4LUSB

Alanine racemase [clostridium difficile 630]
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
382
structure length
373
Chain Sequence
KITVPTWAEINLDNLRFNLNNIKNLLEEDIKICGVIADAYGHGAVEVAKLLEKEKVDYLAVARTAEGIELRQNGITLPILNLGYTPDEAFEDSIKNKITMTVYSLETAQKINEIAKSLGEKACVHVKIDSGFQPNEESVQEIIELNKLEYIDLEGMFTHFATADEEYTYKQANNYKFMSDKLDEAGVKIAIKHVSNSAAIMDCPDLRLNMVRAGIILYGHYPSDDVFKDRLELRPAMKLKSKIGHIKQVEPGVGISYGLKYTTTGKETIATVPIGYADGFTRIQKNPKVLIKGEVFDVVGRICMDQIMVRIDKDIDIKVGDEVILFGEGEVTAERIAKDLGTINYEVLCMISRRVDRVYMENNELVQINSYLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine racemase
publication title Structural and biochemical analyses of alanine racemase from the multidrug-resistant Clostridium difficile strain 630.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Isomerase
total genus 122
structure length 373
sequence length 382
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
B PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 4lusB01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 4lusB02
3B8VA 4QHRA 1VFTA 3MT1A 5FAGA 3B8UA 5GJNA 4BEUA 1EPVA 2J66A 2PLJA 3LLXA 2VD8A 2ON3A 3N29A 3R79A 3N2OA 4PB3A 4KBXA 3WQEA 1XQLA 1FTXA 7ODCA 4AIBA 3OO2A 1L6FA 2RJHA 1VFSA 3N2BA 1BD0A 1HKWA 1VFHA 2YXXA 1F3TA 4A3QA 4ZGYA 2O0TA 4WR3A 2NVAA 5FAJA 3E6EA 2SFPA 1TUFA 3CPGA 3WQFA 4LUTB 3CO8A 1SZRA 1HKVA 1XFCA 3VABA 1D7KA 2VD9A 3B8TA 2RJGA 3GWQA 4DZAA 2DY3A 1KO0A 4BEQA 5GJMA 1KNWA 1B54A 3SY1A 4BF5A 1SFTA 2ODOA 3S46A 1NIUA 2TODA 3C5QA 1TWIA 1XQKA 4LUSA 4LUSB 3ANUA 2P3EA 5FACA 4LUTA 1CT5A 5GJPA 3KW3A 3E5PA 1QU4A 2OO0A 3HA1A 4XG1A 4PB4A 1L6GA 2NV9A 5IRPA 2PLKA 4ILSA 3WQDA 4ECLA 1W8GA 3B8WA 3NZQA 4Y2WA 3BTNA 3NZPA 4FS9A 4PB5A 4V15A 4XBJA 1NJJA 3WQGA 4BHYA 3AWOA 4LUYA 3ANVA 2QGHA 3AWNA 3WQCA 1RCQA 3UW6A 5BWAA 3HURA 4DYJA
chains in the Genus database with same CATH superfamily
1NF0A 2Y1HA 2UWFA 1VLWA 3OZPA 5DELA 3DHUA 1UWSA 4JTQA 3GRIA 3AHXA 3SRKA 3MO7A 4PB3A 3POHA 4AB4A 2DZVA 4IISA 3EEZA 3AYSA 3S8HA 4B5XA 4J3UA 3URNA 1YE4A 2HISA 3WF1A 2XGIA 1W37A 3W1UA 2X7VA 4JY8A 3PBVA 3WQ4A 5FSEC 1XYMA 4HCDA 2A0NA 1JCNA 2NZLA 1TREA 1EJVC 4TVDA 2YFOA 1TPEA 2V81A 3H7RA 3UWZA 4B9ZA 4LCRA 3KOFA 1B9BA 4LGXA 1KR0A 1WZMA 3VZZA 4ZR8A 4S3FA 3WH5A 2GSEA 4JICA 4FIRA 2E7FA 2O92A 3W7CA 2VEGA 3OZOA 5M3WA 7PTDA 4NU7A 3LNMA 2E6FA 2ZA2A 3IPWA 6ENLA 4ADSA 3QLDA 2EJ1A 1LM1A 2V69A 1R3RA 3RLHA 1QI3A 3B8WA 3EWWA 2RAGA 3GKFA 1Q6LA 3MY9A 4M7SA 1E9YB 2H9AB 2OTDA 4UFLA 3GZAA 3SR7A 4GJJA 3WJWA 1PYMA 3T2OA 3KBNA 4R9XA 1G0CA 2CKRA 3C0LA 5G1YA 2BDQA 1H41A 3QFEA 4JXCA 1EGZA 3KP1A 1POKA 4GIEA 4PMXA 2ZYFA 3W7PA 4RPQA 5I00A 2FFIA 4GZ7A 1DPMA 1IZJA 3S2MA 4FOUA 1VLIA 4LC6A 4OU1A 1TPDA 3IIZA 3IAQA 4Q4PA 4EPEC 2GK1B 1MNSA 1QPRA 3CWHA 2WVTA 6PTDA 4UOJA 5DCEA 5J5RA 2Q01A 3WBXA 4C7DA 3WDQA 1R3YA 1L8PA 1UC4A 2QCLA 3TK7A 4ZOCA 1TTQA 1UH2A 4KFPA 3WMLA 3NL5A 2A3LA 3GE7A 3KHJA 1EEPA 4NAEB 2JKPA 2ZBTA 1HFBA 4AHQA 4D6DA 4F3HA 5CZSA 1EB3A 1EP1A 4WZHA 2G3NA 1YMYA 3AS3A 7A3HA 3RUBL 3IJ7A 1PZ1A 5SWUA 1VD6A 2QZRA 2YZRA 1KBIA 5C70A 3BZJA 1EBHA 5K3VA 3MTWA 1P4CA 1I45A 3LI0A 1FDJA 4NNCA 3M16A 4B15A 1HJVA 5KZMA 1PJ9A 4DO4A 4P7NA 1ZCCA 2GVYA 2J8FA 3GDMA 1EQCA 4TQTA 1FWFC 1X1NA 6CGTA 4QR6A 4EPBC 3KBWA 4A8IA 4JCLA 3GVWA 1U30A 2ZUNA 1TZ9A 3TLLA 4GY7A 4Y8FA 5D9PA 2CKSA 4GXMA 1RR2A 3AWNA 2WZHA 3M0ZA 5CEWA 4ZO8A 1IXNA 3WYZA 3A4JA 4CEUC 4CQCA 2CLPA 2QF8A 1K9FA 4ZQPA 4H8NA 4O19A 1W9PA 4N42A 2ZZ5A 1KCZA 3TU9A 4BEUA 4ADUA 1WOBA 4Y90A 3VM5A 2VHLA 3XISA 3PP7A 1DJYA 1XLEA 5LGXA 4LS0A 4YS1A 3RM8A 2YXXA 1GOQA 4PUWA 2GGHA 4PTVA 3WNLA 2J74A 2GUUA 4O1AA 1ISWA 2FTWA 4Y9PA 4C6MA 4H8UA 2ZZ1A 4W7UA 3CU2A 3WLMA 3DG7A 3O15A 2OKTA 3CIVA 3W29A 4IQEA 1ML1A 2VOMA 1M04A 1GVRA 3LLFA 4NX0A 4QJ3B 3KL0A 2EO7A 3QY6A 1S1RA 3DC0A 1Y0EA 3PUGA 1DWJM 4OOZA 3S47A 1V3IA 3NQAA 2PDQA 3KDNA 1JZ4A 3CHVA 3MJYA 4B92A 2VDHA 1MDRA 1P0NA 3CNYA 1IIHA 4DBEA 5HJYA 5GPRA 2O7QA 3V3WA 1ONWA 2C0AA 3MO4A 4C6LA 3TAOA 3ATYA 3GC5A 3TTSA 2V2HA 5BMWA 1RAKA 1VJSA 3WUGA 2CU0A 3L0KA 2ZDRA 1JG9A 3WNKA 4LJ3A 3UW6A 3URAA 3QKEA 1DIEA 4ICMA 1QATA 4LAMA 1PL9A 3GW0A 2GWGA 1B3OA 1JDCA 4IH3A 5D32A 1JI2A 5HXMA 1ZRQA 3UPMA 1V08A 4LBUA 2JQXA 3ES7A 1KTCA 5FF0A 5FA5A 3PZTA 2F2HA 3T40A 4F4RA 1RJPA 1IWPA 1KRCC 2X0SA 4W4QA 1QFEA 3WQPA 2ZXAA 1XBVA 4O1FA 2O9TA 4ZQRA 3OVPA 1QVBA 3VE7A 3CL7A 1BWKA 5IBXA 3UVIA 1AQ0A 5AHMA 2GFTA 2X41A 1K7XA 5A6JA 4YVPA 4KCUA 1FH7A 1XINA 1JYVA 1UMLA 3EWYA 1LTDA 3APGA 2Z0IA 2RGMA 3FHQA 5IHRA 1FY6A 3OYXA 2ZXBA 5EMYA 3P5YA 5A6LA 3B0VC 4XZHA 3EDDA 2YBVA 4CVUA 4PEKA 5HWNA 1EFZA 4YXGA 2E5DA 3RIKA 4MJMA 1MO0A 2P8CA 4D6JA 1EJUC 1I8JA 4PMRA 3SIZA 3E02A 2EPLX 4JIHA 2VX6A 1Q63A 4F2TA 1Q6QA 2PA6A 3NAVA 2KZHA 2WM0A 1QHOA 2UY5A 2E1WA 3ZYZA 3AU6A 3W85A 4GISA 1XL9A 3MB9A 4BWLC 2HJPA 5CJNA 1W9VA 4Q6JA 3W7DA 5I24A 1AH0A 2QNEA 4QXIA 1XD1A 5EMKA 4P2VA 5FCZA 3LYEA 5FEWA 5TQLA 1R3VA 1DBTA 4YPJA 3IV8A 2INEA 5A6MA 3KS5A 4R7OA 1Q5MA 1EO7A 1EJTC 1XIBA 3SRHA 4S3KA 4DWDA 1W5QA 1LT7A 2GYIA 2WANA 1A0EA 1DQXA 3DXIA 1ZP4A 1C8YA 4IGMA 3TH6A 3T05A 4Q32A 3PJXA 2QKFA 4GIAA 3TC6A 5AC6A 2ZDSA 2QAFA 1FWGC 3VIOA 3MCOA 2DSUA 3BCDA 3W07A 4D8ZA 4WEVX 4XKYA 4AG0A 1NP0A 1VAHA 4MWAA 1MUMA 3EX1A 5KZDA 2ZOXA 3A4AA 3WD3A 3O6CA 4ILSA 2D3LA 4ORIA 5E9AA 3Q58A 2BHUA 3DHFA 4Y2WA 3DUGA 4GVFA 3RAOA 5C9WA 3MI6A 4G9PA 4M6UA 2QXWA 3GZ3A 4TMCA 1TTJA 3CHFA 4MGGA 3QFWA 4D71A 4A3UA 1DKWA 1OHLA 4LY4A 1CGTA 4UQ9A 3VMPA 3IIPA 2WO5A 4TIMA 1H2JA 3UYCA 4RZ5A 5A6KA 2WWDA 4GIYA 4RNFA 4EAMA 5A6SA 3U5YA 4GPNA 4LANA 1IZCA 4MNJA 1QDSA 4GJ1A 4C6FA 3VMNA 2Y62A 3ISIX 4AVNA 1DP0A 4NVTA 4ZVJA 2WXDM 1DJNA 2CLHA 1PHQA 3WZ0E 1ZL1A 3WMSA 3RCYA 1OM0A 4J4KA 3AIWA 3LZ5A 4DX3A 1RQBA 5AYYA 1P6BA 4DZAA 3FXGA 3UJRA 5KITA 4A29A 3ARUA 2VR5A 3N12A 5DEZA 1R87A 5BW6A 1J5TA 2VFIA 3BPWA 1SM9A 2PGWA 3FLUA 1UJQA 1ITCA 1GNXA 4L1WA 4LSBA 3U3HA 3QPYA 3UESA 3AS1A 3H12A 4ZZ9A 3GR8A 3G22A 4NP7A 4OWGA 1RZMA 3MYOA 2G4JA 1XV8A 2VZSA 5LKYA 4AEEA 5DFAA 2J8TA 3VMOA 1I0BA 4IQLA 2V3EA 1SPQA 3H55A 4JEQA 3EPMA 1TPB1 3ONBA 5CSRA 3TYZA 4QAIA 3N11A 3R43A 4MOZA 3VOHA 4QQ3A 3G24A 3LEPA 3GFZA 3QTGA 4N4PA 3WQ8A 4GNVA 1EPVA 3FJNA 3KVLA 1H49A 1XIDA 2ON3A 4AZCA 4C90A 4WY0A 4KBXA 2FFCA 2D23A 3ABZA 1A5UA 5D4YA 3WD4A 1TRDA 1YDVA 2Z26A 2EG7A 5HINA 1IT7A 4AF0A 4S3EA 2BOFX 2YBTA 5E6ZA 4R9OA 3MCMA 1DHPA 5LSMA 1F73A 3K8MA 3R94A 3EOOA 3VC5A 4MPQA 1TFVA 2PEVA 3KS6A 3LHYA 3BZGA 4MF4A 2GL5A 3HM7A 3APTA 4IGNA 1ADOA 1RA0A 4B2DA 3BL3A 3BLLA 4PRRA 4XSLA 3ITCA 4FLQA 4WJEA 3VNJA 2Z6JA 3FIGA 3MHGA 3WDJA 3S1VA 1JPIA 3DC8A 3SZ8A 3THDA 4B3ZA 3UJ2A 4IL2A 3ZVIA 2P88A 1P0DA 2W61A 1UG6A 3M0VA 5AYXA 1P48A 1JCLA 1EJWC 5AVHA 1R86A 4S3JA 1UR9A 2PWUA 3UJFA 1VRXA 3SN4A 1MQQA 1M7PA 4GQQA 2EPHA 2DZSA 3WUBA 5ABFA 4NZFA 1B3VA 4CNPA 3QR0A 4JL2A 2X1IA 3EKLA 4DAIA 3WNMA 1N82A 4Y9OA 2J7HA 3TNBA 2D3NA 2INZA 2OKOA 3P7YA 6XIMA 5JXQA 2OSXA 1KM1A 5BU9A 1AFSA 4BQ3A 2Y89A 5AHEA 3R79A 1JR1A 4H04A 4KWWA 3CPUA 1AD4A 2ZADA 2BSLA 5DMYA 1IEXA 4UNIA 2X1RA 2O9PA 2A1YA 3MP3A 1MZRA 2NVAA 2GDVA 4GMEA 1FA2A 2XH7A 3L2LA 1GORA 3HG2A 2VEKA 1F74A 3L2MA 4LAZA 4KMQA 4QNWA 4ENLA 3HPSA 3MMWA 4R27A 1UD5A 4GABA 1FUYA 3B06A 5D9OA 4V27A 1DORA 1KGWA 1RUSA 1V03A 2CETA 2R82A 3Q45A 3T81A 3URBA 4U33A 3W83A 1KC7A 3IJDA 3VNIA 1W31A 1E43A 1OCNA 1YE6A 1CLVA 2QGYA 1JUEA 2A7PA 1YPFA 3OU8A 4ZQNA 1BYAA 4ZOEA 2OYLA 2W0UA 1TWSA 2E25A 1V51A 1YDNA 2W91A 3RITA 2C79A 4FXJA 4WXYA 4V15A 1AJZA 1JQXA 3PPGA 1KA9F 3AYTA 3IVTA 4A4AA 4I9MA 3DKLA 4Z42C 1KKRA 4RK8A 4B5NA 3WQCA 1KFLA 3HG4A 2ADAA 4XTIA 1W9UA 1TWZA 4G1NA 3GDKA 4BK9A 2IMRA 3AIQA 1R8LA 4H01A 2XTKA 2G3MA 3H23A 3KRSA 2YBUA 3AUOA 1H7XA 3IJ9A 1E4LA 1NFPA 2PE4A 2FGBA 2IPGA 4RDWA 4FX7A 3MJMA 3NQDA 2QCMA 3KCJA 1K8XA 1KCXA 4F0SA 5BMXA 1VFFA 1Z44A 3URQA 3LSBA 1F3EA 2X1SA 3EWDA 4PTXA 4F0HA 5DY2A 2WMFA 1VYSX 4MWAB 4I9JA 5EL1A 7TAAA 3NQ8A 4QLLA 4H41A 4MKVA 1UIPA 4DIAA 2P0OA 3CUJA 3I10A 3LHZA 1UQZA 1T6MA 3WLPA 1BKSA 2AL1A 3UWUA 3GVVA 1TB3A 1U1JA 1VRDA 4IM4A 4REQB 5CC3A 2BVTA 2YL8A 3NZRA 2VGBA 2DUXA 1FHVA 3S2NA 1MW0A 3CWNA 3MSDA 2Y0FA 5F1UA 3PPHA 4D6FA 4P7RA 4QGCA 1MW1A 4ZA0A 1EDTA 4UFMA 5FJOA 3EMZA 4JBRA 1GCYA 3L4XA 4D6EA 3PTMA 3MKKA 4HNUA 3ZR6A 3S2JA 1UR2A 4R3UA 2ZIDA 1UWRA 3I4EA 3BCFA 4CVWA 4L56A 3SGZA 4Q7IA 1ZPTA 4KPLA 3S6OA 2RDTA 4YJ5A 4J1OA 1HJXA 5G1TA 3DYMA 4C65A 2JK2A 3EWCA 1F5ZA 1LRNA 5CBJA 4HK7A 2X2GA 4O8RA 2GVJA 5J8LA 3SN1A 1CGUA 4OQVA 1GT8A 3EYPA 4NHVA 3MHFA 3FNDA 3EDEA 4BI7A 3MZNA 2R1KA 4IP5A 3HTWA 5CPTA 3QOMA 4W93A 1MW3A 3TN3A 1ZU8A 4XO6A 3DFHA 5LXEA 1WX0A 1S39A 1SFSA 3RO8A 2C15A 1WDQA 4A35A 1PTGA 4NRRA 4QG8A 1GZ1A 1E9ZB 2IXUA 3IRSA 2YCKX 3I6RA 3M4HA 3LHUA 1OINA 3NCOA 2VEMA 5KMYA 1M65A 2F38A 3CV6A 5LIUX 1TMQA 1UH3A 1PIIA 2VRJA 4KH2A 5D02A 3B40A 4XZBA 1YW1A 5JBEA 3QXBA 3UFYA 1TZ7A 2AQVA 3DFYA 1DXFA 3H24A 4ALDA 2PLCA 5I7GA 3DHDA 2MANA 4YN5A 3IWPA 3GHRA 2DZWA 2H8XA 4ADTA 3M46A 1GVIA 1Q6FA 4DWSA 3VKBA 2VXNA 3LI1A 2YA1A 2QDHA 3U2CA 5EB8A 2BY2A 3FX4A 2CERA 3RM4A 3SGUA 2YDSA 3G1FA 4MSSA 2ZRYA 3G2GA 7CGTA 1E70M 1XQKA 2PBOA 5ABFB 1WDWA 4PBGA 1CT5A 4IX0A 4C6DA 2CITA 3NPVA 2GGEA 3RMEA 4Y7EA 1DJQA 2XH4A 9XIAA 3W1AA 4W84A 1P7TA 1DWAM 2CW6A 1PSCA 3QYSA 3LBMA 3PAJA 1UBPC 2OPJA 1KRMA 1H7NA 2B7OA 4MB4A 4FS9A 3D5HA 3GHSA 2R8WA 3WDPP 1T96A 3DBPA 3OVGA 5LIKX 1MUCA 5C9UA 1LBMA 2YW3A 2OZ8A 3GNNA 3W1QA 3VGBA 2Y2WA 5HOSA 1S5VA 5H91A 1W32A 4IGHA 1KM6A 3VD9A 1GUVA 1E3ZA 4MNMA 1GW1A 1PKNA 1QK0A 4L4OA 1KWGA 1GVSA 5JIPA 3AYRA 1QOPA 1U22A 1C29A 2OMAA 4GX9A 2XIQA 4HJFA 1PHWA 2NUXA 4PCSA 4YVXA 2PWEA 2YZ5A 5TF0A 3NJ3A 4OV4A 3N25A 3GTIA 3P2VA 2OEJA 4DJEA 4UQCA 1PZ0A 1ZB5A 2FLIA 3K2GA 3WD2A 1EC7A 3VNYA 2J7DA 4W89A 2ZWZA 4YCPA 1S1PA 1XYLA 3DERA 1KXVA 3W28A 4QG9A 4JNMA 1ZJAA 2OEKA 2X1TA 3C5QA 2B0MA 2NX1A 4QG6A 4HHLA 1P0BA 5FACA 1M3UA 3P80A 4GI4A 3W2LA 3B3DA 2FJKA 2HQAA 2ABBA 1F3WA 4CN6A 1RCXB 3BWWA 5CSSA 1RK6A 4ZB0A 3APYA 3UR7A 4AIOA 4HN8A 2FHCA 2VUNA 1E72M 3TYEA 3DKJA 1XKJA 3FKKA 4JCMA 2Z27A 2PCEA 3T0BA 1SZGA 2PC8A 3OBAA 3W1NA 3GNOA 5HQMA 1W1TA 1VBGA 4KW2A 1U33A 3TA6A 1E3XA 4FNUA 4Q8MA 4KEZA 3AMCA 1O12A 4MYAA 3CBWA 3IV3A 3HGSA 1IWBA 1K02A 3KLLA 3VIJA 4UFHA 1NY1A 3OLDA 3O05A 4DJDD 1NDZA 2WAGA 1ZAIA 2ZC1A 3KTCA 4M6PA 4FX6M 3B9OA 3IJQA 1PCKA 4OBSA 1NOWA 1UW9A 1NAL1 3WUEA 1BD0A 1HJSA 4WHBA 2AQOA 3GXTA 3W26A 2X09A 1QHZA 4DO5A 1UZDA 3W75A 5AYBA 1BQGA 1KR1A 3OB8A 4DBUA 3C6CA 5GVJA 1MSSA 4JHOA 4JIIX 1JCJA 3OLIA 3S83A 1OX4B 1G94A 2R1NA 4LEFA 3KBMA 3RHGA 1RA5A 3EDFA 2BV9A 2ZXDA 2EPNA 1I1XA 1CB2A 2DVTA 4Z0JA 2QPXA 1R2RA 2F6UA 3E5PA 3GNXA 3F4DA 3V75A 1TJRA 3GLCA 1VHCA 4AHOA 4LS2A 5HNTA 1T0OA 2AGKA 4L4PA 4JFSA 2YL6A 4FF5A 4O28A 3J7HA 1I75A 1XRFA 1MW2A 2XN0A 2QDEA 3L7RA 3M64A 3QC0A 3BJFA 4EXAA 3ABQA 2C1IA 4GKLA 1A0DA 5FF4A 1OC7A 5B80A 4LPCA 8CGTA 3VPLA 3P93A 3W23A 1EF3A 3WLKX 4JQ1A 1OGGA 2DSZA 2TMDA 2F8QA 4JTSA 2Z1KA 4A6GA 4X61A 1JL8A 1QMLA 5CC5A 2VP8A 5JQ9A 3T0DA 4QJ5B 4NAFB 3FA5A 1JZ2A 2VQTA 2B7NA 1B57A 4JN6A 3T0AA 1EWDA 3VIMA 2EHHA 1AJ2A 4G5DA 3VE9A 6A3HA 1A4MA 1BF2A 3MUCA 3N13A 3CEUA 1SR0A 2PDHA 3AUJA 5BXRA 1GKQA 2CBIA 2PI6A 1VFLA 3NQ6A 4L1GA 4M1RA 1C93A 3KCOA 1K1DA 1YQ2A 1BYBA 2Q3OA 2QCEA 4BF9A 4MDPA 2PAJA 3WQWA 4W88A 3TCEA 1I2OA 1BSIA 3R0KA 5FKYA 3MUY1 1QU4A 1JZ8A 2OO0A 4PMVA 5CLTA 1OY0A 4AY8A 3ZQ9A 5MHBA 4DJED 1A5SA 4AD2A 1M7OA 4HYWA 3CQJA 4IWWA 4DPPA 2Y7EA 5DCDA 1OYAA 4UOQA 4ES4A 1MZHA 5EGRA 3R0UA 2Z29A 3HPFA 2PGRA 3W4RA 3AZRA 2CWNA 3AQUA 3GIPA 1ICPA 1BVNP 3BAJA 1A5KC 3KRUA 4K3ZA 3MUZ1 4AZ5A 1MEIA 3TDFA 3TNOA 4L1XA 4IQDA 3AIEA 2ZUVA 4Q3MA 2AKZA 1UP3A 4A3YA 2VWSA 4DWSB 4UIOA 1WE5A 1UBSA 2BGSA 4AZIA 3ARQA 1LWHA 1W91A 2NQHA 1JPDX 3UT0A 1XBZA 3HGJA 2NX9A 3GIQA 1C9DA 2X2YA 4PTWA 1R2TA 5D38A 4UTHA 3DBNA 3QM3A 4NI3A 3BDKA 2BY3A 1UASA 6XIAA 2W5FA 1P7TB 1KFJA 1U1UA 1TVNA 5LA0A 1EHAA 4NZ1A 5DXXA 3WLTA 2BLEA 4U31A 3CZEA 3PFMA 1OADA 2WCAA 4M8UA 4PTNA 5CC7A 1UMYA 2E9BA 4UC5A 3S0CA 5BXSA 4DUOA 3VGDA 3O7UA 3WL1A 1M6JA 3T6CA 5AB3A 2ZFAA 1UIOA 3M47A 3LPFA 1BRLB 2V5DA 3FDGA 3W00A 3NXFA 3GXIA 5HUPA 3A5VA 4F48A 3KRBA 2WB5A 4JD4A 3HJZA 3T2QA 2QJNA 1XUZA 2Z28A 3TMQA 2Q02A 2RDWA 5C55A 1R9XA 2JALA 3TR9A 1XXXA 4JX5A 4K7VA 3LUTA 2BVDA 3ES8A 5L9FA 4FA3A 3VVGA 4UFKA 1XW8A 1WXJA 4EKJA 1Z32X 3W53A 1F3TA 4GYKA 4JPGA 4X3ZA 1EKOA 3LPGA 4RXGA 2P76A 1IV8A 3GY1A 2HPMA 4DVOA 2GGJA 4UTWC 2INFA 2Y5SA 3KP0A 4JFVA 4KRTA 4XD6A 3IAPA 4DY1A 2Z1WA 3LTPA 3O6AA 2PU1A 3SCQA 4UTFA 3N4FA 4Q7BA 2GQ3A 2NT0A 2C14A 5ECUA 3GUGA 3GFYA 1GVQA 1GEQA 5D9NA 3TTEA 1YXDA 1PWMA 3WSUA 2QCGA 1KXHA 1LLOA 1Z6KA 3SN0A 2BY1A 5G4WA 1GQKA 1CNVA 3VNLA 3TEVA 3GTNA 3VKDA 1DJWA 2HDJA 1XSIA 2G95A 1Q7QA 1UKSA 2TSYA 1YKWA 2BODX 4DLMA 4AQLA 3G0XA 1J0IA 2CLEA 4CNOA 3LPOA 2WJFA 3T8QA 3WIJA 1ITUA 3IVUA 1SW7A 4B3LA 1UOKA 2CLOA 4K6AA 1UD3A 3NQFA 4PFHA 3OG2A 3W88A 2Y6ZA 5CZTA 3CJPA 2GJXA 3WLJA 5H8MA 4JEJA 4Z1CA 2J13A 4LTSA 3MPGA 4PMYA 1ZJIA 5HQLA 2KAUC 5I06A 3GG1A 4RPPA 2CNCA 2Y63A 3E0LA 1KM4A 2E68A 4ZXOA 4GFIA 3M0MA 4FIQA 4GUFA 5IHSA 3FY1A 1B30A 3BOLA 4UTTA 1EXPA 3P62A 3PBWA 1LOQA 4YNGA 2PF0A 1Q7ZA 1I6NA 3CIXA 3TQKA 1KBJA 2WLYA 3CHDA 2J24A 3FW6A 4O1BA 3UF9A 4HB7A 1G4TA 1TR1A 5F2LA 4HA1A 5D30A 1VIZA 2CHRA 4JIRA 5KSWA 4DO6A 3H2EA 3SJNA 4I7WA 3KW3A 3G1AA 1AZ2A 2WVVA 3N4AA 2WMKA 3AHVA 5BZAA 1GOXA 3ITLA 3VIHA 5FJIA 2WZEA 5CH9A 2Y7DA 2VGGA 4HMNA 1TPC1 3PN8A 3AMDA 1BEUA 3LK6A 4GYFA 4AYSA 4JHZA 5L6UA 1LLZA 3GDRA 5HMDA 3WELA 3ZOAA 2OWXA 1XC6A 1XYFA 4ZO7A 1SMAA 4IZGA 2WZTA 2WQDA 3TIMA 1IT0A 1GWJA 2W4XA 5HATA 2NV1A 2QF7A 3GHTA 3NPUA 1SYTA 5FI8A 1H1NA 2JFEX 3L21A 3WLRA 3GO2A 5HAOA 3ERPA 1WV2A 2NW0A 1J93A 5I3GA 4RW5A 4E2BA 1NVMA 2Y5EA 2XVKA 4MZYA 1LF1A 1N8WA 4G8TA 1HKVA 4GXPA 4KEMA 4WSJA 2WWCA 2Z1BA 1SGJA 4KS0A 3N9RA 2O56A 3CV1A 4TV5A 3WBWA 1Q6OA 5GJMA 2BVYA 3RF9A 3E9AA 1EZ2A 3SY5A 1HKIA 4H2CA 3AI0A 3G6LA 4HNVA 3WDRA 1K8CA 4LUSA 2FZMA 2VT0A 3PZUA 3BO9A 1J6OA 1NOFA 2QCCA 5I3DA 4WKAA 4ZTXA 4A2SA 3ZJKA 4IPPA 1TJPA 5ENLA 1RSCA 5FJRA 1G69A 4D2JA 2PODA 4C6OA 2WC3A 3ZMRA 3EB2A 1Q85A 5D8ZA 3VCCA 4O0KA 3VIGA 4KCTA 3QY8A 7REQA 3WLQA 2PSNA 1O7AA 3ALGA 5A8PA 1T7LA 1M01A 4P61A 2Y61A 3CTLA 3W7RA 3CT2A 3W1XA 2ISSA 1BPLB 4Z17A 3QR3A 1CGXA 2XFFA 2WM1A 2W79A 1L6FA 4HSOA 4I5UA 3TKFA 4EF8A 5G5IA 1CB7B 3QMTA 3ID7A 2Z7GA 3AIBA 4IIHA 4PL1A 1EJRC 2B7QA 3N6JA 1F07A 2V5KA 1ZSXA 4QRNA 3PG9A 5D05A 2E9LA 4UQBA 4Q8OA 5HPCA 3COTA 3TMLA 4F0KA 2A3EA 1E4IA 4F9JA 1V0NA 1SZNA 4BF5A 4HMEA 3WNNA 2P53A 2QHAA 4R5EA 4I6VA 3FFSA 3WK0A 3T9PA 4L7ZA 2HXTA 1OJXA 4S3BA 4GD0A 1CXEA 4Y9MA 1SO6A 3S3GA 1RK5A 2PGFA 4CQAA 4W7WA 2Z1SA 3NA8A 4FLOA 4JTLA 3TN4A 4GXWA 3LBOA 2DT3A 3LB0A 4QP0A 4GYJA 4PN2A 6TAAA 3W71A 3R25A 3FXYA 1EX5A 1WZAA 2VCCA 2DQWA 5FD0A 4GCAA 3M5ZA 1IEVA 4XAPA 3K13A 2GOUA 2OR2A 2JEQA 4HPGA 5D9MA 3NSXA 4F0MA 2ZUUA 3U4FA 1D2KA 4DXKA 5JVLA 4EWJA 3KE0A 1PKYA 1ZBWA 3UCDA 4NASA 5IFPA 4JIEA 3VOJA 2I9UA 1NTHA 4NKCA 3ABSA 2OB3A 1F2JA 3PUOA 2V5LA 4FZIA 1S2AA 3KVJA 1TIWA 4FMVA 1ONRA 3RLUA 3ZLFA 2X0YA 3VCRA 1PXGA 3K4DA 3LV5A 4U4MA 3WQFA 4FXFA 1JUBA 2R91A 1GEHA 3UVAA 3A9IA 3OZYA 2I5GA 3MC5A 2RJGA 3JVAA 2XIIA 3E2VA 3DG6A 1OC6A 3LZ3A 3CB3A 1CDGA 1K3UA 3SO7A 3SCPA 3T08A 2WKGA 3LU2A 3K30A 3TZFA 3VU2A 1SJAA 1OX6A 3PNUA 2RH9A 4UNLA 4IPJA 1GQIA 2H90A 2HNEA 3UJEA 1EGMA 3EOUA 2WCSA 4YMZA 3G1XA 1E1CA 3PWAA 2HE8A 3N18A 3BLFA 4JTFA 1FCVA 2Q6ZA 1F76A 4H9ZA 3AXHA 2QDGA 1ECEA 2G4FA 2P3ZA 2PZNA 1KFEA 2C19A 4NQ1A 3WUFA 3EMCA 2VZUA 5A6BD 1VS1A 4NJHA 4AUBA 3NEHA 1HNYA 1GOOA 4XUYA 4NY2A 3DZ1A 1ZUAX 3P6LA 2J25A 2BZNA 4W8AA 1JEZA 1W1B1 1ENUA 1S5WA 1EEXA 4E2OA 3E12A 1NOUA 2J66A 2PDYA 2Z2BA 1J11A 1VPXA 2YA0A 4W85A 1CXKA 2VR2A 5CBBA 2DT0A 1XQLA 1CXLA 4CD4A 4IX2A 1K70A 2PDBA 3K46A 1XIEA 5DO8A 4HU4A 2PDWA 3FHAA 2B81A 3C61A 3THAA 3VABA 1EO5A 3OBEA 3IJLA 2PDUA 3WLLA 1DXIA 1HT6A 4C5YA 3EB3A 1V02A 4X2RA 4FI4A 2HSAA 3CO4A 2X30A 3G8RA 2D2OA 4LAKA 4B5VA 4HPNA 3WKZA 3MA8A 1E51A 1FWTA 2VR4A 1NARA 1E0VA 2VGFA 2FB2A 2FJUB 4R85A 1T8XA 3RGTA 1J0YA 5CPNA 1RVKA 2XH2A 2OELA 3L4YA 4S39A 5FJUA 3CYJA 4PZVA 2OJPA 3T78A 3AWOA 3QPZA 2WBGA 1XBXA 3LMYA 3W22A 3QW3A 1THFD 1XPGA 1XH2A 4K68A 2JIWA 3QN3A 3ARRA 2PS2A 4AY1A 1GYMA 4JKLA 4ZEPA 2ISVA 4B3KA 1ZAHA 2XIOA 2C1GA 2O9RA 1FWJC 2B31A 3OA3A 4GUJA 3W0KA 1I4NA 2QJMA 3RMJA 1FOBA 4S2CA 2I16A 4N9DA 4ACZB 4AIEA 4AVOA 4ZFCA 4YCOA 2IKHA 3RX2A 4O4WA 1Q6EA 3O6DA 1XH1A 3CL8A 3RYSA 3M5XA 2RHGA 4XZNX 4Q22A 3KVMA 4H6RA 2FHFA 4X2PA 2WNZA 4ATLA 4US6A 1XD0A 1HGYA 2ISWA 5LNRA 2JE8A 1QOXA 4E2VA 1XIJA 3NYZA 4ERGA 3FYOA 4J9JA 1OZQA 4DEFA 1H60A 4ZQOA 7REQB 2FZ8A 1TQXA 4H6KA 1X38A 3R1ZA 3CAWA 1VJZA 4GQ0A 3HPZA 2ALDA 3BOFA 4L9YA 4AFYA 5CJMA 4RE0A 3PWGA 1R2SA 1PYFA 5F1VA 2XDFA 2V6AA 1JDFA 2V8ZA 4AMAA 1W2PA 3F4VA 5IDIA 3JZEA 3IRDA 1UA3A 4MKNA 4IMFA 4IL0A 3DFNA 1ONEA 4Q8QA 3DFQA 4RDZA 2J47A 7XIMA 3WQVA 2EJAA 2CLIA 3JW7A 3SUTA 3N29A 3N15A 1RD5A 4KT2A 1WKEA 4MM1A 1DHKA 4GLEA 1EDGA 3I6EA 4GHRA 1ICQA 3QY7A 1NDVA 2HE5A 3SCUA 4C6QA 5EU9A 3L66A 1UUMA 3VILA 1FWIC 2Z1XA 1KLZA 1DJZA 3VX1A 5K4XA 1R46A 1IYXA 4NXKA 2Q8ZA 3V0TA 1AQFA 4AH7A 1DIKA 4GBUA 1BHGA 2XFYA 3SUVA 1YBQA 1ZZMA 4ROQA 2J79A 2E3ZA 4E0CA 4F9DA 3M7SA 1HF6A 3GQYA 4LV4A 3C0SA 1GOIA 1UKTA 3N17A 1X6NA 1FX6A 3FCPA 3POCA 4TO8A 4MADA 3CK5A 2AOSA 4Z1YA 1K8ZA 3OVQA 1O1ZA 3H8AA 3KWSA 3VAVA 3WF4A 1CEOA 5C5YA 4JHMA 2DH3A 1J2WA 4GH1A 2WHJA 4PMUA 1GTEA 1Q13A 1A5BA 1KM5A 2PC4A 3ANVA 1E1EA 1HJQA 4KEUA 1R5YA 3VD3A 5AC4A 2DP3A 3BLEA 3BLIA 3DGRA 4QCFA 5DCBA 4D9PA 3B4YA 4M19A 4O53A 4AEOA 2WVSA 4PBEA 1JVNA 3V4BA 4WKFA 3W6LA 3PHAA 3LX9A 4WOZA 4DJFA 4JTAA 1I2PA 4NX5A 3B9EA 3PZGA 2DSVA 1C7TA 1X39A 1D3CA 4AWEA 3IS4A 3VTRA 2HS8A 3L67A 3CO8A 3AHYA 4JOMA 5AHNA 1JCXA 4JNYA 1LLWA 4I5RA 2WHKA 1W5OA 3UEQA 2DY3A 1AG1O 3RN6A 1IR2A 4ORMA 3WO8A 4YIWA 1ZJBA 1VBHA 2ESCA 1X8CA 3U9IA 1U1HA 3WLOA 3I7SA 4XVEA 3V5FA 3GU9A 1QPNA 5HQEA 1WNOA 4PBFA 2NV2A 2F6KA 2QV5A 3IGSA 4JKKA 3WQDA 1MRAA 4PCFA 4AY7A 4CEXC 1W17A 3EWZA 4DI8A 1WA3A 4DM2A 3QGKC 2WLZA 1SMDA 4O57A 1SZFA 1FCUA 1XLJA 2Q09A 5E93A 2GVGA 2PDGA 2GJNA 3U7VA 1O5QA 1FWDC 2WSYA 1WP6A 3DN5A 1OFQA 1OFAA 1F8MA 3PR2A 2VFDA 3W70A 2FZNA 2GDQA 1TYGA 4PMJA 3VUSA 4MY1A 2VD8A 1YHTA 2BXZA 5F2IA 1VPYA 3A64A 5HWMA 1W5PA 3H4WA 4IMCA 2QUNA 1D7FA 1YX1A 1YADA 3FYPA 2GK1A 4LYKA 1H3GA 2H3BA 1FHLA 3XINA 3G0SA 2EXOA 4DZ5A 2EEXA 2P1FA 4O12A 1QCWA 1XDLA 5FIPA 3ITVA 3K8KA 4MUZA 3CH9A 1G6CA 5LA1A 4ZCWA 1EDQA 1OYBA 4AMCA 3AAMA 4NAEA 2Y4SA 3FSTA 2PP0A 1J96A 1TG7A 8TIMA 1Z3NA 3E74A 3WD1A 1X6UA 1WQ5A 5BOFA 2ZRUA 5IXEA 2CLFA 4M24A 4Q8UA 1FCQA 1X6LA 3BVJA 4EANA 1ZBCA 3ITGA 3MBFA 2F61A 4K1GA 2WKJA 3NWRA 4MWAC 4RZ6A 4EK7A 2ZX7A 3TP4A 4E6MA 4PUUA 3N6HA 3CQKA 3GX9A 5C54A 1E56A 1F8IA 2VRQA 3NZQA 2OLAA 1E55A 4ZB5A 4W9TA 1Q2SA 2VKZG 2VVNA 4MPKA 1W3JA 1S46A 4Q33A 5CPQA 1GG1A 3V18A 4JYFA 3MV11 3CGTA 2VDGA 3LENA 2WJEA 3UWWA 5HNRA 4G56A 2NSXA 1EJXC 3PZVA 3HPXA 1J12A 1KLYA 2WSQA 4QNEA 4C91A 1EP2A 3K5XA 4QSHA 1YNQA 3EDKA 5EFDA 3U7BA 3E0WA 4KIRA 2VFHA 1S3HA 4LYPA 3AC0A 1T8QA 4NRSA 4QITA 3V7PA 3B8IA 3LM3A 3OIHA 3PWIA 1W3IA 3M44A 5DBTA 3B0YA 2WQPA 2E40A 1UZ1A 5AVNA 1HJUA 3LDVA 2PDLA 1MXGA 4S3DA 3SY1A 4ACYA 4AC1X 1Q4WA 2YXOA 5DY3A 3IUDA 1FDZA 1XDJA 1FWNA 1H7OA 2OLSA 4DJFD 2G0WA 4IP7A 2Z1VA 4K7YA 3LRLA 1VYRA 4BI5A 3PBYA 3MUAA 4WF7A 4HYVA 1V3JA 4WSKA 1NWSA 5E0KA 1KM3A 5GNXA 3O6YX 1J0JA 1W3TA 2A85A 4K8EA 3W24A 3F4NA 2Y70A 3NZPA 1B9ZA 1RLDA 4L65A 3VGEA 2ZXQA 4YVVA 1NJJA 3QQ1A 1DE5A 1Y8BA 3E38A 5EY5A 2GZXA 3UXDA 2VX5A 3U8GA 2CHNA 1QASA 1U83A 2QVNA 3GC4A 3T55A 1A5OC 2E77A 3IGXA 3WQEA 4PCTA 3W72A 1RP8A 1DIDA 1UR0A 3T0TA 1YBQB 1ZFJA 3INPA 1YRRA 2DZBA 3AZSA 4GUIA 2H8ZA 4S2BA 1QXLA 5EBAA 4GI6A 3CMJA 3AIRA 1VYPX 1UWTA 3NQ2A 1CENA 2HXUA 3UZZA 3KEHA 2C0HA 4XX6A 3NVDA 2YLLA 1SUXA 3LTYA 4Q4OA 3N9KA 3O2LA 1RPXA 2WC7A 4PFMA 2NLYA 1TR9A 1T41A 3H22A 1HUVA 2Y88A 4KCWA 3GM8A 2GJLA 4IJBA 4MYXA 5LIYX 4PE8A 4CN1A 3CV2A 1SJDA 1E0XA 1FVPA 3CZGA 2ICSA 5CAKA 2QT3A 3W2NA 1G4EA 4F79A 2BXVA 1FFRA 4LAOA 4NIRA 3CUZA 3IIXA 5BRQA 4UTLA 1M7JA 4FP1A 3LM7A 3V35A 4Z1BA 2Z7KA 3B04A 4PGLA 2TPSA 3CL6A 3L9CA 1ZJHA 1DTUA 3HB9A 2XSBA 4PMDA 3NURA 3VDGA 3OA5A 2GJRA 1S3TC 3N2MA 3FJLA 2OYMA 3UXIA 4LUYA 1QNVA 1KFKA 3KZPA 2V2DA 1GPWA 2XSAA 3I3BA 3SM0A 1NSJA 1OGSA 3ARWA 1QBAA 1QI5A 3SURA 4O0QA 3WN6A 4H9XA 4QBXA 3UWVA 4JZ5A 4HK5A 3GXDA 1H11A 2A3CA 4I9TA 1BTCA 3SI9A 3W84A 4PCNA 3G1SA 1GG0A 1G7VA 4HK6A 4TUFA 2HPIA 4WCJA 2XZ7A 4WY0F 3PS7A 2Z24A 4B91A 3GH4A 3GBEA 4PTDA 3LGEA 3L65A 1K9DA 3STPA 4Q4MA 5CPSA 1EHNA 2OSWA 2JIEA 4JYEA 3ORWA 1FQ0A 1PKLA 1TIMA 3G1DA 4UXDA 5DF0A 4EXBA 4PUJA 2CXEA 4GFSA 5LIWX 2D22A 1J79A 3W73A 3F5JA 4AWSA 1HL2A 3QSTA 3UWQA 1XG4A 1UZHA 1OZMA 3DFPA 4UOZA 3TWAA 3DX5A 3HQNA 3VNDA 3RCNA 2BOGX 4QS6A 2FYMA 4MJ4A 4AEFA 4B5UA 4UBPC 3IGHX 4M56A 2G50A 2VENA 4W7VA 4PUDA 4NJGA 2C13A 3M07A 4OOUA 3BICA 4QISA 4AD5A 2QJHA 3GTXA 4CU7A 3KTXA 4CCDA 3W7MA 1OGBA 1Q6DA 3H2CA 4DBSA 4W86A 1GVYA 2J88A 1H7PA 3PBUA 1A49A 4PR4A 5AZ1A 1BF6A 4KQNA 4DUXA 1HL9A 4C6CA 4L9XA 1HL8A 1LOLA 3E1F1 4XSMA 3UGRA 5JBDA 4BA0A 4AIUA 2PTZA 1O6IA 1ESWA 2VC7A 4HTBA 5LNWA 4H4IA 3P67A 4BF7A 3DOPA 3VOIA 1WKDA 1OFDA 1R85A 3C8NA 4YTRA 2BX7A 4N9CA 3I3EA 3PBGA 2NXIA 1J8VA 2W6RA 3I4KA 3L4UA 4XKMA 3UY7A 3F7JA 4IXXA 4A22A 3MP4A 4FK9A 3G3MA 1J10A 2I56A 7ENLA 3IUHA 4KETA 1QBBA 1J2BA 1X7IA 1I2QA 1M5WA 2XYLA 2J7BA 1EX1A 4CQ8A 3BAYA 2JEPA 4MAZA 3BGAA 2W66A 4ECLA 1W8GA 1JXJA 1JYXA 3A4XA 1OSEA 4XBJA 1OFPA 3WEOA 5AZ0A 2OZ0A 4PUNA 4G6CA 2ZE0A 4DI9A 4UQAA 4DM1A 2O4QA 2QV4A 1PIFA 4DYJA 3GU1A 3QHNA 5E5CA 1CIUA 1O60A 3SIMA 1H63A 3UGVA 4HNCA 4HBKA 2D2GA 2FZDA 2XVPA 1VPQA 1ISZA 1GPFA 3SSZA 3RK8A 4RJEA 4H9TA 3PM6A 3N14A 3QYQA 2VL4A 8XIAA 1V3MA 4E4UA 4RW3A 1XLCA 4YYCA 1HKWA 4N0RA 3HGOA 2V3FA 4RLIA 1P0EA 3CT7A 3DIPA 1L0PA 5JMUA 3ZS4A 3UG8A 1JUKA 3CAVA 1XCXA 3W25A 2EQDA 2BTMA 2ASHA 1VCVA 2FMOA 2OGJA 4GKTA 3AROA 5CPMA 4HP5A 4PA8A 5D8WA 5JBFA 4GRSA 4MB3A 3WMCA 3LCGA 3RU6A 2GGGA 2IKGA 4PMNA 2NQ5A 4F8XA 1NQKA 5ABTA 2DZPA 1BKHA 1KV8A 3W38A 4DJDC 2VEIA 1G4SA 2I5IA 2G37A 3SJ3A 3ZLHA 1W3HA 4DF1A 2DQXA 2J9ZA 1OABA 2V5BA 1GOKA 1JCMP 3CHEA 5C2GA 3H53A 1WXZA 4HVXA 3UR5A 4D8AA 5LNVA 4JTKA 3F2DA 3DI0A 3AISA 3V0UA 3ONCA 3OZMA 3S2LA 4B5TA 3GNPA 4AD3A 1L6WA 3QQ0A 3WH6A 4AZ6A 4B4FA 4V2XA 4X60A 1AODA 2UV8G 5FL1A 4UZUA 3B8UA 5TIMA 3CEPA 1ZY9A 3BAXA 3SUUA 4AWUA 3BW2A 1V6UA 3E5BA 1UJPA 2UY4A 4HNOA 4C6NA 2I17A 4QIUA 4M1BA 1BYDA 5A8NA 3OO2A 3OQ8A 4OT7A 4UTIA 2VNCA 5M2FX 3CZLA 3ELFA 3W2JA 5FEZA 5TAOA 4HA0A 3M7WA 3PZQA 4MFDA 2REQA 2VFEA 1M1BA 4FXSA 2ZRZA 3ECQA 2ATMA 4DWSC 2XVLA 1FXPA 4P8WA 3LS9A 3WK1A 1PDYA 5DMNA 3FJ4A 5A2CA 1YYAA 3UERA 3BJTA 3ITYA 4WD0A 4M29A 1SFTA 3EX2A 4HHMA 3S5ZA 3ITXA 3BLDA 3VOCA 4LX4A 2V5JA 4RE2A 3WFZA 4A8RA 1KW1A 2PF8A 3RJXA 1AW1A 2QULA 1CGWA 4IIDA 4H8HA 4X0VA 5E1QA 4LFYA 4PB5A 2GQAA 3CWOX 3NNTA 4N2YA 1KM0A 5EMUA 1D8WA 4J35A 4QAWA 1MMFA 2XHYA 3FVDA 5M5DA 1V5XA 3RPDA 2L5HA 3EA2A 1Y5XA 4ERAA 5I3FA 1ODZA 1ISVA 3AHZA 2XGZA 5CC6A 3PNZA 4IMGA 4O15A 1UC5A 3B0XA 4E5TA 1G9HA 2VCBA 1CECA 1CCWB 2FH6A 2Z25A 7ODCA 1KGXA 3LA4A 2YCLA 2E6AA 4IFOA 4FR6A 2Z4GA 4UWMA 1R6WA 1RJRA 2JKAA 1US0A 4C6BA 2EAWA 4OUIA 3E6EA 2J7GA 4R33A 2OSYA 4V28A 1RALA 4J3WA 4DJEC 2YA2A 1V3LA 2G3IA 1SZRA 3CUFA 4GQRA 3PFRA 2DZAA 1Q3NA 3JZUA 4K38A 4XK2A 2RGLA 4QLKA 2YJQA 5CXPA 1VFOA 1U5VA 5M17A 1QWKA 2PTDA 1GQJA 2EPKX 3HG5A 4L61A 2YX0A 3MW7A 2LLEA 3BV7A 3H6OA 3VKJA 3TXZA 3A22A 4REQA 2FVKA 3LCFA 2DVUA 4ZTYA 1V6XA 5D2VA 2QCNA 5CLWA 5AC7A 3VOGA 4FB7A 1V0KA 2BB0A 4GO8A 5HNUA 3W01A 3VGGA 5LNSA 4HNTA 4LNYA 4GCXA 4JQ2A 1KBLA 1LDCA 1A5NC 4B4HA 3NDOA 4YWIA 3ABOA 3CTTA 2CHOA 4URIA 4Q8TA 1JD7A 4JDYA 3RCMA 3UR2A 3L23A 2WNQA 1VR6A 4H9YA 1OT1A 4HYRA 1FTXA 3K4AA 2D69A 2XG9A 4C1KA 4D1IA 1A5LC 3KLKA 2WHLA 3SY8A 2ZX6A 4C6JA 1ZENA 3JR2A 4RV8A 2YDAA 4QJ4B 3M6DA 1RLCL 2XVNA 4KGJA 3PUDA 1E4NA 5I3KA 5I09A 1QNQA 2PZ0A 1TWDA 1JFHA 4DBWA 3P8JA 4EACA 3LG3A 1T40A 4GUHA 3BGJA 2IS7A 4HU3A 1GVEA 4OZOA 4C5ZA 3VD4A 1JXKA 1JZ6A 2C71A 4N9EA 2POTA 5E70A 3HV8A 5CJ5A 3TJLA 3EGJA 4P7LA 1JDAA 4ONVA 2V5CA 4FX8A 3B8SA 4M7TA 5I07A 5CG0A 2VCAA 3VGFA 5BU6A 2TAAA 2W9MA 3SUSA 1OG0A 4AZ7A 2FKPA 4NJKA 4BQ5A 1VGAA 4MLRA 1MXSA 1TPH1 2RDUA 4GACA 3L4VA 4K8HA 3UJSA 3RRAA 2XISA 1TVPA 3IK4A 3A4WA 3DDMA 4PC8A 1HQTA 5C7HA 2D2HA 1JRBA 4P8UA 1LUCB 4J40A 4IP4A 3GAYA 3CUXA 5HNNA 4LV9A 5G2WA 1LG2A 2WV8A 1WB0A 3MMTA 4QDWA 3I7RA 4O10A 3PBMA 1VCFA 2NLIA 1XX1A 5T26A 1JPMA 3NQCA 3FSUA 2NUWA 1H61A 4ZGYA 4O17A 3SDOA 4DZIA 4CQ9A 2WC4A 1ZAJA 4GYPA 5LHFA 4GZEA 2OZTA 3TYAA 1QRQA 3PZMA 1E6ZA 3V16A 3BQ6A 3KOYA 2NUYA 4J3VA 2Y8KA 3W1MA 3WQ6A 1J6PA 3NVTA 3QMSA 3QBUA 5JH1A 3G1VA 5T9CE 2PRLA 1JI1A 3BURA 3EXRA 4PSRA 5LNUA 3R8GA 3TOPA 4PUEA 1J0HA 1EA0A 1PZ3A 3I7QA 4TOQA 1HXJA 1DJXA 3W2MA 1XF0A 4FEZA 2PU0A 5D2TA 4LRSA 2DIEA 3TCSA 3CQIA 3WFLA 2QVHA 4M51A 3TC3A 4MWAD 3F4WA 1MWOA 1XH0A 3RX4A 1UR8A 3NOEA 3A21A 1SU5A 2WNNA 4RDVA 4R53A 1F4AA 3KX6A 3XIMA 1HVQA 1VEOA 3IUIA 1R9YA 3O16A 2ZC8A 3FEMA 3D0CA 2ZRVA 2REQB 2PB1A 4LY8A 1ZBKA 1V6YA 3W7QA 1GJPA 1UD4A 1TPVA 4YTQA 4H7CA 2GWNA 1UWIA 3HV9A 3E49A 2D0HA 2E8YA 2CIPA 3TYUA 3H70A 5BXPA 3IJIA 1OCJA 3RG6A 4YLWA 3FOKA 2WOQA 4TXEA 3HQ1A 4CU6A 3PJUA 1W8SA 2PBGA 3GWQA 2WZIA 5AFDA 1UWAA 2JBMA 4O8AA 2V63A 5HWJA 2FTYA 5I23A 2CZVA 3NXLA 1VIWA 2PWHA 1M7XA 1FWRA 1YDYA 1MVYA 5BOOA 4O1CA 3AICA 4N6EA 1BSLA 2QPUA 4M5PA 5CSYA 4HPHA 2YB1A 4W5ZA 1JFXA 4UTUA 1LOSA 2R14A 1JDEA 1XRVA 2W63A 1DJHA 4AZGA 1XG3A 4L4MA 2YR1A 1ALDA 1H51A 2PDFA 1FWAC 1K7FA 1W2VA 1AVAA 3L2IA 4QLJA 3IARA 4RR4A 5H8PA 2QCDA 2YCLB 1QJWA 3N34A 4OECA 4YTUA 1FFQA 3F03K 1EYEA 2QJJA 3UNTA 4GOAA 4X0NA 2HROA 1O5RA 5JU6A 4E8CA 1JAEA 3ANYA 1TTIA 3ZWTA 1ZBVA 4MHBA 3CASA 4AX7A 4AIBA 3WX7A 1H62A 4Z08A 4DBDA 3C2FA 3UNDA 3UETA 3VIKA 3VI2A 1PV8A 3BLKA 2Q3RA 1OFBA 1A50A 4C6PA 3NDYA 4W8LA 3ZZ1A 4MFEA 1LROA 2EPMX 5D2XA 3KOZA 3I6TA 5HDRA 1I1WA 1GKRA 3HGRA 1OX4A 1XLKA 4QE5A 2WKLA 5REQA 4LAUA 3H54A 4B2DD 3EBVA 2JGYA 4S3AA 3LXCA 4EOUA 3ZT5A 4RX0A 3O1NA 5FOOA 1TSIA 2DZXA 2QMKA 3WY1A 1L2UA 3TV8A 2R6OA 4UTJA 3B8DA 4YHGA 5A2AA 3MVTA 4LBSA 4DPQA 3MV01 4L6OA 4BS0A 1TTPA 5CZKA 4D6GA 3UBPC 4ICNA 3A47A 4HZ6A 1UPPA 2ANUA 2HTMA 3BLOA 1REQB 2CESA 3C3UA 1OD0A 1QW8A 3NTYA 3QTPA 4GGHA 3VD7A 1ADDA 4H6QA 1VJIA 4EX4A 5FAGA 1UD6A 4AD4A 2FIQA 1O95A 2V9DA 3P5ZA 2WZMA 2HZGA 1CXIA 1K03A 4GQGA 4E4PA 4KF1A 2ZX8A 5C6MA 2XZ9A 5F4XA 3L68A 4LCQA 4NAFA 4MZ1A 1QNPA 4JTGA 2YYUA 3FV9A 1B3WA 4ZQMA 4WRHA 3VM7A 5HUOA 4UTTC 1PWLA 3NSMA 2UY2A 4GIRA 3G77A 1D7KA 4MMWA 3NR0A 5A3HA 4J3XA 3N2CA 3NGFA 4V1YA 3BANA 2J8GA 2YDRA 2X0HA 1LL4A 2DSWA 2GQ9A 4RDYA 1UR3M 3O0FA 1ZALA 1S2TA 4HOZA 5MKGA 3PUEA 5CQ1A 2IKIA 5TBOA 4J7RA 1TV4A 5IRPA 2YW4A 4PMOA 1B31A 1XHGA 3R2GA 4B90A 3G1HA 1G7UA 2ACUA 1MI3A 1GONA 3UU0A 1Q2RA 4MNLA 1SSGA 3RU8X 3TFXA 2V82A 5C0QA 4Z1DA 5HMSA 2QGHA 3VDBA 2CFFA 4QEHA 4AYGA 1CZ1A 4IG2B 4KFNA 2E5BA 1AQMA 3UZXA 4C1NA 4MJ2A 3NUKA 1UKQA 3S9YA 1VQTA 2HCVA 3KCLA 1GK8A 1UA7A 1IEWA 3LLXA 1D8CA 3BSGA 3N2OA 1DIOA 2RKXA 3UCQA 4AC7C 4LNCA 3PULA 4JNZA 1XIGA 1XICA 1ZTVA 2DJLA 3T44A 3PVFA 3UZYA 1PTAA 2E6YA 1XRSA 8XIMA 3AMLA 4RCXA 2YCEA 2IKJA 1F9CA 4NNAA 3S6TA 2VMFA 1QW9A 2NQJA 4QE4A 4ZO6A 2FQIA 4DXVA 3GG8A 2W92A 3L4TA 2PRMA 1XLIA 2R1MA 4KGLA 1TMLA 3CZ8A 1H5YA 3B9DA 1OFRA 2BBFA 1JGMA 3Q94A 3OHMB 3MUIA 1M53A 1GKPA 3RM9A 2CBVA 5CSUA 4UZSA 2VO5A 3HN3A 2Z2UA 3W7OA 5DBUA 3R89A 3L5MA 1BRLA 3WK3A 3OQEA 6REQB 1KM2A 3GSMA 1ODUA 4RE3A 3LBCA 4C6KA 1LZOA 4NYUA 3EEGA 4FR1A 4BZYA 1FXQA 1V77A 1LWIA 5F2MA 4ATWA 4LQ1A 3AZTA 1WDSA 3QH2A 2VELA 1EXBA 1S2WA 1XLDA 1XPYA 4IIBA 1JDDA 5JUVA 4S3GA 3D47A 4J27A 1S38A 3F4CA 2BHYA 3VNKA 1JGIA 3DCPA 4HU0A 1R7OA 4RUBA 1QPQA 3P74A 1RD6A 2VDIA 3DECA 4GINA 3PTKA 1ME8A 4IMDA 4IIGA 1IF2A 5I02A 1KCKA 4A05A 5BXTA 4A3QA 3LERA 1JD9A 3C0JA 1H5VA 3I65A 5DT5A 2TYSA 4WXZA 2NQ9A 2C6QA 4CCEA 4QEEA 1A53A 2EG6A 1BXCA 1W1YA 3ANUA 4O16A 5I2UA 3LCWA 1RVGA 2PTXA 1UP2A 2QCDB 4KIEA 3TFCA 3THQA 3VINA 1GJWA 1K6WA 4UR9A 4QFUA 2Q71A 4H3DA 1XSKA 1PTDA 3DI1A 3PY2A 2JF6A 4FPSA 3OYZA 2OX4A 2C7FA 1V6VA 4NZ4A 2YGYA 1EC9A 1HW6A 1AMYA 1R47A 3SQSA 1UUQA 4QDPA 1N8IA 3WBEA 1O1HA 1K9EA 4WK9A 2XVGA 2F6XA 4YWSA 2BHZA 4GQBA 4HMDA 4DELA 2BGNE 3ITTA 4GVGA 4OUEA 4XD4A 1JZ7A 1KFCA 4S38A 3G3DA 1IT8A 1DVJA 3R6IA 1F3XA 1I9CB 2BNJA 4XTDA 3SRFA 1H0GA 1PS9A 1ZGDA 2OODA 3UYIA 1XLFA 3VA8A 5REQB 5JH2A 1X7FA 3MCNA 2BVWA 3KBJA 4P5UA 1W9BM 2OVLA 4NZJA 5LXXA 4H6EA 3W81A 2WCGA 3LCHA 4NXSA 1BXNA 1J5SA 3RX3A 1FKWA 3BC9A 4O54A 3GK0A 1XYAA 1YTDA 1V6WA 2NXHA 4F0RA 1V93A 3MQTA 1VHNA 4PYSA 1PB0A 4FSAA 4DWSD 5C9XA 2OU4A 2C91A 4YTSA 3IACA 1W3LA 5AHLA 3AMKA 3TSDA 3U2EA 3REQA 2ZUSA 3DFSA 2E0PA 5K9DA 3KZSA 4I6KA 1HGWA 1AA1B 3RR4A 4B16A 1QW7A 5A6AA 3S5SA 2J7CA 4XG1A 2XM2A 1KWKA 4D6IA 2QR6A 4OVXA 1EZWA 1ME9A 3ARZA 1UPMB 3GNDA 4X63A 4ML9A 6ALDA 5DMMA 4IJRA 3QVQA 2GSJA 3R58A 4ZXLA 1NQ6A 1W5NA 1W0MA 2X16A 1MDLA 1W9DM 3S6DA 3LD5A 5AYZA 4F66A 1ICSA 4WGXA 3W7NA 2J6VA 5E09A 3EA3A 4KEVA 5AC5A 1A5CA 1XLLA 3Q67A 4K1WA 2AMXA 1G67A 5XINA 2V3DA 1IE7C 1TRIA 1FWHC 3SB0A 3KFTA 3NZ1A 3TC7A 3TVAA 4D1JA 3DGBA 1BGGA 1UZ4A 3SEPA 4QS5A 3F5LA 5MKGB 5CG7A 3WNOA 4AISA 4JTRA 1QNSA 1XC4A 3P0XA 4ZB2A 9XIMA 3QRHA 3G5EA 2YKKA 3NO3A 3P81A 1H1ZA 1LL6A 5EMLA 1BAGA 1VH7A 5G2HA 3Q37A 2OQLA 1AJ0A 4CNNA 3CHCA 3GIYA 3C86A 1ITXA 3ABRA 3OODA 2Y8UA 1TE1A 1QNOA 3G1YA 4C1NB 3WBYA 5I5RA 1B3YA 2CC0A 3GG7A 2NQLA 2Z2AA 3R10A 4JTUA 1XGDA 4DQWA 1U2YA 3EA1A 1S2VA 2Y24A 1BG9A 3ARTA 2B4GA 1SW3A 4O14A 3NGJA 3S1WA 3AJ7A 5EPDA 3W7KA 4LVBA 2E6DA 2QYGA 2ZVRA 3PB0A 3SCSA 4OKDA 4O11A 3VDHA 3WF3A 1A3WA 1SFJA 3NM3A 3H2OA 3R11A 2XSXA 1NWUA 3WLSA 2A6NA 1RH9A 5E0CA 2IPJA 1OX5A 1PEZA 1RBOB 4IFKA 3W7EA 1H7WA 2VURA 3TQ0A 3CM4A 1FWSA 3CQ0A 1E15A 3S9IA 1PDZA 5HMFA 4WVXA 3MU7A 3BAKA 4QSFA 3LOTA 5HJLA 4PTMA 3H2NA 3W37A 3OLEA 1SJBA 2XUCA 3CZJA 3VCNA 1TKKA 1TWIA 3UXAA 3PTDA 3ARYA 2CZFA 3HBLA 3M0LA 3M41A 1XLHA 1VCGA 2VGIA 4GBDA 1US2A 2HS6A 2I7GA 3OPSA 3TROA 4JTIA 2FDMA 5BYWA 1HX0A 1UHVA 4AAJA 4KWUA 4KRUA 4LT9A 1S5MA 4JGDA 4NNBA 3SSJA 3M0XA 2YL9A 1E6XM 4XO7A 1HVXA 1NWRA 1BVWA 1CX9A 2BP1A 5KETA 1V4YA 1IXQA 3A3XA 3BMWA 3MHUA 2DDXA 3N04A 4HKPA 4UCGA 1EJSC 3JRKA 2PDJA 3KUMA 3E96A 4ATDA 3MBDA 4IMEA 4HNNA 1WAUA 4JFWA 2PMQA 1CLXA 2QUTA 3WJZA 4UCFA 3O63A 3B0UX 4UNKA 4K39A 2PLJA 1B4EA 4JKMA 2ZRXA 4IUGA 1VFUA 1DJGA 3T2PA 5C8BB 1P6WA 3VKKA 1T99A 4U5KA 1M68A 3FK4A 1TE6A 3JUGA 1R3TA 4XAYA 4EE9A 4HIBA 3PANA 2D20A 2HNHA 2KX9A 5CKSA 3QLLA 1HTIA 1SSDA 3UZJA 3U2ZA 2W27A 4HZ7A 4OV9A 1V8EA 3UR8A 1F6PA 2R1PA 3GDTA 3VZXA 3GG0A 2ZE3A 4JTJA 4WDXA 3TTOA 3GXNA 4JS3A 2PCQA 1M9HA 3TA9A 1JYWA 4PMQA 2J4GA 4Q4KA 1TWWA 1VFMA 3GVRA 2QPSA 4JQAA 5C9RA 1NIUA 5A2BA 4JTDA 4Q8PA 4US5A 2WMGA 3QV6A 1JF6A 3W2UA 1OB0A 4ZSTA 4E38A 5U4NA 3TWBA 1JAKA 3NSNA 5I77A 5GQBA 1BG4A 4JAWA 3SCRA 1V3KA 2O4MA 4A3RA 5T91A 1PVNA 3W2KA 2ZX9A 3ZO9A 4PULA 2BMBA 1B4KA 2QUMA 2IPWA 2IUZA 1CYGA 3NL3A 3BV4A 1CW2A 3G1RA 1VFTA 2WW5A 3M0YA 1PKMA 4DNHA 5A94A 1LT8A 2DFAA 3FN9A 4GI9A 4J2MA 1W54A 3D46A 3N3MA 3ARVA 3UG5A 1NDYA 1CGYA 3LCLA 2XH0A 4FOJA 2AAAA 3SW6A 3TQVA 4HT3A 4ML4A 3AIVA 3QZAA 1KFBA 2HVOA 4DJFC 1C8XA 1F61A 4RZBA 4LWWA 4Z1AA 3BXWA 3CPRA 4XAFA 1DYSA 4QDMA 3REQB 2B7PA 4HHPA 2MUCA 3AXKA 3T4WA 3LXAA 1NH6A 2PDCA 3EPNA 1OEPA 1TJ0A 2VVSA 1QT1A 1QO2A 3O3RA 3UA3A 3ICJA 3VIIA 1GZJA 2I14A 4DF0A 3L5LA 3V1HA 2J6XA 5G4EA 4HZMA 3G18A 4UMBA 1YTEA 1MFVA 3SUWA 3RXZA 1SO3A 1G5AA 3F5KA 1RHCA 5CCZA 3AXMA 1CTNA 3OP2A 4EF9A 1EGVA 3MVIA 4H9UA 3MWAA 1UKOA 4FXRA 2D73A 4CD5A 4ZMGA 2G41A 1YXYA 3NQBA 2GUYA 4HTYA 5F7UA 4WUIA 1OIFA 1JPKA 1Y5WA 5T9BG 2V38A 1DWHM 3EMQA 1VZWA 4HMCA 3WJYA 3MMUA 5I03A 1LBLA 2FDSA 1WCGA 2GUBA 3B8VA 4XWUA 4U2ZA 3DFTA 3W7LA 4WJ8A 1P43A 4LOCA 2FGZA 1RPKA 4LUJA 5LA2A 1IXPA 1AW5A 2V3GA 1AZ1A 3TJXA 1G4PA 1GGOA 2WSRA 2FPTA 4P7QA 4Q8VA 3ME3A 3UD6A 1BWLA 5H1WA 1XM3A 5D2WA 1K6AA 2ZCGA 4INFA 2A79A 1ISXA 1EH9A 3QHMA 1JCYA 2O0TA 1EIXA 1WPCA 1TVLA 2ACSA 3R5EA 3MANA 4O52A 2ISDA 5FEPA 1W1PA 4ACZA 4MUPA 4CCCA 1CWYA 2VD9A 2RUSA 4G7EA 3P3BA 3STCA 1V7YA 4P8XA 3G8EA 4O4VA 4U5IA 5PTDA 3LGGA 5K9CA 4IF2A 3OGRA 3EWBX 3JS3A 1RY0A 1FHUA 1XIMA 4WJXA 1LJYA 1Y65A 4RKAA 3LQGA 1TPFA 1C8QA 3W7HA 2DW6A 2PLKA 5CBIA 2OWCA 3N2TA 1PE1A 2VC9A 1RP9A 4R7JA 3BTNA 1E40A 3TYBA 3LLDA 2PP1A 5KZ6A 1Z8AA 4CUCA 3O06A 2G8ZA 4EXQA 4UFIA 5AHFA 1XP3A 4ASTA 2PDNA 1XFBA 4Y9NA 1RQEA 3GAKA 3NQ7A 4LCSA 1XLMA 4P7OA 1IXOA 4US5D 3S5NA 2PDXA 4MB5A 4KESA 4IFKB 4UTMA 4L9ZA 2Y7FA 2BASA 5EBUA 3R12A 1H7RA 2DEPA 3H2AA 1PX4A 1EIBA 3TE9A 2YFNA 4XZLX 2F9RA 2PUZA 4S1FA 4S3CA 1BFNA 1VFHA 4Q7NA 3F2BA 2Y8VA 4PEEA 1TX0A 3M0HA 4DLFA 2WPGA 3W9ZA 1KQYA 2Z00A 1ONXA 2WNWA 1ISYA 4B5WA 2F2KA 3HG3A 3C2EA 3T7VA 3P60A 2CYGA 4MG4A 3SCNA 3UY8A 4QTGA 3ZFHA 1KTBA 1Q6RA 4WSHA 2WSPA 4WLCA 2ZZ2A 5H2ZA 2EGZA 4XKYB 3BUVA 1OQFA 4F2UA 4O1EA 1XUUA 3W74A 4KKXA 1ELSA 3GR4A 4R88A 3STFA 3NG3A 1YIXA 3SFWA 4MIMA 2PDMA 1S2UA 4XIMA 4V1XA 4W5UA 4JIQA 1IIGA 8RUCA 4CGTA 1QTWA 3U5UA 4XQ6A 1E0TA 4XB3A 3C0QA 3QV9A 2CZDA 3BGGA 4AD0A 2VI0A 3EXSA 4FNSA 4LALA 4I9AA 3IJ6A 3I68A 1ZS2A 2QIIA 1NELA 4BKNA 1CXHA 4DXXA 1UH4A 5I0DA 4GE8A 2EKCA 1VFSA 3Q2DA 1EOKA 4Y96A 2F7FA 2PPGA 1FWCC 5AN7A 3E2SA 2XU2A 3PZOA 3M5YA 2GLKA 4Z0SA 2OEMA 1UR4A 4HQVA 3B8TA 3UZWA 2W67A 1BTMA 3UPWA 3DAQA 2AGTA 2WPBA 4ZENA 4X9YA 3FYYA 3IANA 1Z48A 3LMZA 2D24A 3GD6A 3T1GA 1XI3A 4LU0A 2W3ZA 5XIAA 4IQJA 3OLGA 4NZCA 1G01A 1UKPA 1SO5A 3W82A 4IFRA 2ZUTA 3IIVA 1SJCA 3SQMA 5J5DA 4PH6A 3TTYA 1UQYA 1BQCA 3WDHA 4GUGA 4HD5A 3W7IA 4GVIA 2IXVA 4PMZA 1JRCA 1J4EA 1VKFA 2J9XA 1SW0A 2IQ0A 5KINA 2A7RA 1X97A 2DU2A 5D03A 4DJDA 2WVUA 3KM8A 3MWCA 1E5JA 3OTRA 3CXOA 1W1IE 2ZA1A 4FNRA 4AZHA 1CLKA 2A3AA 2JF7A 1EJ7L 3D6NA 3VX0A 3ZLGA 3ZSSA 3CZKA 3MSYA 1FDYA 3P14A 3FVMA 4AZCB 4WY0B 1F7BA 5AKQA 2D0FA 3A3HA 4BI6A 1Y5VA 1XIIA 2I1OA 4H8VA 1I2NA 4AF0B 3S5YA 2YYTA 1W3KA 3N9SA 5IDZA 2V67A 2QJGA 1MFUA 3QEZA 3CB8A 3FDKA 4D72A 1AK5A 4I8YA 5DQPA 3T07A 3B03A 1P5BA 5AOUA 4GO9A 5A6TC 4DO7A 4MWAE 1FP9A 4N4QA 4XV0A 3UWYA 4LEQA 3W6MA 1J0KA 3N19B 4I3GA 1P1MA 4G7FA 4R34A 1R7AA 2IQTA 2QS8A 4OTKA 1TQJA 3RPMA 3CLMA 4LUTA 1OD8A 3S9ZA 3CAKA 3S1XA 4K8GA 1XIFA 5K4ZA 2PTYA 2QUVA 2P5NA 1WZLA 4JTEA 2XJ7A 4J2PA 3IIOA 5GNYA 3W1TA 1KRBC 4WDWA 1H1YA 3OHIA 4XAGA 4JTTA 3IJ8A 4ZE4A 2DZUA 3SBFA 3WLNA 3N6QA 1Q6CA 3S1GA 4NJIA 1RCQA 4ZBCA 1D9EA 5CPLA 2O9OA 1YXCA 5TNVA 2CBJA 2D2JA 1QNRA 4QJ1A 3NEVA 2QEZA 2ZWYA 3B9NA 1Q7MA 3B97A 3PC0A 2CZ5A 4BWLA 4X22A 3O0KA 3OGVA 2GQ8A 4G7EB 2WSKA 3CS2A 3VYLA 1E6QM 4TVCA 3BG3A 3QJAA 3GXFA 3H26A 2VQUA 1Q8AA 2NXGA 3F2CA 1CPUA 1JYNA 3AO0A 1N55A 4HPXA 4HOWA 2OWWA 3V1PA 4WDTA 4BQ2A 4M6VA 1XDMA 1SO4A 4Z2IA 3GXMA 3PSWA 1H4PA 1WDRA 1Z42A 3BLPX 5H8UA 5BROA 1ZP3A 4DN1A 4GK8A 2UBPC 5HPOA 2QW5A 1R0MA 4NZ5A 3MDWA 3NQEA 3GFXA 1TCMA 4Q6XA 3TN5A 2POZA 4FO4A 5AY7A 3UPBA 3LTSA 4NZ3A 2GDUA 1FKXA 4PB4A 4JFUA 4LH8A 4TR9A 3QF0A 1UWQA 3AALA 3YPIA 2J62A 3U4AA 4MY8A 5A8GA 5BRPA 4AXKA 1F4HA 1XKYA 1E6SM 4XZIA 4Q8WA 3EOSA 4TTGA 2X7WA 3MI2A 2YPIA 3ZR5A 5ECVA 2ZTKA 1TV5A 1WUEA 1JNDA 3C2VA 3QV7A 3R4IA 2R24A 1TPUA 2G3FA 4LRTA 3E2QA 2XN2A 4XISA 5I6SA 1F6KA 3WD0A 1L2QA 3TSMA 1TMHA 4ZSUA 2PLMA 2DGAA 2P10A 1GVOA 3EAUA 2JKEA 4IHCA 4QROA 3W87A 1TJ2A 2BGQA 5FF2A 3SAZA 3W1LA 4F40A 5FJTA 2I9EA 1FCBA 2C16A 4YU1A 1OWQA 1XS2A 3ITOA 5HMEA 2ZX5A 3ZT6A 1WAWA 2DW7A 4Q4RA 2ACQA 5A69A 1GQLA 3NL6A 3LCXA 1KO0A 3WNPA 1PZ2A 1R3WA 2A3BA 1KKOA 2WK2A 1XRTA 4G2DA 4PSPA 3P8IA 1RBAA 3AOFA 1DWGM 2EBNA 1YNPA 1YDOA 3IK2A 2R9RA 3TOYA 3KL5A 3M1ZA 2HVMA 3TYDA 3EZ4A 3ARSA 5E6YA 5CZ0A 4S23A 4DYEA 3UA4A 1RJQA 4H9MA 3S2CA 3H4GA 2XM1A 3TJIA 4AU0A 2X8RA 1Z89A 3W3OA 5C9ZA 3CUHA 1KQZA 4E3VA 3MSGA 4UMAA 4CD7A 4XD5A 1FBAA 2CBUA 2PP3A 3M9YA 4UR8A 3MT1A 4MVAA 1XISA 2BFGA 3HO8A 1KRAC 4GWEA 5M03A 1TJ1A 1LRQA 3QGVA 3QHOA 5IBXC 4JFTA 3A23A 4LC8A 2XFRA 4ZFMA 3ZXWA 2QCFA 5EMMA 4FOKA 5DX7A 3AYVA 4L64A 1LCOA 1DXEA 5RUBA 5EA9A 3CMGA 1HO4A 1V0LA 1AQHA 2OLHA 1KTNA 3UZ5A 3KWXA 4C1LA 1GOMA 4I5XA 1FWBC 4EPDC 1GQNA 2UY3A 1HN1A 1XFCA 1W1A1 4HOXA 4IPLA 3B0PA 1UCWA 3MYPA 3CAQA 4F0LA 3WK2A 4WDUA 4J3ZA 3GHUA 3FGCA 4IXHA 4OHQA 2ZUWA 3DYPA 3WF0A 2XN1A 1JPHA 5IFTA 2P3EA 3RJYA 1AD1A 3GS6A 2Y5JA 4X9SA 1IZKA 5C71A 1J18A 1NM9A 3ZVHA 2DT2A 3LCIA 1O5KA 2PWVA 3FS2A 3U6WA 4ZL1A 4MLJA 2CCRA 5DANA 2HV5A 5FJPA 4P8VA 4KERA 3C4UA 4L4LA 3M0KA 4UB9A 5FEXA 4DNMA 1OF8A 4H83A 6TIMA 2P0IA 3EOEA 3PZNA 4D8LA 4PCPA 4QHRA 3GH5A 1EWEA 3A12A 2PD9A 1Q8JA 4C60A 1K8YA 4NSBA 2A5HA 3NM1A 4M3PA 3CIWA 2E4TA 3USZA 4AW7A 1ZCOA 4RXFA 1KCLA 4V33A 1ZQ5A 3B9AA 3NQMA 2PTWA 5ABHA 2O55A 2OT0A 3VIPA 2XIJA 4U28A 1TV2A 1JNEA 5E0FA 4KWSA 4ZE5A 1OVDA 3STGA 3ZJ8A 1B3ZA 1K9TA 1BXBA 1S5NA 4D6HA 2BWGA 1TUFA 2Y85A 4C7FA 2CZEA 3WENA 4LUTB 1LQ0A 1WDPA 4JTCA 2WMHA 2VFGA 3QGAC 2YIHA 3A13A 1XYZA 3G6MA 4JDBA 4TX6A 1CI1A 1WBHA 1MQPA 4PL2A 1XIHA 1WDDA 1E9LA 2OQHA 3SECA 2ATSA 1WXYA 5LGZA 2FZBA 1GYNA 2PFHA 1MEWA 1DQUA 4NI8A 1TV7A 1I60A 1E9IA 4AWTA 2CLKA 4JYDA 5D37A 3T4CA 1PPIA 4PODA 4K36A 5I3HA 4XBSA 4GC3A 3LRKA 4IIFA 1W1ZA 1UYQA 3CMFA 4PRWA 3WJSA 1QAPA 2DT1A 2DSKA 3TXVA 4J28A 2O7SA 3NO1A 5IOBA 5J04A 2FB3A 2VYOA 4Z2GA 1DQWA 3QV8A 3LY0A 3LPPA 4IT1A 2XGBA 3OJGA 2WHMA 4Z2KA 3U2OA 4HN4A 4OBRA 1H09A 3HFYA 2GVEA 3FA4A 5AYIA 5EMJA 2V0TA 4L5ZA 1DWIM 1AMKA 3GW3A 4CD6A 3GTHA 2RJHA 4IMAA 2VFFA 4UUIA 2E67A 2G96A 2J75A 5HBFA 4WR3A 1B0IA 4WQ6A 3GYCA 4MAVA 3GVQA 4I8DA 1VP5A 1Z41A 1GVFA 1TV3A 3K8LA 1SZEA 2FVMA 2VTFA 5HR7A 1KXTA 1GOWA 1SQ7A 5FESA 1PCWA 1EQPA 1KNWA 1B54A 3NQVA 2BOEX 3FEQA 4MKSA 4JIPA 4CKQA 3ARXA 1X8FA 1OBAA 3GKAA 3R0DA 3PTQA 5A8MA 5BWFA 4LBRA 3LGDA 4JN8A 1IQ8A 1L8NA 2VOTA 3WH7A 4J5NA 4NILA 3OVRA 1VBUA 3KBSA 4H1ZA 2XFWA 5D33A 3PG8A 2A7NA 3VNMA 2Y7GA 1QI0A 1JIBA 3CUIA 5K2ZA 2ACRA 3HQOA 1AUSL 4DUVA 2ZTJA 4WKHA 1HG3A 4MNKA 1Q6GA 2MNRA 1WYIA 2NQZA 3WDIA 3ZIZA 1E0UA 1PBGA 4JL1A 1QPOA 2PDKA 4HSHA 4LF2A 4UFJA 1BWVA 4NT0A 1R3SA 4QX4A 1GHRA 3L0NA 3C52A 4OE7A 3WLHA 1IGSA 3TR2A 3NYDA 4IPNB 2DV0A 1ME7A 1LQ2A 4CU8A 1WKFA 5U7SA 1N8FA 1SVDA 2X42A 3P61A 3QZEA 5FF7A 4JQ3A 2YDQA 1A47A 3LHVA 3TZNA 3P82A 3N2BA 5DRCA 2C1HA 3EB4A 1E0WA 2R1LA 4KCVA 2VX7A 4Q4SA 4GYPC 3CPGA 5H6HA 2ZA3A 1UR1A 3RLVA 2ZUMA 2X40A 2J7EA 3A6OA 1TPWA 5LIXX 2DIJA 2YLAA 1A3XA 1DE6A 1X1ZA 5ABEA 3BW3A 4BEQA 3ALFA 4O50A 4GJIA 1JZ3A 3N73A 4A8NA 3B05A 1MXDA 5M1TA 2ODOA 3GNRA 7TIMA 1WO2A 4W8BA 3S4TA 1XGEA 3TN6A 1EF2A 1FHDA 3LRMA 4GVHA 1HZYA 1HKMA 2ZICA 4UR7A 1M41A 2YOCA 4EP8C 2CWXA 1AW2A 4QM1A 1R3QA 4BR1A 5GNZA 5D2YA 1Z69A 2H3DA 4ZODA 1HKJA 4IPIA 3ZJ7A 3VOFA 5F2GA 4RNJA 2HEJA 2OZ3A 1IHIA 1AH4A 2QDDA 4E2DA 3EX3A 3ABXA 3VDAA 2YSWA 3R8HA 2BS9A 5TD4A 1XGZA 3SCOA 2V68A 1K7EA 1V6TA 4H7ZA 3HZ3A 2JGQA 3VFCA 3FGCB 4IGSA 5I3IA 3BE7A 4A8LA 4IUOA 2XWDA 3Q4DA 4U10A 3S5OA 1PX8A 1A5AA 1F05A 4DUWA 3ZVHB 4OIFA 3S42A 4HGXA 3THUA 1UD2A 1TX2A 4LYRA 3PK7A 3O8AA 1IR1A 4FLSA 2E8ZA 3AS2A 1K4GA 4GI8A 3T8LA 2HMCA 4GGBA 3MKCA 2DPEA 3N3TA 4L80A 5DN1A 4FLRA 3QMRA 4JY9A 1EL3A 4NG3A 1FWWA 4MY9A 2OG9A 3HF3A 1RBLA 1PX3A 4G1KA 5A6BA 3K1DA 1UWUA 1XSJA 1MUWA 5HK4A 4TX8A 2PURA 4HA3A 3NZGA 3C2OA 1EUNA 3LQLA 2EPOA 3WL0A 1OC5A 3B4UA 4NL1A 2C3ZA 3NL2A 4DB7A 1O5XA 1C90A 2WJDA 3M6YA 3QPEA 3DESA 1VBJA 3WEZA 2CLLA 3S1UA 2GPTA 1ZLPA 3KAOA 3BG9A 1P1XA 3HQPA 4U3CA 2PWGA 2CLMA 1V79A 3NFUA 4LXFA 1DWFM 2GVLA 4JQ4A 3RRXA 4GY0A 3C8FA 5DRIA 2G3JA 4E4FA 2NWSA 3UQNA 5MF5A 1FH8A 3BJSA 4GC4A 5BRBA 3GU2A 1OYCA 3MUXA 4Y8EA 3SADA 4DAFA 5A8OA 3W02A 1MEHA 2CPUA 3VO0A 3AXIA 1MYRA 3SGGA 3M5VA 3FJ6A 3VGHA 2VC6A 2FPYA 4BJHA 3RNDA 4JTHA 1LYXA 2YCJA 2PD5A 1A3HA 4AVFA 3BAIA 3GR7A 1XLBA 4M0XA 4LVDA 1QPKA 3TONA 3W76A 2XWEA 4WX2A 4BY3A 5EFFA 4M81A 4XUGA 3UXLA 1H50A 2BG5A 3KXQA 3TX9A 1TCDA 5LYRA 3R7MA 1PAMA 4TMBA 1ITQA 3WF2A 2OOGA 3E3HA 2RDXA 5FL0A 2DJXA 3QR1A 3WG6A 1UUOA 2IPFA 3TJ4A 2QCHA 3VUPA 3FAXA 1Q45A 1OK4A 1Z9AA 2GGIA 2J7FA 5D04C 2F84A 3R13A 1YLVA 4N9BA 1JJKA 2NWRA 1EYWA 1QO5A 4LF1A 4PUMA 3RO6A 4TV6A 1JULA 2NT1A 5CGQA 3WEMA 1LUCA 3H2MA 1L6YA 1QUMA 2VZOA 3AJXA 3DYOA 5I3JA 1W9XA 2OO6A 4YL2A 3VKCA 3H7UA 2GJPA 4QE1A 3UG3A 4RL3A 2PWFA 2BXYA 3NO5A 1VC4A 1JQVA 4O18A 3OBKA 1FRBA 3T42A 3STEA 3GBDA 2CXGA 2V2CA 2VWTA 5ABGA 1NF7A 2DORA 3U0HA 3D3AA 1OK6A 4BCEA 3CQHA 1OF6A 3A3WA 1TV8A 4JR5A 2A2IA 1GJUA 1HP5A 4CD8A 3QZ6A 4E8GA 4OFCA 2X1UA 1VF8A 1C92A 1O94A 2J9YA 4O13A 3A9BA 2QAPA 3QW4B 1K4HA 2A4AA 3MMDA 4EIVA 1L9WA 4ROPA 3BQ5A 1KB3A 1X98A 3MSRA 1J9YA 1L6GA 3H7VA 4LB3A 2AMGA 3NIYA 3TUUA 3NPWA 4XIAA 4CQBA 3C2RA 2OFJA 3G0UA 3ZT7A 5F4SA 5KZEA 1B1YA 1VEMA 4Y6GA 4LYQA 3AS0A 2ZQ0A 4LVFA 4JN7A 1LQAA 8A3HA 5XIMA 3HIJA 1G1YA 4N02A 4DF2A 1MRQA 1YPIA 2WMIA 2GJXB 3LNPA 5GJNA 1WOAA 1W6TA 1LL7A 3EOLA 5T8GA 1XJBA 5KTLA 2XIBA 1YTKA 2C8NA 3KTSA 1E6RA 3P0WA 3KOWA 1CGVA 3K4WA 1OIMA 3BH4A 2FVLA 4E3TA 1X1OA 4Z2LA 2I57A 1PO9A 1XR2A 1XCWA 2I5QA 2ALRA 1EOMA 1VEPA 3EDJA 3R8RA 3W6YA 3GB6A 5LHEA 2VJXA 4FNTA 1YPXA 2OXNA 2E09A 4HPJA 3SCVA 4F2BA 3WH9A 2IW0A 5GJPA 4ERIA 3KBVA 1DEDA 1UB3A 2WVVB 3E0IA 4BFAA 2DUAA 3KRZA 2OQYA 2VX4A 2HVNA 3AIUA 2EF9A 3H4XA 1QI2A 4FHAA 2DVXA 1M03A 4XAZA 1JCTA 1XLAA 3TQPA 3V5OA 3THCA 5F4WA 1E6PA 4XD3A 2UZ9A 4GH3A 1US3A 4GA8A 1OT2A 3KVKA 2VUYA 4B5SA 1OFOA 3A5FA 2YCIX 5BWAA 1I0DA 1C91A 3EXTA 3AFBA 1MNZA 3FAWA 2YXGA 1IEIA 3VDCA 1KFWA 3USBA 1UP0A 1KGUA 4QCEA 4H7VA 3RFAA 4YYFA 3DG3A 1P6CA 3OIXA 1V0MA 1VBRA 1GYLA 2QIWA 2AAMA 4GNKB 1FP8A 3M0IA 1QWGA 3GUWA 2ZZ4A 3DFOA 3FKRA 5K7JA 3LXBA 1TA3A 3EWUA 3BCJA 3N4EA 4ZO9A 2ISFA 4O0ZA 4D6CA 4H00A 4NF7A 1DV7A 2NX3A 3MDUA 2HRWA 3NDZA 4IIEA 1IEQA 1XYBA 3UG4A 2ABAA 3BSHA 3PAOA 4MZ8A 2J78A 5KEZA 3VIFA 4LUSB 1NWTA 4XZWA 3WJXA 3EX4A 1KBBA 4AZBA 1W3NA 2DZTA 3CC1A 2J27A 5HA7A 3HA1A 5K9XA 1P0KA 4NJJA 4DYKA 1E4MM 3H2FA 3QKZA 4K37A 2ZVIA 2QQ6A 2QLYA 2ZZ7A 3WQOA 1E1FA 1QI4A 3WQ5A 1WBJA 1EUAA 4A2RA 3W1PA 4LW7A