4LUSB

Alanine racemase [clostridium difficile 630]
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
382
structure length
373
Chain Sequence
b'KITVPTWAEINLDNLRFNLNNIKNLLEEDIKICGVIADAYGHGAVEVAKLLEKEKVDYLAVARTAEGIELRQNGITLPILNLGYTPDEAFEDSIKNKITMTVYSLETAQKINEIAKSLGEKACVHVKIDSGFQPNEESVQEIIELNKLEYIDLEGMFTHFATADEEYTYKQANNYKFMSDKLDEAGVKIAIKHVSNSAAIMDCPDLRLNMVRAGIILYGHYPSDDVFKDRLELRPAMKLKSKIGHIKQVEPGVGISYGLKYTTTGKETIATVPIGYADGFTRIQKNPKVLIKGEVFDVVGRICMDQIMVRIDKDIDIKVGDEVILFGEGEVTAERIAKDLGTINYEVLCMISRRVDRVYMENNELVQINSYLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine racemase
publication title Structural and biochemical analyses of alanine racemase from the multidrug-resistant Clostridium difficile strain 630.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Isomerase
total genus 122
structure length 373
sequence length 382
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
B PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 4lusB01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 4lusB02
4BF5A 2OO0A 3MT1A 4DZAA 3C5QA 4ILSA 5FAGA 4BEQA 1HKVA 3ANUA 2YXXA 1XFCA 4ZGYA 4V15A 7ODCA 5IRPA 1XQKA 3SY1A 1VFSA 2QGHA 3CPGA 3WQGA 1D7KA 2NV9A 4LUTA 1W8GA 3N2BA 2ODOA 3E5PA 4PB3A 1NIUA 1B54A 3WQDA 3R79A 2P3EA 4PB5A 2O0TA 4LUTB 3B8UA 4Y2WA 4LUYA 1BD0A 3AWNA 3CO8A 2DY3A 4DYJA 1SFTA 1XQLA 2PLJA 2TODA 1L6FA 3WQFA 2ON3A 4XBJA 4WR3A 4BHYA 3S46A 4A3QA 3NZQA 1VFTA 2RJGA 3N2OA 3HA1A 4AIBA 1NJJA 3B8WA 4BEUA 3GWQA 2VD9A 1L6GA 1EPVA 1KNWA 5FACA 3WQEA 1QU4A 4PB4A 2NVAA 1CT5A 4QHRA 4ECLA 1TWIA 2RJHA 3VABA 3LLXA 5BWAA 1KO0A 3E6EA 3B8VA 3B8TA 1F3TA 3ANVA 1HKWA 3WQCA 1SZRA 1FTXA 3HURA 3AWOA 4LUSA 1TUFA 3KW3A 3BTNA 3UW6A 5GJPA 2VD8A 3OO2A 2J66A 5FAJA 3NZPA 4XG1A 5GJNA 2SFPA 4LUSB 4FS9A 4KBXA 2PLKA 1RCQA 5GJMA 3N29A 1VFHA
chains in the Genus database with same CATH superfamily
3QY6A 1LM1A 3MSDA 3BJTA 4BEQA 1Z9AA 4HNVA 5MKGA 2XH0A 3SB0A 3BE7A 4XZHA 3B0XA 2YYTA 1BYCA 1QHOA 5C54A 5A8NA 4M3PA 4V2XA 2FHFA 5E5CA 1BSLA 3AIVA 4PULA 3W1AA 2QCLA 4OVXA 2OODA 2G97A 3RPMA 4OQVA 2QJMA 1QFEA 2PI6A 5CSYA 4RNFA 4HMNA 1VLWA 4P7LA 1NFBA 2C14A 3VXGA 1OY0A 2DUAA 4WX2A 3TJIA 1TV8A 4O17A 2ATSA 5U7SA 3OOQA 4DO7A 1FWFC 3VU2A 1JPKA 3AIBA 3M46A 4KCUA 1KTBA 4NX5A 2FDSA 1OVDA 2CERA 4F9JA 1GYNA 4LVDA 5D2WA 1DYSA 1QU4A 1TWSA 3UG5A 5D38A 1CT5A 1B3XA 3GH4A 1UR2A 1C93A 4L1WA 3HJEA 5L9FA 3C52A 3BGAA 3OW1A 1H62A 3G1DA 3CB3A 3QPZA 3YPIA 1XF0A 1Q63A 3URQA 2PAJA 4IPIA 3PR2A 3CT7A 2QVNA 2IPGA 4JFUA 2C6QA 1OINA 3QKZA 3FYOA 2EPHA 3W53A 4BF5A 3VDAA 1EGVA 4DRSA 4NL1A 2WHKA 1XG4A 1BGGA 4GY0A 1UPPA 3CL8A 4BF7A 3BG5A 1GVOA 3AQUA 4H9ZA 2WW5A 3WBAA 3IUHA 1GKQA 3G2GA 3M47A 4L56A 4MFDA 4B5XA 4KF1A 4K37A 1ZJIA 1EIXA 3TOYA 3DU0A 4QE1A 2ZRVA 3V16A 3V5OA 1OCJA 2O9TA 5DMLA 1SYTA 4GK8A 4XZ9A 1E9LA 3ERPA 3C2YA 4O8RA 2V2HA 4EK7A 3WLIA 3ABXA 5D2VA 2WZTA 4U3AA 4PC8A 3OQEA 4K3ZA 3NNTA 2E40A 3PAJA 4XBKA 1Q6RA 4BQ3A 4O18A 3VIPA 4B5SA 3NL3A 4W5UA 9CGTA 2Y8KA 3CMGA 4DJDA 3TW7A 4YCPA 2D0GA 1XL9A 5F4XA 3CWHA 1LQ2A 4W7VA 3CASA 2AL2A 4TX6A 2GJNA 3B8TA 5BOOA 3K1GA 5DXXA 1Z69A 2NWSA 4NYYA 5D2XA 5G4EA 2ZX8A 3M7WA 5GJMA 1U2YA 5F2LA 5DY3A 2WSYA 4QROA 3M16A 4M6UA 1XIIA 3VUSA 2DSVA 1G4SA 3WD2A 4J3UA 4I7WA 2W92A 3WQGA 1NWUA 1PX4A 4AWSA 4AX7A 4DBUA 5DO8A 2VR2A 3K4DA 4HHHA 4JIHA 3GZAA 2O0TA 3OODA 4LS0A 1C7TA 2J8TA 4AEEA 5TIMA 2YBUA 1W8SA 2DFAA 2ZX6A 3SCWA 2HBXA 5FJOA 3PB0A 3CTTA 3HPAA 5D8WA 4JQ3A 1EH9A 5EMYA 2D23A 1GOKA 4WK9A 3OLEA 3TSBA 1S2UA 3GK0A 3WLHA 2UY4A 3PS7A 1TRDA 4LF1A 2V8ZA 1RSCA 4WD0A 1HP4A 4QAWA 1L6YA 1XIDA 2W9MA 4XUYA 4O4WA 3Q67A 3SJNA 4US5A 4HU3A 4YWSA 1JZ6A 1B30A 1GYMA 3RCYA 2PWHA 2WJDA 3UXDA 1M7PA 2ZTJA 3CUJA 3CLMA 4DLFA 3QLDA 1V0LA 5AHNA 2NLYA 3PSWA 1KBJA 1W0MA 3GR8A 3HG3A 3GC5A 1PXGA 2BMBA 5GJNA 2GDQA 3IJ6A 1GTEA 5I23A 4BF9A 3FYPA 3M1ZA 4O10A 3M0IA 4C6IA 2XIMA 4H6EA 2CYGA 4ZZ9A 4MLJA 3GU2A 3AS1A 4NRRA 5D03A 3DKJA 3BL3A 3FAXA 4N4QA 4EOUA 1E5NA 1W32A 3NUKA 4H8NA 1DHKA 5BRPA 3L23A 7REQA 3GRIA 2INFA 1AVAA 4GZEA 9XIMA 3EB4A 4WDUA 1TV3A 4LAZA 3LLDA 4EIVA 2VFEA 3MO7A 2YCEA 2PDUA 3EWYA 1G4TA 2ICSA 4JTSA 2BOFX 3W1PA 1XYCA 2ACSA 1E6XM 4GNVA 1DJYA 3NQ7A 2YIHA 4UCGA 4Q3MA 4DZ5A 4ZQOA 1NDZA 1ZAHA 4Q8VA 3M5ZA 4RNHA 1O66A 2QPSA 3RG6A 1MVYA 4E5TA 1LRNA 1XLKA 5XIMA 3R10A 3CMFA 3QN3A 4FXRA 3B0VC 4CD4A 3W25A 3N15A 3B9EA 4QQUA 1O5KA 2D0HA 4HZ8A 3GNRA 2PS2A 4OUIA 2D2GA 3GIQA 2YDQA 2DSKA 2QLYA 4LUSB 1VEOA 1XCFA 1R46A 5T26A 2EKGA 3DFYA 3LA4A 5ABFA 5D4YA 3WG6A 3VGDA 3LERA 2CHOA 3PFRA 3NXLA 3VIFA 1MXDA 1KLYA 1E3ZA 1OT2A 4R34A 1TVPA 4KESA 3ARYA 1T6MA 2NQHA 2XN0A 3VNYA 1V4YA 4Q4SA 5JVLA 4C6KA 1XIHA 3BW2A 4J3ZA 1BVNP 1DWGM 1EO5A 4G8TA 1XRFA 3H4GA 2VOMA 1JIBA 2PLCA 4PFMA 1ZQ5A 3GX9A 2XH7A 3EMQA 1LBLA 1UJPA 3GIPA 3ZJ7A 2ZXQA 2WQDA 1MUWA 4CQBA 4HKPA 1FWHC 1OGBA 1TYGA 3GUWA 2RGLA 1SMAA 1KFWA 2G95A 4TVUA 3KUMA 3EXTA 2PRLA 3I10A 1EUAA 3SDOA 1TTQA 4H2HA 1YDNA 3ALFA 2WAGA 3FKRA 2PWEA 3AXHA 3G6MA 1V51A 2OU4A 3TZFA 4A8NA 3L4YA 3UCDA 2YA0A 5DT7A 3GXMA 4LUJA 3TX9A 2O7SA 5RUBA 1GOQA 4XVDA 4FNTA 2DW7A 2PDHA 4AD5A 3N13A 3VE9A 2YXXA 3A3WA 4UTTA 1W1TA 3GD6A 4MWAA 1R3RA 3A12A 5ECUA 1OABA 1I45A 1M01A 5KITA 2WZHA 2IXVA 3AMLA 3KVJA 3TAKA 1A53A 5FJUA 1ADDA 1NELA 4L4OA 1FWCC 4CNUA 3VNDA 2QUVA 3V0UA 3H4XA 3EA3A 4F0MA 1UD6A 4UTJA 3CZLA 4G2DA 3NM1A 2Q02A 4K6AA 2PMQA 5D9MA 1FBAA 2BTMA 4NUWA 1UOKA 4NVTA 3SIMA 4P7QA 4CU7A 4U28A 3W1TA 1VYPX 1B4EA 1KRMA 4OECA 3CZJA 1XRVA 2WVUA 1OG0A 5LSMA 3G1HA 1Y8BA 3MC5A 2PZ0A 1ITUA 1QJWA 4ORIA 3GXDA 3R0DA 1EP3A 3U9IA 1VB9A 2PE4A 4MNLA 2XHYA 2EO7A 1OG6A 3H2EA 4PUEA 4IFRA 4HZ7A 2HTMA 3ABRA 2VZOA 2GGJA 2ZUSA 1Q8JA 2QCMA 4WCJA 2PDWA 2G41A 3N73A 3H24A 2VEPA 4DXKA 2DZPA 2ZICA 4KCVA 4MY8A 1CXEA 3OLIA 4WDTA 4HIBA 4E6MA 1FDYA 2CLFA 3GB6A 4HNUA 1BSIA 2PTWA 4C6LA 3NIYA 1XH0A 3GHSA 3OYXA 2GFTA 5AOUA 4C91A 2V5LA 1M3UA 2G8ZA 5AC6A 1E4IA 4KCTA 3TMLA 2PB1A 3ITYA 2NV1A 4Y9MA 1TV5A 3QOMA 3GW3A 2HQAA 1B3ZA 1GVFA 4AU0A 3E02A 3K13A 4GJJA 3PZMA 2QV5A 3GHTA 1D3HA 3UWYA 2E09A 1XD1A 4GCXA 1VKFA 1Q2SA 4NZ3A 4O16A 3ID7A 3MZNA 2WSPA 5I3HA 3CV6A 3S0CA 5FI8A 1LYXA 4CD8A 5IDIA 4JTLA 1R8LA 3W2UA 3G24A 3FVDA 1U1UA 2EKCA 3P14A 1BYBA 2XVGA 3GBDA 3JUGA 1IT0A 3KVKA 5I77A 2I9EA 2INZA 4RKAA 3B8DA 3QYQA 1OCBA 2PTZA 3JZEA 5DLCA 4AWUA 1SZGA 3RO6A 1RJPA 1K7FA 4J3WA 3SUSA 1RJRA 1VFMA 3Q94A 4I9MA 4PMZA 4HP5A 1KKRA 1SMDA 3S5NA 3GXPA 4RZ5A 1QNVA 1YNYA 1YEYA 4J3SA 2UY3A 3BJSA 3M9YA 1FHVA 2EG8A 1VYRA 1ONXA 1QMLA 1JPMA 3DBNA 4A4AA 1H0IA 3L7RA 1MEIA 1R3TA 3O8AA 3LG3A 3URBA 2V38A 2AAAA 2YSWA 4P8UA 4Y9PA 4KWVA 3VCCA 2YL8A 1VPXA 3QW4B 1PYFA 3VGFA 1GQNA 6REQA 3DI0A 3W87A 5D33A 3M43A 4DQWA 3AHZA 2VMFA 1S5TA 3ES7A 4TVCA 3UQNA 1KTNA 4WGHA 3T42A 3TW9A 4WY0F 4AMAA 1S2CA 3WLJA 1W3HA 1K8XA 4CD6A 2J88A 3WUBA 4QNWA 2CBUA 1D7FA 1D3CA 5J04A 2E7FA 4NJHA 4MAVA 3VYLA 1KR0A 1A3WA 3VGBA 4FOJA 2PDPA 4D1IA 2WHJA 1TR1A 3W37A 1CGVA 2Z26A 2ZZ6A 3E2VA 3MCMA 3QPEA 2CLLA 1GG0A 2YBVA 1K6AA 1HQTA 5BOEA 4L61A 1MDRA 3UP8A 1BVWA 4JTGA 1KXHA 2WC7A 2PBOA 4WOQA 2VFDA 4JQ4A 6XIMA 2X7WA 4K38A 4A29A 3ITLA 3WCZA 1IE7C 1FCVA 3UWZA 2Y1HA 1V0MA 1AL8A 3UWUA 4I5RA 4RPQA 2WMGA 3FY1A 4H3DA 1JEZA 1LP6A 3LCWA 1JNDA 3MDWA 5LIXX 5HA7A 4XD5A 3B0YA 4IF2A 3OG2A 4LUYA 3HO8A 3T4CA 1KRBC 1CGUA 3TC6A 1Z44A 3CH9A 1X7FA 4FP1A 3OGRA 2G3MA 2W27A 4L4LA 3J7HA 4BFAA 2CPUA 3W1QA 4G9PA 1V7YA 1ODUA 1E71M 4KMQA 5EFDA 5FSDC 4EE9A 3BOLA 2HJPA 5DMMA 3FJ4A 5U4NA 2WJZA 1YNPA 1H11A 3LCFA 3H4WA 3C4UA 1PTDA 3F5LA 1E6PA 3EX2A 3QRHA 4HMCA 3RO8A 3DAQA 3UWWA 1KB3A 5B7ZA 1RCXB 3NO1A 4KERA 4IOTA 4LS1A 3N2CA 3BAWA 3CUXA 3I4EA 1WZMA 4A05A 4OUEA 3VNIA 3UW6A 1H51A 2GQ9A 3SCTA 3OHIA 1DIEA 3TSDA 3SO7A 2QMKA 1CIUA 1WKFA 1CXIA 3UBPC 3ZVHA 1M6JA 3LSBA 3CTLA 3S6DA 4NSBA 3CQ0A 3VTRA 1NARA 1QNSA 3SW6A 4O19A 1SFLA 4N9BA 4C6NA 4E4PA 3FA3A 3KCJA 3ARXA 4DB7A 4N6FA 4NNCA 3BMXA 4AXNA 3W2KA 3WUGA 2OT1A 3TN6A 5HUPA 1GNXA 1BKHA 2FTYA 2OOFA 1JDDA 4NT0A 4XO6A 1GZ1A 1ICPA 2VI0A 2VX4A 5A6BD 2QJGA 3TA9A 3W2JA 1TR9A 3HOJA 3HBLA 3E49A 1R3WA 1B2YA 3P74A 3S1VA 3UZZA 4QISA 1JCTA 2WKJA 3Q2DA 3WK0A 2XSBA 1PX3A 2Z2UA 5FOOA 1OFPA 3UY8A 1ZY9A 1UKQA 3WQ6A 1BXBA 3MI2A 3NQ6A 3UJFA 1E0TA 5AC8A 5AN7A 5CC5A 2W79A 3C2VA 4PMUA 5HAOA 3CV7A 3O6DA 1ELSA 2J8FA 4TMBA 5JIWA 1KFJA 3W29A 2TRSA 3EWCA 4RPPA 4JDYA 3REQA 3CGTA 3RU8X 5BOFA 4L65A 3AMGA 3PTQA 3SFKA 1MI3A 3AXMA 3VOHA 1QO5A 3WL0A 1QASA 3XISA 4PCSA 3P0XA 4Q8UA 2DVXA 4DZAA 3LXCA 1CPUA 3U2EA 6ALDA 3CB8A 2DORA 2XM2A 4JTAA 3GTFA 3S5SA 5LGZA 1H4PA 1PKNA 3UA4A 2QGHA 1GVSA 4QG6A 1V03A 1TV4A 3GXIA 1MFUA 4PYSA 3L0KA 2WSQA 4LUTA 1RV8A 3WQPA 4L80A 3LMZA 4S3KA 3FK4A 5C9RA 3NGFA 2BODX 4DPQA 3BLDA 3WLQA 1A49A 3U6WA 3BOXA 2XIOA 3RHGA 3AALA 1Q6EA 1MZHA 4XZIA 4GVFA 4GHRA 1M03A 5AYYA 4DYKA 5KTLA 1KR1A 3A64A 4B5VA 4ZR8A 2CLIA 3EXRA 1VRXA 2W3ZA 3SCUA 1CXKA 5HDRA 3GWQA 3SN4A 3E0VA 3VX1A 1JPHA 1RK6A 2D73A 4YTQA 1DXIA 3ZLFA 3NPWA 3P67A 3MDUA 3EWBX 4F3HA 1WKYA 3QGVA 4H9MA 3PZGA 2H3DA 4JHZA 3FYYA 3U2ZA 3KW3A 2F84A 4GKLA 2QIWA 1GJPA 1EJWC 2VURA 3C0JA 1XGZA 1SJCA 4KW2A 1YDYA 5A6SA 1WXJA 1BTCA 3S2LA 2WV8A 3UNTA 1Q13A 4I5XA 1JYXA 1C8YA 4IH3A 4LWWA 3TH6A 2VEFA 4LNYA 4MUPA 2BXZA 2D2JA 5DY2A 3HQNA 4G7EB 4HPHA 4U33A 4PMQA 5A94A 3KFTA 3AMDA 3UGVA 1YDOA 2WCAA 4M51A 1UUOA 5HQMA 3LCLA 3AO0A 5IHSA 4M1BA 3CPRA 4LCRA 2XVPA 3APGA 4Y8EA 1UHVA 1M9HA 2VVSA 3VK5A 3GDRA 3MV11 1AUSL 3CIVA 2GDUA 4AUBA 2J6XA 3AOFA 4NZ4A 1WDPA 1TUXA 3DX5A 5DCBA 2PLJA 4K1WA 3QGAC 3V36A 3PBVA 5LKYA 3MMDA 1UKTA 4A22A 1RZMA 3WF4A 4OOUA 2A3HA 3LCIA 2PF0A 4GJ1A 3N2XA 2PEVA 4HNNA 1UBPC 3PK7A 5LHEA 1H3GA 3UYCA 2Z24A 1ZRQA 3P8JA 4TXEA 1UA7A 1S2VA 5FEXA 3UA3A 3R1ZA 3ABOA 1F74A 4UMCA 1YXDA 3T0DA 1QT1A 1N8FA 4KFPA 3I7RA 3ZS4A 3LHUA 4X60A 3EGJA 5CC3A 3W24A 3N12A 4O1DA 1D3GA 5IXEA 4P8VA 2CKRA 3L4TA 4UTUA 1TG7A 2XIQA 1VCGA 2XTKA 3GTXA 1X6LA 2ACQA 3PG9A 1OBAA 3USZA 4A3RA 1LWHA 4AW7A 2G4JA 2EHHA 2OXNA 3MHUA 3Q45A 1Q6CA 3H26A 4LVAA 7PTDA 4NYUA 3NYDA 1OCQA 1IHIA 2V6AA 3BW3A 3M6DA 1JXKA 1TSIA 3N9SA 5TAOA 2OSWA 3STFA 4CCDA 4MVAA 5D32A 2EEXA 2R1PA 1IZCA 3T7VA 1PIIA 3IJLA 1A0DA 3KOWA 4RXFA 3U5UA 2PODA 3NWRA 2GK1A 1L8PA 1QR7A 1W3KA 2E8ZA 2QDGA 2F6KA 3F4VA 3HV8A 1POJA 1HL9A 1NDYA 4NILA 5FF3A 2WBGA 3IUDA 5D37A 1NAL1 5BU9A 3G22A 1XRSA 3CHEA 4Q6JA 4D9PA 2WSKA 3WH9A 4DY1A 4RLIA 1JUKA 3T0BA 1PKMA 2VUYA 1VR6A 1OD0A 3N14A 4NRSA 1GOIA 3F4CA 3V5FA 4LTSA 4KQNA 4BJHA 5CKSA 4GD0A 3WJWA 4F0RA 3W7DA 4LANA 3W02A 2WOQA 5I07A 2YKKA 5DRCA 4CVWA 1OGGA 3SUUA 1US3A 4D6IA 4N02A 4TU1A 4U5KA 5KSWA 3NL5A 1XH2A 4X61A 1PO9A 2HBVA 3PY2A 3R5EA 1N8IA 3GNDA 2RDWA 1F61A 1AFSA 3RM4A 2YW4A 1XC4A 2PGWA 3DENA 2ZWZA 1TV7A 4K8EA 1ZFJA 1ZU8A 4PMVA 3TXZA 2VZSA 3NJ3A 3DIPA 3RCMA 5BXRA 1F4HA 2WQPA 4W4QA 7REQB 3OP2A 2Q8XA 3RMEA 3IAQA 5DX7A 4URIA 4KIEA 1UD3A 3WNKA 5I3IA 5CJNA 1IZJA 3W7CA 3W28A 4DO6A 3QMSA 1V0KA 1OFRA 1SJBA 2YPIA 3UG4A 2OB3A 1HT6A 3N3MA 3O9NA 4QXIA 1H7XA 2AKZA 1ICSA 2EPNA 1AW1A 1K02A 3W1MA 1O5XA 1W5MA 3UXKA 2Z28A 3AHYA 1KBLA 1REQB 4FO4A 3QH2A 4GOAA 5BWFA 1K9FA 3QFWA 2LLEA 1UD2A 4GYPC 2J9YA 1V0NA 3TTSA 3L12A 1ESWA 1I2QA 3PZVA 3KDOA 3EPMA 3GXTA 1EF3A 2ANUA 3O6AA 4W8AA 2ZZ7A 1TRIA 1RLDA 2HPMA 3LD5A 1K1DA 1ZBKA 1US2A 1P6BA 1C8VA 3RJXA 2BY2A 4B4HA 3HPSA 1TTPA 2QCGA 4CUCA 3AUOA 4UOJA 1L8NA 4W88A 3FV9A 5DN1A 3AYRA 4NXKA 2V0TA 1E3XA 3B8VA 1V02E 3GIYA 4UZUA 3AWOA 5LA1A 4AC7C 1NY1A 2C79A 4DWDA 2Z7KA 2GGIA 2KX9A 3A13A 3NPXA 1HJXA 1OK6A 3S1WA 3TCSA 4Q8WA 1HKMA 2OX4A 2CU0A 1K9DA 4U4MA 2NW0A 4EP8C 2WWDA 1PPIA 3UXAA 3W75A 1QOQA 1W1IE 4X0NA 4IIDA 1J0KA 2R82A 5HNUA 2GZXA 4LRTA 1SO3A 3CYVA 4Y9NA 2OLAA 1QOXA 1CTNA 3GU1A 1W3JA 4DJEC 1EUNA 1VBUA 4AB4A 5CJ5A 3RF9A 2WMKA 4BI6A 2YFNA 3SQSA 3V4BA 2NX1A 1ZBCA 3NXFA 4IIEA 3LMYA 1R9YA 4YVXA 4BK9A 1TMQA 1FWBC 2BXVA 1M7JA 1FHDA 1R2TA 3T08A 5HR7A 1HJUA 4C65A 4J4KA 3WELA 2TMDA 2V81A 3GG7A 4D6DA 1JYNA 3N6QA 4UTWC 3N2OA 1X97A 1AD1A 4P61A 4AIBA 2L5HA 4CN4A 2V5KA 1R9XA 4AWTA 2FKPA 1A5BA 4CU8A 1RVGA 2Y5SA 5BZAA 4JBRA 3EDJA 3B9OA 1OZQA 1EEXA 2D69A 3R6IA 1DWIM 4MB4A 2YR1A 2A7RA 2CHNA 1IYXA 4E0CA 4LY4A 1HKKA 1X7IA 5HMDA 1EQPA 1T40A 3PWGA 4HA4A 1G69A 3VD5A 2EXOA 3WLTA 3C61A 3N2MA 1X8CA 4PEEA 1OCNA 2O56A 5AFDA 1EKOA 5C2CA 1EX1A 1P43A 2WYSA 3ABZA 4PEKA 1Z32X 1RXOB 1IQ8A 2GPTA 4EWND 1V6WA 4QS6A 3GDMA 4MWAB 4Q4QA 4S39A 3U4AA 2O4QA 4AQLA 3PP7A 4H19A 4NXSA 4O12A 3KS6A 4JDBA 2JKEA 2R8WA 3QPYA 5BCAA 4L6OA 3R0UA 1F6PA 1LL4A 3MHFA 1H7RA 3EXSA 1EA9C 4G6CA 2OG9A 4GX8A 3P81A 3HZ3A 1WYIA 3OLGA 4P2VA 4PCNA 4AIEA 2VL4A 1OF6A 3ANYA 3WDHA 1GVYA 1FWJC 3M0ZA 1FRBA 3B0PA 4GUFA 3F5KA 3ZWSA 2PDXA 3WLMA 3IV8A 3KTXA 5A8QA 1TWDA 2PLMA 2P8BA 4MJMA 3T1GA 3BO9A 4I9TA 2CESA 3PJWA 4RXGA 4OFCA 3FXGA 2WNWA 1RBLA 3RUBL 3LV5A 4S1FA 3WNPA 2CLPA 2X05A 4UFJA 3TFXA 3W0KA 3R43A 3HTWA 2Z00A 2V30A 3FS2A 3VIKA 3RM9A 3SFWA 4LBRA 4JFWA 1MSSA 2PGEA 4QTGA 1FKWA 4HT3A 2X40A 2E9MA 3SM0A 3VAVA 3B9NA 1UR4A 4JTKA 4XX6A 3RM8A 3K2GA 1DV7A 3F4DA 1FCBA 1GONA 1F4AA 6CGTA 3ZJ8A 4EPBC 3OGSA 3BXWA 3CMJA 1U30A 2UY2A 4A3YA 3I7QA 3JW7A 2V5DA 4UC5A 1PZ2A 1P0KA 4GXPA 3WNLA 2VEMA 4HPJA 3F7JA 3G1RA 3B9AA 2VNCA 4FOKA 1R7AA 3TXVA 5CPNA 3HG2A 1QW8A 4ICCX 2CC0A 3AISA 4RZBA 4H2CA 4RNJA 1LTDA 1IT7A 4HSOA 4R7WA 1TZ7A 4OBRA 2H90A 4HU8A 4M6PA 1XHGA 4O4VA 1B5TA 4CN6A 1GOMA 2E6AA 1XDJA 5EPDA 1X38A 4HYRA 3IIPA 3CNYA 3HFTA 1LL7A 5LA0A 4J7RA 4WIWA 4O1AA 2VC7A 4ACZB 4C7FA 2PC8A 3PBMA 1K9EA 5JQ9A 2FVLA 2C91A 1KO0A 4S3BA 3WNOA 1DE5A 1HJWA 3PULA 1LDCA 4DAIA 2IS7A 3LTSA 3NQVA 1TUFA 3M5XA 4PUKA 3GLCA 4F40A 1XIBA 4Z2IA 2ZQ0A 4I6VA 2VDIA 1GQIA 2V63A 3LV6A 1TQXA 3HGJA 2XFRA 1B3YA 3U5YA 3CL6A 1XKYA 1GWJA 4ZXLA 4B9YA 2Q8ZA 3G5EA 3AHTA 2NSOA 4CNNA 5G5IA 1JPDX 1K8ZA 3MUY1 2VX5A 3DHFA 4Q4MA 4QEHA 4XISA 3GO2A 3GYEA 5E1QA 2VRQA 4BHYA 1VH7A 4OIFA 5AVNA 2WLZA 3Q65A 3WX7A 4A6GA 4PTDA 4NNBA 1D2KA 3W7EA 3EOOA 2BSLA 2XVNA 4HN4A 3WQEA 4S3EA 1ZTVA 4E8DA 3KOZA 3R4IA 4UQ9A 1LLOA 5F2IA 1IGWA 4YXGA 3UU0A 8A3HA 1ECEA 1DPMA 4W7UA 3BCFA 3UR2A 1CI1A 4LVBA 1BTMA 1E73M 4UTHA 1LRTA 4MZYA 5F1VA 4N4PA 4QCEA 3R12A 3WNNA 1ME9A 1WKEA 3DGBA 1TFVA 4OBTA 4QFUA 1C29A 4D6JA 4ZO8A 3ZO9A 5CZKA 1D7KA 3U2CA 3T05A 2WVVB 5D30A 4CNOA 2BNJA 4QAIA 3GC2A 3EMCA 4UCFA 1DJQA 1W1B1 3D47A 3R11A 1Z48A 2CIPA 1X39A 3WKZA 1D8WA 2WPGA 4AWEA 1XLGA 4ACYA 1UZDA 4Y6GA 1LZOA 3H70A 1UP3A 1J2WA 3M0LA 2YDRA 1YTDA 2NX9A 5C7HA 4S23A 1UUQA 1GQJA 5AB3A 3MVIA 1V6XA 1Q45A 5GQBA 3HPFA 4AD1A 5B80A 3CV2A 4EVZA 3NFUA 3PBYA 1A5MC 4U10A 4M1RA 3KM8A 1QK0A 4MNMA 2WHMA 4AMCA 3LPPA 3H2AA 1EWEA 1DBTA 3VMPA 2Z1VA 3ARSA 2WZIA 4HMDA 2ZRYA 2WMIB 3BLOA 4X3ZA 4JFTA 4Q8OA 1NOUA 2JGYA 1FFQA 3FA5A 2ZUVA 1AQMA 4PODA 1XDLA 4HZ6A 5C2GA 4FXJA 4FNSA 3MW7A 1Q4WA 4XZBA 1BF2A 2E4TA 3S5YA 3UF9A 1CWYA 4WJ8A 1OB0A 5H8MA 1THFD 1H63A 2YCJA 5GNXA 5FAGA 3I6RA 3UZWA 4H8VA 3S1GA 2X0YA 3L65A 4JIQA 4L1XA 2Z7GA 1K6WA 1S2AA 5JH1A 4AIOA 3N9RA 1TE1A 4JHOA 4IPNB 3G3MA 1FWEC 1G5AA 3HN3A 1HN1A 3IJ8A 2XGBA 4WZHA 3VKAA 3BUVA 3CQJA 3BAXA 4JNMA 1DJWA 3IS4A 3UESA 1FWNA 2X30A 3EDKA 1Z3NA 3THDA 2HS6A 4H1ZA 1XPGA 3TLQA 4A8IA 1C7SA 2A3AA 3ARUA 3KHDA 4UIOA 2P0OA 1VHNA 2DQXA 3TJLA 2Y70A 4QLLA 1DQUA 3CAVA 4JIIX 4KGJA 1E6ZA 1U5HA 3E1F1 2E68A 2ESCA 8CGTA 2ISVA 4Q8TA 4Q4RA 4Y9AA 1E9YB 2F7FA 1VZWA 3LM3A 5HMFA 5LIUX 1F5ZA 1HKWA 1KFCA 1VCVA 1J9YA 3CZGA 2PWGA 5HQEA 3WLKX 3L4XA 4MJZA 3F4NA 4C60A 3WIJA 3A5VA 3B4UA 4MB5A 4W87A 1SVDA 3GU9A 4G1NA 3AS2A 1OC6A 4LC6A 2AQWA 2EG6A 2DH3A 3L4VA 4O15A 4AHOA 3INPA 2DQWA 1H61A 2X1SA 1JR1A 2ZCGA 1X6NA 3I3DA 2J4GA 4Y7EA 2FMNA 5C55A 4D8LA 2ZIDA 4IWWA 4M80A 1O1ZA 3Q4DA 4QDWA 1B54A 4ZB0A 1TB3A 2WJEA 2FZMA 1Z7AA 2HISA 1AQFA 2FZNA 3UGRA 1J93A 1V5XA 3K8LA 4C5YA 3ATZA 4WXYA 5HNNA 3N34A 1XLJA 4TVDA 3LXAA 4E3TA 4MF4A 3WQ5A 3O2LA 3M44A 2FJKA 4HYWA 3RLHA 1JD9A 5AYBA 1V7AA 4GUGA 3TE9A 3E96A 4HNLA 1IGSA 1ZALA 4Q7BA 1G4EA 1EBGA 4PSRA 4HJWA 4J3VA 1EC7A 1ZNNA 2BS9A 3OEXA 4XD6A 4OWGA 4IMGA 3WYZA 2YZRA 4MUZA 3DEQA 2VX6A 3MSYA 3VGGA 2YFOA 2PWUA 3GE7A 5AHFA 1RP9A 3A4WA 4LUSA 3CPUA 3OU8A 3ENLA 5A6KA 3RLGA 3LHVA 2BWGA 3VINA 4HZMA 4B15A 5EMMA 5F4SA 2OQLA 4LNCA 1CCWB 4BZYA 3OVGA 1C91A 4LAMA 3VKDA 3WDQA 1UP0A 2ZA2A 3A4AA 4KEUA 1P48A 4PMOA 2CETA 2ZKMX 2FB2A 5I24A 2VUNA 1F3XA 4FLQA 1YBQB 3M0XA 3GKFA 8RUCA 2I7GA 3H55A 3QC0A 3BVJA 3G1XA 4FSAA 4HPGA 4K2SA 3ZQ9A 3AJ7A 1JD7A 3UY7A 4OU1A 4TV5A 2HSAA 2NX3A 4O54A 3PUEA 3QQ0A 5IBXC 5A6MA 3OTRA 1TPVA 4G1KA 5AKQA 5CSUA 1IEIA 2W67A 2HVMA 3C0SA 5BNKA 3AXXA 5DBTA 1NF7A 1SFSA 5JIPA 3W83A 3C8FA 4B3KA 3H8AA 3ITTA 3NO3A 1W2VA 5CG7A 4GQGA 3DI1A 3DFQA 3NSNA 4DHGA 2POTA 4XAZA 4CVUA 1Y7VA 3TYCA 4ZQCA 1E6QM 4AFYA 3MCOA 2VQTA 4JTHA 4O1BA 1TPWA 4X2PA 2EJ1A 3URAA 5LXEA 4BR1A 5CEWA 3AC0A 2VD8A 1QVBA 4IP5A 4PUJA 4QJ1A 4LAUA 4ZL1A 2QJNA 2Y0FA 2OO0A 4O0QA 1W9PA 2J62A 3FX4A 1W9DM 3L2LA 2G0WA 4NP7A 4MWAC 5CCZA 4ERAA 1FWTA 4F0HA 5I3KA 2CWXA 2E1DA 2PDJA 1WOBA 3KS5A 3HGOA 5A6JA 3E0WA 4UFMA 1P6WA 2R1MA 3LCHA 4N42A 5M1TA 3TOPA 1NQKA 1MEHA 4B90A 3QV9A 3HM7A 5TBOA 3DG7A 3GW0A 3WF3A 3UR5A 2FDMA 3WLOA 2QNEA 3M07A 1EC8A 4DF0A 4S3DA 3O15A 4GACA 3TWBA 1D8CA 4FXFA 4RDWA 5D2TA 4AZCA 5I6SA 5A8GA 1J79A 3RU6A 1ZJAA 2I17A 2YCLB 3QTPA 4B5NA 4KGLA 2EGZA 1W9BM 4D6HA 1GPFA 1TTIA 4MY1A 4OT7A 1M53A 3TW6A 1CLKA 2EPOA 1JFHA 5REQB 3EX3A 2Q8LA 1BG4A 2XVKA 3AHVA 4Q7IA 4K36A 1WZLA 1SO4A 3E0FA 3OA3A 1XCWA 5M2FX 3BSGA 5C8BB 2MUCA 3T4WA 1GTHA 2DT0A 2ZRWA 3BARA 4HN8A 4LPCA 4WEVX 1VIZA 5H2ZA 3IGUA 2VRKA 3MUCA 4AF0B 1JDFA 2ACRA 5EU9A 3DN5A 3ALGA 3SCVA 4MLRA 3LXBA 4H9UA 1GEQA 2I5IA 2ZC8A 4UWMA 1RBAA 2JEQA 1FA2A 4MHBA 4GE8A 4WKHA 2BVTA 4QDPA 1YTKA 2Y89A 1PHWA 2ZADA 4D6FA 2VXNA 4P7OA 1RY0A 4ZFCA 3VMNA 5CZ0A 2WZEA 3LTYA 2E77A 1MXGA 2P3EA 1KCKA 1YPXA 2PGFA 3DFTA 3UFYA 4PMYA 5FL0A 3IEBA 1EWDA 1L9WA 3WQOA 4LJ3A 4QJ5B 3RPTA 4JKLA 3LB0A 1GGOA 1DQWA 3HQOA 2PDYA 3UWEA 3WBYA 1VFLA 2GVJA 1TQJA 3O3RA 2FJUB 2TAAA 3DYPA 4IX2A 4DLMA 4GINA 4GYJA 1V6VA 1KM6A 4XO7A 3KHJA 2P88A 4GVHA 4LB4A 2GUUA 4HCLA 1CGXA 5JH2A 1OFQA 3T2PA 2PWDA 2OFJA 4JCMA 5XIAA 5FEWA 1RA0A 3W1UA 4UQAA 1UH2A 1G9HA 5HJLA 1JGIA 4Q7NA 1LLWA 1FWIC 3TYDA 2YA1A 1E55A 4IM4A 4XVEA 2JF6A 1XLLA 5DELA 3KAOA 5HWNA 3PN8A 4YPJA 5CAHA 4KIRA 4UR8A 1FWRA 2CZDA 1VC4A 4B92A 3C2FA 5HJXA 4ML4A 2D2HA 2W6RA 1QI2A 3EDEA 4MPKA 2QCDB 2VFHA 3DBPA 4TUFA 2QF7A 3TTYA 4YTTA 1HZYA 2BVDA 3QLLA 4PUWA 3WK3A 5FJIA 1EB3A 2BZNA 4PRWA 1GEHA 3NA8A 4CCEA 3DHDA 2PF8A 4LB3A 4LEFA 3G1AA 2FLIA 3G1FA 3W7RA 1PE1A 3WD0A 3G0XA 3O6CA 1G0CA 3ICJA 4IZGA 3WQFA 3W86A 1TA3B 1TPDA 4QIUA 3AFBA 4AY7A 4QLKA 2OJPA 2PP3A 1UWSA 3R8RA 4E38A 4IMCA 5DCEA 2DP3A 1NFGA 5HULA 4GLEA 1JJKA 4EPKA 5I78A 2HE5A 1OYBA 3WBEA 1G01A 3PUOA 1R86A 2FVMA 1JYWA 2QF8A 2O4MA 3WK2A 1UB3A 3QMRA 2ZDSA 4FLRA 3WBXA 4PUDA 4IPLA 3RJYA 4A35A 3RPDA 4AYSA 2DZSA 4CD5A 2A3BA 3SRKA 2Y88A 4LYPA 2TSYA 2HWGA 4C5ZA 2QXWA 2C3ZA 1B31A 4DF1A 2W66A 1M7OA 1XLEA 1GOXA 4MB3A 2GVEA 1YIXA 5FCZA 2CW6A 1YKWA 1MNZA 1OSEA 4JXCA 3CWNA 2ZA3A 1KM4A 1ML1A 4JR5A 2PDCA 4GABA 5D2YA 4F4RA 1XUZA 4DI9A 1FWSA 1T41A 4A2SA 1C90A 3EZ4A 1KGUA 4ZE4A 1R3VA 3E2SA 3G1VA 3QGKC 4MDOA 1M68A 3W71A 4KRUA 5C0QA 2WVSA 4M5PA 1OX4B 4PRTA 4DI8A 3DKLA 2AMGA 3OYZA 3KXQA 1HJQA 3UYIA 1XQLA 2PGRA 4MG4A 3O0KA 3WMSA 3G3DA 5BRBA 1QATA 4C1NB 1CYGA 5LXXA 1J0YA 1I2PA 1N55A 4G56A 4DN1A 5F1UA 4S3FA 3SAZA 4JEJA 4NNAA 4E8CA 1VJIA 3WEOA 2VCAA 5FJTA 1K8CA 2A3CA 2BVWA 4KWSA 4I7UA 3IACA 3CWOX 4QNEA 4Y96A 4H9XA 4CNSA 4I8YA 4WRHA 4PB4A 3U8GA 4H9YA 3AIQA 4NJIA 2OTDA 5K9XA 1N82A 4M8UA 3LRMA 2ZA1A 4GIAA 1LF1A 3T2QA 3W27A 3NQGA 5CBBA 3EB2A 1ADSA 1AW5A 2XVLA 3I68A 2X0HA 3UG3A 1EDTA 2ZRXA 3JVAA 4IICA 1UW9A 3H2NA 3IJIA 2WK2A 3WLPA 2Z1XA 3SY1A 3TNBA 3V1HA 1WB0A 1NP0A 2B7NA 3ABSA 3QY8A 3W81A 1JZ3A 5CBJA 1FKXA 2NUYA 4DO5A 4ZMGA 3I3EA 3ZXWA 2V2DA 2DJLA 3CM4A 1GW1A 2HVOA 1ODZA 4DWSD 3SQMA 4CGTA 4LC8A 2X2YA 4F0LA 2D0FA 3BCJA 2OPJA 1FWGC 2RKXA 5LGXA 2RJGA 3IIOA 1BF6A 4IMEA 3NEHA 1CGYA 4NQ1A 1M7XA 1JRBA 1C3FA 3HGSA 3N11A 3H2MA 1XLCA 1ITCA 2QPXA 3DH7A 5A6BA 3H54A 4YHEA 5CGTA 2J78A 5HNRA 2DZUA 1RPKA 1TX2A 1XXXA 3FKKA 3L0NA 1E9ZB 4DWSB 4EXAA 3PHAA 1F8MA 5FJPA 3DG6A 1BRLB 1UR1A 3LZ3A 3VX0A 4UMBA 1Q66A 4JAWA 4C90A 3N6HA 3HU7A 3F5JA 3R13A 4L7ZA 3QKEA 1B9BA 1WP6A 1C9WA 2CHRA 5F2MA 5CZTA 4N7QA 5GNYA 1VS1A 2BY1A 2A21A 2E9BA 4JHMA 1FUYA 3GNPA 2YB4A 4DUWA 1EZ2A 5HMEA 4DBDA 4JKKA 2FTPA 5HMSA 4O1EA 3PSVA 1UKSA 4MKVA 1T96A 1J4EA 4X9SA 4ADSA 1R47A 1P0NA 1O60A 3N4AA 3NR0A 2VR5A 1BWKA 3EPNA 4HK5A 1GJUA 3RIKA 2NQ5A 1UIOA 2HDJA 1E56A 3W1XA 1I1WA 2YLAA 3NPUA 4FR6A 1XICA 2Y6ZA 3APYA 5G2IA 5IFTA 5EGRA 1ITXA 1L6GA 4Z0JA 3SUWA 3BAYA 3IARA 1XDMA 1UH4A 3LTPA 2BHUA 4IUOA 4LXFA 4AISA 3AU6A 3OBEA 1H1NA 4QHRA 4ECLA 4N9EA 4XZNX 5CG0A 3P7YA 2XUCA 3IK2A 4TQTA 4ALDA 3QC3A 1PIFA 1IR1A 3B3DA 3CUIA 4MGGA 3G8RA 3CQKA 5FAJA 2W62A 1RD5A 3KZSA 4G7EA 1A50A 1FWDC 3W9ZA 4AZ5A 3ZJKA 3W38A 3THAA 4KT2A 4DJFC 2A79A 1HKVA 5TQLA 5I3GA 4F0SA 1OT1A 3KWXA 2EAWA 2DZWA 3K4WA 3CH0A 1WDRA 4PCTA 3HB9A 5AHEA 1IXQA 7XIMA 4PB3A 3BLEA 3KZPA 6ENLA 1DEDA 1DOSA 3EWUA 1J0IA 2ZTKA 4Y2WA 1JCJA 3MP3A 1E1CA 1J2BA 1XW8A 1YTEA 2C0AA 3O7UA 4AZHA 4AD4A 1LQAA 1YPFA 5G1TA 3EYPA 1C9DA 5C2XA 3C3NA 4WSJA 2UZ9A 1B90A 2EBNA 2GYIA 4GYFA 4O1CA 4PTWA 3CHDA 4TX8A 1TELA 4PTXA 4DAFA 1GW9A 4GJIA 3EX4A 5T91A 3MMWA 3O0FA 2J7GA 3LPGA 3GH5A 4YTSA 2IPWA 3C2OA 3DYOA 4ZEPA 1H0GA 2NQJA 1KA9F 2WXDM 5EBAA 2ISSA 3WEMA 1FVPA 1XIMA 2JE8A 4OKDA 3IVTA 3FEQA 3PBWA 4Q4KA 5KMYA 1P0EA 4UNLA 5AYZA 2OKTA 1FP8A 1UIPA 4E2BA 5I3FA 3LX9A 1JFXA 2VQUA 1LUCB 5EKYA 6PTDA 1VEMA 3EWDA 2HMCA 2YL6A 3WK1A 1BXCA 5CZJA 5K4ZA 3FJ6A 1K8YA 5I3DA 4NX0A 1E1EA 3LU2A 2WM0A 3SIZA 3R89A 2QCFA 3S3GA 2ZX9A 2DDXA 4R5EA 5FL1A 2C0HA 1JQVA 3A9IA 3CLWA 2V9DA 2BGQA 3RRXA 2ZOXA 1L2QA 4HB7A 2XH4A 2AGTA 3N1AA 3QYSA 4NZ1A 1PKYA 4ZOCA 4QBXA 2WKGA 4I9AA 4J27A 4Z1DA 1EPVA 2QHAA 2PSNA 3QV8A 3WLRA 4GBUA 2VVNA 5JMUA 1UWAA 3ARTA 3G1YA 7A3HA 3QJAA 4PMXA 4GA8A 1PL9A 3BOFA 3JR2A 1EL3A 3GAYA 4EPEC 3NSMA 3M0HA 3I6EA 1ZBVA 4ZTYA 4IG2B 1S3HA 3P6LA 3B97A 3TU9A 1JAKA 2ONEA 4IFKB 4DBWA 1HVQA 5EMKA 1W1PA 3GFYA 3TROA 3G0UA 4LQ1A 2GUBA 5DXYA 4PRRA 2XIBA 3Q58A 4ML9A 3EOEA 1JF5A 1OFBA 2NXIA 4LY8A 5DT5A 3H23A 4OZOA 3A9BA 1REQA 4PBGA 3BURA 1KV8A 3QHNA 3FAWA 5HXMA 1W17A 1ISWA 4RW3A 3TNOA 3IPWA 1NP2A 1QW9A 5AYXA 3HG5A 2Q3OA 2C18A 1S3TC 1HGYA 4GZ7A 2OQHA 2QZRA 4QITA 2BASA 2NQZA 4ADUA 1MZRA 3NQDA 3V75A 4ZODA 1FDZA 5C9XA 2YJQA 3W6YA 3NURA 2ZRUA 4PN2A 4C6EA 4Q22A 3VZYA 3MVTA 1UKPA 3MYPA 2D24A 2OEMA 1EJUC 1FWAC 4GQBA 6XIAA 3LNMA 5CSSA 5K3VA 3NDOA 1HJVA 2C71A 1GPWA 1OC7A 8XIMA 1FHLA 4H6KA 4LV9A 1NOWA 1QOPA 2NXGA 2NSXA 3TN3A 2V3EA 3TV8A 1KM2A 4FB7A 5HWMA 1QTWA 1KW1A 3VD4A 3GTNA 1DWFM 4NF7A 1F2JA 2BBFA 3WD3A 4R9XA 3DFOA 5LNWA 1B4KA 3CK5A 3IIZA 2X0SA 4XAFA 3PZUA 4LRSA 3O07A 2G37A 3MUZ1 1GHRA 4FAMA 4F2TA 4Z17A 3ARQA 1YRRA 1KCXA 3EB3A 4NKCA 4FF5A 3W7NA 4JEQA 4IPJA 2NVCA 3KBSA 5IBXA 2UV8G 1XV8A 5EBUA 4YYFA 1RA5A 1UP2A 4IQJA 2GSJA 3XINA 1SR0A 3I7SA 4B3ZA 1CXFA 4IMFA 2O9PA 3TEVA 1TIWA 1UR8A 2E6DA 2JIWA 1GK8A 3LY0A 5TF0A 1PZ1A 4B2DD 3CBWA 2RHGA 2NUWA 3VDGA 3NQCA 3UETA 1Z8AA 1WA3A 3GXFA 2O9OA 4B9ZA 3UCQA 1ISYA 3ITGA 2DPEA 3H12A 4PMRA 3KTSA 3VIHA 4FR1A 4NZJA 3QHOA 2J74A 4GZIA 1XYBA 1KM3A 2Y7GA 3I3BA 3P80A 1HG3A 3WFLA 3OG3A 4K68A 1SSDA 2CBJA 2D1ZA 4AAJA 2OZTA 4REQB 1O1HA 5DMYA 2P3ZA 4XSLA 4JTJA 3WL1A 4BA0A 3QR0A 2PTXA 1LOLA 3MO4A 1J01A 4HD5A 5I2UA 3LDVA 4PTNA 4ICMA 3LCGA 3R0KA 4HYVA 1KKOA 3EX1A 3VCRA 3FGCB 5A8OA 4D6EA 5EYWA 4PCPA 7ODCA 5J8LA 3DHUA 3BG3A 1GKPA 3VNJA 2GJXA 2ISFA 4EWJA 2PFHA 1F6YA 1HNYA 4AZCB 1LOSA 1K9TA 3AZSA 2BGNE 5FJRA 4GY1A 3L4UA 1ICQA 2I57A 3V0TA 3P61A 1KM0A 4QX4A 5KEZA 2HCVA 5CGQA 4ERGA 4KRZA 3EBVA 3F2CA 4NZ5A 3R25A 3NZQA 2VM8A 2R94A 2JGQA 2NQLA 3CL7A 1P0BA 1HF6A 4R3UA 2CBVA 1QPNA 2GOKA 3LENA 3VFCA 1KXVA 4PUNA 3CUHA 1WXYA 4H83A 2C13A 4B91A 2FHCA 1Q7ZA 3ZR5A 1A0CA 1BEUA 1H41A 1XBZA 3DDMA 5M3WA 3CC1A 4BQ4A 1AMYA 3WJXA 1T7LA 4Z1YA 1TREA 3W76A 3L21A 4YMZA 1W3NA 5HBFA 1RAKA 5D9OA 2VDHA 4H7VA 3EKZA 5DEZA 1CB7B 3KL3A 2IKHA 3L5MA 2DU2A 4WKFA 1VBJA 4V33A 4QG9A 3F2DA 2HZGA 4ZENA 4AVOA 3PFMA 3MBFA 4MJ2A 3SR7A 3H22A 4LAOA 3AXIA 3S6TA 1D9EA 1XYMA 2INEA 5CLTA 2FZDA 4RW5A 1JCMP 1H5YA 2J27A 2QAFA 1NVMA 3OJGA 2WC4A 4M7SA 1IT8A 3V1PA 1X1NA 4YVVA 4V28A 2Z4GA 1VBHA 3TC3A 4Q8PA 3QXBA 2C7FA 2HK0A 5IFPA 1WUFA 2VHLA 1U5VA 1VENA 5HPOA 2X8RA 1ZHAA 4M6QA 2A2IA 2TYSA 1MW2A 4AD3A 3C56A 5BMXA 5FF0A 2QQ6A 3VD9A 2WMHA 4E4UA 1ZCOA 3VNKA 1PTGA 2HXUA 3DCPA 4DYJA 3AIEA 1HFBA 1SFTA 1YPIA 2F61A 2J75A 1QUMA 5AZ0A 4ORMA 1X96A 4N2YA 1J96A 1NDVA 1FOBA 3OB8A 3VPLA 1IR2A 4O57A 3WFZA 2Y7DA 4GG9A 5TD4A 1UMLA 4ACZA 1TCMA 2DH2A 1O6IA 2ZBTA 3D6NA 2IW0A 3GDTA 4OBSA 3TDFA 4D8AA 1KFLA 3WN6A 3IGSA 4J3XA 3IVUA 3MZ2A 4JKMA 3ME3A 4J2PA 1JG9A 1A5CA 4ENLA 3E38A 3K30A 3WMLA 4DWSC 3IAPA 4XK2A 2DSWA 5DF0A 4DZHA 5DFAA 1OX6A 3AICA 1PJ9A 1XCXA 2WBKA 2A1YA 3MI3A 4I90A 1W5NA 1XLHA 1HX0A 1OYAA 4IIBA 4GI6A 1QPKA 3GHUA 2XFWA 3E9AA 1W3IA 3LK6A 1VFOA 2DZXA 4BQ2A 1TWZA 2DUZA 4NJJA 2F8QA 3EKGA 2VZTA 1LG2A 1UMYA 4UQDA 1RLCL 3DC8A 2JK2A 3O05A 4K1GA 4RZ6A 5A69A 1RALA 4PUUA 1TCDA 1DJGA 3QOKA 2IPJA 4HA1A 1WX0A 5JBDA 2BY0A 3CXOA 4IP7A 3MUAA 2H9AB 1ZZMA 1E0XA 1QDSA 3WQVA 5MF5A 1FH9A 2J6VA 4IIGA 1NEYA 1PWLA 2ZC1A 1MMFA 1XYZA 1JI1A 2J47A 3NQ2A 9RUBA 1KM1A 4NG3A 4JPGA 3BAJA 1EJ7L 4H41A 2CCRA 4EF8A 2DZTA 2WMFA 4JQAA 4JTIA 2C1IA 5A8MA 4UNKA 1WV2A 5FD0A 2VC5A 3C0QA 4XB3A 3PJUA 3W7OA 1UCWA 4UOZA 2REQB 3EAUA 1TJ1A 1DIKA 2QW5A 3G0SA 3TFCA 1KD0A 3LM7A 4XKYB 3FHQA 3GG0A 1BXNA 2OWXA 3RMJA 1HTIA 4ZSTA 3GYCA 1GVQA 2P1FA 3CZ8A 3LEPA 3U7BA 1RCQA 3G77A 3LQGA 1E43A 3ABQA 3UWVA 1PTAA 2ASHA 2WVVA 1QPRA 2XSXA 3V35A 4LGXA 4EF9A 5IRPA 5CH9A 4ZQMA 4NU7A 5BMWA 2VX7A 3N2BA 4JZ5A 4FNUA 4IHCA 2D22A 4ATWA 2YYUA 5HUOA 4IX0A 3STGA 4O28A 2CXEA 4ZOAA 3WJYA 3D5HA 2RFGA 3JZUA 3FDGA 3EA2A 3VIOA 4E8GA 2QCCA 3FSUA 5ABTA 1F7BA 4XBJA 1XBVA 3FNDA 4DUXA 1N7KA 4GI4A 1I0DA 1VYSX 3GG1A 2IQDA 3FN9A 4CLMA 1E0UA 1P0DA 2BOEX 3K8KA 3R2GA 1QCWA 1EF2A 2QDDA 3UJEA 1WDSA 3OVQA 3NQBA 2WMIA 1XRTA 3BLKA 4R85A 4W7WA 1DKWA 4GI9A 2ZZ1A 4R9OA 2DGAA 5DANA 1DIOA 3W7IA 5G2WA 4I8DA 1SW0A 1SM9A 1DTNA 1MXSA 4L9ZA 3RFAA 3TCEA 3W7MA 4FALA 1UJQA 1GJWA 3VE7A 3SGGA 5C5YA 3GXNA 1BG9A 1I0BA 3M0MA 2X1TA 1ONWA 4JYFA 2GQ3A 2DT3A 3MT1A 1UD4A 1PEZA 2FZBA 3MU7A 5HJYA 1W91A 4OGZA 2XDFA 1S5WA 4IUGA 4HOZA 4EANA 3K8MA 2AQOA 1EO7A 1KCZA 1KC7A 4MB1A 1BVZA 1KBIA 5HPCA 2VZVA 3O63A 1CEOA 1MYRA 1JUEA 2TPSA 4MWAE 4UZSA 2P5NA 4J35A 4AX6A 7TAAA 2VFGA 2XM1A 4GPNA 4LV4A 1W5OA 5B7YA 3T0TA 4DM1A 4XAGA 4RZ4A 1Z41A 1SW7A 3N9KA 4XTDA 1A47A 3VA8A 3EKLA 4PSPA 3I6TA 4XQ6A 3KP1A 1N2VA 1Y0EA 4C6QA 2JIEA 3N19B 4F8XA 1F3EA 3B8WA 4BEUA 1BAGA 1UZ4A 2J7HA 4TOQA 3V18A 2E0PA 1R5YA 5HATA 1JF6A 1MFVA 4GQRA 4JL2A 1POKA 2ZZ3A 4QE4A 3MKCA 3KBWA 4RE2A 3CS2A 4UBPC 4KKXA 2FB3A 1Q7QA 4HJFA 4H04A 2OMAA 2PU1A 3H6OA 3W7HA 2V69A 2EPLX 1I6NA 3LRLA 4M6VA 3BGJA 2GJPA 2VR4A 3TR2A 4IJCA 4CEUC 2J66A 3WY1A 1A0EA 4CCZA 4Z1AA 3UNDA 1H50A 3WJZA 4O13A 1K7XA 5GNZA 3VKJA 4DO4A 2W63A 1FHUA 1JGMA 2Q71A 2XINA 1OC5A 1VJZA 1PKLA 1W5QA 2PP0A 2QCHA 3P8IA 4ZOBA 3MTWA 3TAOA 2BXYA 2GGEA 2RUSA 3QV7A 1FCQA 1E72M 4U5IA 4Z2KA 1KQYA 3NM3A 1MUMA 2QCNA 2VEKA 4M7TA 1SR9A 1XLIA 3W7JA 2NVDA 4EXQA 3TYUA 4UFKA 3ORWA 3R58A 1F3WA 3P3BA 1JDEA 1CLXA 1J11A 2NLIA 3B0UX 1ZJBA 2GQ8A 3NDZA 5A2CA 2ZZ5A 1L0PA 1TPC1 2UBPC 2Q01A 4GC3A 1DJZA 1J0JA 4J40A 3UXLA 1HP5A 2IXUA 2OCZA 4FF7A 3SRHA 3QF0A 2Y5EA 3W73A 2E25A 5L6UA 1KRAC 3R8HA 1MW0A 3S1XA 2G4FA 1KNWA 1A80A 2ZWYA 1A5SA 1ALDA 1IEWA 3TP4A 2FGZA 1GKRA 2BG5A 5FA5A 4QP0A 5C9WA 3D3FA 1IXOA 4DJFA 1P7TA 2J7DA 5BU6A 4TR9A 3OBAA 5AVHA 3QR1A 3M64A 2OELA 4D72A 2QJJA 5EMJA 1TVLA 1SGJA 1W9XA 2PRHA 1R87A 3WQ8A 1T5AA 1MQPA 2CNCA 1CENA 4GUHA 1YBQA 4MM1A 4WY0B 3SUTA 3A23A 3JU2A 4IQDA 3IV3A 1T8XA 1W9VA 3MQTA 4EKJA 2QGYA 5GVJA 1E1CB 4MYAA 3S2CA 5A5WA 5CLWA 3SN1A 3F4WA 5K4XA 3TQ0A 3TUUA 1YNQA 1FDJA 4W84A 2BX7A 3CUFA 1XLFA 4HK6A 3VOJA 3C86A 3IK4A 1Y5VA 2NZLA 2WB5A 4WHBA 3MP5A 2BLEA 1F8IA 1TJ2A 4Z2GA 2VYOA 4QG8A 3AMKA 1T99A 3DFHA 1ZS2A 5C7VA 4QRNA 1JZ8A 3LNPA 4LBSA 1VCFA 5CPLA 3SSJA 4DNMA 4GUJA 2Z2AA 2C8NA 1UC5A 2ISWA 1VD6A 3IGXA 2J77A 1HO4A 1ONRA 1PDYA 4XSMA 1Q6DA 1XLMA 3ZZ1A 4RR4A 2OR2A 3VGHA 5CXPA 1PCKA 2AOSA 3IJQA 1V3IA 3T0AA 3RR1A 3VNLA 4JN8A 3AZRA 5E0CA 1W6TA 4Y90A 4GFSA 1QPQA 2QAPA 3SECA 2BY3A 1B57A 2PDGA 4M0XA 3LQLA 4CQ8A 2XWDA 2OOGA 3CPGA 3E12A 4YU1A 1E4LA 1UBSA 2X42A 1OK4A 1AQHA 1EZWA 4MAZA 3ZVIA 3T44A 2PDKA 1V6TA 3WF1A 5AYIA 4GH3A 4R7OA 1PV8A 1XBYA 1P1MA 2DY3A 4XIMA 2A4AA 2YCLA 2XGIA 4C6MA 1EQCA 2A0NA 4GX9A 4WR3A 2PWVA 4N6EA 4AHQA 2FYMA 2QS8A 1ZP4A 2YL5A 3W23A 5REQA 1IZKA 3VKCA 2ZRZA 1QRQA 1VP5A 2E5BA 4N9DA 5LNUA 2WNZA 2EG7A 2ZXDA 5A2BA 4X22A 2VENA 1QWKA 4ONVA 3LGGA 4Q8NA 2CZFA 2IQ0A 1S5NA 4DYEA 4L1GA 1C8QA 2J9XA 1BHGA 7TIMA 3H7RA 1EBHA 2POZA 4JFVA 3TTQA 1W5PA 4FIQA 3LLXA 4UR9A 3W26A 4AF0A 3KLLA 4FLOA 4FNRA 4GNKB 2Q09A 3NO5A 4DUOA 1Q65A 2FMOA 4XG1A 2B7QA 4GC4A 2V67A 3C8NA 1VEPA 1M5WA 3G1SA 3UVIA 3SI9A 2F6UA 4V15A 2X1IA 1XISA 1XJBA 4UTMA 1WE5A 5D04C 4KH2A 4WOZA 2VC6A 3C3UA 5BXSA 4D6CA 1RCOB 4E4FA 3BW4A 3FEMA 1ECQA 3P84A 5C9UA 4ATDA 4ZCWA 3MBDA 4NASA 4Y8FA 4U2YA 3VKBA 3QQ1A 3GC4A 3BZGA 4C1LA 4H00A 3DFPA 1E9IA 3TONA 3IJ7A 3A5FA 5FESA 2RGMA 1KFBA 2Y8VA 1GVEA 4ZQPA 3B8SA 1UROA 3KRZA 1K7EA 1AL7A 2CLEA 2HEJA 1RK5A 1KFEA 2VD9A 1X1OA 4HOWA 4KEMA 1A5OC 3OGVA 4H8HA 3TQPA 2WJFA 4WDWA 2Z27A 1WDQA 5KZDA 1UR0A 3V5CA 3MI6A 4NAFB 5E6ZA 5AHLA 1JZ4A 4LBUA 1GYLA 1EIBA 2QJIA 1LORA 4HVXA 4LH8A 3L68A 3HF3A 1RBOB 2Y7FA 3SRDA 4KCWA 2ZX7A 3W7LA 4IL2A 5HANA 1U33A 1BWLA 1U1HA 3N04A 4XAYA 1XSIA 3S8HA 4DBSA 2VJXA 4BCEA 3CQHA 6TIMA 4FS9A 3A4JA 1VFHA 4RDYA 5ABGA 3T09A 2QCDA 4Q4OA 3MB9A 4POCA 5EMLA 3QSTA 3W74A 1VFFA 2QVHA 4RL3A 2JFEX 1I9CB 4ASTA 1XSJA 3TYZA 2CZVA 3USBA 1XG3A 2QDEA 5T9BG 2ZUMA 3CUZA 3GDBA 5A8PA 3ARVA 3T8QA 2YCKX 4C6JA 2QUMA 3L2IA 2VKZG 1TPUA 3ARPA 1U5JA 2YCIX 3S9YA 2VTFA 5H91A 1OZMA 1TA3A 3PJXA 2O7QA 4O1FA 4AH7A 4AZ6A 1KM5A 1YADA 1M1BA 4UUIA 1AA1B 4MOZA 4LEQA 1AMKA 3VDCA 1BKSA 1H1ZA 3S2NA 5C70A 5LNRA 4WJEA 4FPSA 4KPLA 3FVMA 1TJPA 2PCEA 4S2CA 3HG4A 4LF2A 1K70A 4H7CA 1WOAA 3DUGA 4E2DA 4I6KA 4JGDA 2XGZA 4JY8A 1HW6A 2AMXA 1ZPTA 3WF2A 3W82A 4IGMA 1JDCA 1VIWA 3S1UA 2FPTA 1ZB5A 4M81A 1RY8A 4WGXA 3VABA 4LT9A 3KBMA 5H8UA 5EY5A 1IXPA 2Z1BA 2OYLA 3NQEA 4D6GA 4A8LA 1UD5A 3TLLA 1AJ0A 2ISDA 2Z1SA 1EHAA 3DECA 4ZSUA 3OVRA 1F76A 1X8FA 2JEPA 5F4WA 3C6CA 3NTYA 4W93A 2GJXB 3CAQA 4BQ5A 1TMLA 3ANUA 4C6DA 5G1MA 2GGGA 3GVVA 4KWUA 1SZNA 1OX4A 3RGTA 4A8RA 3FJLA 1ZAIA 3N18A 2X1UA 4A2RA 1OFEA 3C0LA 4G7FA 2OLHA 2PCQA 3HMCA 2OYMA 3ZOAA 4J3TA 4NZCA 4LW7A 4C1NA 2J7BA 3VZZA 4UR7A 2E6FA 1F73A 1OM0A 1L6FA 2GOUA 4I9JA 3NZGA 1UA3A 4IT1A 1UKOA 4W5ZA 3S9ZA 2ALDA 3N25A 2YDSA 2DVTA 2ZVRA 4WF7A 3KVMA 3TVAA 2XN1A 1M65A 2V3DA 3TYEA 1AH3A 3W00A 4ZQNA 3S2JA 1Q3NA 2YL9A 4WLCA 2I5QA 2HROA 3ARRA 3T9PA 1WZKA 4KFNA 1J8VA 3A21A 4LFYA 3FOKA 2OSYA 2V5CA 4L64A 3VOGA 4GI8A 1T8QA 4NAEA 1CBGA 1J5TA 1EXPA 2OWWA 1TWWA 2R14A 1YQ2A 4IFOA 3K5XA 1O12A 4ZOEA 4TV6A 3QTGA 4ZBCA 4GO9A 1A5AA 2XWEA 3RILA 1WAUA 4FZIA 4H4IA 3MUIA 5A95A 3M0YA 4AZGA 4W9TA 4XKMA 5EB8A 5K9DA 4UQBA 1SSGA 1E0VA 5A6TC 2EF9A 3LI0A 3MMUA 9XIAA 2ALRA 2FH6A 2F6XA 4HMEA 4C6FA 1W8GA 1Q4NX 1W37A 3TZNA 3W84A 3DFNA 4F79A 3T6CA 2CKSA 3SCQA 1JDAA 1CNVA 3M7SA 3F2BA 2J7EA 4Q8QA 1I2RA 1O68A 4B5UA 3QMTA 1JCLA 3LN3A 1UWUA 3CO8A 3BSHA 4KWOA 3L66A 4AZBA 2PC4A 3S6OA 1EPXA 4A3QA 3VDBA 2ZZ4A 2Y2WA 3URNA 3LHWA 2VCCA 4MNKA 4HPXA 4HU4A 5E0KA 4P7RA 3UZXA 3BGGA 3LHZA 1LQ0A 2WVTA 3VVGA 1UWRA 1X1ZA 3W7GA 4DWSA 3KCLA 1EEPA 3GH7A 2J24A 4MZ8A 3FFSA 1U22A 1BRLA 3T8LA 3LLFA 2YB1A 3EEGA 1G4PA 3AI0A 1WCGA 2OO6A 1RP8A 1YHTA 5E93A 3E6EA 1R6WA 1TVNA 3T07A 2CLMA 3HURA 2O55A 3WH5A 5XINA 4UB9A 1EHNA 1OJXA 1TPH1 2VWTA 3H7UA 2SFPA 1IEVA 4UNIA 4DJED 3CQIA 4N9CA 3UPMA 4E2VA 4EAYA 4UTFA 2PZNA 3QR3A 3S4TA 2NUXA 1GG1A 1NU5A 4YHGA 3Q37A 4GCAA 5CPSA 1VPYA 4MPQA 4ZGYA 1E70M 5MHBA 1FQ0A 3KVLA 2YOCA 2QT3A 4OOZA 1JNEA 4O8AA 2VCBA 2R1LA 2ODOA 1TPEA 2PBGA 1EOMA 3NSXA 3LS9A 3WJSA 2Q6ZA 2YZ5A 4ZO9A 2XJ7A 2GJRA 4Y9OA 3GDKA 5I02A 4R27A 4HHMA 1PBGA 1XLDA 1JQXA 3AHXA 1J12A 3G18A 3PF3A 1PAMA 1F6KA 4IGNA 4RV8A 3WLNA 1WBJA 3UVAA 1JCYA 3GUGA 3VM5A 4UFHA 3GG8A 2E1WA 1EJRC 1I2OA 1J6PA 3TQKA 4KRTA 1E4MM 4JL1A 2Z0IA 1AW2A 3ITOA 4TMCA 3SCRA 4B5WA 1ZJHA 2PWFA 3TC7A 3OLDA 1AODA 4AIUA 5LIYX 3IIXA 3QFEA 1J18A 1XS2A 3BMWA 1OFAA 2PDIA 3ARZA 1TZ9A 2ZZ2A 4CQDA 3QHMA 4IMDA 3W6LA 1K03A 1YW1A 2AQVA 3UZYA 3C5QA 3CIWA 3SBFA 4B3LA 4UTIA 2Y5JA 5HK4A 3ZWTA 5CGMA 4AZIA 1IXNA 1WZAA 1A3HA 4S3JA 2WPBA 3VCNA 1IWBA 3L9CA 3GTIA 4MNJA 1JPIA 4ZA0A 1S38A 4F0KA 4M29A 4BKNA 3IANA 1DVJA 5PTDA 3PTDA 4WXZA 1ZP3A 3CAKA 4AC1X 2VGFA 1AK5A 3VGEA 4LCQA 3LPOA 3VM7A 4YS1A 2W61A 2QV4A 4JY9A 4Q8MA 2C16A 4L9YA 3S9IA 1XSKA 3K4AA 3NVTA 3ITCA 1XBXA 2VEGA 2C15A 2DIJA 1Z42A 3HA1A 1HXJA 1B3WA 1YX1A 5DMNA 4KEZA 2OWCA 3FDKA 1O95A 4S3GA 2R24A 2B4GA 4JTFA 5J5DA 1RQBA 1FP9A 3GNOA 4GGHA 3TN5A 5CBIA 1H60A 3EA1A 1C8XA 4UXDA 1BQCA 2ZVIA 1PIGA 5K9CA 1SZRA 3HGRA 2CZ5A 3TIMA 2PD5A 4TO8A 4V1XA 4KETA 3WO8A 5A6AA 3DOPA 3CHCA 3KOYA 1LUCA 1YXCA 1VF8A 4H7ZA 4QJ4B 3NCOA 3ZLHA 5AHIA 1LT8A 4GH1A 1CZ1A 5H1WA 3BLIA 1R0MA 4NZFA 3WLLA 2GGHA 3TJXA 3PZNA 4RDVA 4KS0A 2CLOA 4JOMA 1KXQA 5CC7A 2PU0A 2DJXA 3UCCA 3BMVA 1AH4A 5T8GA 1ZBWA 5JBFA 2ABAA 4JTEA 5IDZA 1G1YA 1MEWA 2R91A 1PHQA 5FF7A 2JF7A 4Q33A 4EAMA 3PZ9A 1UOZA 3GNNA 4GBDA 1H2JA 4GISA 1KWKA 1PUDA 3RRAA 1RH9A 1NTHA 3GSMA 4J2MA 4MIMA 4FXSA 4GWEA 3WUEA 1HO1A 4FX7A 1V02A 6A3HA 3FSTA 3MWAA 3W2LA 2D3NA 1AQ0A 1ISVA 1W3TA 4LOCA 1DJNA 4ZVJA 4W89A 4MTVA 4IG2A 3QBUA 2O9RA 5FKYA 2WO5A 4HQVA 3AIUA 4C6BA 4IFKA 1GUVA 5AC5A 3W88A 1SFJA 3WF0A 4JX5A 1R9ZA 1T0OA 1W1YA 4C6CA 4X2RA 1Q6FA 1VLIA 2MANA 1ONEA 3DERA 3W70A 2GSHA 2G5WA 1UASA 1XD0A 2F2KA 4UQEA 1AG1O 4S2BA 1Q8AA 3B04A 1W31A 5MKGB 2W4XA 4RDZA 3DYMA 4HHLA 1ZGDA 2WANA 3RYSA 1QI3A 3KL0A 4W86A 1HJSA 2MNRA 1QHPA 2R6OA 3R79A 3EOLA 1V8EA 4PZVA 3DHPA 1U83A 3NQMA 4AY1A 3EDDA 3UR7A 4Z42C 1B0IA 4QSFA 5C71A 1TMHA 2XZ7A 3P5ZA 3HPZA 2A5HA 3OVPA 4F9DA 1NFPA 3C2RA 5E6YA 2ZE0A 1EC9A 4LYQA 4FA3A 3IRDA 1CXHA 4HTYA 4LU0A 3PG8A 1XGEA 3AAMA 1DQXA 4ZO6A 3W1NA 3L5AA 2Z1KA 1CX9A 1S2WA 1P7TB 6TAAA 2WSRA 3AJXA 4ZB5A 5A1AA 1CXLA 4MDPA 3L0GA 4P7NA 1B9ZA 5HNTA 1Y5XA 1BPLB 2DZVA 4JS3A 3VO0A 3G8EA 4HK7A 2H3BA 4NJKA 4JIEA 1VAHA 1EFZA 2OEJA 3CIXA 3OO2A 2G3FA 3EWWA 4MADA 1XPYA 1HL2A 1S39A 3KBJA 3WLSA 1KGXA 3BJFA 1GZGA 2OVLA 3PPCA 3CV1A 3BPWA 1KCLA 2VFIA 3WEZA 3VD7A 3AUJA 3E2QA 3GFXA 2QMJA 1GOWA 1NWTA 4AXKA 3N4FA 3IRSA 2DW6A 3WBWA 4K7YA 4C6OA 3GVQA 4LYKA 3TQVA 3PPFA 4H6RA 1IEXA 1JYVA 2VRJA 4BI7A 1PB0A 2D3LA 3BZJA 4MMWA 1XGDA 1NF0A 3U3HA 3AWNA 1AZ1A 2CXGA 2HNEA 4QQ3A 1H7PA 3GAKA 4EXBA 2ZXAA 2TODA 4DJDD 4PTVA 1BYAA 3W2MA 2P8CA 4DIAA 5I5RA 4PR4A 2QKFA 2HK1A 4OJYA 3FCPA 4JN6A 3WSUA 4HNOA 4FK9A 1PS9A 1XLAA 1DTUA 4JFSA 3VIIA 4PCFA 3KRSA 5E09A 3AYVA 3BWWA 3NPVA 2GWNA 1NWSA 4K39A 2V3FA 1MRQA 3W7QA 5A2AA 2KZHA 4A3HA 4B2DA 2ZUNA 4M82A 3WD4A 1EYEA 1I60A 4LVFA 4REQA 2KAUC 4A3UA 1CGTA 4IP4A 4FX6M 3MY9A 1BYDA 1KV5A 5EFFA 2ZUUA 3D46A 1FCUA 2AL2B 4ERIA 3P0WA 1OEPA 1VFUA 3TK7A 1S1PA 1KXTA 3PJTA 4HNTA 1BWVA 4U3CA 3FGCA 1KBKA 2OEKA 4GVGA 5DBUA 3AXKA 3GS6A 2DZBA 2PA6A 4PA8A 1MRAA 2IPFA 1XINA 3KOFA 2BB0A 2ACUA 3BV4A 5BXTA 5IM51 4IXXA 4CU6A 2X41A 2P53A 4LYRA 2BDQA 1UH3A 4XZWA 3AROA 2W5FA 3GNXA 1XIGA 4U31A 3I4KA 3ZT5A 1UUMA 4Z2LA 4C1KA 2B7PA 1EDGA 4QE5A 2QPUA 4YNGA 1BD0A 4QDMA 4US5D 3EMZA 1DXEA 1R2RA 3ZT7A 5K2ZA 4X9YA 1Z89A 1JI2A 2CWNA 1ZCCA 2VGIA 3N17A 4KFOA 5E0FA 4OTKA 3STPA 1KBBA 1QWGA 3FA4A 4WUIA 1ME7A 3RNDA 1P5BA 1PZ0A 2XG9A 1IWPA 3ZJ6A 1EP1A 1I4NA 4UTLA 2IKIA 3PBUA 3BC9A 3QZEA 1B3OA 3GY1A 2BHZA 4QGCA 5DCDA 1C92A 4KEVA 1KFKA 1W54A 1DJHA 1K4HA 4M56A 3QY7A 5CPOA 2J7FA 1F3TA 1UZHA 1W1VA 3P60A 5G1YA 1F07A 3IUIA 4GIRA 4RE3A 4AD2A 1Q6GA 1LROA 3T0CA 4O52A 2Y85A 3O6YX 4XAPA 3CZEA 4Z08A 1MW3A 1PYMA 4ZO7A 3XIMA 1HKJA 3THUA 4ILSA 2YXGA 1W2PA 2D2OA 1J0HA 3CT2A 2I5GA 1EJSC 2BVYA 3M0JA 4Q4PA 2V5BA 4B16A 1ZAJA 3GR7A 4YL2A 1DJIA 1TV2A 4ICNA 1IV8A 1LOQA 3GVWA 4GQQA 3EWZA 3COTA 5CAKA 2ZYFA 4DVOA 2ZDRA 1GCYA 3E2RA 3MWCA 2CBIA 3EX6A 3BAKA 5T9CE 1W56A 4B4FA 2WM1A 1QNOA 1UQZA 3AS0A 5F2GA 3M41A 1W1A1 2QUUA 3MPGA 4JIRA 1EJTC 3M0KA 4N0RA 3ISIX 4JTDA 2PURA 1QAPA 3FLUA 1O5RA 4GKTA 1XIFA 4PUMA 4O14A 4U2ZA 5H8PA 3H53A 2OQYA 1DORA 3KL5A 4JX6A 5FSEC 1EJXC 3O16A 5AHMA 3DC0A 4HA0A 4K8HA 4GIEA 1I2NA 4HTBA 3PZTA 1TKKA 1JVNA 1SO5A 4DXXA 2P0IA 1IIHA 1JL8A 2Z6JA 1WNOA 3U4FA 1G7UA 1R7OA 3LYEA 1V3JA 1VBRA 1QBBA 4OE7A 3NZPA 3SURA 1CECA 4CQAA 3MSGA 1QHZA 2RDXA 1GORA 2WLYA 2A3LA 3W7PA 1F05A 3SCNA 2XSAA 3ZT6A 3SY8A 2V82A 1GVRA 5ABFB 3HQ1A 3RX4A 2X2GA 4JIPA 3ES8A 4H01A 4HU0A 2J25A 3A47A 1EJVC 3GVRA 2PDLA 4JNYA 2H6RA 2HVNA 3OBKA 4IGSA 4CQCA 3VNMA 2H9AA 5D9PA 4E2OA 4TTUA 1Q7MA 1UYQA 4WDXA 1ISZA 2CZEA 5LZLA 4YTRA 4K8GA 2R9RA 3G6LA 3W6MA 3BLPX 5E70A 1M41A 3WZ0E 1XI3A 3QEZA 3POHA 3GHRA 3SUVA 5HWJA 2OZ0A 4GXWA 1RQHA 4BWLC 2OZ3A 3LBCA 3ZR6A 3LBOA 1V3MA 5FEPA 4NI3A 2FFIA 4K7VA 1A4LA 3NAVA 3LZ5A 2REQA 4X63A 1OIMA 2OZ8A 4CEXC 3A3HA 3BANA 5G4WA 4XKYA 1TWIA 3IJDA 1XYFA 3H2FA 4MWAD 2H8ZA 3U48A 3DESA 4M19A 5CPTA 1L6SA 3BTNA 3THCA 3ZM8A 3MUXA 3PUDA 4HBKA 3EEZA 1MW1A 4L4MA 1RR2A 4AD0A 1K77A 1FFRA 1MDLA 3NOYA 2G50A 5CPQA 2GWGA 4CD7A 3N29A 5J5RA 1JXJA 1ENUA 3W72A 3S5OA 1DIDA 1O5QA 2OGYA 3U0HA 1RHCA 3RLVA 2BHYA 3SADA 4IMAA 5AZ1A 3W22A 2DVUA 3L4ZA 3TYBA 1DP0A 2X09A 1YE4A 1J10A 3OA5A 1V3HA 3PC0A 2YA2A 5M5DA 1E6RA 3UPBA 2E5DA 1DXFA 1V08A 2ABBA 3QZAA 2WZMA 3BICA 1PX8A 1Q6QA 4MZ1A 3F03K 4YWIA 1YLVA 4GO8A 3TSMA 3LBMA 2WNNA 4JN7A 3CO4A 3NQFA 4C7DA 3FXYA 2XIJA 1XH1A 3PTMA 3AS3A 4WQ6A 2UWFA 2Y63A 1SJAA 1O4UA 3BH4A 5AC7A 4ROQA 3UG8A 3VD3A 5H6HA 1ISXA 2Z1WA 4M24A 2EPKX 4UFLA 3BV7A 1EX5A 1P1XA 4A21A 4LAKA 3RXZA 3BSMA 2A7NA 2P50A 3BQ5A 3AIWA 3GM8A 5A3HA 4NAEB 4ZTXA 1A4MA 2R1NA 2EPMX 1R85A 2QR6A 4AG0A 3I65A 3NL2A 4P8WA 2PTDA 3GBEA 4CNPA 2RH9A 3NVDA 3GQYA 3HV9A 3MHGA 1V77A 4H9VA 3WENA 3RITA 3KOXA 2PLKA 1DJXA 1MQQA 4ATLA 1H1YA 4L9XA 3SY5A 1EP2A 5GPRA 5IOBA 3H2CA 4D2JA 2E5CA 1SW3A 1VGAA 1VBGA 2J79A 1RUSA 4O0KA 5BROA 1TPB1 4O53A 1YMYA 2GJLA 4AEOA 2A6LA 4Z2JA 1AD4A 1ZL1A 1LLZA 4MKSA 3S42A 4DM2A 4Q32A 2Z2BA 3SGUA 2QIIA 1KLZA 3UZJA 4EX4A 3GTHA 4XD3A 3OZYA 2W91A 3W01A 3UD6A 1XIEA 2WWCA 2YXOA 1OHLA 3UWQA 3IWPA 5BW6A 4YN5A 1L6WA 4CNTA 3UEQA 1I8JA 4DX3A 3CAWA 3H2OA 2CITA 2FHBA 1E1FA 2YDAA 3W1RA 2QJHA 5TNVA 5LNVA 2QUTA 4RE4A 1DWJM 3M6YA 3NZRA 3S83A 2XZ9A 3QQWA 4FX8A 1V6YA 3KWSA 2NQ9A 1E4NA 3RDKA 2FTWA 5ECVA 1V3LA 4NI8A 4IQLA 4LCSA 4IISA 3LCXA 1HL8A 1UQYA 4X0VA 1EDQA 5I79A 3W7KA 4NY2A 4DNHA 2A6NA 5CPMA 4JTRA 4YYCA 1GQLA 5LIKX 2YW3A 2F2HA 4F2UA 1IF2A 3VOCA 3A6OA 1WUEA 3CU2A 3LRKA 4QSHA 4XUGA 3TMQA 2G96A 4DXVA 2CEQA 1NDWA 3E74A 3HQPA 2NV9A 3QV6A 1BLIA 1O94A 2C1HA 1QI4A 4LALA 3T40A 5D02A 3U57A 4PBFA 1OFDA 2X7VA 2FPYA 3VUPA 3ZSTA 2PDQA 3B8UA 3PWIA 2V5JA 6REQB 1IIGA 1MO0A 3E0LA 1JCNA 1UWIA 2DIKA 1QNPA 5E9XA 1RPXA 2ZUTA 3S46A 1VFTA 4PFHA 1PZ3A 4GRSA 4RNIA 4YCOA 1XKJA 2DV0A 2RDUA 1FY6A 5JXQA 4DZIA 5KINA 3VI2A 4YJ5A 5FACA 3K1DA 3SCPA 3AU2A 3A4XA 4HSNA 3MS8A 1ZLPA 2UY5A 4B5TA 3TTEA 2GVLA 2GSEA 3B8IA 1NOFA 3TA6A 1Y65A 1MNSA 5A6LA 1KQZA 5LIWX 3ONCA 2Y24A 2HE8A 1DE6A 1XX1A 2B0MA 4DEFA 2RDTA 4WY0A 2J13A 2XH2A 2FZ8A 1BQGA 1AH0A 3DXIA 2VC9A 3P5YA 4QLJA 2I14A 3BLFA 4G5DA 2ZUWA 5FJJA 3BAIA 4QS5A 3B05A 4P5UA 1LJYA 2OX1A 4RUBA 2PD9A 3W3OA 5G2HA 3NGJA 1XQKA 4FEZA 2AGKA 4HCHA 3KX6A 4HGXA 1YXYA 3OIHA 1Q2RA 4XZMX 4JTQA 3HFYA 3CZKA 4L4PA 3PZOA 4IL0A 1LRQA 1AJ2A 4OHQA 3VDHA 1PVNA 3PAOA 2QULA 3P82A 1NSJA 4EPDC 2W0UA 2D20A 2ON3A 3PTKA 4W85A 1UPMB 3WDIA 1F9CA 1DL3A 4FOUA 1A5UA 1OADA 1UWTA 4S3AA 1VHCA 1QNQA 1SO6A 1G7VA 3SRFA 3N6JA 2F9RA 4W8BA 5CC6A 4LVGA 4WSHA 1P4CA 4J5NA 4AVNA 4WJXA 3TYAA 3UPWA 4GZJA 2B81A 3PZQA 5HR6A 3ANVA 3L4WA 4JQ2A 1W9UA 4GQ0A 3ECQA 1WQ5A 2G3JA 5CSRA 3KE0A 4DJDC 2GUYA 4RX0A 4RE0A 1EGZA 1VJSA 4HPNA 2ZFAA 2BOGX 1PCWA 3PANA 2QEZA 2DSUA 3KRBA 5IHRA 5CJMA 3C2EA 3B40A 3IIVA 5EMUA 3ZVHB 2VP8A 2DEPA 1QI0A 1SZFA 5I3JA 2OT0A 1G6CA 3CHVA 1MWOA 2BFGA 2YBTA 4O11A 2HS8A 2JALA 5DQPA 3RN6A 5EA9A 3KRUA 5LYRA 1OF8A 2RAGA 3P93A 4J9JA 3WQWA 2GVYA 4C6PA 3MV01 5BYWA 1GOOA 1AZ2A 3W2NA 3O1NA 3P2VA 1Y5WA 1EA0A 3KBVA 2IQTA 3KDNA 3N3TA 1OD8A 1Q85A 3ZIZA 3NOEA 5EL1A 1GHSA 4AYGA 4Z0SA 1QXLA 3HIJA 1FH8A 4FNQA 4O0ZA 1ZUAX 3TKFA 3TN4A 3SCOA 4BI5A 2VELA 1CGWA 3NZ1A 2WCSA 3U2OA 3M5YA 1FTXA 1QPOA 1WDDA 2AL1A 1JZ2A 1E6SM 1NWRA 3H7VA 1CLVA 1V3KA 4RCXA 4V1YA 4ROPA 2FGLA 4IQEA 2C19A 3WH7A 4KWWA 3V3WA 3REQB 2ZE3A 2AKMA 1JZ5A 5I0DA 1L2UA 5LHFA 4PH6A 3SZ8A 3KBNA 2XN2A 2I16A 2HRWA 3M5VA 1B1YA 2ZXBA 1I1XA 1XFCA 5KZEA 4AZ7A 3MANA 3SSZA 5AY7A 1V93A 2I1OA 2BV9A 5M03A 3VZXA 1KTCA 1OX5A 3VC5A 3AZTA 4OV4A 2XPKA 4MY9A 1QW7A 1UZ1A 3WQDA 3LGEA 1GT8A 1K4GA 4LUTB 1H5VA 3MP4A 2YGYA 4IGHA 3SCSA 2WKLA 3N4EA 4S38A 3FJNA 2VFFA 1JULA 2PDBA 1J5SA 3B4YA 3L2MA 4C7GA 2E28A 3W07A 3PM6A 1WXZA 1XP3A 5I00A 3OIXA 4HHPA 3POCA 2DUXA 2Y62A 4ZXOA 4HOXA 1LG1A 4JTUA 1MUCA 4NAFA 3WFAA 2B31A 1XUUA 3GZ3A 3F1QA 3OZPA 2H8XA 3R7MA 4L6DA 5FF4A 1HUVA 3OQ8A 3PWAA 1ZENA 3W1LA 1HIZA 4LX4A 2CLKA 3PNZA 4R88A 1EOKA 2VGBA 4CQ9A 4QJ3B 5BWAA 3MJMA 1LBMA 1GVIA 3PVFA 3MKVA 4DJFD 1PSCA 1QI5A 4MSSA 3WQCA 1ZSXA 3S5ZA 4WKAA 3QW3A 4FIRA 1S46A 4DBEA 2GVGA 3VOIA 3THQA 1TPFA 1SUXA 3JS3A 4R7JA 3QVQA 4UTKA 1UD8A 1GQKA 3KLKA 1U1JA 2F38A 2XFYA 3OZMA 1QK2A 2VDGA 4YLWA 4UQCA 3E5BA 4F48A 3FW6A 5FIPA 1XFBA 2Z29A 4YVPA 4J1OA 4MFEA 1TZZA 1DHPA 3DZ1A 1S5MA 3PNUA 3CJPA 1S5VA 3E5PA 1DWHM 4I5UA 4H8UA 2FPVA 2X1RA 1YE6A 3MSRA 4ADTA 4XIAA 1M04A 3TWAA 4QM1A 4ZE5A 1LT7A 2WMJA 1NQ6A 2GDVA 1PWMA 3GR4A 3N2TA 1I75A 5LNSA 3KCOA