA 5FOOA 3TW7A 3B9EA 2DH2A 2PZ0A 1XH2A 4LS1A 3N04A 5D8ZA 1R38A 1TG7A 2WBKA 1NH6A 4JBRA 3UG4A 4E3TA 3H70A 3VZYA 1Z9AA 1UMYA 3LBMA 3BGAA 4AIUA 2G3MA 3N6JA 4Y9MA 3VD5A 1GNXA 1WA3A 2XIJA 1GQLA 1FVPA 3NNTA 2QAPA 1YE4A 5FESA 2VEGA 3NQEA 3L68A 1Q7MA 1FOBA 1RPKA 3MMWA 2HPIA 3AMKA 4JD4A 1VR6A 1KM5A 2E25A 2WXDM 3FJNA 3PFRA 1TSIA 3PTQA 1GPFA 4UFKA 3LQLA 1BKHA 3SN0A 3STFA 1BQGA 2PWHA 1PIGA 1CNVA 3KOYA 3AHZA 4QJ1A 3LM7A 1OSEA 3AYVA 4MKNA 6XIAA 3ZJ8A 2FGBA 3V75A 4JHZA 4P7LA 4S1FA 3S2LA 3LV5A 3W7MA 1OX5A 4YHGA 1OCJA 3TV8A 5HWJA 4Q8TA 3P74A 1DOSA 1HJSA 3E9AA 3GH4A 1JPIA 4XIAA 1PVNA 2W6RA 1FHDA 4PBGA 1K7FA 1VRDA 4UNIA 3WF2A 1FKXA 1WZMA 4H7CA 3EOSA 2J7CA 3CO4A 3QQWA 3G22A 5JIWA 5HUPA 3ZVHA 4K7VA 3VGDA 3NA8A 1LZOA 2VZVA 5LXEA 1VFUA 3U4AA 4HMDA 3LRLA 3UXLA 3T05A 3LPPA 5I02A 4Z1YA 3B03A 1TE6A 1BG4A 2BFGA 2W0UA 3SGUA 4QQ3A 1TX2A 2HBXA 4GH1A 1V3KA 1TCDA 3FKKA 3GTHA 3R7MA 4QCFA 2FGZA 3B4YA 4L4PA 4V15A 2XTKA 3RAOA 1I1XA 1ISZA 3PK7A 3QR3A 3W0KA 1XHGA 3H2MA 3M0LA 1XLCA 1J2BA 4C6CA 1VC4A 2GQ8A 3BLKA 3VD7A 1FY6A 4W86A 1FWJC 3IARA 2O9RA 5CSUA 1KC7A 4I9MA 7XIMA 4JL1A 3OQ8A 3WDJA 3R6IA 5D8WA 3N2MA 5FSEC 1W2PA 3N18A 1UUQA 3VTRA 1JZ7A 4W8BA 2FTYA 1J93A 1PHWA 3KZSA 4JTDA 3ATZA 3SO7A 1XC6A 3ATYA 4HMCA 3AIUA 1UKTA 1PX3A 4X0NA 3NQ6A 1V6VA 4K1WA 3AYRA 3AS1A 3SCQA 1A0EA 2HCVA 1KKRA 3CQ0A 6ALDA 4HNOA 3TN6A 3UVIA 4PB3A 4MUZA 3BAWA 3REQB 1A80A 1WUEA 2XFFA 3T2PA 1MXGA 4IMDA 2ZBTA 4MYAA 2YCLB 3ZT7A 3PHAA 4KH2A 3LCHA 1H51A 4X2RA 2W9MA 5CC5A 4AWSA 3I68A 2OQHA 3KBSA 4US6A 1XQKA 3OQEA 4DPQA 3G0SA 3EAUA 4DF1A 1UB3A 1EWEA 5FIPA 3AS3A 3G8EA 4OBSA 3WNNA 5BOFA 4GZJA 3KX6A 1LWHA 5D05A 4A8RA 2JGYA 3RM9A 4Q8QA 1DQXA 1VEPA 1QNVA 4NYUA 5A94A 2E4TA 1Q6DA 2FYMA 3ME3A 3ABQA 2G3FA 3G1YA 2J9ZA 3SGGA 1FH7A 4HJWA 3U48A 3K2GA 4AF0B 2YFOA 3HPZA 1GW1A 1DJWA 2XU2A 4GVGA 1VCVA 4Q4QA 1H50A 4H9XA 1MXDA 4FOJA 2B7NA 3RK8A 1EJ7L 7REQB 4AZCB 2Z2AA 3VFLA 5G2HA 2A3HA 4PTMA 4XZ9A 4Z0SA 1A5CA 4QX4A 4EAYA 2FLIA 1B3XA 1QPNA 3ITVA 1KTCA 4J3SA 3WQPA 5A6AA 1AL7A 1XBZA 2CLMA 1KLYA 2GGIA 1TPH1 2BXVA 2DZBA 4QLKA 1BHGA 1YNYA 4CD5A 5D9OA 3S5NA 2XIIA 1WXYA 3LSBA 3BW3A 5M17A 3R79A 3L5LA 1VD6A 4S3AA 1VEMA 4F2UA 3M9YA 4JDYA 5T8GA 3SM0A 4S38A 1SJCA 3EEZA 4JFUA 1JL8A 5A69A 2INEA 2QW5A 1BFNA 5HATA 1O4UA 2OEJA 1IGWA 4O13A 2PDQA 3V5FA 4JYEA 1CGTA 1TJ1A 2D22A 2G95A 2J75A 4YCOA 4J3UA 3CZGA 3FYPA 3TC6A 2QJGA 1YBQA 4CGTA 1M65A 2Z2UA 1WXJA 1T96A 2NQHA 3RR4A 2EG7A 3DX5A 4GYFA 4DLMA 2FPYA 4JX5A 1VLWA 5M1TA 1FH9A 1NQKA 3WZ0E 3DENA 1EB3A 1POKA 3XIMA 1K70A 1EJSC 1JFXA 1ZSXA 3A64A 1WDSA 4AHOA 4YPJA 2GGJA 1U5HA 3W7KA 3EWBX 3KVJA 3CMJA 1TA3B 5C2GA 3IUDA 1U1HA 4U5KA 1UIPA 4MG4A 3W7OA 3EBVA 3WF3A 1R2SA 3AHYA 4NNBA 3VOGA 3ZSSA 2E67A 1RJRA 2OCZA 1US3A 3GDMA 1JZ6A 7TAAA 2JGQA 4D6EA 5J8LA 1JXKA 3OGVA 1RCOB 2DSWA 3BO9A 1GVQA 5BRPA 2VGBA 5BXSA 4NZ3A 2GK1B 1EHAA 1P5BA 1EGMA 1L6YA 5BW6A 2D2JA 4J3WA 5F4SA 3LCLA 2J7GA 2V3GA 1GONA 3KE0A 1AH0A 4N9EA 4FOKA 3CHEA 3GNRA 3U4FA 3KW3A 3S46A 1LQ2A 3T42A 3SCUA 3BG5A 3H6OA 4CQAA 4E2VA 2PMQA 1OABA 1FWDC 3GU2A 3SN1A 2VELA 3WDIA 5G1TA 1Z41A 2V9DA 1WPCA 2Z25A 4TV6A 1EEXA 3WUGA 3T9PA 4JR5A 3POHA 2VO5A 2WANA 3H8AA 4AD4A 4J7RA 4ZZ9A 1C93A 5I3KA 3QHOA 4WUIA 5I7GA 4CCZA 5ABTA 1H0IA 3WLIA 2QJMA 2ZDRA 1ZHAA 3IIZA 1YTKA 4HHHA 1NWTA 1WOAA 3SI9A 4X9YA 1PTDA 4U33A 1T5AA 1PSCA 2YW4A 1HJWA 1XCXA 1E15A 5AOUA 1E56A 4MIMA 5K7JA 2BB0A 3P61A 3WMLA 4A22A 1RLCL 2AAAA 1AQHA 1NARA 3IAPA 2AGKA 5DEZA 3MUAA 4UMAA 3S2CA 2EQDA 5GJPA 2EG6A 2WKLA 6ENLA 3WMCA 1ONWA 3AXKA 4Q8UA 2W67A 4OV9A 2ALRA 4CNTA 1UHVA 3HQ1A 5E0FA 1TVPA 3KLLA 1OT1A 5BU9A 1UPPA 3WIJA 3VX0A 2Q02A 1ICPA 1SMDA 2VFHA 4FNTA 1HKIA 4QS5A 4OGZA 3B4UA 2REQA 1E3ZA 3MHUA 1H1ZA 3CV2A 3VYLA 1RBAA 3D0CA 4O11A 3COTA 3FW6A 3VDHA 4MFEA 3GG7A 2CWNA 1R30A 4L6OA 3IJ8A 3WUFA 5FL0A 3SBFA 1OYCA 2POTA 2IPJA 4WDTA 1W0MA 2PWEA 3PPHA 4Z2IA 4RNJA 2Y85A 4MY8A 3OBKA 1YRRA 5EMMA 3CT2A 3TQPA 3P93A 2CESA 1QOXA 4XUGA 3W84A 3CK5A 1JPHA 3C4UA 2PGWA 5FEPA 2I9EA 5BYWA 2OMAA 4W5ZA 2DIJA 1QK0A 3J7HA 3CH0A 2GSHA 3W2NA 1E0VA 1ONXA 5FKYA 1MZHA 1TIWA 2VX4A 4GJIA 3RITA 1H7PA 2QS8A 1IZCA 3GXNA 1XGDA 3BH4A 2EBNA 4QDWA 3NPUA 4H7ZA 1CGWA 4YTRA 1JZ5A 2ZUNA 2QV4A 2YSWA 3GNPA 1WAWA 4DJED 2ZTKA 3AALA 4ZL1A 4GCXA 2F6XA 5KSWA 1HJVA 1M03A 3AZSA 5BXTA 4H8VA 1YDVA 5LGZA 5CBIA 4JTUA 3EWUA 2B4GA 1KRMA 3N15A 1AW2A 3S47A 4O1BA 2XIMA 1L6GA 1X1NA 1P1XA 4ACZA 2OPJA 3QV8A 2PWFA 3SW6A 1XH0A 3ZQ9A 4AZGA 2VVNA 1O66A 3W27A 1JCNA 5JU6A 4TOQA 4WKHA 1XYMA 4XTIA 1R6WA 1E4MM 2VZSA 4PCTA 5A6JA 2OSWA 2QDDA 4S3CA 2VOTA 1J12A 3CUZA 1FWWA 3V1PA 3PZVA 4IQEA 4AY1A 4Y9OA 2VC7A 5C2CA 3AZRA 3UNTA 2WSPA 2WJEA 2YCJA 3MC5A 7CGTA 5AYIA 4IX0A 4ZO8A 4ZO6A 1HKJA 4GVFA 1LTDA 4M7TA 2GVJA 1Y7VA 4O8AA 4IFKB 1QBAA 2HVNA 3LY0A 1KRAC 4PODA 2AQVA 2XUCA 3M46A 3NQGA 5G2IA 3FVDA 3RU6A 3TXVA 3UCDA 4HN4A 3SSJA 1D7FA 5HWNA 4HHPA 2G8ZA 5IDZA 2ZXQA 4O0ZA 1W3HA 5I3DA 3VKBA 1K03A 4PYSA 3CHCA 2BGSA 1QO5A 2ZUSA 1OX4A 1SPQA 5ABGA 3NZGA 1IE7C 2VMFA 2V5JA 3SN4A 4UFLA 4ZCWA 1QW9A 3QY7A 1X8CA 5CJMA 2NUXA 1W17A 3H4XA 2NWRA 3CS2A 4GIRA 3NUKA 3WQ4A 2E5DA 4GNKB 2B31A 3ERPA 2Z0IA 5AC8A 4JNMA 3GNDA 4GQGA 4W84A 5CZJA 1P0KA 4CN4A 3TYBA 1PEZA 2XN1A 5H8PA 1B57A 3BAYA 4QJ5B 3NVTA 1AD1A 3D46A 4NF7A 3LQGA 4QHRA 4GO8A 4JTQA 4LGXA 3OU8A 3P80A 3TJXA 5FAGA 3IIOA 4U2ZA 2XYLA 1ME9A 2O0TA 1PZ0A 1W1YA 1TREA 5DLCA 2DZVA 5G1MA 4F66A 2V2CA 1PBGA 2WMKA 1I2NA 1W1TA 4IX2A 1JNDA 1SO3A 3KL3A 3LXBA 3GZAA 1WOBA 4M1RA 3SRHA 3PFMA 3NPXA 1M3UA 4R7OA 3NOEA 4ONVA 1QPOA 3HM7A 2D0GA 1FHLA 1S2VA 1GYNA 4DVOA 3G3DA 4HA3A 2CFFA 2JEPA 2Q6ZA 4C6DA 2QUMA 4X9SA 2HRWA 5GNXA 3IJ9A 5GVJA 3GKFA 1MQRA 1MRAA 1XDLA 1AW1A 1HL9A 3PWGA 2BOEX 4B5NA 4BCEA 3K8MA 2JK2A 1XRSA 3FK4A 3B04A 2WMHA 2XM1A 3ONBA 4IL2A 3T2OA 5AHNA 3AHVA 3DXIA 1VFFA 4LY4A 1VPQA 1XL9A 3TSMA 3O6YX 1HTIA 3EDFA 5AC5A 3TFCA 2A7PA 4KIRA 1UR0A 4NL1A 3E3HA 2J8GA 3CUGA 2JF6A 1DIKA 4FS9A 2YA2A 3DFQA 2O9TA 4RXGA 3A4XA 2IPWA 1TZZA 1SGJA 2GVLA 2Y62A 3ALFA 3BDKA 4JFTA 1JRBA 1LLOA 4RX0A 1CXKA 1XG4A 2B81A 1YTDA 3WEZA 1LM1A 3F4WA 4NNCA 4PUUA 2E9MA 4LCSA 1KR1A 2J7HA 2E6DA 1TJ0A 3UZXA 2A3LA 5A95A 5DBUA 4JTFA 1FWAC 2EPNA 2J6XA 4DF2A 3MUZ1 1TR9A 3ZLFA 2IS7A 3VCNA 1DJYA 3OIXA 4LEQA 4MDPA 1X1OA 3JR2A 4L9YA 4B92A 4GMEA 4YMZA 3IGXA 4EVZA 1GOQA 1XLFA 2FIQA 4ATWA 1ISXA 3IJ6A 5AYXA 4D1IA 1XDMA 3BAKA 1J8VA 1W3TA 4GE8A 4C1NB 3BJSA 3D5HA 2BGNE 3DH7A 1XQLA 3MZNA 4XKYA 2X16A 2A0NA 2IQTA 3VABA 1MO0A 5HR7A 3QEZA 1EC9A 1QPRA 3DFSA 4IP5A 1OADA 4D1JA 1VIZA 1LF1A 1GZJA 4MUPA 1S2TA 1OBAA 1TQJA 3FY1A 3FEMA 1DXIA 5PTDA 2G50A 1DE5A 4KWWA 3N17A 3QR1A 4O57A 3ZWTA 2CLLA 4AAJA 3QXBA 2V8ZA 1Z89A 1CGUA 3UWZA 3GKAA 1S2WA 3DUGA 4I8DA 4RZ5A 2OYMA 1OFDA 2OO0A 5EMJA 3ZS4A 4H9UA 4CCDA 4GI6A 2Y6ZA 3U2ZA 1TJ2A 3FGCA 4LBSA 4O1FA 3VGEA 1WV2A 2WCGA 1PIIA 1VFTA 4JTRA 4TMCA 3CL6A 5M03A 2V3EA 3PG8A 3FSTA 4OWGA 5I3GA 2OQLA 4GZEA 4O4VA 1HO1A 3SCRA 1OJXA 1RH9A 2GOUA 1ZP4A 1X7FA 3F2BA 3DERA 1U1UA 4ERGA 2FTWA 4KCUA 4CU8A 4FLSA 2E77A 3GFYA 4QDMA 4LX4A 4GZ7A 3BANA 1W5QA 3THUA 5C9WA 4BEQA 3RCMA 1QNRA 3H54A 5E6ZA 1VB9A 3WH7A 4RE0A 2WHMA 5CZTA 3VVGA 3TU9A 2OSXA 1BAGA 3UR7A 3KOFA 1M1BA 4C65A 2VJXA 2CW6A 4WY0B 3C8FA 4L4LA 1TELA 3FFSA 4BHYA 1UKSA 1ADOA 3O2LA 4QBXA 1LL7A 3SDOA 2WZIA 1EP2A 1ZAIA 3IRDA 4PULA 2PODA 3RG6A 2H90A 1JCTA 3T40A 3NAVA 3WLLA 3G18A 2VYOA 1VCFA 4XO6A 3SAZA 3R2GA 2HISA 5EBAA 4U2YA 1IT0A 2P0IA 4LVFA 1ZFJA 4R53A 3T7VA 3YPIA 4ZQMA 2P5NA 4CQ9A 1PZ1A 2VT0A 5CLWA 4CCEA 1WO2A 2CU0A 4HYWA 3UPWA 4KESA 6TIMA 2Z1BA 5EMYA 1GVRA 1X38A 3RJYA 2I5QA 2OR2A 3TDFA 4MMWA 3W6LA 1UZDA 2C71A 2PD5A 4D6GA 3O07A 1QW7A 2ZICA 2NQJA 3W6YA 1YPFA 2YYUA 1UH2A 2DZAA 3UR5A 3NEHA 3QH2A 1U2YA 4O17A 2J47A 3E38A 1REQB 3H2CA 1JYXA 1EDQA 1U5JA 3ARVA 1DV7A 4JIRA 3S5OA 2PC8A 4ORMA 3BLEA 4LC8A 4K8GA 3O8AA 5FF3A 4Q8MA 3OBEA 3QMTA 3RGTA 3RN6A 2VC6A 3AYTA 1K77A 1NOFA 2P10A 2ZX6A 1RSCA 4UNLA 4N0RA 3VNJA 4W7VA 1CCWB 4IG2A 3CUJA 1Q6LA 1KQZA 2PD9A 4H04A 3W7GA 3NGJA 1YEYA 3KL5A 1B30A 4DLFA 4DO4A 1SR0A 4WGHA 1YLVA 1ZALA 3VAVA 1U22A 2DT0A 1RCQA 4UQAA 3TW9A 5DMYA 3CQKA 4RDVA 2CPUA 5A1AA 2DQXA 2FJUB 1RBLA 3GC4A 1RY8A 1PO9A 3N1AA 3TA6A 3MP4A 4L64A 1KRCC 4CNOA 2J8FA 4OT7A 3C0QA 3ABRA 1T7LA 2Y5JA 5I3FA 3A24A 1X7IA 4FHAA 4K68A 4NT0A 4N2YA 3AISA 4DBSA 3UZYA 3EDDA 1QDSA 4AEOA 4GXPA 1ISYA 1W56A 1YADA 2PGRA 2VP8A 2XINA 1K7EA 1D9EA 2E8ZA 2VCBA 2XN2A 5DN1A 2BGQA 3MV01 3I4EA 2OLSA 3MCNA 1OC6A 1Q4NX 1YNQA 3WH6A 2ISVA 3MO7A 3C2FA 4W7WA 4D8AA 3TX9A 5HMFA 4BKNA 3JVAA 4KEUA 1J01A 4WGXA 3NM1A 4FMVA 4L61A 1H7WA 3GXIA 3VMNA 3L2IA 3NO5A 4O0KA 1B31A 1XLJA 1DP0A 1ME8A 3LM3A 3UBPC 1XIEA 2WVTA 2D3NA 3MJMA 1DEDA 1RBOB 4UZUA 4HK5A 4PMOA 4PGLA 2JFEX 4DWSB 3AXHA 1JI1A 1Z6KA 3PN8A 1Q8AA 1GT8A 3CTLA 2D20A 1UWQA 1L6FA 3C52A 3TJ4A 3HBLA 3A9IA 2PP3A 2PCEA 3NL5A 2CXGA 4AU0A 4HNLA 4LV4A 3BVJA 2OODA 4DF0A 2O56A 5A5WA 4XBJA 5DT7A 5I23A 3AMGA 2V5BA 2GJRA 4WIWA 4D6DA 3VOHA 2WWCA 1G0CA 2XIQA 3K46A 1F6YA 3MPGA 4HHLA 1W32A 3VIMA 5M5DA 1K6AA 3S6DA 2YJQA 1GTHA 3LCIA 4HA4A 1R86A 3DIPA 3IANA 2BSLA 3KBMA 1W1VA 1SZEA 3TNOA 1VBJA 3A12A 3BE7A 1P7TB 3IK4A 3H55A 3RX3A 4J3ZA 3VC6A 4UNKA 4GPNA 3WNOA 4J35A 2KAUC 2QDGA 5E5CA 1JCLA 1JZ4A 2INZA 5B80A 3GD6A 4E5TA 1KV8A 3U8GA 3U2OA 4C6OA 1KXTA 3ITTA 4UOQA 1QI5A 2PDPA 2WHKA 1JR1A 1IT7A 5EPDA 4AMCA 3A21A 4M8UA 1KFEA 3E2QA 2RGLA 3BW2A 4QS6A 1JI2A 4N4PA 3N4FA 1G7UA 2XG9A 3WDQA 2IXUA 2QLYA 5ABFA 2VX5A 3H26A 4A8LA 4GKTA 3E5BA 1AZ1A 1JUEA 3UA3A 4C5ZA 4MAVA 3QYSA 2WZEA 3C2EA 3IVSA 5CJ5A 4O1AA 1XLIA 4PMDA 3UJ2A 1EBGA 5KEZA 4H19A 3BWWA 3SRKA 1IEVA 1PKLA 3WN6A 3URNA 1XLLA 1NF0A 3GFZA 4NX5A 3LXCA 4YTTA 4TV5A 3THAA 4AZ7A 1R8LA 4UTJA 4L65A 1GOKA 1WDQA 2C1HA 4AZBA 3AMCA 4C6MA 4IT1A 3VGGA 1EKOA 4LBUA 1S5TA 2PF0A 5CGQA 4DO6A 1DJZA 3TTYA 2CBIA 3F5KA 4NU7A 2AAMA 1W3NA 1F9CA 1OFRA 4KWOA 1RAKA 2Y1HA 1X96A 4O1DA 1OCBA 4F48A 4Z1DA 3W02A 2O4MA 1OF6A 2I14A 3UZZA 1OYAA 4UR9A 3S8HA 4WCJA 3JW7A 5EMKA 1H0GA 3OJGA 2C0AA 1NF7A 4RDZA 1HO4A 2DSVA 4Z2HA 4HPHA 1F07A 2FHCA 1KTNA 1IWPA 1P0DA 5G5IA 3GBDA 4HJFA 3H24A 5G1YA 2SFPA 3PZGA 3SUUA 1JG9A 5DRIA 3ENLA 2GVGA 3E0VA 4AWEA 1TV8A 2PTYA 3RXZA 1TPWA 4H6KA 3PZOA 2YCEA 2F6UA 3V5OA 3DKLA 4R7WA 4XAGA 1O5QA 1H5VA 2ZRZA 3OIHA 4GYKA 4PBEA 4ZGYA 3STEA 2WHLA 1VP5A 1SSGA 3WLNA 2W62A 1WBHA 4QG9A 3MTWA 1OWQA 1VZWA 3GTNA 3GDLA 3A22A 3WNKA 2XFYA 4NAFB 3IPWA 3HFYA 1RK5A 1AJ2A 4OUEA 5BCAA 5DXXA 2ZCGA 3VDAA 2OT0A 1AMKA 3B3DA 2JBMA 1WKFA 2NSOA 4LS0A 1MDLA 1DXEA 2PDGA 3HMCA 1J0KA 5I6SA 5CEWA 4QTGA 1K7XA 3TVAA 4DUOA 3S9ZA 1E71M 1CW2A 1GYMA 3LCXA 3PJXA 3ZJKA 2WQPA 3GG8A 3JU2A 3W00A 4KGJA 1UD2A 1NDYA 1OCNA 3M6DA 4PEKA 3OVGA 1GW9A 4LUJA 1UOKA 1FQ0A 1UKQA 3WH9A 3B8VA 1BWKA 1XKJA 3NG3A 4B9YA 3PJTA 4MY9A 1SW3A 3UETA 5A8NA 1OFBA 3VKKA 4U28A 5D2VA 1ZU8A 3WQ8A 2VFFA 4BJHA 4WF7A 1TTIA 2IQDA 3E49A 3LTYA 4FR1A 4OV4A 1PUDA 1QRQA 2H9AA 3MSDA 3IRSA 2ZWZA 3IUHA 5K4ZA 2I56A 2G3IA 1ZCCA 1KGXA 1KW1A 4L7ZA 1HJXA 2RJHA 1UQZA 4ACZB 3T2QA 2DGAA 1EGVA 3EPMA 2I1OA 2VFEA 3RRAA 4O1EA 4G9PA 3USBA 4NASA 3SRFA 4BF9A 4Z0JA 1H2JA 2DVXA 4NXSA 1XGEA 4CVWA 3T78A 5M2FX 1KO0A 1PKYA 4PRRA 4F9DA 1WB0A 3ARUA 2XZ9A 5I09A 3CZKA 3DYPA 1DJXA 2QPUA 2D69A 2ACQA 3L5AA 1QNOA 4P8VA 1EXBA 1OT2A 3I3EA 3TWAA 2XIOA 4E38A 4BQ5A 3WH5A 4MPQA 4D6CA 5KETA 3RPMA 4GFSA 2NQZA 4ASTA 5KZDA 4HSNA 4R27A 4XQ6A 2V5LA 3SRDA 2A3EA 1YDOA 3NDOA 4ICMA 3TLQA 5LIUX 3SY5A 1VJSA 1HF6A 3CO8A 3C3UA 2INFA 3WH8A 3T55A 4LF1A 1IR1A 3NURA 4JTHA 4QLLA 4KPLA 3KCLA 1J6PA 3CPRA 5GJMA 1V3IA 4PTDA 2B7QA 2Y8UA 4DUXA 3PPFA 5HPCA 2V5CA 1E4NA 3BUVA 4WJEA 1BTMA 5HR6A 1N82A 2QCEA 4CEXC 5A6SA 2J25A 2UZ9A 4I8YA 3WFLA 5D02A 4RLIA 1YDNA 3CHDA 2AKZA 3I7SA 3LHTA 3NGFA 1HW6A 1R47A 1FWFC 4H8UA 1OD8A 4DBDA 5KTLA 4NAEA 4K6AA 3M5YA 3MVTA 1C8VA 2QUUA 1E72M 3M5XA 1QI3A 4LBRA 3I3DA 2OYKA 2VCAA 2CERA 1E73M 4Q8NA 2NVDA 3PJUA 5F2GA 3CV1A 3AROA 2QMKA 3VX1A 2OEKA 2IUZA 4REQB 2CITA 4CQBA 4R3UA 3H2EA 4YIWA 1U83A 1UASA 2Z1VA 1J96A 2RDWA 4YJ5A 1QNQA 3G1RA 4LAMA 4QCEA 3V16A 4O10A 1YIXA 3P7YA 3FN9A 3F5LA 3TAOA 2CZEA 2DZWA 1EPVA 3OGSA 1EC7A 3KOWA 1DVJA 3MS8A 3MVIA 4RV3A 2QGYA 3AXXA 1X1ZA 3UG3A 3W53A 3UJFA 1E0WA 2PPGA 3AZTA 4PR4A 4FX7A 4BWLA 3CEPA 1LLWA 1XIHA 4DZ5A 1XSJA 1BRLA 5C5YA 1WZAA 1GOWA 3LG3A 2CEQA 1J0IA 4HOXA 2QPXA 2PDKA 1CGXA 3CC1A 3BL3A 3WUEA 1BXCA 3EPOA 3DFOA 3GNXA 1BWLA 3W29A 3VIIA 5G4WA 3S5YA 1O68A 5D4YA 9RUBA 3L4YA 1H60A 4PMVA 3ORWA 4PFHA 1WP6A 1NWRA 3LGEA 3W7DA 4M82A 3VILA 1AZ2A 2FFIA 1HG3A 4XIMA 4DX3A 3S1GA 2E5BA 2WB5A 1UQYA 3ARWA 4M3PA 3A5FA 3TCEA 4DYKA 3DYOA 4OIFA 3G6LA 4HPXA 3N9RA 1PYMA 4UCFA 2WMJA 4UTTA 2MANA 4ZSUA 4GUJA 3AI0A 3QPEA 3QGKC 1Q8JA 5LXXA 4DJFA 4N02A 4DBWA 2YFNA 2ZZ6A 3SY8A 4IIDA 4AF0A 4GYPA 1AK5A 5HUOA 2FFCA 4LCQA 5C9UA 1FH8A 2DV0A 4DJDA 2X41A 4HZ6A 1ZJHA 1MWOA 5LKYA 3WFZA 1SVDA 5H91A 1QPQA 2ABAA 1PAMA 3MMTA 3BURA 4K8HA 1ZJBA 2R1PA 2WSQA 3B0VC 1TPUA 3DCPA 3LTPA 3EX2A 2VL4A 4OJYA 3RDKA 3F2CA 1Q2SA 4WXYA 1G5AA 5E1QA 4CN6A 2C0HA 4KERA 4W93A 1Z32X 4UTMA 4KGLA 3UYIA 2X1SA 3HV9A 1P1MA 1GJPA 3KRZA 1Q5MA 3WQ6A 4EPKA 2ISWA 3JUGA 1OGBA 3QOKA 4CU7A 2GJLA 1XLAA 3C2VA 3M1ZA 5EA9A 3CQJA 1BXBA 4W7UA 3FA4A 1THFD 4HGXA 1XPYA 2ZTJA 5AVHA 5EYWA 3WYZA 3PUOA 4RL3A 4PMYA 5TNVA 5F2MA 1D3CA 3G77A 4ZMGA 3C0LA 1WDWA 1NSJA 3W3OA 2FDSA 2PS2A 2IKIA 1DJQA 3MI2A 2NQ5A 5IHRA 4DZHA 2NQ9A 2ONEA 4ROQA 4QROA 3WENA 4JN8A 4MZ8A 2PDIA 1AJ0A 1RCXB 2XH2A 1W5PA 3DHDA 2Y7GA 4Y9NA 1GORA 4BF5A 4QLJA 1RY0A 1UWUA 4IJRA 4HN8A 4P2VA 5H8UA 4GWEA 2G3JA 1KR0A 1EP1A 3TN3A 4ZE4A 3VXGA 2WC3A 3UZ5A 1HL2A 3BW4A 3BXWA 4M6QA 1RK6A 1O1HA 3BOFA 2WYSA 2ZX8A 5HOSA 4HZ7A 4DRSA 5HQEA 5D03A 4RZ4A 3KS5A 2D1ZA 1SMAA 2J78A 2W5FA 1WDRA 1CLKA 3NJ3A 3QSRA 4CNUA 1M7XA 3R8RA 2BOFX 4ZFCA 4GQRA 2YIHA 2YKKA 4GNJA 3WMSA 1NIUA 1TCMA 3H22A 3DZ1A 5LNRA 4OFCA 4LRTA 3W7PA 4C6IA 1YMYA 2ZFAA 4Q7NA 1QOPA 1JYWA 3MHGA 3SCPA 4JY9A 2Q8ZA 1A0CA 2HZGA 5CBBA 3VDGA 2KZHA 4CNPA 1J11A 3QRHA 3DG3A 2PA6A 3GE7A 4IQLA 3K4WA 1TR1A 5C8BB 2HS8A 1BF6A 4UBPC 4WSKA 4ZOEA 3ZR4A 3DHPA 3S9YA 5ECVA 4FIRA 4NHVA 4LT9A 2PC4A 3TEVA 1SFJA 2E9LA 5T9BG 2X1RA 5BWFA 1KM6A 4TX6A 2OZTA 4LSBA 1BLIA 3OB8A 3QV7A 2WV8A 1GYLA 3P62A 2QCFA 1BSLA 3V35A 2QCCA 4DM1A 1E9LA 2IXVA 2FB2A 4QE4A 3CHFA 4LY8A 2W27A 3K30A 4PB4A 4TX8A 3AUJA 3W1AA 3GTIA 3VIGA 2OGJA 1V6WA 4FXSA 4ZXOA 1N8WA 3G1SA 2EO7A 2FVLA 2PF8A 1TPFA 5GJNA 3JS3A 4FLOA 2I5GA 3EA1A 1KNWA 1BYBA 2VD9A 3IAQA 2FGLA 2ZKMX 2HEJA 1XX1A 1DIEA 3DFPA 3VGFA 3W76A 5G2WA 1HKMA 5DCBA 3RLUA 2Z7KA 2D2OA 4LUYA 4HU3A 2J27A 3PBVA 2DJXA 3R0DA 1W1PA 1XIFA 1Q6QA 1YXCA 2L5HA 4JXCA 4URIA 3B8WA 5LNUA 4XAFA 4TVUA 4LRSA 3QV6A 3LGDA 5DQPA 4CU6A 3IV8A 1R0MA 1RLDA 1NTHA 2GSJA 2WZTA 1FUYA 3APYA 3EOEA 1SO5A 4HK7A 4RK8A 1AMYA 4QQUA 1H3GA 1NDVA 3M0MA 4B3LA 1DWGM 2GL5A 3V3WA 4R85A 5ABEA 4C7DA 3E0WA 4K7YA 5CPNA 3VINA 1MEIA 4HNNA 3WK2A 1XLMA 4W5UA 1CTNA 2DT2A 1UR3M 1JD7A 1GCYA 3HPAA 5BU6A 2Y8KA 4AZHA 4NAFA 1EF2A 5GQBA 5H6HA 2FZDA 1JNEA 3DGBA 1V6XA 1LOLA 4Z2JA 2ABBA 3LPGA 4HB7A 3PBGA 2Z28A 4D6JA 3AHXA 2ZXAA 1J5SA 4ZB5A 2ZZ4A 4B5TA 4Z08A 2QYGA 3KRBA 2H3DA 1Z48A 1ZQ5A 1R2TA 3BQ6A 4AYSA 2WZMA 1I8JA 3Q58A 4NZFA 3MYOA 3PTDA 4RNFA 3EOUA 2ZRXA 4HYVA 5L6UA 4L1XA 2O92A 4B3KA 3L21A 3ZJ6A 1G01A 3GBEA 3N12A 1A50A 2ESCA 5G4HC 1MZRA 2G3NA 4OHQA 3E6EA 3QQ1A 2ZIDA 3NL3A 4JNZA 1D3HA 3WFAA 2UY3A 4L6DA 2ZX7A 3PR2A 1E6ZA 4OOUA 3TCSA 4AH7A 1VYRA 2OKTA 2WZHA 4AB4A 5AYBA 3W73A 3AQUA 2CZVA 3ITGA 2ACRA 2BS9A 3TJIA 5CAKA 3VE7A 1I9CB 1W9XA 4D72A 3GU9A 1F3XA 1PDYA 2VURA 4RW5A 2NWSA 2FVKA 2IW0A 1PYFA 2JIWA 4WRHA 4LH8A 1VFOA 1E6XM 1VJZA 2VGIA 4XKMA 3LSCA 5LIKX 4O14A 4EAMA 3QSTA 3M6YA 4S3GA 4FX8A 7ENLA 1QK2A 3T4CA 1ML1A 2W63A 4DWSA 1V51A 3LRMA 2BBFA 5TBOA 1VYPX 5AC7A 4W8LA 3KBVA 1KXQA 1QPKA 5C2XA 4Q4PA 2FZ9A 3MJYA 1AD4A 2GQ3A 1FWGC 4M51A 3DESA 1HVXA 3GX9A 5CSRA 4MM1A 3OLGA 3Q37A 1V3LA 2Q3RA 1EL3A 4EACA 1K3UA 1PX8A 4WVXA 1HJUA 1IEQA 3RILA 2WNQA 3KRSA 1P6BA 2HTMA 2UY5A 4NX0A 4CLMA 5HPOA 2XJ7A 3W4RA 4GI4A 2OLHA 3IGSA 5CZ0A 2GLKA 4WK9A 2VZUA 3BSHA 3GXDA 5T91A 2GJPA 4YVVA 1A5OC 4HBKA 4YTQA 4FX6M 2A7NA 3SECA 3HN3A 3ARZA 3UY7A 2CZ5A 4JQ2A 1NOUA 2PLJA 3UY8A 3FJ4A 2WSKA 3UERA 4UTTC 1TIMA 4KRUA 3VE9A 2ZUVA 3ABXA 5A3HA 4G7FA 4WOQA 1LLZA 3MBFA 4G6CA 2BP1A 2ASHA 1HGWA 2V3FA 2E0PA 5IXEA 2ANUA 3C0JA 1CI1A 3WK1A 1W91A 1EZ2A 1K9FA 4RR4A 3EKLA 1E55A 2W4XA 5DCEA 5TAOA 4LVAA 4DXXA 5J5DA 4YHEA 4DPPA 5C7HA 5CSSA 4GQBA 3P14A 3TYDA 1K9EA 3MUCA 2XFWA 1RD5A 3GDBA 3QV9A 1HQTA 2GZXA 3CASA 1E0XA 4DWDA 3B40A 2BNJA 4PUKA 4N6FA 4ECLA 2FZ8A 3P8IA 5BZAA 3CB3A 3I6TA 1TRDA 3PANA 1W31A 4DNHA 3BG9A 2YDQA 4XZNX 3W81A 4NI3A 3UEQA 1JIBA 1JULA 2AQOA 3II1A 4TUFA 1B1YA 4AFYA 1V3JA 3KTXA 2WVUA 4AZ6A 3BARA 4JCLA 2O4QA 1FWRA 4C6NA 1DIOA 2A4AA 1S3TC 5I3JA 1KFCA 4GBDA 1J2WA 1E6QM 1SQ7A 3QR0A 4C6FA 3KUMA 4HQVA 4IXHA 2NLIA 4LANA 7TIMA 1ZTVA 3FHAA 3FYYA 2E68A 3RMJA 1FWNA 4GVHA 2PDCA 2BTMA 5DFAA 1N7KA 2JEQA 4GD0A 6CGTA 5CZSA 3VKCA 2PWGA 5F2IA 3IS4A 3MCOA 3WL1A 4MGGA 2WQDA 3AIRA 1EUNA 5KZ6A 1I60A 1B3ZA 1KBIA 2DPEA 5HMSA 3I7RA 2Y7DA 1C7TA 1RXOB 5TD4A 2TAAA 3ISIX 2ISFA 3I10A 2D0FA 5AB3A 4DUWA 3DKJA 3H4GA 4RNHA 1CGVA 1UR1A 4UQDA 1XYFA 4UQ9A 4C7GA 4J9JA 3P5ZA 2QVNA 2DW6A 2BY2A 4ADUA 3DBPA 4AXNA 4HU8A 3AOFA 4E2DA 3OZOA 1J0JA 4MADA 2WM1A 1XLEA 2C1GA 3TAKA 2PE4A 2G4FA 1F61A 5A8GA 3UGRA 3EB4A 4FXFA 4MWAE 5E0KA 5A6KA 1EIXA 4CD7A 3O6CA 1XGZA 1Q6RA 5FEZA 4E4PA 2OVLA 2PWUA 3TQ0A 3KTSA 4DBUA 1UWAA 3A9BA 3NXLA 3GDKA 2DZXA 2OYLA 4Z2LA 2FPTA 3KFTA 3GSMA 4MVAA 4F2BA 4GY7A 3VIJA 5DXYA 3E0IA 3T07A 3WLKX 3NQFA 3PUDA 2CETA 3E2SA 1R3RA 1FFQA 1K4HA 2ZUUA 1MW0A 1XC4A 3ZT6A 3QYQA 3W87A 1JPKA 1XUZA 2C7FA 4JIEA 4NUWA 3WMBA 3CXOA 3IIPA 1VAHA 3V18A 2GFTA 4HYRA 3WLRA 4NRRA 1US0A 1JYVA 3R11A 5HNTA 3RR1A 1B4KA 1DHPA 4FNRA 4A4AA 3AXIA 3TROA 4G1KA 3C2OA 4PSPA 4RZ6A 4NJKA 1YBQB 5K4XA 3TYAA 4AVOA 1X6UA 3IJLA 4UFJA 1TV4A 2WMFA 4W85A 3LZ3A 5K9DA 3HG3A 4LVBA 2GQ9A 1F6KA 2X2YA 3VIKA 8CGTA 3TQKA 2DZSA 4ZA0A 3AIEA 1TTJA 3KVMA 4XB3A 1OIFA 3E0FA 1IEXA 4UTLA 2CHRA 1N8FA 3S5ZA 3UU0A 3GVRA 5XINA 2J7FA 1PPIA 4LPCA 5HQLA 2C1IA 2FB3A 3BJTA 2DUAA 3M64A 4LUIA 1SZGA 1U33A 3TOYA 1B3WA 1KKOA 4H4IA 4DI9A 2V81A 3FLUA 3M5VA 2Y5EA 1MW1A 2BOGX 2RKXA 2HV5A 1O5XA 4HCDA 3O6DA 4AEFA 1FCQA 3LTSA 1ELSA 1LBMA 5A8MA 2C14A 3WK0A 4AD2A 3H21A 2V69A 1EDGA 3CBWA 3P3BA 2O55A 2HXTA 1BYDA 5C9RA 1V02E 1V03A 1XPGA 4AW7A 3FCPA 3QZAA 2D73A 3W1NA 1PWLA 4P7QA 5HNNA 5AHIA 1LRQA 1BTCA 2WSYA 4MAZA 4XD5A 5CPMA 1JF5A 3N3TA 3R89A 1AA1B 1PZ3A 4O19A 3I3BA 5DMLA 3GNOA 3HGJA 4PEEA 4ZTXA 4IIFA 3WLQA 3RO8A 1POJA 1VGAA 1D3GA 1S2CA 3ZVHB 4IWWA 4PUMA 2FZNA 1U5VA 4H1ZA 4W9TA 3LPFA 4PZVA 1IEWA 2CKRA 4HKPA 1XIJA 2ZX5A 1T8QA 3EMZA 1GGOA 5C6MA 2FPVA 5EGRA 4ADSA 3HFTA 3TOPA 3FAWA 4IGSA 2FVMA 4YWSA 3CQIA 2J9YA 3I65A 3RHGA 4HMNA 4LUTB 4PMRA 5SWUA 5FA5A 3OBAA 8XIAA 2A1YA 2YW3A 1KD0A 3Q65A 1VCGA 3PAOA 1EHNA 1HN1A 2ZC8A 4ICCX 3T8LA 3INPA 1O1ZA 1UD5A 3M41A 2OO6A 1CXHA 2IMRA 4MNKA 4D2JA 4M29A 2HE8A 2X0YA 1K8ZA 3HB9A 1C91A 1OGGA 4XBSA 4YLWA 2VFGA 2R94A 2EPOA 2QUNA 2GSEA 1REQA 2X1IA 1TMHA 3R10A 1V6UA 4Y2WA 2BZNA 2RDUA 4IG2B 3QPYA 4G8TA 1H7RA 3G24A 1I45A 3ZT5A 3K1DA 4WZHA 4D9PA 1FWHC 3NQDA 3PG9A 1JFHA 2P0OA 2GUYA 4M80A 3TN4A 4U3CA 3UF9A 2F6KA 3NM3A 5BMWA 5FL1A 3EWYA 4GJ1A 2CLOA 2R24A 1BGAA 3U9IA 3IWPA 1Q4WA 1QWKA 1HKWA 5MKGA 4ML9A 4QM1A 1FWEC 1UPMB 1CLXA 1PTAA 2DQWA 1DE6A 2VRJA 1JDCA 4X60A 3AFBA 2I9UA 5JUVA 1FX6A 1OX6A 2V6AA 3B9DA 3RYSA 3LX9A 1W8GA 1NWSA 2F9RA 4RNIA 1FWIC 2ZVIA 4LU0A 5DBTA 3FDGA 1JF6A 1UA3A 3M0YA 2RDTA 4C6QA 2HK0A 3ITCA 2VEPA 2VQTA 4FLRA 1PZ2A 2VGGA 3K8KA 3NWRA 4GG9A 4O15A 1DYSA 1G4PA 4Q7IA 2NVCA 1Y5XA 3OG3A 5D2TA 3LN3A 1DWAM 3ZR5A 1W8SA 3BMXA 5AZ0A 3WQCA 2ZA1A 1LYXA 1ZB5A 4LW7A 2I16A 1ZAJA 2P3EA 3BJFA 2Y5SA 3N13A 4F0RA 3ITYA 2ZADA 1GKPA 4Z2KA 3LENA 4YU1A 3LS9A 2YOCA 1SUXA 3CTTA 5DY2A 3EZ4A 3E5PA 4GBUA 1FWCC 1WYIA 1MSSA 4OE7A 3TSBA 3E02A 3FA5A 3RM8A 3SQLA 2FMOA 1V7AA 1YQ2A 4D6IA 4AZCA 4E8DA 2HNHA 1ESWA 1PTGA 4PMZA 4PUEA 4QJ4B 1V3HA 4MDOA 1EDTA 1LRTA 3B9AA 2NV1A 2V68A 3AHTA 5I06A 4GUGA 1WQ5A 4M6VA 4KIEA 1FWSA 1L6SA 2CLEA 4ZOCA 4ZB2A 3T0AA 3GW3A 2QGHA 2J4GA 5K3VA 4I5XA 3IGHX 4IPNB 4B3ZA 4GGBA 1VFHA 4FF5A 4LUSA 3WJYA 1QO2A 1C7SA 4IZGA 1I2RA 3IGUA 4OOZA 4IPIA 3UW6A 3DYMA 4ZQPA 3WK3A 2AL2A 3RJXA 1VBHA 1L8PA 3FJLA 4IXXA 1CXIA 1VFMA 1YTEA 2R8WA 2HSAA 3TNBA 2OG9A 1V77A 3L2LA 5ENLA 3GG1A 4JQ4A 3G1XA 5E93A 4F0SA 3UWEA 2Q71A 1XLBA 2PURA 1XLDA 4IMEA 3FHQA 3W37A 3TYZA 1S5WA 1ICQA 3S1VA 4UFIA 3O1NA 1OG0A 3H12A 3V0TA 4J1OA 3R94A 3M47A 4Q6XA 2PDYA 3V1HA 2AL1A 5DMNA 1EIBA 3FKRA 4O54A 3TLLA 3LHYA 4IH3A 4Q33A 1RQEA 3GUGA 2QCHA 1FRBA 2YA0A 3VNIA 1BYCA 4BFAA 1XFCA 4AEEA 3MY9A 3C2YA 3SQSA 4IIGA 1DWFM 2A85A 1TA3A 2WBGA 4JTGA 1SFTA 3VFCA 3ELFA 4NZ4A 4QGCA 5JBEA 5LIYX 2WVVA 3KP1A 4UTUA 2QKFA 1B90A 2ACSA 3N2XA 2D23A 2GJXA 3ZVIA 3LCFA 4C1KA 1U30A 3LPOA 3OYZA 5BRQA 2P3ZA 3LV6A 4G5DA 3IJQA 3ARPA 1RJPA 3CLMA 4P7OA 1B4EA 3IVTA 1NM9A 1IQ8A 4XVEA 3AAMA 4XVDA 2OZ8A 4OUIA 4F0LA 3ARTA 1QFEA 3VDCA 3LLDA 2GYIA 1RUSA 5AZ1A 3UFYA 4TR9A 1K8CA 1TZ9A 2ZC1A 3VKAA 4LNCA 3KBWA 1UD6A 3GDRA 4FOUA 1ZNNA 3NDYA 4N7QA 4UTHA 3C6CA 4F4RA 4MSSA 1O7AA 2ZE0A 3I6EA 3QKEA 5CZKA 3XINA 1EWDA 4JCMA 1UMLA 2X7VA 3W38A 2WMIB 1UR4A 5REQA 4LYKA 2R1LA 3R0KA 1MFUA 1V0MA 1BVNP 2QIWA 3L4XA 4U4MA 3W1XA 4H41A 3NL6A 1MMFA 3CL8A 2VVSA 3DGRA 2W61A 2OT1A 1ODUA 1M01A 2PBGA 3VOJA 3W2KA 1QR7A 1Z69A 3KP0A 1F5ZA 1TQXA 1ISWA 4H01A 4C6PA 5FJUA 1WAUA 3NQ2A 2WLYA 3P6LA 4YCPA 1B3YA 1GVSA 3OA3A 2ALDA 3NSNA 2GVEA 2WCAA 1QXLA 2PDJA 3LHUA 2NUYA 5C54A 3NCOA 3GNNA 2IKHA 1JVNA 5HQMA 1GVEA 3ZZ1A 4UOJA 1AH4A 2E3ZA 1XBYA 1A47A 1XDJA 1I2OA 1H49A 3QVQA 4XZWA 2X40A 2YL8A 2CBUA 3SIZA 5DELA 2WC7A 2YL6A 5FI8A 1ZUAX 1NOWA 4A8NA 4A3YA 1GOMA 1P48A 4XAPA 1NDWA 4S3DA 1FHUA 1LOQA 3R4IA 1YPIA 2W79A 3NVDA 4XZLX 5K2ZA 2PB1A 2BV9A 4Q6JA 4XKYB 1Q7QA 2QJJA 1V0NA 2Y7FA 4QITA 4XUYA 3TR2A 5HBFA 2HMCA 3GAYA 3UESA 3FNDA 4A3RA 1G1YA 3V36A 3MKCA 3PZMA 2QDEA 2AGTA 3E96A 4LWWA 1JCMP 2VQUA 4I90A 3TYEA 4LQ1A 4I9TA 2EGZA 1RHCA 4JQ3A 2TPSA 3EDEA 4DJFC 1GTEA 2QVHA 3EEGA 3UPMA 1DKWA 2UWFA 1EBHA 1UIOA 3PAJA 2YR1A 2E1WA 3T0BA 4LAOA 4UTFA 2CLPA 3GXMA 1YNPA 4AG0A 1UD3A 3TFXA 1CIUA 5EBUA 1UWRA 4HOWA 1ZJIA 3E2VA 3TJLA 4DHGA 1DL3A 4CD6A 1UUOA 2CKSA 3UXIA 3N3MA 4MY1A 2DT3A 1N55A 1UCWA 4A29A 4IFOA 1J0YA 1GOOA 2D2HA 2DZTA 3QN3A 1TV3A 2VC5A 1EXPA 1VIWA 3EX4A 2UBPC 1IF2A 3W1PA 4DJFD 4MJ4A 1F05A 3E74A 2VR2A 3V0UA 1J18A 5K9CA 3UQNA 1WBJA 3OVQA 4GRSA 4S2CA 3CZJA 4FF7A 4P8UA 3OO2A 5FACA 3D3FA 4HPJA 2OEMA 4BQ2A 4B2DD 4FZIA 5JBDA 4B91A 2EXOA 2WJDA 2CLIA 1DIDA 1XUUA 1C8YA 4Q4OA 4MYXA 4LUSB 2VDHA 1F8MA 3GYEA 4WKAA 2PDMA 2BVYA 2FDMA 3AWOA 1EO5A 4FK9A 4Q3MA 1K1DA 4EWND 1GZGA 4QEEA 3TC3A 1OEPA 2X0SA 4LB3A 3F03K 1QI0A 3F5JA 1UH4A 3VD9A 2Y70A 1AG1O 4TIMA 4UFMA 4GUHA 4S2BA 1EJTC 3TXZA 3EGJA 3B8DA 2CXEA 1W3JA 2NXHA 4E8GA 1HNYA 1E5NA 4AIBA 2BODX 2PRHA 3OHMB 4QG6A 4OQVA 4C6JA 5I2UA 1A5UA 3SFWA 2C79A 4AX7A 1EGZA 1NFBA 5A2AA 4XZMX 2V63A 3G1VA 4DAIA 1I2QA 4ILSA 1HP4A 4PUDA 4LTSA 1IIGA 3QGVA 2Z29A 1WE5A 3W1RA 4XV0A 1HGYA 2QF8A 5E70A 4AD0A 1OIMA 3TH6A 2BLEA 3EXSA 3E12A 1Z44A 3CAVA 3VNKA 1OFEA 1GQKA 2BVWA 3NOYA 1QTWA 3TE9A 1DTNA 1R9ZA 5T9CE 5LA0A 4WSJA 4N4QA 1NJJA 5FF4A 3U57A 5HJLA 3L5MA 3MCMA 3WL0A 3CIWA 1LDCA 2YX0A 4RUBA 3UWWA 4OBRA 1XSIA 4KT2A 3KLKA 1NVMA 4H2HA 4RZBA 2QR6A 3WLOA 3HU7A 3E1F1 3ITXA 6PTDA 2CZDA 3EOOA 1FHVA 3QF0A 4PMQA 4B5SA 4O28A 2BDQA 3HG2A 3OLDA 3ZXWA 5LA1A 2QHAA 3CIXA 1CB2A 4Q4SA 3GK0A 2XISA 1E40A 3NXFA 1HT6A 2VEKA 1EQCA 4IIHA 2PDWA 1R3WA 3QLDA 3UVAA 2VEFA 4PMUA 4KCVA 5IOBA 1AH3A 4YWIA 3REQA 4UIOA 3KDOA 1ODZA 4GISA 2DEPA 3GH5A 3RCNA 4NYYA 2GWGA 2DVUA 4FNQA 3TKFA 2XH0A 4PUNA 3W7EA 4IPLA 3HV8A 4DB7A 5LNSA 1LROA 1A5BA 3RLGA 3ABSA 2YCLA 1TV7A 3AO0A 4RXFA 3NDZA 1UA7A 1UYQA 3W26A 1BVZA 3F7JA 4YS1A 1H11A 1RR2A 4JTSA 1UKPA 2F8QA 4YYCA 2CYGA 4PUJA 2PP1A 1XIIA 3I7QA 4WJ8A 2ZRWA 3D3AA 2UY2A 3QY6A 5D9NA 1KCKA 3DG7A 1LWJA 3TYCA 4J3VA 3WBWA 3W2LA 4FEZA 1XYZA 4F40A 1ICSA 4DM2A 4US5A 5AC4A 1OINA 2OFJA 4LAUA 4X61A 4H83A 5HAOA 3PWAA 2XFRA 4HT3A 2QCNA 4QNWA 4QNEA 4S39A 3W2UA 2A6LA 2V30A 1UH3A 4K37A 1DPMA 3HF3A 4W89A 1E1CB 4H9YA 4K2SA 2J7EA 4NVTA 4CQCA 3NQ8A 2QCGA 2PTDA 2ZUWA 3PWIA 3VKDA 1ZRQA 3DECA 1D8WA 1XCWA 3RX2A 3BLOA 2JKPA 3L23A 1KM4A 1PIFA 1XBVA 4G7EA 2NQLA 3VOFA 1IZJA 1EYWA 1E9ZB 3S9IA 3GWQA 3RU8X 1JEZA 1RP8A 1X97A 4TMBA 5LIWX 4LAKA 3R1ZA 4IM4A 1M7PA 3MUXA 3ZMRA 3MWCA 2GGGA 1HL8A 1S39A 3BAIA 3A4AA 1ZBKA 2YLLA 3GM8A 1R7OA 3LZ5A 2ZUTA 4QP0A 1UD8A 2X7WA 5A2BA 4JHOA 2ZDSA 4O1CA 3S0CA 4UWMA 1FP8A 1P7TA 3OVPA 1IXPA 3F1QA 3GC2A 2G96A 1XRTA 2ZRUA 4HZMA 1H63A 5E6YA 2PRMA 1FXQA 1OM0A 4EWJA 3B8IA 4GUFA 4H00A 5KINA 1TRIA 2W66A 1VEOA 4HNVA 2I17A 4KETA 1TPVA 3L4VA 5A8PA 1M04A 1XIDA 3N14A 4Q8WA 1QHOA 1Q63A 3FS2A 3C5QA 2YCIX 3HQPA 1CGYA 1C9WA 4S3JA 1EFZA 2RJGA 1GHRA 2RHGA 3GHTA 9XIAA 4B5UA 3GHSA 4JHMA 3OW1A 5D9MA 2RH9A 4FR6A 5LNVA 3IJIA 3DI1A 2EPKX 1Z3NA 1A5LC 1VQTA 3TMQA 3STPA 2FZMA 3RPDA 4HNCA 1JGMA 4Y8FA 3RO6A 2ZZ1A 4E8CA 1TFVA 5D09A 4IIEA 2HPMA 1V7YA 2QXWA 1M53A 5ECUA 1WNOA 3AMLA 2IKGA 2VRKA 1A5NC 1LL4A 1W2VA 3UA4A 2DW7A 2NT1A 3G0UA 3MP3A 3NIYA 4CCCA 3O06A 4ZBCA 1HJQA 2ZZ2A 2OZ0A 1UR9A 1XIGA 3M7WA 2PDFA 3G0XA 3B9OA 3ZJ7A 1W9DM 3F4VA 4NXKA 1RZMA 3MBDA 1UR8A 3VUSA 1XICA 1LP6A 2VCCA 2GUBA 1W9UA 1FP9A 2Z1XA 2A7RA 3W85A 3WBAA 3ZIZA 3GTXA 2BX7A 3S4TA 1WDPA 1XLGA 2P53A 1AUSL 3EXRA 2E8YA 3LBOA 3LMZA 2J13A 1J9YA 3A4WA 1CBGA 1AQMA 3VDBA 3CMFA 1UKOA 1B5TA 4K1GA 4OBTA 2R9RA 1RVGA 3L4WA 3UZWA 2V2HA 2EKGA 3OLEA 4G1NA 1IYXA 3NL2A 2OB3A 1VFSA 4H9TA 4GK8A 1WCGA 3W82A 4J27A 3N11A 1E6PA 1ZY9A 3GRIA 1WKYA 4E2BA 2X30A 2X1TA 4WOZA 5CSYA 3OZPA 2R82A 5AVNA 2C13A 2VZTA 3G1AA 4WR3A 4UZSA 4GUIA 1ZGDA 4LOCA 1KTBA 1HX0A 2JQXA 3MZ2A 4JKMA 3RM4A 2Q3OA 1MI3A 6TAAA 3SUVA 4Q8VA 3FJ6A 2WNNA 1TUXA 3PUEA 5D9PA 2VX6A 3PM6A 4B4FA 5AECA 4NP7A 1JZ2A 2X8RA 3OODA 1KFWA 1EOMA 2C16A 2A5HA 1XYBA 4DJDD 3UCCA 3W1QA 5BRBA 1OD0A 4HNUA 2NV2A 1TPC1 1HKVA 4UOZA 1TUFA 2BG5A 4YNGA 3G2GA 4PE8A 2VDIA 1IWAA 1SO4A 1EX5A 1XFBA 1E9IA 4ML4A 1S5MA 3VGBA 1A5KC 3DAQA 4IL0A 4AD3A 4MZ1A 3B0PA 3APGA 1SYTA 2ZZ7A 4ES4A 4GX9A 1EX1A 2QF7A 3B05A 5U7SA 1BKSA 4Y9AA 2POZA 2OGYA 1UBPC 1O5RA 2A6NA 4L1WA 3W2MA 4R5EA 3UGVA 3MANA 1TZ7A 3SZ8A 3WEOA 4N9DA 1EYEA 1JZ8A 4W87A 3SGZA 1UW9A 3QM3A 4KQNA 3GB6A 3XISA 4DZIA 3AJ7A 2FZBA 5HDRA 1EQPA 1OC5A 1PCWA 2R1KA 4JTAA 1OB0A 4JTLA 3GQYA 1XH1A 2D3LA 1ONEA 3THCA 3BPWA 1W54A 3POCA 3EYPA 1GKQA 5E9XA 2QMJA 3C56A 3N73A 4DWSC 1LBLA 5A2CA 3WJZA 5IBXA 1K4GA 3PF3A 1KXVA 1JAEA 1DTUA 4BF7A 1WDDA 1RD6A 4MHBA 3TK7A 4IUOA 4PRWA 4OECA 3FV9A 2WM0A 4IP7A 2NZLA 2R6OA 1EJWC 4RCXA 2XVKA 5J5RA 4IICA 4GYJA 4W4QA 4AZIA 4QE5A 4N9BA 4TTUA 1WZLA 5AY7A 4P7NA 1WUFA 5KZMA 1UD4A 1KFLA 4JIPA 1SO6A 4ZQNA 4WEVX 4A2SA 4JFVA 4AWTA 3L66A 4O50A 4XX6A 3KHJA 4HMEA 3SR7A 4JTEA 2E7FA 3W1LA 4BA0A 3EB3A 3LD5A 3NYZA 3PZTA 1YXYA 2Y0FA 2VEIA 3SCNA 4S3KA 1I4NA 4GOAA 4K8EA 4JAWA 4ROPA 3WJSA 4DO5A 3U5YA 4GC3A 3QTPA 3MV11 3ZYZA 3THQA 3ICJA 1I0BA 4Y96A 3WLJA 2OELA 4L80A 4OKDA 1IXNA 4NAEB 4REQA 1YXDA 4CQDA 4HP5A 3O15A 3HOJA 3KBNA 4NY2A 4H6RA 1FCVA 2WW5A 3EWWA 2PGEA 4U5IA 1EO7A 3UZJA 3LB0A 5CG0A 1UJPA 3TZFA 4B5VA 2HK1A 3BG3A 1XKYA 3NR0A 5XIAA 3PNUA 5BXPA 5C0QA 3P0XA 3LDVA 4TQTA 3HGOA 1E0TA 4JTKA 2HROA 4HNTA 2X05A 1EH9A 4Q8PA 3H7RA 4ZQCA 2XSAA 4S3EA 4JTCA 4GCAA 2J6VA 1UZHA 1ONRA 4F0KA 5IDIA 1GKRA 3CYVA 3WD0A 3MDUA 3CWOX 3T8QA 2H6RA 5AKQA 4QFUA 4F3HA 2QCMA 4WHBA 5IFTA 3LI0A 3UCQA 2WAGA 3A4JA 3EA3A 1Q85A 4MNLA 5TQLA 4GH3A 3F4CA 1N8IA 4LJ3A 5EMLA 1ZCOA 1F8IA 1TYGA 5A6LA 1HKKA 1DWJM 1X39A 3CWNA 1IHIA 2DP3A 5AYYA 1EA0A 1B3OA 3UXKA 4N6EA 2PGFA 3L4UA 5REQB 3SJNA 1K8YA 4HZ8A 1H41A 1QW8A 3W7HA 4LS2A 4WLCA 2BVDA 1JCYA 3MI6A 3QQ0A 1V6TA 1SJBA 4CUCA 3EWXA 3S6TA 4J3TA 4BS0A 1GJUA 3STCA 1F74A 5HWMA 1ADDA 1KFJA 1GZ1A 1IIHA 1MQPA 2E5CA 3W23A 2CIPA 4JOMA 5AHMA 5CLTA 4GGHA 2Z26A 4EPEC 4M56A 2GWNA 4JQAA