4LVJA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt). mn-bound crystal structure at ph 5.5
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
192
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVFSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid recombination enzyme
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Dna binding protein/dna
total genus 63
structure length 192
sequence length 195
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lvjA01
4LVJA 4LVMA 4HT4A 4LVIA 4LVKA 2NS6A 4LVLA
chains in the Genus database with same CATH superfamily
4HWOA 3IKMB 1YFTA 4WF2A 2ZCEA 3ICAA 4XTZA 4XTYA 4WJ3M 4K86A 2HNIA 4H2YA 3A32A 1B7YB 3A5YA 4YRJA 2ARSA 1Z7MA 4H2SA 3NELA 4YP0A 2DXUA 1NYQA 2ZR3A 4X5OA 3TEHB 4BWAA 1E24A 1NJ5A 2E64A 2DZCA 3QO8A 2DU7A 4YRQA 1H4QA 3HXVA 4XEMA 4UPAA 2ZXFA 2RHQA 3A7RA 1QE0A 4XTWA 4Q6GA 3NENA 2NS6A 1WQ7A 3L4GA 3V8LA 1BIBA 1BBUA 4HVCA 4P74A 4HWPA 4YDQA 5E3IA 1EFWA 4OP0A 2E10A 4LNSA 3TUPA 4E51A 2I4LA 1ADJA 2ZR2A 4YPFA 1YGBA 4LVJA 1B70A 2AMCB 1EVLA 2DVEA 2QHVA 1KMMA 3PZCA 3FJPA 4RMFA 4YRRA 4YCUA 1H4TA 2E3CA 3RKWA 3A74A 5HGQA 2CIMA 2P0LA 5ELOA 4CS3A 4YRGA 4RQFA 2G4CA 3G1ZA 2CJAA 4XU2A 4H2WA 2EAYA 5KNNA 2AKWA 2ZT8A 4TVYA 3QO7A 1NNHA 1PYSA 4P73A 3V8JA 3PCOB 2IY5B 4P74C 3HFZB 1B8AA 3RUXA 3L2ZA 1IL2A 4K87A 2XGTA 3HY1A 2A8EA 4K88A 2DTHA 1SESA 3HTZA 3RL6A 4YREA 3A31A 3CMQA 4H2XA 1NJ2A 4YRCA 1YB3A 3L1AA 1SETA 4RDXA 3MF2A 3V7CA 4NCXA 3A7AA 4XTVA 2CGHA 2EL9A 2P5IA 1LYLA 1HXDA 1W66A 2Q7EA 4P73C 4XU1A 4CH4A 2Q5IA 1EIYA 4HWSA 2ALYB 4UP8A 1C0AA 1USYC 2DXTA 3IG2A 2DQ3A 3HXUA 1ASYA 1HTTA 2QHSA 4KQEA 2C7IA 4CS2A 5C53B 1ASZA 4TVAA 1B70B 4G85A 4YRFA 4YRLA 4H02A 2DJZA 2EJ9A 3MQZA 1KMNA 3E9IA 5ELNA 3VQWA 4XTUA 2ZT5A 3RKXA 5K1XA 3HY0A 4PHCA 3VQVA 3HXWA 3NEMA 1ADYA 4EO4A 4HWRA 4KR2A 1BBWA 3VQXA 1B7YA 3W3SA 4TTVA 1B76A 1H4VB 2E1HA 2CJBA 3UGQA 2EWNA 4XEOA 2ZZGA 2RHSB 3TEHA 3P8TA 4YRMA 3EFSA 4AH6A 1Z7NA 2C8MA 4OLFA 4HWTA 1G51A 3VQYA 3M4QA 2QHTA 2ZTGA 1ATIA 3EFRA 2DTIA 3I7FA 1JJCB 3RKYA 1YFRA 3BFMA 1J5WA 3MEYA 3WQZA 2DTOA 5F5WA 1GGMA 4XTXA 3P8YA 1FYFA 1USYA 1L0WA 2EJFA 2ZIMA 2AMCA 4L87A 4LVKA 4P3PA 2I4MA 1EVKA 3E9HA 4CH5A 1KOGA 3HFVA 5K1PA 4HA8A 3RGLA 4YYEA 4XU3A 2I4OA 1RIQA 3V7RA 1X2GA 1WYDA 4YCVA 4PG3A 3DSQA 2DKGA 3P8VA 3QNEA 2ZGWA 4ZTZB 3KFUA 2ZT7A 2ARUA 1NJ1A 3TEGA 2RHQB 2ZNIA 3REXA 4EX5A 1G5HA 3PCOA 2IY5A 3L4GB 3HFZA 3M4PA 2ODRC 2DZ9A 4TQFA 1NYRA 1WLEA 2ODRD 2E5AA 1X2HA 4UP9A 1X56A 2ZNJA 4ZIBA 1WQWA 3LSQA 4O2DA 4Q15A 4TWAA 4DPGA 3UH0A 4YRIA 3QO5A 1X01A 2PMEA 4TVWA 3MF1A 2J3LA 3UFGA 4ZTUB 1SRYA 2E41A 3HRKA 2J3MA 4CH3A 2ZZFA 1SERA 1NJ8A 1WPYA 4YRPA 2XTIA 2DU5A 4WI1A 3REUA 2DDZA 3A5ZA 3LC0A 2QHUA 1E1OA 4KR3A 4G84A 2Q5HA 3OD1A 2AKWB 3R07A 3V8KA 1EQRA 2Q7HA 2ZINA 1PYSB 4XU0A 4YRKA 2DQ0A 4CS4A 4P71A 5C51B 3LSSA 2ALYA 3UGTA 2ARTA 4WJ4A 4CH6A 2ZZEA 12ASA 4P75A 1G5IA 4H2VA 5C52B 2ZIOA 2Q7GA 4H2TA 4P3NA 4YROA 4H2XB 1VQZA 1X54A 3V7SA 4YCWA 1BIAA 2FYKA 4YRNA 2CJ9A 1E1TA 1X55A 4P72A 1YFSA 1WNLA 4LVLA 4P3OA 4UP7A 1N9WA 1HC7A 2PMFA 4DQ2A 4H2UA 1WU7A 4HT4A 2EJGA 2DEQA 4J15A 4P71C 3VBBA 2ZT6A 3IKLA 3A7UA 4YRTA 3RF1A 1EIYB 4TQDA 1E22A 3BJUA 3RACA 2RHSA 4BW9A 4P75C 2I4NA 3HXYA 3QTCA 3HXXA 1H4SA 3HRIA 2E65A 4TVAB 11ASA 1EOVA 4LVMA 3HXZA 3IALA 4RQEA 3RIRA 4YRSA 1JJCA 4LVIA 4P72C 1QF6A 3NETA 1NJ6A 3ERRA
chains in the Genus database with same CATH topology
4HWOA 3IKMB 1YFTA 4WF2A 2ZCEA 3ICAA 4XTZA 4XTYA 4WJ3M 4K86A 2HNIA 4H2YA 3A32A 1B7YB 3A5YA 4YRJA 2ARSA 1Z7MA 4H2SA 3NELA 4YP0A 2DXUA 1NYQA 2ZR3A 4X5OA 3TEHB 4BWAA 1E24A 1NJ5A 2E64A 2DZCA 3QO8A 2DU7A 4YRQA 1H4QA 3HXVA 4XEMA 4UPAA 2ZXFA 2RHQA 3A7RA 1QE0A 4XTWA 4Q6GA 3NENA 2NS6A 1WQ7A 3L4GA 3V8LA 1BIBA 1BBUA 4HVCA 4P74A 4HWPA 4YDQA 5E3IA 1EFWA 4OP0A 2E10A 4LNSA 3TUPA 4E51A 2I4LA 1ADJA 2ZR2A 4YPFA 1YGBA 4LVJA 1B70A 2AMCB 1EVLA 2DVEA 2QHVA 1KMMA 3PZCA 3FJPA 4RMFA 4YRRA 4YCUA 1H4TA 2E3CA 3RKWA 3A74A 5HGQA 2CIMA 2P0LA 5ELOA 4CS3A 4YRGA 4RQFA 2G4CA 3G1ZA 2CJAA 4XU2A 4H2WA 2EAYA 5KNNA 2AKWA 2ZT8A 4TVYA 3QO7A 1NNHA 1PYSA 4P73A 3V8JA 3PCOB 2IY5B 4P74C 3HFZB 1B8AA 3RUXA 3L2ZA 1IL2A 4K87A 2XGTA 3HY1A 2A8EA 4K88A 2DTHA 1SESA 3HTZA 3RL6A 4YREA 3A31A 3CMQA 4H2XA 1NJ2A 4YRCA 1YB3A 3L1AA 1SETA 4RDXA 3MF2A 3V7CA 4NCXA 3A7AA 4XTVA 2CGHA 2EL9A 2P5IA 1LYLA 1HXDA 1W66A 2Q7EA 4P73C 4XU1A 4CH4A 2Q5IA 1EIYA 4HWSA 2ALYB 4UP8A 1C0AA 1USYC 2DXTA 3IG2A 2DQ3A 3HXUA 1ASYA 1HTTA 2QHSA 4KQEA 2C7IA 4CS2A 5C53B 1ASZA 4TVAA 1B70B 4G85A 4YRFA 4YRLA 4H02A 2DJZA 2EJ9A 3MQZA 1KMNA 3E9IA 5ELNA 3VQWA 4XTUA 2ZT5A 3RKXA 5K1XA 3HY0A 4PHCA 3VQVA 3HXWA 3NEMA 1ADYA 4EO4A 4HWRA 4KR2A 1BBWA 3VQXA 1B7YA 3W3SA 4TTVA 1B76A 1H4VB 2E1HA 2CJBA 3UGQA 2EWNA 4XEOA 2ZZGA 2RHSB 3TEHA 3P8TA 4YRMA 3EFSA 4AH6A 1Z7NA 2C8MA 4OLFA 4HWTA 1G51A 3VQYA 3M4QA 2QHTA 2ZTGA 1ATIA 3EFRA 2DTIA 3I7FA 1JJCB 3RKYA 1YFRA 3BFMA 1J5WA 3MEYA 3WQZA 2DTOA 5F5WA 1GGMA 4XTXA 3P8YA 1FYFA 1USYA 1L0WA 2EJFA 2ZIMA 2AMCA 4L87A 4LVKA 4P3PA 2I4MA 1EVKA 3E9HA 4CH5A 1KOGA 3HFVA 5K1PA 4HA8A 3RGLA 4YYEA 4XU3A 2I4OA 1RIQA 3V7RA 1X2GA 1WYDA 4YCVA 4PG3A 3DSQA 2DKGA 3P8VA 3QNEA 2ZGWA 4ZTZB 3KFUA 2ZT7A 2ARUA 1NJ1A 3TEGA 2RHQB 2ZNIA 3REXA 4EX5A 1G5HA 3PCOA 2IY5A 3L4GB 3HFZA 3M4PA 2ODRC 2DZ9A 4TQFA 1NYRA 1WLEA 2ODRD 2E5AA 1X2HA 4UP9A 1X56A 2ZNJA 4ZIBA 1WQWA 3LSQA 4O2DA 4Q15A 4TWAA 4DPGA 3UH0A 4YRIA 3QO5A 1X01A 2PMEA 4TVWA 3MF1A 2J3LA 3UFGA 4ZTUB 1SRYA 2E41A 3HRKA 2J3MA 4CH3A 2ZZFA 1SERA 1NJ8A 1WPYA 4YRPA 2XTIA 2DU5A 4WI1A 3REUA 2DDZA 3A5ZA 3LC0A 2QHUA 1E1OA 4KR3A 4G84A 2Q5HA 3OD1A 2AKWB 3R07A 3V8KA 1EQRA 2Q7HA 2ZINA 1PYSB 4XU0A 4YRKA 2DQ0A 4CS4A 4P71A 5C51B 3LSSA 2ALYA 3UGTA 2ARTA 4WJ4A 4CH6A 2ZZEA 12ASA 4P75A 1G5IA 4H2VA 5C52B 2ZIOA 2Q7GA 4H2TA 4P3NA 4YROA 4H2XB 1VQZA 1X54A 3V7SA 4YCWA 1BIAA 2FYKA 4YRNA 2CJ9A 1E1TA 1X55A 4P72A 1YFSA 1WNLA 4LVLA 4P3OA 4UP7A 1N9WA 1HC7A 2PMFA 4DQ2A 4H2UA 1WU7A 4HT4A 2EJGA 2DEQA 4J15A 4P71C 3VBBA 2ZT6A 3IKLA 3A7UA 4YRTA 3RF1A 1EIYB 4TQDA 1E22A 3BJUA 3RACA 2RHSA 4BW9A 4P75C 2I4NA 3HXYA 3QTCA 3HXXA 1H4SA 3HRIA 2E65A 4TVAB 11ASA 1EOVA 4LVMA 3HXZA 3IALA 4RQEA 3RIRA 4YRSA 1JJCA 4LVIA 4P72C 1QF6A 3NETA 1NJ6A 3ERRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVJ A;  4LVM A;  4HT4 A;  4LVI A;  4LVK A;  2NS6 A;  4LVL A; 
#chains in the Genus database with same CATH topology
 4HWO A;  3IKM B;  1YFT A;  4WF2 A;  2ZCE A;  3ICA A;  4XTZ A;  4XTY A;  4WJ3 M;  4K86 A;  2HNI A;  4H2Y A;  3A32 A;  1B7Y B;  3A5Y A;  4YRJ A;  2ARS A;  1Z7M A;  4H2S A;  3NEL A;  4YP0 A;  2DXU A;  1NYQ A;  2ZR3 A;  4X5O A;  3TEH B;  4BWA A;  1E24 A;  1NJ5 A;  2E64 A;  2DZC A;  3QO8 A;  2DU7 A;  4YRQ A;  1H4Q A;  3HXV A;  4XEM A;  4UPA A;  2ZXF A;  2RHQ A;  3A7R A;  1QE0 A;  4XTW A;  4Q6G A;  3NEN A;  2NS6 A;  1WQ7 A;  3L4G A;  3V8L A;  1BIB A;  1BBU A;  4HVC A;  4P74 A;  4HWP A;  4YDQ A;  5E3I A;  1EFW A;  4OP0 A;  2E10 A;  4LNS A;  3TUP A;  4E51 A;  2I4L A;  1ADJ A;  2ZR2 A;  4YPF A;  1YGB A;  4LVJ A;  1B70 A;  2AMC B;  1EVL A;  2DVE A;  2QHV A;  1KMM A;  3PZC A;  3FJP A;  4RMF A;  4YRR A;  4YCU A;  1H4T A;  2E3C A;  3RKW A;  3A74 A;  5HGQ A;  2CIM A;  2P0L A;  5ELO A;  4CS3 A;  4YRG A;  4RQF A;  2G4C A;  3G1Z A;  2CJA A;  4XU2 A;  4H2W A;  2EAY A;  5KNN A;  2AKW A;  2ZT8 A;  4TVY A;  3QO7 A;  1NNH A;  1PYS A;  4P73 A;  3V8J A;  3PCO B;  2IY5 B;  4P74 C;  3HFZ B;  1B8A A;  3RUX A;  3L2Z A;  1IL2 A;  4K87 A;  2XGT A;  3HY1 A;  2A8E A;  4K88 A;  2DTH A;  1SES A;  3HTZ A;  3RL6 A;  4YRE A;  3A31 A;  3CMQ A;  4H2X A;  1NJ2 A;  4YRC A;  1YB3 A;  3L1A A;  1SET A;  4RDX A;  3MF2 A;  3V7C A;  4NCX A;  3A7A A;  4XTV A;  2CGH A;  2EL9 A;  2P5I A;  1LYL A;  1HXD A;  1W66 A;  2Q7E A;  4P73 C;  4XU1 A;  4CH4 A;  2Q5I A;  1EIY A;  4HWS A;  2ALY B;  4UP8 A;  1C0A A;  1USY C;  2DXT A;  3IG2 A;  2DQ3 A;  3HXU A;  1ASY A;  1HTT A;  2QHS A;  4KQE A;  2C7I A;  4CS2 A;  5C53 B;  1ASZ A;  4TVA A;  1B70 B;  4G85 A;  4YRF A;  4YRL A;  4H02 A;  2DJZ A;  2EJ9 A;  3MQZ A;  1KMN A;  3E9I A;  5ELN A;  3VQW A;  4XTU A;  2ZT5 A;  3RKX A;  5K1X A;  3HY0 A;  4PHC A;  3VQV A;  3HXW A;  3NEM A;  1ADY A;  4EO4 A;  4HWR A;  4KR2 A;  1BBW A;  3VQX A;  1B7Y A;  3W3S A;  4TTV A;  1B76 A;  1H4V B;  2E1H A;  2CJB A;  3UGQ A;  2EWN A;  4XEO A;  2ZZG A;  2RHS B;  3TEH A;  3P8T A;  4YRM A;  3EFS A;  4AH6 A;  1Z7N A;  2C8M A;  4OLF A;  4HWT A;  1G51 A;  3VQY A;  3M4Q A;  2QHT A;  2ZTG A;  1ATI A;  3EFR A;  2DTI A;  3I7F A;  1JJC B;  3RKY A;  1YFR A;  3BFM A;  1J5W A;  3MEY A;  3WQZ A;  2DTO A;  5F5W A;  1GGM A;  4XTX A;  3P8Y A;  1FYF A;  1USY A;  1L0W A;  2EJF A;  2ZIM A;  2AMC A;  4L87 A;  4LVK A;  4P3P A;  2I4M A;  1EVK A;  3E9H A;  4CH5 A;  1KOG A;  3HFV A;  5K1P A;  4HA8 A;  3RGL A;  4YYE A;  4XU3 A;  2I4O A;  1RIQ A;  3V7R A;  1X2G A;  1WYD A;  4YCV A;  4PG3 A;  3DSQ A;  2DKG A;  3P8V A;  3QNE A;  2ZGW A;  4ZTZ B;  3KFU A;  2ZT7 A;  2ARU A;  1NJ1 A;  3TEG A;  2RHQ B;  2ZNI A;  3REX A;  4EX5 A;  1G5H A;  3PCO A;  2IY5 A;  3L4G B;  3HFZ A;  3M4P A;  2ODR C;  2DZ9 A;  4TQF A;  1NYR A;  1WLE A;  2ODR D;  2E5A A;  1X2H A;  4UP9 A;  1X56 A;  2ZNJ A;  4ZIB A;  1WQW A;  3LSQ A;  4O2D A;  4Q15 A;  4TWA A;  4DPG A;  3UH0 A;  4YRI A;  3QO5 A;  1X01 A;  2PME A;  4TVW A;  3MF1 A;  2J3L A;  3UFG A;  4ZTU B;  1SRY A;  2E41 A;  3HRK A;  2J3M A;  4CH3 A;  2ZZF A;  1SER A;  1NJ8 A;  1WPY A;  4YRP A;  2XTI A;  2DU5 A;  4WI1 A;  3REU A;  2DDZ A;  3A5Z A;  3LC0 A;  2QHU A;  1E1O A;  4KR3 A;  4G84 A;  2Q5H A;  3OD1 A;  2AKW B;  3R07 A;  3V8K A;  1EQR A;  2Q7H A;  2ZIN A;  1PYS B;  4XU0 A;  4YRK A;  2DQ0 A;  4CS4 A;  4P71 A;  5C51 B;  3LSS A;  2ALY A;  3UGT A;  2ART A;  4WJ4 A;  4CH6 A;  2ZZE A;  12AS A;  4P75 A;  1G5I A;  4H2V A;  5C52 B;  2ZIO A;  2Q7G A;  4H2T A;  4P3N A;  4YRO A;  4H2X B;  1VQZ A;  1X54 A;  3V7S A;  4YCW A;  1BIA A;  2FYK A;  4YRN A;  2CJ9 A;  1E1T A;  1X55 A;  4P72 A;  1YFS A;  1WNL A;  4LVL A;  4P3O A;  4UP7 A;  1N9W A;  1HC7 A;  2PMF A;  4DQ2 A;  4H2U A;  1WU7 A;  4HT4 A;  2EJG A;  2DEQ A;  4J15 A;  4P71 C;  3VBB A;  2ZT6 A;  3IKL A;  3A7U A;  4YRT A;  3RF1 A;  1EIY B;  4TQD A;  1E22 A;  3BJU A;  3RAC A;  2RHS A;  4BW9 A;  4P75 C;  2I4N A;  3HXY A;  3QTC A;  3HXX A;  1H4S A;  3HRI A;  2E65 A;  4TVA B;  11AS A;  1EOV A;  4LVM A;  3HXZ A;  3IAL A;  4RQE A;  3RIR A;  4YRS A;  1JJC A;  4LVI A;  4P72 C;  1QF6 A;  3NET A;  1NJ6 A;  3ERR A; 
#chains in the Genus database with same CATH homology
 4HWO A;  3IKM B;  1YFT A;  4WF2 A;  2ZCE A;  3ICA A;  4XTZ A;  4XTY A;  4WJ3 M;  4K86 A;  2HNI A;  4H2Y A;  3A32 A;  1B7Y B;  3A5Y A;  4YRJ A;  2ARS A;  1Z7M A;  4H2S A;  3NEL A;  4YP0 A;  2DXU A;  1NYQ A;  2ZR3 A;  4X5O A;  3TEH B;  4BWA A;  1E24 A;  1NJ5 A;  2E64 A;  2DZC A;  3QO8 A;  2DU7 A;  4YRQ A;  1H4Q A;  3HXV A;  4XEM A;  4UPA A;  2ZXF A;  2RHQ A;  3A7R A;  1QE0 A;  4XTW A;  4Q6G A;  3NEN A;  2NS6 A;  1WQ7 A;  3L4G A;  3V8L A;  1BIB A;  1BBU A;  4HVC A;  4P74 A;  4HWP A;  4YDQ A;  5E3I A;  1EFW A;  4OP0 A;  2E10 A;  4LNS A;  3TUP A;  4E51 A;  2I4L A;  1ADJ A;  2ZR2 A;  4YPF A;  1YGB A;  4LVJ A;  1B70 A;  2AMC B;  1EVL A;  2DVE A;  2QHV A;  1KMM A;  3PZC A;  3FJP A;  4RMF A;  4YRR A;  4YCU A;  1H4T A;  2E3C A;  3RKW A;  3A74 A;  5HGQ A;  2CIM A;  2P0L A;  5ELO A;  4CS3 A;  4YRG A;  4RQF A;  2G4C A;  3G1Z A;  2CJA A;  4XU2 A;  4H2W A;  2EAY A;  5KNN A;  2AKW A;  2ZT8 A;  4TVY A;  3QO7 A;  1NNH A;  1PYS A;  4P73 A;  3V8J A;  3PCO B;  2IY5 B;  4P74 C;  3HFZ B;  1B8A A;  3RUX A;  3L2Z A;  1IL2 A;  4K87 A;  2XGT A;  3HY1 A;  2A8E A;  4K88 A;  2DTH A;  1SES A;  3HTZ A;  3RL6 A;  4YRE A;  3A31 A;  3CMQ A;  4H2X A;  1NJ2 A;  4YRC A;  1YB3 A;  3L1A A;  1SET A;  4RDX A;  3MF2 A;  3V7C A;  4NCX A;  3A7A A;  4XTV A;  2CGH A;  2EL9 A;  2P5I A;  1LYL A;  1HXD A;  1W66 A;  2Q7E A;  4P73 C;  4XU1 A;  4CH4 A;  2Q5I A;  1EIY A;  4HWS A;  2ALY B;  4UP8 A;  1C0A A;  1USY C;  2DXT A;  3IG2 A;  2DQ3 A;  3HXU A;  1ASY A;  1HTT A;  2QHS A;  4KQE A;  2C7I A;  4CS2 A;  5C53 B;  1ASZ A;  4TVA A;  1B70 B;  4G85 A;  4YRF A;  4YRL A;  4H02 A;  2DJZ A;  2EJ9 A;  3MQZ A;  1KMN A;  3E9I A;  5ELN A;  3VQW A;  4XTU A;  2ZT5 A;  3RKX A;  5K1X A;  3HY0 A;  4PHC A;  3VQV A;  3HXW A;  3NEM A;  1ADY A;  4EO4 A;  4HWR A;  4KR2 A;  1BBW A;  3VQX A;  1B7Y A;  3W3S A;  4TTV A;  1B76 A;  1H4V B;  2E1H A;  2CJB A;  3UGQ A;  2EWN A;  4XEO A;  2ZZG A;  2RHS B;  3TEH A;  3P8T A;  4YRM A;  3EFS A;  4AH6 A;  1Z7N A;  2C8M A;  4OLF A;  4HWT A;  1G51 A;  3VQY A;  3M4Q A;  2QHT A;  2ZTG A;  1ATI A;  3EFR A;  2DTI A;  3I7F A;  1JJC B;  3RKY A;  1YFR A;  3BFM A;  1J5W A;  3MEY A;  3WQZ A;  2DTO A;  5F5W A;  1GGM A;  4XTX A;  3P8Y A;  1FYF A;  1USY A;  1L0W A;  2EJF A;  2ZIM A;  2AMC A;  4L87 A;  4LVK A;  4P3P A;  2I4M A;  1EVK A;  3E9H A;  4CH5 A;  1KOG A;  3HFV A;  5K1P A;  4HA8 A;  3RGL A;  4YYE A;  4XU3 A;  2I4O A;  1RIQ A;  3V7R A;  1X2G A;  1WYD A;  4YCV A;  4PG3 A;  3DSQ A;  2DKG A;  3P8V A;  3QNE A;  2ZGW A;  4ZTZ B;  3KFU A;  2ZT7 A;  2ARU A;  1NJ1 A;  3TEG A;  2RHQ B;  2ZNI A;  3REX A;  4EX5 A;  1G5H A;  3PCO A;  2IY5 A;  3L4G B;  3HFZ A;  3M4P A;  2ODR C;  2DZ9 A;  4TQF A;  1NYR A;  1WLE A;  2ODR D;  2E5A A;  1X2H A;  4UP9 A;  1X56 A;  2ZNJ A;  4ZIB A;  1WQW A;  3LSQ A;  4O2D A;  4Q15 A;  4TWA A;  4DPG A;  3UH0 A;  4YRI A;  3QO5 A;  1X01 A;  2PME A;  4TVW A;  3MF1 A;  2J3L A;  3UFG A;  4ZTU B;  1SRY A;  2E41 A;  3HRK A;  2J3M A;  4CH3 A;  2ZZF A;  1SER A;  1NJ8 A;  1WPY A;  4YRP A;  2XTI A;  2DU5 A;  4WI1 A;  3REU A;  2DDZ A;  3A5Z A;  3LC0 A;  2QHU A;  1E1O A;  4KR3 A;  4G84 A;  2Q5H A;  3OD1 A;  2AKW B;  3R07 A;  3V8K A;  1EQR A;  2Q7H A;  2ZIN A;  1PYS B;  4XU0 A;  4YRK A;  2DQ0 A;  4CS4 A;  4P71 A;  5C51 B;  3LSS A;  2ALY A;  3UGT A;  2ART A;  4WJ4 A;  4CH6 A;  2ZZE A;  12AS A;  4P75 A;  1G5I A;  4H2V A;  5C52 B;  2ZIO A;  2Q7G A;  4H2T A;  4P3N A;  4YRO A;  4H2X B;  1VQZ A;  1X54 A;  3V7S A;  4YCW A;  1BIA A;  2FYK A;  4YRN A;  2CJ9 A;  1E1T A;  1X55 A;  4P72 A;  1YFS A;  1WNL A;  4LVL A;  4P3O A;  4UP7 A;  1N9W A;  1HC7 A;  2PMF A;  4DQ2 A;  4H2U A;  1WU7 A;  4HT4 A;  2EJG A;  2DEQ A;  4J15 A;  4P71 C;  3VBB A;  2ZT6 A;  3IKL A;  3A7U A;  4YRT A;  3RF1 A;  1EIY B;  4TQD A;  1E22 A;  3BJU A;  3RAC A;  2RHS A;  4BW9 A;  4P75 C;  2I4N A;  3HXY A;  3QTC A;  3HXX A;  1H4S A;  3HRI A;  2E65 A;  4TVA B;  11AS A;  1EOV A;  4LVM A;  3HXZ A;  3IAL A;  4RQE A;  3RIR A;  4YRS A;  1JJC A;  4LVI A;  4P72 C;  1QF6 A;  3NET A;  1NJ6 A;  3ERR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...