4LVJA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt). mn-bound crystal structure at ph 5.5
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
192
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVFSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid recombination enzyme
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Dna binding protein/dna
total genus 63
structure length 192
sequence length 195
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lvjA01
4HT4A 4LVLA 4LVIA 4LVKA 2NS6A 4LVMA 4LVJA
chains in the Genus database with same CATH superfamily
1X56A 1SESA 4UP7A 1H4VB 1RIQA 4CH3A 1QE0A 3QTCA 4WJ3M 3MF1A 4UP8A 4OLFA 4E51A 1EIYB 4XTYA 3PCOA 3HFZA 2C8MA 2ZT5A 1ATIA 5K1PA 3HXWA 3V7SA 3W3SA 5ELNA 3HRIA 1BBUA 4TTVA 3RKYA 3HTZA 4O2DA 3IALA 3P8YA 2RHQA 2CJAA 2Q5IA 2Q7GA 3REUA 4H2XB 3HXUA 2E3CA 4RQEA 4H2WA 4P3PA 2J3MA 2J3LA 4H2UA 1WQWA 1HXDA 4P72C 4XTZA 2I4NA 4P72A 3HXZA 1SRYA 1KMNA 3RKWA 1ADYA 1WNLA 1NYQA 2DJZA 3A74A 4Q6GA 4HWOA 3HRKA 2ZT7A 2ODRD 2ZXFA 4J15A 3VQXA 4CS3A 4P71C 2IY5A 4XU2A 3HXYA 2I4LA 1H4QA 2ZR3A 4H2VA 4YYEA 4YRGA 3LSQA 4HWPA 2CJBA 2DXTA 2Q5HA 3QO8A 2ZNIA 4LVIA 3R07A 4L87A 4K86A 4KR3A 1B70A 1YFRA 3OD1A 4K88A 3G1ZA 2I4OA 2E64A 4RDXA 1H4SA 2RHSB 2AMCB 2E65A 1USYC 3VQWA 4XEOA 4WF2A 3L4GB 3RIRA 3A5ZA 2QHVA 4YP0A 4YRIA 2ZNJA 4CH5A 2E10A 5F5WA 2NS6A 4XEMA 1NJ2A 4ZTZB 1EOVA 3ICAA 1FYFA 2EJ9A 4EX5A 3UFGA 1WU7A 4YRKA 3E9HA 1NJ5A 1BIAA 1HTTA 1J5WA 2ZINA 4HWTA 3QO5A 1Z7NA 3A31A 1W66A 4LVJA 1NJ6A 3LSSA 1WQ7A 1X2HA 3EFSA 3RGLA 1HC7A 5C51B 1SETA 2CGHA 2EWNA 5HGQA 2ZT8A 5K1XA 4K87A 4PG3A 2DTOA 4YROA 3UH0A 2ARTA 1BIBA 3IKLA 4DQ2A 4HT4A 1VQZA 1WLEA 4H2YA 1X54A 2DKGA 1LYLA 1G5HA 3IG2A 2AKWA 2C7IA 3KFUA 2E41A 2ZZFA 4P75A 4YCVA 2ZCEA 2ARUA 4YRTA 4ZIBA 2ALYA 1YFSA 3PCOB 3HFZB 11ASA 3L1AA 1E1OA 3VQVA 4HWRA 3HFVA 3QNEA 2DQ0A 1WYDA 1JJCA 3NELA 1NJ8A 2I4MA 2PMFA 4LVMA 3QO7A 1WPYA 3V8JA 1E24A 3V7RA 4P3OA 4YRMA 4YCWA 2DEQA 1NYRA 2EAYA 1NJ1A 1QF6A 4KR2A 2RHQB 1BBWA 4TVYA 1G51A 4XU1A 4XU3A 4YRNA 1X01A 2ZZGA 2ZIOA 12ASA 1EFWA 3V8KA 4CH6A 4XTWA 2DQ3A 3BFMA 4G85A 3PZCA 2EJFA 3HY1A 1PYSA 3E9IA 3TEHA 4UPAA 4H02A 2Q7HA 3P8VA 4P74C 2ARSA 4YRJA 1KOGA 4YRQA 2E1HA 2IY5B 5KNNA 1H4TA 4P74A 2ZR2A 4HVCA 2ZGWA 1E22A 3RUXA 1L0WA 3VQYA 3BJUA 3RKXA 1NNHA 1C0AA 1X55A 3NETA 1ASZA 3EFRA 3ERRA 3MF2A 4RMFA 5E3IA 4LVLA 3A7UA 2DDZA 1B70B 1E1TA 3TUPA 4WI1A 3FJPA 2QHUA 4YREA 1X2GA 4ZTUB 4Q15A 2HNIA 4G84A 3A32A 2FYKA 4LVKA 2DZCA 4YPFA 3CMQA 3P8TA 1N9WA 2P0LA 4NCXA 4XTUA 4AH6A 1PYSB 3TEHB 3M4PA 3L2ZA 1B8AA 4BW9A 3HXVA 2DU7A 2A8EA 2Q7EA 1YB3A 4P75C 3V7CA 4PHCA 4HWSA 4UP9A 1B7YA 4HA8A 3A7AA 3UGTA 4DPGA 2G4CA 2XTIA 3A5YA 2QHSA 4X5OA 2ZT6A 2ODRC 3V8LA 3VBBA 1EVLA 3A7RA 4TQFA 4XTXA 3I7FA 3RL6A 2ZIMA 4KQEA 4TVAA 5C53B 2RHSA 2AMCA 1GGMA 1ADJA 3RACA 2DTIA 3REXA 3L4GA 5ELOA 3NEMA 2ZTGA 3UGQA 4CS2A 1EVKA 1IL2A 2P5IA 3WQZA 2AKWB 4CS4A 1G5IA 3M4QA 1B7YB 4XTVA 4P71A 2DU5A 4YRPA 2PMEA 3TEGA 3LC0A 4YCUA 2DZ9A 4XU0A 4YDQA 3NENA 1SERA 3MEYA 2ALYB 2DXUA 2CJ9A 1B76A 3RF1A 2QHTA 1EIYA 2ZZEA 2DTHA 3HXXA 2DVEA 4TVWA 1JJCB 4TVAB 4CH4A 4TWAA 1EQRA 4WJ4A 1YGBA 2XGTA 3IKMB 1KMMA 2E5AA 4P3NA 1USYA 2EJGA 4P73C 4YRCA 4P73A 4RQFA 4TQDA 1YFTA 4H2TA 4LNSA 1Z7MA 4BWAA 4OP0A 3DSQA 5C52B 1ASYA 4H2SA 4YRFA 2CIMA 4YRLA 4YRSA 3HY0A 4YRRA 4EO4A 3MQZA 2EL9A 4H2XA
chains in the Genus database with same CATH topology
1X56A 1SESA 4UP7A 1H4VB 1RIQA 4CH3A 1QE0A 3QTCA 4WJ3M 3MF1A 4UP8A 4OLFA 4E51A 1EIYB 4XTYA 3PCOA 3HFZA 2C8MA 2ZT5A 1ATIA 5K1PA 3HXWA 3V7SA 3W3SA 5ELNA 3HRIA 1BBUA 4TTVA 3RKYA 3HTZA 4O2DA 3IALA 3P8YA 2RHQA 2CJAA 2Q5IA 2Q7GA 3REUA 4H2XB 3HXUA 2E3CA 4RQEA 4H2WA 4P3PA 2J3MA 2J3LA 4H2UA 1WQWA 1HXDA 4P72C 4XTZA 2I4NA 4P72A 3HXZA 1SRYA 1KMNA 3RKWA 1ADYA 1WNLA 1NYQA 2DJZA 3A74A 4Q6GA 4HWOA 3HRKA 2ZT7A 2ODRD 2ZXFA 4J15A 3VQXA 4CS3A 4P71C 2IY5A 4XU2A 3HXYA 2I4LA 1H4QA 2ZR3A 4H2VA 4YYEA 4YRGA 3LSQA 4HWPA 2CJBA 2DXTA 2Q5HA 3QO8A 2ZNIA 4LVIA 3R07A 4L87A 4K86A 4KR3A 1B70A 1YFRA 3OD1A 4K88A 3G1ZA 2I4OA 2E64A 4RDXA 1H4SA 2RHSB 2AMCB 2E65A 1USYC 3VQWA 4XEOA 4WF2A 3L4GB 3RIRA 3A5ZA 2QHVA 4YP0A 4YRIA 2ZNJA 4CH5A 2E10A 5F5WA 2NS6A 4XEMA 1NJ2A 4ZTZB 1EOVA 3ICAA 1FYFA 2EJ9A 4EX5A 3UFGA 1WU7A 4YRKA 3E9HA 1NJ5A 1BIAA 1HTTA 1J5WA 2ZINA 4HWTA 3QO5A 1Z7NA 3A31A 1W66A 4LVJA 1NJ6A 3LSSA 1WQ7A 1X2HA 3EFSA 3RGLA 1HC7A 5C51B 1SETA 2CGHA 2EWNA 5HGQA 2ZT8A 5K1XA 4K87A 4PG3A 2DTOA 4YROA 3UH0A 2ARTA 1BIBA 3IKLA 4DQ2A 4HT4A 1VQZA 1WLEA 4H2YA 1X54A 2DKGA 1LYLA 1G5HA 3IG2A 2AKWA 2C7IA 3KFUA 2E41A 2ZZFA 4P75A 4YCVA 2ZCEA 2ARUA 4YRTA 4ZIBA 2ALYA 1YFSA 3PCOB 3HFZB 11ASA 3L1AA 1E1OA 3VQVA 4HWRA 3HFVA 3QNEA 2DQ0A 1WYDA 1JJCA 3NELA 1NJ8A 2I4MA 2PMFA 4LVMA 3QO7A 1WPYA 3V8JA 1E24A 3V7RA 4P3OA 4YRMA 4YCWA 2DEQA 1NYRA 2EAYA 1NJ1A 1QF6A 4KR2A 2RHQB 1BBWA 4TVYA 1G51A 4XU1A 4XU3A 4YRNA 1X01A 2ZZGA 2ZIOA 12ASA 1EFWA 3V8KA 4CH6A 4XTWA 2DQ3A 3BFMA 4G85A 3PZCA 2EJFA 3HY1A 1PYSA 3E9IA 3TEHA 4UPAA 4H02A 2Q7HA 3P8VA 4P74C 2ARSA 4YRJA 1KOGA 4YRQA 2E1HA 2IY5B 5KNNA 1H4TA 4P74A 2ZR2A 4HVCA 2ZGWA 1E22A 3RUXA 1L0WA 3VQYA 3BJUA 3RKXA 1NNHA 1C0AA 1X55A 3NETA 1ASZA 3EFRA 3ERRA 3MF2A 4RMFA 5E3IA 4LVLA 3A7UA 2DDZA 1B70B 1E1TA 3TUPA 4WI1A 3FJPA 2QHUA 4YREA 1X2GA 4ZTUB 4Q15A 2HNIA 4G84A 3A32A 2FYKA 4LVKA 2DZCA 4YPFA 3CMQA 3P8TA 1N9WA 2P0LA 4NCXA 4XTUA 4AH6A 1PYSB 3TEHB 3M4PA 3L2ZA 1B8AA 4BW9A 3HXVA 2DU7A 2A8EA 2Q7EA 1YB3A 4P75C 3V7CA 4PHCA 4HWSA 4UP9A 1B7YA 4HA8A 3A7AA 3UGTA 4DPGA 2G4CA 2XTIA 3A5YA 2QHSA 4X5OA 2ZT6A 2ODRC 3V8LA 3VBBA 1EVLA 3A7RA 4TQFA 4XTXA 3I7FA 3RL6A 2ZIMA 4KQEA 4TVAA 5C53B 2RHSA 2AMCA 1GGMA 1ADJA 3RACA 2DTIA 3REXA 3L4GA 5ELOA 3NEMA 2ZTGA 3UGQA 4CS2A 1EVKA 1IL2A 2P5IA 3WQZA 2AKWB 4CS4A 1G5IA 3M4QA 1B7YB 4XTVA 4P71A 2DU5A 4YRPA 2PMEA 3TEGA 3LC0A 4YCUA 2DZ9A 4XU0A 4YDQA 3NENA 1SERA 3MEYA 2ALYB 2DXUA 2CJ9A 1B76A 3RF1A 2QHTA 1EIYA 2ZZEA 2DTHA 3HXXA 2DVEA 4TVWA 1JJCB 4TVAB 4CH4A 4TWAA 1EQRA 4WJ4A 1YGBA 2XGTA 3IKMB 1KMMA 2E5AA 4P3NA 1USYA 2EJGA 4P73C 4YRCA 4P73A 4RQFA 4TQDA 1YFTA 4H2TA 4LNSA 1Z7MA 4BWAA 4OP0A 3DSQA 5C52B 1ASYA 4H2SA 4YRFA 2CIMA 4YRLA 4YRSA 3HY0A 4YRRA 4EO4A 3MQZA 2EL9A 4H2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HT4 A;  4LVL A;  4LVI A;  4LVK A;  2NS6 A;  4LVM A;  4LVJ A; 
#chains in the Genus database with same CATH topology
 1X56 A;  1SES A;  4UP7 A;  1H4V B;  1RIQ A;  4CH3 A;  1QE0 A;  3QTC A;  4WJ3 M;  3MF1 A;  4UP8 A;  4OLF A;  4E51 A;  1EIY B;  4XTY A;  3PCO A;  3HFZ A;  2C8M A;  2ZT5 A;  1ATI A;  5K1P A;  3HXW A;  3V7S A;  3W3S A;  5ELN A;  3HRI A;  1BBU A;  4TTV A;  3RKY A;  3HTZ A;  4O2D A;  3IAL A;  3P8Y A;  2RHQ A;  2CJA A;  2Q5I A;  2Q7G A;  3REU A;  4H2X B;  3HXU A;  2E3C A;  4RQE A;  4H2W A;  4P3P A;  2J3M A;  2J3L A;  4H2U A;  1WQW A;  1HXD A;  4P72 C;  4XTZ A;  2I4N A;  4P72 A;  3HXZ A;  1SRY A;  1KMN A;  3RKW A;  1ADY A;  1WNL A;  1NYQ A;  2DJZ A;  3A74 A;  4Q6G A;  4HWO A;  3HRK A;  2ZT7 A;  2ODR D;  2ZXF A;  4J15 A;  3VQX A;  4CS3 A;  4P71 C;  2IY5 A;  4XU2 A;  3HXY A;  2I4L A;  1H4Q A;  2ZR3 A;  4H2V A;  4YYE A;  4YRG A;  3LSQ A;  4HWP A;  2CJB A;  2DXT A;  2Q5H A;  3QO8 A;  2ZNI A;  4LVI A;  3R07 A;  4L87 A;  4K86 A;  4KR3 A;  1B70 A;  1YFR A;  3OD1 A;  4K88 A;  3G1Z A;  2I4O A;  2E64 A;  4RDX A;  1H4S A;  2RHS B;  2AMC B;  2E65 A;  1USY C;  3VQW A;  4XEO A;  4WF2 A;  3L4G B;  3RIR A;  3A5Z A;  2QHV A;  4YP0 A;  4YRI A;  2ZNJ A;  4CH5 A;  2E10 A;  5F5W A;  2NS6 A;  4XEM A;  1NJ2 A;  4ZTZ B;  1EOV A;  3ICA A;  1FYF A;  2EJ9 A;  4EX5 A;  3UFG A;  1WU7 A;  4YRK A;  3E9H A;  1NJ5 A;  1BIA A;  1HTT A;  1J5W A;  2ZIN A;  4HWT A;  3QO5 A;  1Z7N A;  3A31 A;  1W66 A;  4LVJ A;  1NJ6 A;  3LSS A;  1WQ7 A;  1X2H A;  3EFS A;  3RGL A;  1HC7 A;  5C51 B;  1SET A;  2CGH A;  2EWN A;  5HGQ A;  2ZT8 A;  5K1X A;  4K87 A;  4PG3 A;  2DTO A;  4YRO A;  3UH0 A;  2ART A;  1BIB A;  3IKL A;  4DQ2 A;  4HT4 A;  1VQZ A;  1WLE A;  4H2Y A;  1X54 A;  2DKG A;  1LYL A;  1G5H A;  3IG2 A;  2AKW A;  2C7I A;  3KFU A;  2E41 A;  2ZZF A;  4P75 A;  4YCV A;  2ZCE A;  2ARU A;  4YRT A;  4ZIB A;  2ALY A;  1YFS A;  3PCO B;  3HFZ B;  11AS A;  3L1A A;  1E1O A;  3VQV A;  4HWR A;  3HFV A;  3QNE A;  2DQ0 A;  1WYD A;  1JJC A;  3NEL A;  1NJ8 A;  2I4M A;  2PMF A;  4LVM A;  3QO7 A;  1WPY A;  3V8J A;  1E24 A;  3V7R A;  4P3O A;  4YRM A;  4YCW A;  2DEQ A;  1NYR A;  2EAY A;  1NJ1 A;  1QF6 A;  4KR2 A;  2RHQ B;  1BBW A;  4TVY A;  1G51 A;  4XU1 A;  4XU3 A;  4YRN A;  1X01 A;  2ZZG A;  2ZIO A;  12AS A;  1EFW A;  3V8K A;  4CH6 A;  4XTW A;  2DQ3 A;  3BFM A;  4G85 A;  3PZC A;  2EJF A;  3HY1 A;  1PYS A;  3E9I A;  3TEH A;  4UPA A;  4H02 A;  2Q7H A;  3P8V A;  4P74 C;  2ARS A;  4YRJ A;  1KOG A;  4YRQ A;  2E1H A;  2IY5 B;  5KNN A;  1H4T A;  4P74 A;  2ZR2 A;  4HVC A;  2ZGW A;  1E22 A;  3RUX A;  1L0W A;  3VQY A;  3BJU A;  3RKX A;  1NNH A;  1C0A A;  1X55 A;  3NET A;  1ASZ A;  3EFR A;  3ERR A;  3MF2 A;  4RMF A;  5E3I A;  4LVL A;  3A7U A;  2DDZ A;  1B70 B;  1E1T A;  3TUP A;  4WI1 A;  3FJP A;  2QHU A;  4YRE A;  1X2G A;  4ZTU B;  4Q15 A;  2HNI A;  4G84 A;  3A32 A;  2FYK A;  4LVK A;  2DZC A;  4YPF A;  3CMQ A;  3P8T A;  1N9W A;  2P0L A;  4NCX A;  4XTU A;  4AH6 A;  1PYS B;  3TEH B;  3M4P A;  3L2Z A;  1B8A A;  4BW9 A;  3HXV A;  2DU7 A;  2A8E A;  2Q7E A;  1YB3 A;  4P75 C;  3V7C A;  4PHC A;  4HWS A;  4UP9 A;  1B7Y A;  4HA8 A;  3A7A A;  3UGT A;  4DPG A;  2G4C A;  2XTI A;  3A5Y A;  2QHS A;  4X5O A;  2ZT6 A;  2ODR C;  3V8L A;  3VBB A;  1EVL A;  3A7R A;  4TQF A;  4XTX A;  3I7F A;  3RL6 A;  2ZIM A;  4KQE A;  4TVA A;  5C53 B;  2RHS A;  2AMC A;  1GGM A;  1ADJ A;  3RAC A;  2DTI A;  3REX A;  3L4G A;  5ELO A;  3NEM A;  2ZTG A;  3UGQ A;  4CS2 A;  1EVK A;  1IL2 A;  2P5I A;  3WQZ A;  2AKW B;  4CS4 A;  1G5I A;  3M4Q A;  1B7Y B;  4XTV A;  4P71 A;  2DU5 A;  4YRP A;  2PME A;  3TEG A;  3LC0 A;  4YCU A;  2DZ9 A;  4XU0 A;  4YDQ A;  3NEN A;  1SER A;  3MEY A;  2ALY B;  2DXU A;  2CJ9 A;  1B76 A;  3RF1 A;  2QHT A;  1EIY A;  2ZZE A;  2DTH A;  3HXX A;  2DVE A;  4TVW A;  1JJC B;  4TVA B;  4CH4 A;  4TWA A;  1EQR A;  4WJ4 A;  1YGB A;  2XGT A;  3IKM B;  1KMM A;  2E5A A;  4P3N A;  1USY A;  2EJG A;  4P73 C;  4YRC A;  4P73 A;  4RQF A;  4TQD A;  1YFT A;  4H2T A;  4LNS A;  1Z7M A;  4BWA A;  4OP0 A;  3DSQ A;  5C52 B;  1ASY A;  4H2S A;  4YRF A;  2CIM A;  4YRL A;  4YRS A;  3HY0 A;  4YRR A;  4EO4 A;  3MQZ A;  2EL9 A;  4H2X A; 
#chains in the Genus database with same CATH homology
 1X56 A;  1SES A;  4UP7 A;  1H4V B;  1RIQ A;  4CH3 A;  1QE0 A;  3QTC A;  4WJ3 M;  3MF1 A;  4UP8 A;  4OLF A;  4E51 A;  1EIY B;  4XTY A;  3PCO A;  3HFZ A;  2C8M A;  2ZT5 A;  1ATI A;  5K1P A;  3HXW A;  3V7S A;  3W3S A;  5ELN A;  3HRI A;  1BBU A;  4TTV A;  3RKY A;  3HTZ A;  4O2D A;  3IAL A;  3P8Y A;  2RHQ A;  2CJA A;  2Q5I A;  2Q7G A;  3REU A;  4H2X B;  3HXU A;  2E3C A;  4RQE A;  4H2W A;  4P3P A;  2J3M A;  2J3L A;  4H2U A;  1WQW A;  1HXD A;  4P72 C;  4XTZ A;  2I4N A;  4P72 A;  3HXZ A;  1SRY A;  1KMN A;  3RKW A;  1ADY A;  1WNL A;  1NYQ A;  2DJZ A;  3A74 A;  4Q6G A;  4HWO A;  3HRK A;  2ZT7 A;  2ODR D;  2ZXF A;  4J15 A;  3VQX A;  4CS3 A;  4P71 C;  2IY5 A;  4XU2 A;  3HXY A;  2I4L A;  1H4Q A;  2ZR3 A;  4H2V A;  4YYE A;  4YRG A;  3LSQ A;  4HWP A;  2CJB A;  2DXT A;  2Q5H A;  3QO8 A;  2ZNI A;  4LVI A;  3R07 A;  4L87 A;  4K86 A;  4KR3 A;  1B70 A;  1YFR A;  3OD1 A;  4K88 A;  3G1Z A;  2I4O A;  2E64 A;  4RDX A;  1H4S A;  2RHS B;  2AMC B;  2E65 A;  1USY C;  3VQW A;  4XEO A;  4WF2 A;  3L4G B;  3RIR A;  3A5Z A;  2QHV A;  4YP0 A;  4YRI A;  2ZNJ A;  4CH5 A;  2E10 A;  5F5W A;  2NS6 A;  4XEM A;  1NJ2 A;  4ZTZ B;  1EOV A;  3ICA A;  1FYF A;  2EJ9 A;  4EX5 A;  3UFG A;  1WU7 A;  4YRK A;  3E9H A;  1NJ5 A;  1BIA A;  1HTT A;  1J5W A;  2ZIN A;  4HWT A;  3QO5 A;  1Z7N A;  3A31 A;  1W66 A;  4LVJ A;  1NJ6 A;  3LSS A;  1WQ7 A;  1X2H A;  3EFS A;  3RGL A;  1HC7 A;  5C51 B;  1SET A;  2CGH A;  2EWN A;  5HGQ A;  2ZT8 A;  5K1X A;  4K87 A;  4PG3 A;  2DTO A;  4YRO A;  3UH0 A;  2ART A;  1BIB A;  3IKL A;  4DQ2 A;  4HT4 A;  1VQZ A;  1WLE A;  4H2Y A;  1X54 A;  2DKG A;  1LYL A;  1G5H A;  3IG2 A;  2AKW A;  2C7I A;  3KFU A;  2E41 A;  2ZZF A;  4P75 A;  4YCV A;  2ZCE A;  2ARU A;  4YRT A;  4ZIB A;  2ALY A;  1YFS A;  3PCO B;  3HFZ B;  11AS A;  3L1A A;  1E1O A;  3VQV A;  4HWR A;  3HFV A;  3QNE A;  2DQ0 A;  1WYD A;  1JJC A;  3NEL A;  1NJ8 A;  2I4M A;  2PMF A;  4LVM A;  3QO7 A;  1WPY A;  3V8J A;  1E24 A;  3V7R A;  4P3O A;  4YRM A;  4YCW A;  2DEQ A;  1NYR A;  2EAY A;  1NJ1 A;  1QF6 A;  4KR2 A;  2RHQ B;  1BBW A;  4TVY A;  1G51 A;  4XU1 A;  4XU3 A;  4YRN A;  1X01 A;  2ZZG A;  2ZIO A;  12AS A;  1EFW A;  3V8K A;  4CH6 A;  4XTW A;  2DQ3 A;  3BFM A;  4G85 A;  3PZC A;  2EJF A;  3HY1 A;  1PYS A;  3E9I A;  3TEH A;  4UPA A;  4H02 A;  2Q7H A;  3P8V A;  4P74 C;  2ARS A;  4YRJ A;  1KOG A;  4YRQ A;  2E1H A;  2IY5 B;  5KNN A;  1H4T A;  4P74 A;  2ZR2 A;  4HVC A;  2ZGW A;  1E22 A;  3RUX A;  1L0W A;  3VQY A;  3BJU A;  3RKX A;  1NNH A;  1C0A A;  1X55 A;  3NET A;  1ASZ A;  3EFR A;  3ERR A;  3MF2 A;  4RMF A;  5E3I A;  4LVL A;  3A7U A;  2DDZ A;  1B70 B;  1E1T A;  3TUP A;  4WI1 A;  3FJP A;  2QHU A;  4YRE A;  1X2G A;  4ZTU B;  4Q15 A;  2HNI A;  4G84 A;  3A32 A;  2FYK A;  4LVK A;  2DZC A;  4YPF A;  3CMQ A;  3P8T A;  1N9W A;  2P0L A;  4NCX A;  4XTU A;  4AH6 A;  1PYS B;  3TEH B;  3M4P A;  3L2Z A;  1B8A A;  4BW9 A;  3HXV A;  2DU7 A;  2A8E A;  2Q7E A;  1YB3 A;  4P75 C;  3V7C A;  4PHC A;  4HWS A;  4UP9 A;  1B7Y A;  4HA8 A;  3A7A A;  3UGT A;  4DPG A;  2G4C A;  2XTI A;  3A5Y A;  2QHS A;  4X5O A;  2ZT6 A;  2ODR C;  3V8L A;  3VBB A;  1EVL A;  3A7R A;  4TQF A;  4XTX A;  3I7F A;  3RL6 A;  2ZIM A;  4KQE A;  4TVA A;  5C53 B;  2RHS A;  2AMC A;  1GGM A;  1ADJ A;  3RAC A;  2DTI A;  3REX A;  3L4G A;  5ELO A;  3NEM A;  2ZTG A;  3UGQ A;  4CS2 A;  1EVK A;  1IL2 A;  2P5I A;  3WQZ A;  2AKW B;  4CS4 A;  1G5I A;  3M4Q A;  1B7Y B;  4XTV A;  4P71 A;  2DU5 A;  4YRP A;  2PME A;  3TEG A;  3LC0 A;  4YCU A;  2DZ9 A;  4XU0 A;  4YDQ A;  3NEN A;  1SER A;  3MEY A;  2ALY B;  2DXU A;  2CJ9 A;  1B76 A;  3RF1 A;  2QHT A;  1EIY A;  2ZZE A;  2DTH A;  3HXX A;  2DVE A;  4TVW A;  1JJC B;  4TVA B;  4CH4 A;  4TWA A;  1EQR A;  4WJ4 A;  1YGB A;  2XGT A;  3IKM B;  1KMM A;  2E5A A;  4P3N A;  1USY A;  2EJG A;  4P73 C;  4YRC A;  4P73 A;  4RQF A;  4TQD A;  1YFT A;  4H2T A;  4LNS A;  1Z7M A;  4BWA A;  4OP0 A;  3DSQ A;  5C52 B;  1ASY A;  4H2S A;  4YRF A;  2CIM A;  4YRL A;  4YRS A;  3HY0 A;  4YRR A;  4EO4 A;  3MQZ A;  2EL9 A;  4H2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...