4LVJA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt). mn-bound crystal structure at ph 5.5
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
192
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVFSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Dna binding protein/dna
molecule keywords Plasmid recombination enzyme
total genus 63
structure length 192
sequence length 195
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lvjA01
4LVKA 4LVIA 2NS6A 4LVMA 4LVLA 4HT4A 4LVJA
chains in the Genus database with same CATH superfamily
4YYEA 4H2WA 1BIBA 4P72C 4XTWA 2ZNIA 4TVWA 2AMCA 1USYC 1GGMA 3HXVA 4LVLA 4LVJA 2Q5HA 3M4QA 3UGQA 3RIRA 2AMCB 4K87A 4H2XA 3V8KA 3QO7A 4P3PA 3TEHA 4RDXA 2I4MA 3MEYA 4HWPA 3PZCA 2E65A 3LSQA 2RHSA 4XU3A 3HFZA 2QHTA 2EJ9A 4KQEA 3IALA 3V7RA 2AKWA 2DTIA 3VBBA 1EVKA 1YB3A 2XTIA 4TVAB 2I4OA 1SERA 1B76A 2Q5IA 2ZT7A 1PYSA 4YRMA 2Q7HA 4WI1A 3A74A 12ASA 4XU1A 3E9IA 1NJ2A 3HXYA 5K1XA 1KMMA 5E3IA 1Z7MA 3RKWA 5K1PA 1EVLA 1ATIA 1EIYA 1JJCB 1NJ8A 4P73A 4XU0A 4LVKA 5ELNA 3LSSA 4YRIA 4UP7A 4KR3A 1WNLA 3OD1A 3L4GA 4CH6A 4EX5A 4NCXA 2I4NA 4DQ2A 2ZZFA 3QO5A 4YP0A 2ZIOA 2DU5A 2DEQA 4TVYA 3L2ZA 1NYRA 2RHQB 1H4TA 3BFMA 1WU7A 4UP8A 3A7UA 3QO8A 3PCOB 4J15A 2DTHA 4TQDA 3PCOA 2DDZA 4YRNA 2C8MA 4H2YA 2ZNJA 1PYSB 1WPYA 1G5HA 1NYQA 3TEGA 4CS2A 1RIQA 2ZT5A 2E5AA 4RQFA 3LC0A 1BBWA 3V8JA 3P8TA 2G4CA 4LVIA 3UGTA 1H4QA 4YRSA 3QTCA 4P3OA 4X5OA 1E22A 4Q15A 1Z7NA 1WQWA 4UPAA 3RKXA 2ZTGA 4WF2A 4XEMA 5ELOA 4DPGA 2P5IA 4YRFA 2DXTA 4YRGA 1C0AA 3A5YA 4H2SA 4YRTA 2DVEA 3REXA 5HGQA 2ALYB 3V7CA 3RF1A 1YFTA 3HY1A 2J3MA 2P0LA 3HXWA 2NS6A 4P71C 2XGTA 1LYLA 1HC7A 2ODRC 1NJ1A 3L1AA 2ZINA 3UH0A 3E9HA 4P71A 2J3LA 4XTYA 1QF6A 4TWAA 4P74C 4RMFA 2Q7GA 1X01A 5C51B 1X55A 3HY0A 1ADJA 4TVAA 1HTTA 1VQZA 2ZT6A 1B70A 2RHQA 1E1OA 3IG2A 4XTZA 3EFSA 2EJFA 4LNSA 4YCVA 4P74A 2ZIMA 3NEMA 1WYDA 3IKLA 1NNHA 2E64A 3HXUA 4YRQA 1ADYA 2CJBA 2ZR3A 4RQEA 5C53B 4YRCA 3VQWA 3V7SA 4HWOA 4K86A 1SRYA 2EL9A 2CJAA 4H2XB 1WLEA 2ARSA 4CS4A 4HVCA 4XTVA 4WJ3M 1W66A 3RL6A 4Q6GA 3RACA 3R07A 1EQRA 2ALYA 4CH4A 4YRLA 3EFRA 1E24A 4L87A 2DQ0A 4H2TA 1EIYB 1B7YB 3CMQA 4YREA 3HRIA 1NJ5A 3P8VA 3ERRA 4YCUA 4BWAA 4YPFA 4BW9A 3HXXA 3MQZA 2Q7EA 4XEOA 2PMFA 2ZT8A 2QHSA 2DKGA 2QHVA 1EFWA 2ARTA 4TTVA 1YGBA 2ARUA 4AH6A 3HFZB 4YRRA 2DZCA 2DZ9A 1WQ7A 1SESA 3UFGA 3FJPA 3A7AA 4OLFA 1H4SA 3L4GB 1USYA 4G84A 11ASA 1KOGA 1B7YA 4CH5A 2CGHA 4HWTA 3TEHB 1X2HA 4OP0A 2DTOA 2PMEA 3RGLA 2CIMA 4P73C 4YROA 4EO4A 2ZCEA 4LVMA 1B70B 2E3CA 2E41A 1IL2A 1EOVA 4E51A 2E10A 1NJ6A 2AKWB 2DXUA 4HA8A 1X56A 1KMNA 3DSQA 2IY5A 2EJGA 3A7RA 3RUXA 2ZGWA 2EWNA 3NENA 3NETA 1BBUA 5KNNA 4H02A 3TUPA 4K88A 4ZIBA 4H2VA 4YCWA 1BIAA 3MF1A 1N9WA 3HTZA 2I4LA 2ZR2A 4KR2A 2DU7A 4O2DA 2A8EA 4P72A 3IKMB 4G85A 2HNIA 2EAYA 4HWRA 3NELA 3VQVA 3VQXA 3M4PA 1YFRA 1ASYA 1X54A 1JJCA 3G1ZA 3QNEA 4HWSA 4CH3A 4H2UA 4YRJA 3REUA 2ZZEA 3P8YA 3HXZA 3VQYA 3I7FA 4P75A 4HT4A 1H4VB 4TQFA 4CS3A 4PHCA 4P3NA 2DQ3A 3MF2A 3BJUA 2IY5B 3HRKA 3ICAA 3A32A 4WJ4A 4ZTUB 1ASZA 1E1TA 4YRPA 2CJ9A 3A5ZA 3HFVA 3V8LA 3RKYA 2QHUA 4UP9A 5C52B 2C7IA 3W3SA 4YDQA 4YRKA 1G5IA 2ODRD 3A31A 1SETA 2DJZA 4XTXA 4P75C 2ZXFA 2RHSB 2ZZGA 1QE0A 4ZTZB 4XU2A 1J5WA 2FYKA 4XTUA 1FYFA 1X2GA 3KFUA 1YFSA 2E1HA 1HXDA 5F5WA 1B8AA 4PG3A 1L0WA 3WQZA 1G51A
chains in the Genus database with same CATH topology
4YYEA 4H2WA 1BIBA 4P72C 4XTWA 2ZNIA 4TVWA 2AMCA 1USYC 1GGMA 3HXVA 4LVLA 4LVJA 2Q5HA 3M4QA 3UGQA 3RIRA 2AMCB 4K87A 4H2XA 3V8KA 3QO7A 4P3PA 3TEHA 4RDXA 2I4MA 3MEYA 4HWPA 3PZCA 2E65A 3LSQA 2RHSA 4XU3A 3HFZA 2QHTA 2EJ9A 4KQEA 3IALA 3V7RA 2AKWA 2DTIA 3VBBA 1EVKA 1YB3A 2XTIA 4TVAB 2I4OA 1SERA 1B76A 2Q5IA 2ZT7A 1PYSA 4YRMA 2Q7HA 4WI1A 3A74A 12ASA 4XU1A 3E9IA 1NJ2A 3HXYA 5K1XA 1KMMA 5E3IA 1Z7MA 3RKWA 5K1PA 1EVLA 1ATIA 1EIYA 1JJCB 1NJ8A 4P73A 4XU0A 4LVKA 5ELNA 3LSSA 4YRIA 4UP7A 4KR3A 1WNLA 3OD1A 3L4GA 4CH6A 4EX5A 4NCXA 2I4NA 4DQ2A 2ZZFA 3QO5A 4YP0A 2ZIOA 2DU5A 2DEQA 4TVYA 3L2ZA 1NYRA 2RHQB 1H4TA 3BFMA 1WU7A 4UP8A 3A7UA 3QO8A 3PCOB 4J15A 2DTHA 4TQDA 3PCOA 2DDZA 4YRNA 2C8MA 4H2YA 2ZNJA 1PYSB 1WPYA 1G5HA 1NYQA 3TEGA 4CS2A 1RIQA 2ZT5A 2E5AA 4RQFA 3LC0A 1BBWA 3V8JA 3P8TA 2G4CA 4LVIA 3UGTA 1H4QA 4YRSA 3QTCA 4P3OA 4X5OA 1E22A 4Q15A 1Z7NA 1WQWA 4UPAA 3RKXA 2ZTGA 4WF2A 4XEMA 5ELOA 4DPGA 2P5IA 4YRFA 2DXTA 4YRGA 1C0AA 3A5YA 4H2SA 4YRTA 2DVEA 3REXA 5HGQA 2ALYB 3V7CA 3RF1A 1YFTA 3HY1A 2J3MA 2P0LA 3HXWA 2NS6A 4P71C 2XGTA 1LYLA 1HC7A 2ODRC 1NJ1A 3L1AA 2ZINA 3UH0A 3E9HA 4P71A 2J3LA 4XTYA 1QF6A 4TWAA 4P74C 4RMFA 2Q7GA 1X01A 5C51B 1X55A 3HY0A 1ADJA 4TVAA 1HTTA 1VQZA 2ZT6A 1B70A 2RHQA 1E1OA 3IG2A 4XTZA 3EFSA 2EJFA 4LNSA 4YCVA 4P74A 2ZIMA 3NEMA 1WYDA 3IKLA 1NNHA 2E64A 3HXUA 4YRQA 1ADYA 2CJBA 2ZR3A 4RQEA 5C53B 4YRCA 3VQWA 3V7SA 4HWOA 4K86A 1SRYA 2EL9A 2CJAA 4H2XB 1WLEA 2ARSA 4CS4A 4HVCA 4XTVA 4WJ3M 1W66A 3RL6A 4Q6GA 3RACA 3R07A 1EQRA 2ALYA 4CH4A 4YRLA 3EFRA 1E24A 4L87A 2DQ0A 4H2TA 1EIYB 1B7YB 3CMQA 4YREA 3HRIA 1NJ5A 3P8VA 3ERRA 4YCUA 4BWAA 4YPFA 4BW9A 3HXXA 3MQZA 2Q7EA 4XEOA 2PMFA 2ZT8A 2QHSA 2DKGA 2QHVA 1EFWA 2ARTA 4TTVA 1YGBA 2ARUA 4AH6A 3HFZB 4YRRA 2DZCA 2DZ9A 1WQ7A 1SESA 3UFGA 3FJPA 3A7AA 4OLFA 1H4SA 3L4GB 1USYA 4G84A 11ASA 1KOGA 1B7YA 4CH5A 2CGHA 4HWTA 3TEHB 1X2HA 4OP0A 2DTOA 2PMEA 3RGLA 2CIMA 4P73C 4YROA 4EO4A 2ZCEA 4LVMA 1B70B 2E3CA 2E41A 1IL2A 1EOVA 4E51A 2E10A 1NJ6A 2AKWB 2DXUA 4HA8A 1X56A 1KMNA 3DSQA 2IY5A 2EJGA 3A7RA 3RUXA 2ZGWA 2EWNA 3NENA 3NETA 1BBUA 5KNNA 4H02A 3TUPA 4K88A 4ZIBA 4H2VA 4YCWA 1BIAA 3MF1A 1N9WA 3HTZA 2I4LA 2ZR2A 4KR2A 2DU7A 4O2DA 2A8EA 4P72A 3IKMB 4G85A 2HNIA 2EAYA 4HWRA 3NELA 3VQVA 3VQXA 3M4PA 1YFRA 1ASYA 1X54A 1JJCA 3G1ZA 3QNEA 4HWSA 4CH3A 4H2UA 4YRJA 3REUA 2ZZEA 3P8YA 3HXZA 3VQYA 3I7FA 4P75A 4HT4A 1H4VB 4TQFA 4CS3A 4PHCA 4P3NA 2DQ3A 3MF2A 3BJUA 2IY5B 3HRKA 3ICAA 3A32A 4WJ4A 4ZTUB 1ASZA 1E1TA 4YRPA 2CJ9A 3A5ZA 3HFVA 3V8LA 3RKYA 2QHUA 4UP9A 5C52B 2C7IA 3W3SA 4YDQA 4YRKA 1G5IA 2ODRD 3A31A 1SETA 2DJZA 4XTXA 4P75C 2ZXFA 2RHSB 2ZZGA 1QE0A 4ZTZB 4XU2A 1J5WA 2FYKA 4XTUA 1FYFA 1X2GA 3KFUA 1YFSA 2E1HA 1HXDA 5F5WA 1B8AA 4PG3A 1L0WA 3WQZA 1G51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVK A;  4LVI A;  2NS6 A;  4LVM A;  4LVL A;  4HT4 A;  4LVJ A; 
#chains in the Genus database with same CATH topology
 4YYE A;  4H2W A;  1BIB A;  4P72 C;  4XTW A;  2ZNI A;  4TVW A;  2AMC A;  1USY C;  1GGM A;  3HXV A;  4LVL A;  4LVJ A;  2Q5H A;  3M4Q A;  3UGQ A;  3RIR A;  2AMC B;  4K87 A;  4H2X A;  3V8K A;  3QO7 A;  4P3P A;  3TEH A;  4RDX A;  2I4M A;  3MEY A;  4HWP A;  3PZC A;  2E65 A;  3LSQ A;  2RHS A;  4XU3 A;  3HFZ A;  2QHT A;  2EJ9 A;  4KQE A;  3IAL A;  3V7R A;  2AKW A;  2DTI A;  3VBB A;  1EVK A;  1YB3 A;  2XTI A;  4TVA B;  2I4O A;  1SER A;  1B76 A;  2Q5I A;  2ZT7 A;  1PYS A;  4YRM A;  2Q7H A;  4WI1 A;  3A74 A;  12AS A;  4XU1 A;  3E9I A;  1NJ2 A;  3HXY A;  5K1X A;  1KMM A;  5E3I A;  1Z7M A;  3RKW A;  5K1P A;  1EVL A;  1ATI A;  1EIY A;  1JJC B;  1NJ8 A;  4P73 A;  4XU0 A;  4LVK A;  5ELN A;  3LSS A;  4YRI A;  4UP7 A;  4KR3 A;  1WNL A;  3OD1 A;  3L4G A;  4CH6 A;  4EX5 A;  4NCX A;  2I4N A;  4DQ2 A;  2ZZF A;  3QO5 A;  4YP0 A;  2ZIO A;  2DU5 A;  2DEQ A;  4TVY A;  3L2Z A;  1NYR A;  2RHQ B;  1H4T A;  3BFM A;  1WU7 A;  4UP8 A;  3A7U A;  3QO8 A;  3PCO B;  4J15 A;  2DTH A;  4TQD A;  3PCO A;  2DDZ A;  4YRN A;  2C8M A;  4H2Y A;  2ZNJ A;  1PYS B;  1WPY A;  1G5H A;  1NYQ A;  3TEG A;  4CS2 A;  1RIQ A;  2ZT5 A;  2E5A A;  4RQF A;  3LC0 A;  1BBW A;  3V8J A;  3P8T A;  2G4C A;  4LVI A;  3UGT A;  1H4Q A;  4YRS A;  3QTC A;  4P3O A;  4X5O A;  1E22 A;  4Q15 A;  1Z7N A;  1WQW A;  4UPA A;  3RKX A;  2ZTG A;  4WF2 A;  4XEM A;  5ELO A;  4DPG A;  2P5I A;  4YRF A;  2DXT A;  4YRG A;  1C0A A;  3A5Y A;  4H2S A;  4YRT A;  2DVE A;  3REX A;  5HGQ A;  2ALY B;  3V7C A;  3RF1 A;  1YFT A;  3HY1 A;  2J3M A;  2P0L A;  3HXW A;  2NS6 A;  4P71 C;  2XGT A;  1LYL A;  1HC7 A;  2ODR C;  1NJ1 A;  3L1A A;  2ZIN A;  3UH0 A;  3E9H A;  4P71 A;  2J3L A;  4XTY A;  1QF6 A;  4TWA A;  4P74 C;  4RMF A;  2Q7G A;  1X01 A;  5C51 B;  1X55 A;  3HY0 A;  1ADJ A;  4TVA A;  1HTT A;  1VQZ A;  2ZT6 A;  1B70 A;  2RHQ A;  1E1O A;  3IG2 A;  4XTZ A;  3EFS A;  2EJF A;  4LNS A;  4YCV A;  4P74 A;  2ZIM A;  3NEM A;  1WYD A;  3IKL A;  1NNH A;  2E64 A;  3HXU A;  4YRQ A;  1ADY A;  2CJB A;  2ZR3 A;  4RQE A;  5C53 B;  4YRC A;  3VQW A;  3V7S A;  4HWO A;  4K86 A;  1SRY A;  2EL9 A;  2CJA A;  4H2X B;  1WLE A;  2ARS A;  4CS4 A;  4HVC A;  4XTV A;  4WJ3 M;  1W66 A;  3RL6 A;  4Q6G A;  3RAC A;  3R07 A;  1EQR A;  2ALY A;  4CH4 A;  4YRL A;  3EFR A;  1E24 A;  4L87 A;  2DQ0 A;  4H2T A;  1EIY B;  1B7Y B;  3CMQ A;  4YRE A;  3HRI A;  1NJ5 A;  3P8V A;  3ERR A;  4YCU A;  4BWA A;  4YPF A;  4BW9 A;  3HXX A;  3MQZ A;  2Q7E A;  4XEO A;  2PMF A;  2ZT8 A;  2QHS A;  2DKG A;  2QHV A;  1EFW A;  2ART A;  4TTV A;  1YGB A;  2ARU A;  4AH6 A;  3HFZ B;  4YRR A;  2DZC A;  2DZ9 A;  1WQ7 A;  1SES A;  3UFG A;  3FJP A;  3A7A A;  4OLF A;  1H4S A;  3L4G B;  1USY A;  4G84 A;  11AS A;  1KOG A;  1B7Y A;  4CH5 A;  2CGH A;  4HWT A;  3TEH B;  1X2H A;  4OP0 A;  2DTO A;  2PME A;  3RGL A;  2CIM A;  4P73 C;  4YRO A;  4EO4 A;  2ZCE A;  4LVM A;  1B70 B;  2E3C A;  2E41 A;  1IL2 A;  1EOV A;  4E51 A;  2E10 A;  1NJ6 A;  2AKW B;  2DXU A;  4HA8 A;  1X56 A;  1KMN A;  3DSQ A;  2IY5 A;  2EJG A;  3A7R A;  3RUX A;  2ZGW A;  2EWN A;  3NEN A;  3NET A;  1BBU A;  5KNN A;  4H02 A;  3TUP A;  4K88 A;  4ZIB A;  4H2V A;  4YCW A;  1BIA A;  3MF1 A;  1N9W A;  3HTZ A;  2I4L A;  2ZR2 A;  4KR2 A;  2DU7 A;  4O2D A;  2A8E A;  4P72 A;  3IKM B;  4G85 A;  2HNI A;  2EAY A;  4HWR A;  3NEL A;  3VQV A;  3VQX A;  3M4P A;  1YFR A;  1ASY A;  1X54 A;  1JJC A;  3G1Z A;  3QNE A;  4HWS A;  4CH3 A;  4H2U A;  4YRJ A;  3REU A;  2ZZE A;  3P8Y A;  3HXZ A;  3VQY A;  3I7F A;  4P75 A;  4HT4 A;  1H4V B;  4TQF A;  4CS3 A;  4PHC A;  4P3N A;  2DQ3 A;  3MF2 A;  3BJU A;  2IY5 B;  3HRK A;  3ICA A;  3A32 A;  4WJ4 A;  4ZTU B;  1ASZ A;  1E1T A;  4YRP A;  2CJ9 A;  3A5Z A;  3HFV A;  3V8L A;  3RKY A;  2QHU A;  4UP9 A;  5C52 B;  2C7I A;  3W3S A;  4YDQ A;  4YRK A;  1G5I A;  2ODR D;  3A31 A;  1SET A;  2DJZ A;  4XTX A;  4P75 C;  2ZXF A;  2RHS B;  2ZZG A;  1QE0 A;  4ZTZ B;  4XU2 A;  1J5W A;  2FYK A;  4XTU A;  1FYF A;  1X2G A;  3KFU A;  1YFS A;  2E1H A;  1HXD A;  5F5W A;  1B8A A;  4PG3 A;  1L0W A;  3WQZ A;  1G51 A; 
#chains in the Genus database with same CATH homology
 4YYE A;  4H2W A;  1BIB A;  4P72 C;  4XTW A;  2ZNI A;  4TVW A;  2AMC A;  1USY C;  1GGM A;  3HXV A;  4LVL A;  4LVJ A;  2Q5H A;  3M4Q A;  3UGQ A;  3RIR A;  2AMC B;  4K87 A;  4H2X A;  3V8K A;  3QO7 A;  4P3P A;  3TEH A;  4RDX A;  2I4M A;  3MEY A;  4HWP A;  3PZC A;  2E65 A;  3LSQ A;  2RHS A;  4XU3 A;  3HFZ A;  2QHT A;  2EJ9 A;  4KQE A;  3IAL A;  3V7R A;  2AKW A;  2DTI A;  3VBB A;  1EVK A;  1YB3 A;  2XTI A;  4TVA B;  2I4O A;  1SER A;  1B76 A;  2Q5I A;  2ZT7 A;  1PYS A;  4YRM A;  2Q7H A;  4WI1 A;  3A74 A;  12AS A;  4XU1 A;  3E9I A;  1NJ2 A;  3HXY A;  5K1X A;  1KMM A;  5E3I A;  1Z7M A;  3RKW A;  5K1P A;  1EVL A;  1ATI A;  1EIY A;  1JJC B;  1NJ8 A;  4P73 A;  4XU0 A;  4LVK A;  5ELN A;  3LSS A;  4YRI A;  4UP7 A;  4KR3 A;  1WNL A;  3OD1 A;  3L4G A;  4CH6 A;  4EX5 A;  4NCX A;  2I4N A;  4DQ2 A;  2ZZF A;  3QO5 A;  4YP0 A;  2ZIO A;  2DU5 A;  2DEQ A;  4TVY A;  3L2Z A;  1NYR A;  2RHQ B;  1H4T A;  3BFM A;  1WU7 A;  4UP8 A;  3A7U A;  3QO8 A;  3PCO B;  4J15 A;  2DTH A;  4TQD A;  3PCO A;  2DDZ A;  4YRN A;  2C8M A;  4H2Y A;  2ZNJ A;  1PYS B;  1WPY A;  1G5H A;  1NYQ A;  3TEG A;  4CS2 A;  1RIQ A;  2ZT5 A;  2E5A A;  4RQF A;  3LC0 A;  1BBW A;  3V8J A;  3P8T A;  2G4C A;  4LVI A;  3UGT A;  1H4Q A;  4YRS A;  3QTC A;  4P3O A;  4X5O A;  1E22 A;  4Q15 A;  1Z7N A;  1WQW A;  4UPA A;  3RKX A;  2ZTG A;  4WF2 A;  4XEM A;  5ELO A;  4DPG A;  2P5I A;  4YRF A;  2DXT A;  4YRG A;  1C0A A;  3A5Y A;  4H2S A;  4YRT A;  2DVE A;  3REX A;  5HGQ A;  2ALY B;  3V7C A;  3RF1 A;  1YFT A;  3HY1 A;  2J3M A;  2P0L A;  3HXW A;  2NS6 A;  4P71 C;  2XGT A;  1LYL A;  1HC7 A;  2ODR C;  1NJ1 A;  3L1A A;  2ZIN A;  3UH0 A;  3E9H A;  4P71 A;  2J3L A;  4XTY A;  1QF6 A;  4TWA A;  4P74 C;  4RMF A;  2Q7G A;  1X01 A;  5C51 B;  1X55 A;  3HY0 A;  1ADJ A;  4TVA A;  1HTT A;  1VQZ A;  2ZT6 A;  1B70 A;  2RHQ A;  1E1O A;  3IG2 A;  4XTZ A;  3EFS A;  2EJF A;  4LNS A;  4YCV A;  4P74 A;  2ZIM A;  3NEM A;  1WYD A;  3IKL A;  1NNH A;  2E64 A;  3HXU A;  4YRQ A;  1ADY A;  2CJB A;  2ZR3 A;  4RQE A;  5C53 B;  4YRC A;  3VQW A;  3V7S A;  4HWO A;  4K86 A;  1SRY A;  2EL9 A;  2CJA A;  4H2X B;  1WLE A;  2ARS A;  4CS4 A;  4HVC A;  4XTV A;  4WJ3 M;  1W66 A;  3RL6 A;  4Q6G A;  3RAC A;  3R07 A;  1EQR A;  2ALY A;  4CH4 A;  4YRL A;  3EFR A;  1E24 A;  4L87 A;  2DQ0 A;  4H2T A;  1EIY B;  1B7Y B;  3CMQ A;  4YRE A;  3HRI A;  1NJ5 A;  3P8V A;  3ERR A;  4YCU A;  4BWA A;  4YPF A;  4BW9 A;  3HXX A;  3MQZ A;  2Q7E A;  4XEO A;  2PMF A;  2ZT8 A;  2QHS A;  2DKG A;  2QHV A;  1EFW A;  2ART A;  4TTV A;  1YGB A;  2ARU A;  4AH6 A;  3HFZ B;  4YRR A;  2DZC A;  2DZ9 A;  1WQ7 A;  1SES A;  3UFG A;  3FJP A;  3A7A A;  4OLF A;  1H4S A;  3L4G B;  1USY A;  4G84 A;  11AS A;  1KOG A;  1B7Y A;  4CH5 A;  2CGH A;  4HWT A;  3TEH B;  1X2H A;  4OP0 A;  2DTO A;  2PME A;  3RGL A;  2CIM A;  4P73 C;  4YRO A;  4EO4 A;  2ZCE A;  4LVM A;  1B70 B;  2E3C A;  2E41 A;  1IL2 A;  1EOV A;  4E51 A;  2E10 A;  1NJ6 A;  2AKW B;  2DXU A;  4HA8 A;  1X56 A;  1KMN A;  3DSQ A;  2IY5 A;  2EJG A;  3A7R A;  3RUX A;  2ZGW A;  2EWN A;  3NEN A;  3NET A;  1BBU A;  5KNN A;  4H02 A;  3TUP A;  4K88 A;  4ZIB A;  4H2V A;  4YCW A;  1BIA A;  3MF1 A;  1N9W A;  3HTZ A;  2I4L A;  2ZR2 A;  4KR2 A;  2DU7 A;  4O2D A;  2A8E A;  4P72 A;  3IKM B;  4G85 A;  2HNI A;  2EAY A;  4HWR A;  3NEL A;  3VQV A;  3VQX A;  3M4P A;  1YFR A;  1ASY A;  1X54 A;  1JJC A;  3G1Z A;  3QNE A;  4HWS A;  4CH3 A;  4H2U A;  4YRJ A;  3REU A;  2ZZE A;  3P8Y A;  3HXZ A;  3VQY A;  3I7F A;  4P75 A;  4HT4 A;  1H4V B;  4TQF A;  4CS3 A;  4PHC A;  4P3N A;  2DQ3 A;  3MF2 A;  3BJU A;  2IY5 B;  3HRK A;  3ICA A;  3A32 A;  4WJ4 A;  4ZTU B;  1ASZ A;  1E1T A;  4YRP A;  2CJ9 A;  3A5Z A;  3HFV A;  3V8L A;  3RKY A;  2QHU A;  4UP9 A;  5C52 B;  2C7I A;  3W3S A;  4YDQ A;  4YRK A;  1G5I A;  2ODR D;  3A31 A;  1SET A;  2DJZ A;  4XTX A;  4P75 C;  2ZXF A;  2RHS B;  2ZZG A;  1QE0 A;  4ZTZ B;  4XU2 A;  1J5W A;  2FYK A;  4XTU A;  1FYF A;  1X2G A;  3KFU A;  1YFS A;  2E1H A;  1HXD A;  5F5W A;  1B8A A;  4PG3 A;  1L0W A;  3WQZ A;  1G51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...