4LVJA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt). mn-bound crystal structure at ph 5.5
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
192
Chain Sequence
b'SYMVARMQKMKAGNLGGAFKHNERVFSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid recombination enzyme
molecule tags Dna binding protein/dna
source organism Streptococcus agalactiae
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
total genus 63
structure length 192
sequence length 195
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lvjA01
4LVKA 4LVLA 4HT4A 2NS6A 4LVMA 4LVJA 4LVIA
chains in the Genus database with same CATH superfamily
3KFUA 1G5HA 2AKWB 2CJBA 4UP7A 3REUA 2Q5HA 1B70A 1B76A 2E1HA 4XU2A 4DQ2A 2E64A 2DU5A 4H2YA 3A74A 1J5WA 3A5YA 1WYDA 2ZR2A 1ASYA 1YFSA 4HA8A 2J3LA 4O2DA 1X54A 5C53B 5E3IA 1G5IA 3A7RA 4WJ4A 4HVCA 3VQWA 4K88A 1N9WA 1B7YB 4RDXA 2E10A 1KMMA 4YPFA 3UGTA 4LNSA 3R07A 1QF6A 2RHQB 3REXA 1YFRA 2EWNA 2P5IA 1BBUA 1W66A 2DQ3A 2ZT6A 3HXYA 3UGQA 3HFVA 4YRPA 4P3PA 3E9HA 4P71A 4P3NA 4YDQA 3MF1A 3A31A 2I4MA 1H4SA 3LSSA 4WJ3M 3HXWA 1PYSA 3RACA 4YRMA 4DPGA 3IKLA 5ELNA 4PG3A 3VQXA 2DEQA 4WI1A 2AMCB 1NJ5A 4XTUA 3ERRA 2C7IA 4ZTUB 4E51A 3MQZA 4P72C 4BWAA 4H2SA 1ASZA 3RUXA 3ICAA 2ODRC 3BJUA 3IG2A 1EQRA 3CMQA 4EX5A 4H2TA 3L4GB 1H4TA 4PHCA 2RHSA 3P8YA 2CIMA 3NETA 1X56A 4UPAA 4XU0A 3HY1A 2DXUA 1HC7A 2ZZEA 4CH6A 3TUPA 4TTVA 2E5AA 4YRIA 3A32A 3RL6A 4YRFA 3HY0A 2I4LA 4CS4A 2ZIOA 4YRNA 3HXVA 2NS6A 3PZCA 2PMEA 4CH5A 1EVKA 4ZIBA 3EFSA 4H02A 1E1OA 1EOVA 4J15A 2DTOA 2DDZA 2ZT8A 1GGMA 3RKWA 2EL9A 4YRRA 4YP0A 4TVAB 4XEMA 3TEHB 2ARTA 4P74A 2ZXFA 4CH4A 1JJCA 2E3CA 4H2UA 3TEGA 3P8VA 1Z7NA 4K87A 4CH3A 1SESA 3FJPA 3BFMA 4P75A 2EJ9A 4HWOA 1X01A 2Q7GA 5K1PA 1G51A 1USYC 4TVYA 2AMCA 11ASA 4RQFA 4AH6A 2QHTA 4CS2A 2ALYA 4H2XB 4EO4A 3V8KA 2EJFA 2I4OA 1WU7A 3HXZA 2IY5B 4KR3A 3QO8A 1C0AA 2RHSB 5C51B 2ZT5A 4YRQA 5C52B 3W3SA 1KMNA 3RF1A 1X2GA 4YRJA 4P73C 2ZTGA 3HXXA 4X5OA 4XU3A 1BBWA 1Z7MA 1B8AA 2PMFA 3M4PA 4YCUA 1YB3A 4RMFA 1YFTA 4YROA 2EJGA 3L4GA 4KQEA 2Q7EA 2J3MA 1X55A 2DKGA 3UH0A 5KNNA 1RIQA 3E9IA 1WQWA 2DJZA 3RIRA 1ATIA 4YRKA 4HWTA 1L0WA 5HGQA 4OLFA 4WF2A 4P3OA 3LC0A 4P75C 3EFRA 1EFWA 4YRTA 1FYFA 4H2VA 3I7FA 4H2XA 5ELOA 1QE0A 3V7CA 3RKXA 2IY5A 4XEOA 1NJ1A 2XTIA 2QHSA 3QTCA 4CS3A 3NELA 4TVAA 3TEHA 2ZCEA 2XGTA 1JJCB 1VQZA 3HTZA 1WQ7A 3P8TA 4TQFA 4XTVA 4YRGA 4HWSA 2ZIMA 2EAYA 3M4QA 4LVLA 4UP8A 2Q5IA 3HRIA 4ZTZB 1SERA 4HWPA 3RKYA 2ALYB 2CGHA 3HFZB 2DTHA 4TQDA 4XTWA 2ZINA 3PCOA 3RGLA 3QNEA 3IALA 1HXDA 3WQZA 2QHVA 4BW9A 1WNLA 1USYA 2ZT7A 2G4CA 3A7AA 3MEYA 4HWRA 1H4VB 2AKWA 3HXUA 4KR2A 4P74C 1EIYB 2ZNJA 1NJ6A 3NEMA 1B70B 1BIBA 4G85A 1HTTA 4Q15A 4H2WA 3MF2A 2FYKA 4UP9A 2DVEA 5K1XA 3QO7A 4XTYA 4YRSA 1SETA 3V8JA 4TVWA 4P73A 2ZR3A 3VQVA 2ZGWA 3V7RA 1NNHA 4YCVA 12ASA 3A5ZA 1EVLA 3LSQA 2ZZGA 1E22A 4P71C 2ODRD 1B7YA 1ADJA 2CJAA 2ARSA 4NCXA 2RHQA 3QO5A 2ARUA 2DQ0A 3OD1A 1NYQA 2DTIA 2ZNIA 3V7SA 3HRKA 2C8MA 4YRLA 4YREA 2I4NA 3V8LA 2E65A 1ADYA 2A8EA 4LVKA 4K86A 3L1AA 4P72A 4LVMA 1YGBA 4L87A 1PYSB 1NJ2A 3UFGA 3A7UA 1E24A 1H4QA 4G84A 2DZCA 4XU1A 1WPYA 2E41A 4LVJA 4LVIA 1EIYA 4Q6GA 1IL2A 4OP0A 3VQYA 4XTZA 2CJ9A 4YRCA 4HT4A 1KOGA 4YYEA 3VBBA 1SRYA 1WLEA 3HFZA 1LYLA 2DU7A 3L2ZA 3G1ZA 2P0LA 3PCOB 4XTXA 1NYRA 2DXTA 4YCWA 2ZZFA 3IKMB 3NENA 1E1TA 2HNIA 1NJ8A 4TWAA 2QHUA 2DZ9A 5F5WA 1X2HA 2Q7HA 1BIAA 3DSQA 4RQEA
chains in the Genus database with same CATH topology
3KFUA 1G5HA 2AKWB 2CJBA 4UP7A 3REUA 2Q5HA 1B70A 1B76A 2E1HA 4XU2A 4DQ2A 2E64A 2DU5A 4H2YA 3A74A 1J5WA 3A5YA 1WYDA 2ZR2A 1ASYA 1YFSA 4HA8A 2J3LA 4O2DA 1X54A 5C53B 5E3IA 1G5IA 3A7RA 4WJ4A 4HVCA 3VQWA 4K88A 1N9WA 1B7YB 4RDXA 2E10A 1KMMA 4YPFA 3UGTA 4LNSA 3R07A 1QF6A 2RHQB 3REXA 1YFRA 2EWNA 2P5IA 1BBUA 1W66A 2DQ3A 2ZT6A 3HXYA 3UGQA 3HFVA 4YRPA 4P3PA 3E9HA 4P71A 4P3NA 4YDQA 3MF1A 3A31A 2I4MA 1H4SA 3LSSA 4WJ3M 3HXWA 1PYSA 3RACA 4YRMA 4DPGA 3IKLA 5ELNA 4PG3A 3VQXA 2DEQA 4WI1A 2AMCB 1NJ5A 4XTUA 3ERRA 2C7IA 4ZTUB 4E51A 3MQZA 4P72C 4BWAA 4H2SA 1ASZA 3RUXA 3ICAA 2ODRC 3BJUA 3IG2A 1EQRA 3CMQA 4EX5A 4H2TA 3L4GB 1H4TA 4PHCA 2RHSA 3P8YA 2CIMA 3NETA 1X56A 4UPAA 4XU0A 3HY1A 2DXUA 1HC7A 2ZZEA 4CH6A 3TUPA 4TTVA 2E5AA 4YRIA 3A32A 3RL6A 4YRFA 3HY0A 2I4LA 4CS4A 2ZIOA 4YRNA 3HXVA 2NS6A 3PZCA 2PMEA 4CH5A 1EVKA 4ZIBA 3EFSA 4H02A 1E1OA 1EOVA 4J15A 2DTOA 2DDZA 2ZT8A 1GGMA 3RKWA 2EL9A 4YRRA 4YP0A 4TVAB 4XEMA 3TEHB 2ARTA 4P74A 2ZXFA 4CH4A 1JJCA 2E3CA 4H2UA 3TEGA 3P8VA 1Z7NA 4K87A 4CH3A 1SESA 3FJPA 3BFMA 4P75A 2EJ9A 4HWOA 1X01A 2Q7GA 5K1PA 1G51A 1USYC 4TVYA 2AMCA 11ASA 4RQFA 4AH6A 2QHTA 4CS2A 2ALYA 4H2XB 4EO4A 3V8KA 2EJFA 2I4OA 1WU7A 3HXZA 2IY5B 4KR3A 3QO8A 1C0AA 2RHSB 5C51B 2ZT5A 4YRQA 5C52B 3W3SA 1KMNA 3RF1A 1X2GA 4YRJA 4P73C 2ZTGA 3HXXA 4X5OA 4XU3A 1BBWA 1Z7MA 1B8AA 2PMFA 3M4PA 4YCUA 1YB3A 4RMFA 1YFTA 4YROA 2EJGA 3L4GA 4KQEA 2Q7EA 2J3MA 1X55A 2DKGA 3UH0A 5KNNA 1RIQA 3E9IA 1WQWA 2DJZA 3RIRA 1ATIA 4YRKA 4HWTA 1L0WA 5HGQA 4OLFA 4WF2A 4P3OA 3LC0A 4P75C 3EFRA 1EFWA 4YRTA 1FYFA 4H2VA 3I7FA 4H2XA 5ELOA 1QE0A 3V7CA 3RKXA 2IY5A 4XEOA 1NJ1A 2XTIA 2QHSA 3QTCA 4CS3A 3NELA 4TVAA 3TEHA 2ZCEA 2XGTA 1JJCB 1VQZA 3HTZA 1WQ7A 3P8TA 4TQFA 4XTVA 4YRGA 4HWSA 2ZIMA 2EAYA 3M4QA 4LVLA 4UP8A 2Q5IA 3HRIA 4ZTZB 1SERA 4HWPA 3RKYA 2ALYB 2CGHA 3HFZB 2DTHA 4TQDA 4XTWA 2ZINA 3PCOA 3RGLA 3QNEA 3IALA 1HXDA 3WQZA 2QHVA 4BW9A 1WNLA 1USYA 2ZT7A 2G4CA 3A7AA 3MEYA 4HWRA 1H4VB 2AKWA 3HXUA 4KR2A 4P74C 1EIYB 2ZNJA 1NJ6A 3NEMA 1B70B 1BIBA 4G85A 1HTTA 4Q15A 4H2WA 3MF2A 2FYKA 4UP9A 2DVEA 5K1XA 3QO7A 4XTYA 4YRSA 1SETA 3V8JA 4TVWA 4P73A 2ZR3A 3VQVA 2ZGWA 3V7RA 1NNHA 4YCVA 12ASA 3A5ZA 1EVLA 3LSQA 2ZZGA 1E22A 4P71C 2ODRD 1B7YA 1ADJA 2CJAA 2ARSA 4NCXA 2RHQA 3QO5A 2ARUA 2DQ0A 3OD1A 1NYQA 2DTIA 2ZNIA 3V7SA 3HRKA 2C8MA 4YRLA 4YREA 2I4NA 3V8LA 2E65A 1ADYA 2A8EA 4LVKA 4K86A 3L1AA 4P72A 4LVMA 1YGBA 4L87A 1PYSB 1NJ2A 3UFGA 3A7UA 1E24A 1H4QA 4G84A 2DZCA 4XU1A 1WPYA 2E41A 4LVJA 4LVIA 1EIYA 4Q6GA 1IL2A 4OP0A 3VQYA 4XTZA 2CJ9A 4YRCA 4HT4A 1KOGA 4YYEA 3VBBA 1SRYA 1WLEA 3HFZA 1LYLA 2DU7A 3L2ZA 3G1ZA 2P0LA 3PCOB 4XTXA 1NYRA 2DXTA 4YCWA 2ZZFA 3IKMB 3NENA 1E1TA 2HNIA 1NJ8A 4TWAA 2QHUA 2DZ9A 5F5WA 1X2HA 2Q7HA 1BIAA 3DSQA 4RQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVK A;  4LVL A;  4HT4 A;  2NS6 A;  4LVM A;  4LVJ A;  4LVI A; 
#chains in the Genus database with same CATH topology
 3KFU A;  1G5H A;  2AKW B;  2CJB A;  4UP7 A;  3REU A;  2Q5H A;  1B70 A;  1B76 A;  2E1H A;  4XU2 A;  4DQ2 A;  2E64 A;  2DU5 A;  4H2Y A;  3A74 A;  1J5W A;  3A5Y A;  1WYD A;  2ZR2 A;  1ASY A;  1YFS A;  4HA8 A;  2J3L A;  4O2D A;  1X54 A;  5C53 B;  5E3I A;  1G5I A;  3A7R A;  4WJ4 A;  4HVC A;  3VQW A;  4K88 A;  1N9W A;  1B7Y B;  4RDX A;  2E10 A;  1KMM A;  4YPF A;  3UGT A;  4LNS A;  3R07 A;  1QF6 A;  2RHQ B;  3REX A;  1YFR A;  2EWN A;  2P5I A;  1BBU A;  1W66 A;  2DQ3 A;  2ZT6 A;  3HXY A;  3UGQ A;  3HFV A;  4YRP A;  4P3P A;  3E9H A;  4P71 A;  4P3N A;  4YDQ A;  3MF1 A;  3A31 A;  2I4M A;  1H4S A;  3LSS A;  4WJ3 M;  3HXW A;  1PYS A;  3RAC A;  4YRM A;  4DPG A;  3IKL A;  5ELN A;  4PG3 A;  3VQX A;  2DEQ A;  4WI1 A;  2AMC B;  1NJ5 A;  4XTU A;  3ERR A;  2C7I A;  4ZTU B;  4E51 A;  3MQZ A;  4P72 C;  4BWA A;  4H2S A;  1ASZ A;  3RUX A;  3ICA A;  2ODR C;  3BJU A;  3IG2 A;  1EQR A;  3CMQ A;  4EX5 A;  4H2T A;  3L4G B;  1H4T A;  4PHC A;  2RHS A;  3P8Y A;  2CIM A;  3NET A;  1X56 A;  4UPA A;  4XU0 A;  3HY1 A;  2DXU A;  1HC7 A;  2ZZE A;  4CH6 A;  3TUP A;  4TTV A;  2E5A A;  4YRI A;  3A32 A;  3RL6 A;  4YRF A;  3HY0 A;  2I4L A;  4CS4 A;  2ZIO A;  4YRN A;  3HXV A;  2NS6 A;  3PZC A;  2PME A;  4CH5 A;  1EVK A;  4ZIB A;  3EFS A;  4H02 A;  1E1O A;  1EOV A;  4J15 A;  2DTO A;  2DDZ A;  2ZT8 A;  1GGM A;  3RKW A;  2EL9 A;  4YRR A;  4YP0 A;  4TVA B;  4XEM A;  3TEH B;  2ART A;  4P74 A;  2ZXF A;  4CH4 A;  1JJC A;  2E3C A;  4H2U A;  3TEG A;  3P8V A;  1Z7N A;  4K87 A;  4CH3 A;  1SES A;  3FJP A;  3BFM A;  4P75 A;  2EJ9 A;  4HWO A;  1X01 A;  2Q7G A;  5K1P A;  1G51 A;  1USY C;  4TVY A;  2AMC A;  11AS A;  4RQF A;  4AH6 A;  2QHT A;  4CS2 A;  2ALY A;  4H2X B;  4EO4 A;  3V8K A;  2EJF A;  2I4O A;  1WU7 A;  3HXZ A;  2IY5 B;  4KR3 A;  3QO8 A;  1C0A A;  2RHS B;  5C51 B;  2ZT5 A;  4YRQ A;  5C52 B;  3W3S A;  1KMN A;  3RF1 A;  1X2G A;  4YRJ A;  4P73 C;  2ZTG A;  3HXX A;  4X5O A;  4XU3 A;  1BBW A;  1Z7M A;  1B8A A;  2PMF A;  3M4P A;  4YCU A;  1YB3 A;  4RMF A;  1YFT A;  4YRO A;  2EJG A;  3L4G A;  4KQE A;  2Q7E A;  2J3M A;  1X55 A;  2DKG A;  3UH0 A;  5KNN A;  1RIQ A;  3E9I A;  1WQW A;  2DJZ A;  3RIR A;  1ATI A;  4YRK A;  4HWT A;  1L0W A;  5HGQ A;  4OLF A;  4WF2 A;  4P3O A;  3LC0 A;  4P75 C;  3EFR A;  1EFW A;  4YRT A;  1FYF A;  4H2V A;  3I7F A;  4H2X A;  5ELO A;  1QE0 A;  3V7C A;  3RKX A;  2IY5 A;  4XEO A;  1NJ1 A;  2XTI A;  2QHS A;  3QTC A;  4CS3 A;  3NEL A;  4TVA A;  3TEH A;  2ZCE A;  2XGT A;  1JJC B;  1VQZ A;  3HTZ A;  1WQ7 A;  3P8T A;  4TQF A;  4XTV A;  4YRG A;  4HWS A;  2ZIM A;  2EAY A;  3M4Q A;  4LVL A;  4UP8 A;  2Q5I A;  3HRI A;  4ZTZ B;  1SER A;  4HWP A;  3RKY A;  2ALY B;  2CGH A;  3HFZ B;  2DTH A;  4TQD A;  4XTW A;  2ZIN A;  3PCO A;  3RGL A;  3QNE A;  3IAL A;  1HXD A;  3WQZ A;  2QHV A;  4BW9 A;  1WNL A;  1USY A;  2ZT7 A;  2G4C A;  3A7A A;  3MEY A;  4HWR A;  1H4V B;  2AKW A;  3HXU A;  4KR2 A;  4P74 C;  1EIY B;  2ZNJ A;  1NJ6 A;  3NEM A;  1B70 B;  1BIB A;  4G85 A;  1HTT A;  4Q15 A;  4H2W A;  3MF2 A;  2FYK A;  4UP9 A;  2DVE A;  5K1X A;  3QO7 A;  4XTY A;  4YRS A;  1SET A;  3V8J A;  4TVW A;  4P73 A;  2ZR3 A;  3VQV A;  2ZGW A;  3V7R A;  1NNH A;  4YCV A;  12AS A;  3A5Z A;  1EVL A;  3LSQ A;  2ZZG A;  1E22 A;  4P71 C;  2ODR D;  1B7Y A;  1ADJ A;  2CJA A;  2ARS A;  4NCX A;  2RHQ A;  3QO5 A;  2ARU A;  2DQ0 A;  3OD1 A;  1NYQ A;  2DTI A;  2ZNI A;  3V7S A;  3HRK A;  2C8M A;  4YRL A;  4YRE A;  2I4N A;  3V8L A;  2E65 A;  1ADY A;  2A8E A;  4LVK A;  4K86 A;  3L1A A;  4P72 A;  4LVM A;  1YGB A;  4L87 A;  1PYS B;  1NJ2 A;  3UFG A;  3A7U A;  1E24 A;  1H4Q A;  4G84 A;  2DZC A;  4XU1 A;  1WPY A;  2E41 A;  4LVJ A;  4LVI A;  1EIY A;  4Q6G A;  1IL2 A;  4OP0 A;  3VQY A;  4XTZ A;  2CJ9 A;  4YRC A;  4HT4 A;  1KOG A;  4YYE A;  3VBB A;  1SRY A;  1WLE A;  3HFZ A;  1LYL A;  2DU7 A;  3L2Z A;  3G1Z A;  2P0L A;  3PCO B;  4XTX A;  1NYR A;  2DXT A;  4YCW A;  2ZZF A;  3IKM B;  3NEN A;  1E1T A;  2HNI A;  1NJ8 A;  4TWA A;  2QHU A;  2DZ9 A;  5F5W A;  1X2H A;  2Q7H A;  1BIA A;  3DSQ A;  4RQE A; 
#chains in the Genus database with same CATH homology
 3KFU A;  1G5H A;  2AKW B;  2CJB A;  4UP7 A;  3REU A;  2Q5H A;  1B70 A;  1B76 A;  2E1H A;  4XU2 A;  4DQ2 A;  2E64 A;  2DU5 A;  4H2Y A;  3A74 A;  1J5W A;  3A5Y A;  1WYD A;  2ZR2 A;  1ASY A;  1YFS A;  4HA8 A;  2J3L A;  4O2D A;  1X54 A;  5C53 B;  5E3I A;  1G5I A;  3A7R A;  4WJ4 A;  4HVC A;  3VQW A;  4K88 A;  1N9W A;  1B7Y B;  4RDX A;  2E10 A;  1KMM A;  4YPF A;  3UGT A;  4LNS A;  3R07 A;  1QF6 A;  2RHQ B;  3REX A;  1YFR A;  2EWN A;  2P5I A;  1BBU A;  1W66 A;  2DQ3 A;  2ZT6 A;  3HXY A;  3UGQ A;  3HFV A;  4YRP A;  4P3P A;  3E9H A;  4P71 A;  4P3N A;  4YDQ A;  3MF1 A;  3A31 A;  2I4M A;  1H4S A;  3LSS A;  4WJ3 M;  3HXW A;  1PYS A;  3RAC A;  4YRM A;  4DPG A;  3IKL A;  5ELN A;  4PG3 A;  3VQX A;  2DEQ A;  4WI1 A;  2AMC B;  1NJ5 A;  4XTU A;  3ERR A;  2C7I A;  4ZTU B;  4E51 A;  3MQZ A;  4P72 C;  4BWA A;  4H2S A;  1ASZ A;  3RUX A;  3ICA A;  2ODR C;  3BJU A;  3IG2 A;  1EQR A;  3CMQ A;  4EX5 A;  4H2T A;  3L4G B;  1H4T A;  4PHC A;  2RHS A;  3P8Y A;  2CIM A;  3NET A;  1X56 A;  4UPA A;  4XU0 A;  3HY1 A;  2DXU A;  1HC7 A;  2ZZE A;  4CH6 A;  3TUP A;  4TTV A;  2E5A A;  4YRI A;  3A32 A;  3RL6 A;  4YRF A;  3HY0 A;  2I4L A;  4CS4 A;  2ZIO A;  4YRN A;  3HXV A;  2NS6 A;  3PZC A;  2PME A;  4CH5 A;  1EVK A;  4ZIB A;  3EFS A;  4H02 A;  1E1O A;  1EOV A;  4J15 A;  2DTO A;  2DDZ A;  2ZT8 A;  1GGM A;  3RKW A;  2EL9 A;  4YRR A;  4YP0 A;  4TVA B;  4XEM A;  3TEH B;  2ART A;  4P74 A;  2ZXF A;  4CH4 A;  1JJC A;  2E3C A;  4H2U A;  3TEG A;  3P8V A;  1Z7N A;  4K87 A;  4CH3 A;  1SES A;  3FJP A;  3BFM A;  4P75 A;  2EJ9 A;  4HWO A;  1X01 A;  2Q7G A;  5K1P A;  1G51 A;  1USY C;  4TVY A;  2AMC A;  11AS A;  4RQF A;  4AH6 A;  2QHT A;  4CS2 A;  2ALY A;  4H2X B;  4EO4 A;  3V8K A;  2EJF A;  2I4O A;  1WU7 A;  3HXZ A;  2IY5 B;  4KR3 A;  3QO8 A;  1C0A A;  2RHS B;  5C51 B;  2ZT5 A;  4YRQ A;  5C52 B;  3W3S A;  1KMN A;  3RF1 A;  1X2G A;  4YRJ A;  4P73 C;  2ZTG A;  3HXX A;  4X5O A;  4XU3 A;  1BBW A;  1Z7M A;  1B8A A;  2PMF A;  3M4P A;  4YCU A;  1YB3 A;  4RMF A;  1YFT A;  4YRO A;  2EJG A;  3L4G A;  4KQE A;  2Q7E A;  2J3M A;  1X55 A;  2DKG A;  3UH0 A;  5KNN A;  1RIQ A;  3E9I A;  1WQW A;  2DJZ A;  3RIR A;  1ATI A;  4YRK A;  4HWT A;  1L0W A;  5HGQ A;  4OLF A;  4WF2 A;  4P3O A;  3LC0 A;  4P75 C;  3EFR A;  1EFW A;  4YRT A;  1FYF A;  4H2V A;  3I7F A;  4H2X A;  5ELO A;  1QE0 A;  3V7C A;  3RKX A;  2IY5 A;  4XEO A;  1NJ1 A;  2XTI A;  2QHS A;  3QTC A;  4CS3 A;  3NEL A;  4TVA A;  3TEH A;  2ZCE A;  2XGT A;  1JJC B;  1VQZ A;  3HTZ A;  1WQ7 A;  3P8T A;  4TQF A;  4XTV A;  4YRG A;  4HWS A;  2ZIM A;  2EAY A;  3M4Q A;  4LVL A;  4UP8 A;  2Q5I A;  3HRI A;  4ZTZ B;  1SER A;  4HWP A;  3RKY A;  2ALY B;  2CGH A;  3HFZ B;  2DTH A;  4TQD A;  4XTW A;  2ZIN A;  3PCO A;  3RGL A;  3QNE A;  3IAL A;  1HXD A;  3WQZ A;  2QHV A;  4BW9 A;  1WNL A;  1USY A;  2ZT7 A;  2G4C A;  3A7A A;  3MEY A;  4HWR A;  1H4V B;  2AKW A;  3HXU A;  4KR2 A;  4P74 C;  1EIY B;  2ZNJ A;  1NJ6 A;  3NEM A;  1B70 B;  1BIB A;  4G85 A;  1HTT A;  4Q15 A;  4H2W A;  3MF2 A;  2FYK A;  4UP9 A;  2DVE A;  5K1X A;  3QO7 A;  4XTY A;  4YRS A;  1SET A;  3V8J A;  4TVW A;  4P73 A;  2ZR3 A;  3VQV A;  2ZGW A;  3V7R A;  1NNH A;  4YCV A;  12AS A;  3A5Z A;  1EVL A;  3LSQ A;  2ZZG A;  1E22 A;  4P71 C;  2ODR D;  1B7Y A;  1ADJ A;  2CJA A;  2ARS A;  4NCX A;  2RHQ A;  3QO5 A;  2ARU A;  2DQ0 A;  3OD1 A;  1NYQ A;  2DTI A;  2ZNI A;  3V7S A;  3HRK A;  2C8M A;  4YRL A;  4YRE A;  2I4N A;  3V8L A;  2E65 A;  1ADY A;  2A8E A;  4LVK A;  4K86 A;  3L1A A;  4P72 A;  4LVM A;  1YGB A;  4L87 A;  1PYS B;  1NJ2 A;  3UFG A;  3A7U A;  1E24 A;  1H4Q A;  4G84 A;  2DZC A;  4XU1 A;  1WPY A;  2E41 A;  4LVJ A;  4LVI A;  1EIY A;  4Q6G A;  1IL2 A;  4OP0 A;  3VQY A;  4XTZ A;  2CJ9 A;  4YRC A;  4HT4 A;  1KOG A;  4YYE A;  3VBB A;  1SRY A;  1WLE A;  3HFZ A;  1LYL A;  2DU7 A;  3L2Z A;  3G1Z A;  2P0L A;  3PCO B;  4XTX A;  1NYR A;  2DXT A;  4YCW A;  2ZZF A;  3IKM B;  3NEN A;  1E1T A;  2HNI A;  1NJ8 A;  4TWA A;  2QHU A;  2DZ9 A;  5F5W A;  1X2H A;  2Q7H A;  1BIA A;  3DSQ A;  4RQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...