4LVKA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt+3'phosphate). mn-bound crystal structure at ph 4.6
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
195
structure length
191
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
molecule keywords Plasmid recombination enzyme
molecule tags Dna binding protein/dna
source organism Streptococcus agalactiae
total genus 56
structure length 191
sequence length 195
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lvkA01
4LVLA 4LVMA 4LVJA 4LVKA 4HT4A 4LVIA 2NS6A
chains in the Genus database with same CATH superfamily
3EFSA 4XU0A 1WLEA 2E10A 4XU1A 2C7IA 2DXUA 12ASA 2ZZGA 2E3CA 4P3OA 3V8LA 2I4OA 2E41A 4YRIA 4ZTZB 1YFTA 3RACA 3V7CA 2PMFA 1H4QA 2DJZA 4YRRA 1H4VB 1E1TA 4DQ2A 2DQ0A 3QO5A 2DU5A 3MEYA 1EVKA 4Q6GA 3HY1A 4PG3A 2DVEA 4XTZA 3RL6A 1KMMA 2DDZA 1SERA 4P71C 3HRKA 1G5IA 1USYA 2Q7EA 4UP8A 1EOVA 1X55A 2QHVA 4E51A 2Q5HA 2DQ3A 1VQZA 3PZCA 3L4GA 3V7RA 4HT4A 4P72A 2ZTGA 2EJGA 4YRLA 3NEMA 3V8KA 1ADYA 1LYLA 2RHQA 3A5YA 2DZCA 2E5AA 2DXTA 5C53B 1HC7A 1PYSA 4NCXA 3BFMA 4HVCA 4YRTA 4HWSA 4DPGA 2XTIA 1H4TA 4RQFA 4P3PA 3HY0A 3KFUA 2ZNIA 3L4GB 1ADJA 1WU7A 2RHSA 3ICAA 4HWTA 4CH4A 4WI1A 2J3MA 2RHQB 2EWNA 2EL9A 1PYSB 2G4CA 3BJUA 3E9IA 4P73C 4UPAA 2Q5IA 2ZXFA 4TVWA 1NNHA 4XTYA 3LSSA 2CJ9A 1YFSA 4YPFA 3MF2A 4H2SA 2DTOA 1YFRA 4H2XA 1EFWA 4TQFA 4LVMA 2RHSB 3IG2A 4RQEA 1B70A 2E65A 1JJCA 2ZZFA 1NYQA 4L87A 1WNLA 4H2WA 3HXUA 2ODRC 2ZNJA 2DZ9A 5ELNA 4HA8A 1G5HA 4CH3A 1C0AA 2ZIMA 1B76A 1NYRA 1WPYA 3A31A 5ELOA 3TEHA 4LNSA 4H2XB 1Z7NA 4RMFA 2NS6A 2IY5A 4TQDA 3RF1A 1B70B 5K1XA 1JJCB 1SRYA 1BBUA 3L2ZA 1BIAA 3MQZA 4H2UA 1L0WA 4EX5A 4TWAA 4H2TA 4XTXA 1NJ1A 4YYEA 1NJ2A 3FJPA 4H02A 11ASA 3TEHB 3HTZA 4OP0A 2HNIA 3V7SA 1ASZA 4P75C 1FYFA 4HWPA 2Q7GA 4YRCA 4K88A 2IY5B 4H2VA 4Q15A 4XEMA 4KR3A 3REUA 1ASYA 4P3NA 3A7AA 4J15A 4K87A 1BBWA 3UFGA 3P8YA 4OLFA 3E9HA 3MF1A 4LVKA 3HXXA 4YRPA 4YRSA 2ZIOA 3HFZA 3RKXA 4TVYA 1W66A 3RGLA 2ZT8A 1NJ5A 5HGQA 4YREA 4KR2A 4P74A 4O2DA 3V8JA 3UGTA 2E64A 3LC0A 3RKWA 1KOGA 4UP7A 3TUPA 4G84A 3UGQA 1G51A 2ZINA 1X56A 1X54A 4YDQA 2P5IA 4XTUA 3HFZB 4BWAA 3HRIA 3NETA 3PCOA 4AH6A 2CJBA 2PMEA 1X2GA 2ZCEA 4H2YA 4TTVA 2QHUA 4LVLA 1HXDA 2EJ9A 4G85A 1B7YA 5E3IA 4YROA 1BIBA 1SESA 3IKLA 5C51B 4ZIBA 3HFVA 1N9WA 3PCOB 1NJ8A 4XTWA 5KNNA 3A32A 4XU3A 3HXZA 4WF2A 4XEOA 3IALA 1RIQA 3LSQA 2ARTA 3I7FA 1USYC 3P8VA 3HXYA 4WJ3M 3EFRA 2I4MA 1B7YB 4YRFA 2Q7HA 4UP9A 2ARSA 2ODRD 3VBBA 1X01A 1B8AA 3QTCA 4P72C 4YCVA 1IL2A 4YRNA 1NJ6A 1H4SA 1EIYA 1QF6A 4YRJA 3HXWA 2DTHA 3UH0A 2AMCA 4PHCA 2DTIA 1Z7MA 2AKWA 4XU2A 4P74C 4YCUA 2DU7A 2ZT7A 1EVLA 4KQEA 1YGBA 2EJFA 4YCWA 4YRKA 3M4PA 2ARUA 2E1HA 2QHTA 2QHSA 2J3LA 3RKYA 2I4LA 2ZT5A 4LVJA 1EIYB 1GGMA 2CJAA 2CGHA 2ZR2A 3RUXA 2AMCB 2C8MA 2CIMA 3REXA 3VQWA 3W3SA 4WJ4A 1WQWA 5F5WA 2AKWB 2I4NA 1KMNA 4BW9A 5K1PA 4P71A 4CH6A 3DSQA 3OD1A 1SETA 3TEGA 4CS2A 4P75A 4TVAA 2FYKA 2XGTA 4YRQA 3QO7A 4CH5A 3A5ZA 2ZGWA 2ALYA 4K86A 3A7UA 3P8TA 2ZR3A 3NELA 3R07A 1HTTA 4CS4A 3VQVA 2ZT6A 4YP0A 3HXVA 3WQZA 1E1OA 3A74A 3NENA 2EAYA 1E22A 4X5OA 3CMQA 2P0LA 5C52B 4TVAB 4LVIA 3A7RA 3M4QA 2ZZEA 4YRGA 2ALYB 3QO8A 1EQRA 1E24A 1WQ7A 4HWOA 3RIRA 2A8EA 1QE0A 4RDXA 3ERRA 4YRMA 3QNEA 4XTVA 3VQYA 4ZTUB 1ATIA 1J5WA 1YB3A 1WYDA 3IKMB 4P73A 2DKGA 3L1AA 4HWRA 3VQXA 2DEQA 1X2HA 4CS3A 4EO4A 3G1ZA
chains in the Genus database with same CATH topology
3EFSA 4XU0A 1WLEA 2E10A 4XU1A 2C7IA 2DXUA 12ASA 2ZZGA 2E3CA 4P3OA 3V8LA 2I4OA 2E41A 4YRIA 4ZTZB 1YFTA 3RACA 3V7CA 2PMFA 1H4QA 2DJZA 4YRRA 1H4VB 1E1TA 4DQ2A 2DQ0A 3QO5A 2DU5A 3MEYA 1EVKA 4Q6GA 3HY1A 4PG3A 2DVEA 4XTZA 3RL6A 1KMMA 2DDZA 1SERA 4P71C 3HRKA 1G5IA 1USYA 2Q7EA 4UP8A 1EOVA 1X55A 2QHVA 4E51A 2Q5HA 2DQ3A 1VQZA 3PZCA 3L4GA 3V7RA 4HT4A 4P72A 2ZTGA 2EJGA 4YRLA 3NEMA 3V8KA 1ADYA 1LYLA 2RHQA 3A5YA 2DZCA 2E5AA 2DXTA 5C53B 1HC7A 1PYSA 4NCXA 3BFMA 4HVCA 4YRTA 4HWSA 4DPGA 2XTIA 1H4TA 4RQFA 4P3PA 3HY0A 3KFUA 2ZNIA 3L4GB 1ADJA 1WU7A 2RHSA 3ICAA 4HWTA 4CH4A 4WI1A 2J3MA 2RHQB 2EWNA 2EL9A 1PYSB 2G4CA 3BJUA 3E9IA 4P73C 4UPAA 2Q5IA 2ZXFA 4TVWA 1NNHA 4XTYA 3LSSA 2CJ9A 1YFSA 4YPFA 3MF2A 4H2SA 2DTOA 1YFRA 4H2XA 1EFWA 4TQFA 4LVMA 2RHSB 3IG2A 4RQEA 1B70A 2E65A 1JJCA 2ZZFA 1NYQA 4L87A 1WNLA 4H2WA 3HXUA 2ODRC 2ZNJA 2DZ9A 5ELNA 4HA8A 1G5HA 4CH3A 1C0AA 2ZIMA 1B76A 1NYRA 1WPYA 3A31A 5ELOA 3TEHA 4LNSA 4H2XB 1Z7NA 4RMFA 2NS6A 2IY5A 4TQDA 3RF1A 1B70B 5K1XA 1JJCB 1SRYA 1BBUA 3L2ZA 1BIAA 3MQZA 4H2UA 1L0WA 4EX5A 4TWAA 4H2TA 4XTXA 1NJ1A 4YYEA 1NJ2A 3FJPA 4H02A 11ASA 3TEHB 3HTZA 4OP0A 2HNIA 3V7SA 1ASZA 4P75C 1FYFA 4HWPA 2Q7GA 4YRCA 4K88A 2IY5B 4H2VA 4Q15A 4XEMA 4KR3A 3REUA 1ASYA 4P3NA 3A7AA 4J15A 4K87A 1BBWA 3UFGA 3P8YA 4OLFA 3E9HA 3MF1A 4LVKA 3HXXA 4YRPA 4YRSA 2ZIOA 3HFZA 3RKXA 4TVYA 1W66A 3RGLA 2ZT8A 1NJ5A 5HGQA 4YREA 4KR2A 4P74A 4O2DA 3V8JA 3UGTA 2E64A 3LC0A 3RKWA 1KOGA 4UP7A 3TUPA 4G84A 3UGQA 1G51A 2ZINA 1X56A 1X54A 4YDQA 2P5IA 4XTUA 3HFZB 4BWAA 3HRIA 3NETA 3PCOA 4AH6A 2CJBA 2PMEA 1X2GA 2ZCEA 4H2YA 4TTVA 2QHUA 4LVLA 1HXDA 2EJ9A 4G85A 1B7YA 5E3IA 4YROA 1BIBA 1SESA 3IKLA 5C51B 4ZIBA 3HFVA 1N9WA 3PCOB 1NJ8A 4XTWA 5KNNA 3A32A 4XU3A 3HXZA 4WF2A 4XEOA 3IALA 1RIQA 3LSQA 2ARTA 3I7FA 1USYC 3P8VA 3HXYA 4WJ3M 3EFRA 2I4MA 1B7YB 4YRFA 2Q7HA 4UP9A 2ARSA 2ODRD 3VBBA 1X01A 1B8AA 3QTCA 4P72C 4YCVA 1IL2A 4YRNA 1NJ6A 1H4SA 1EIYA 1QF6A 4YRJA 3HXWA 2DTHA 3UH0A 2AMCA 4PHCA 2DTIA 1Z7MA 2AKWA 4XU2A 4P74C 4YCUA 2DU7A 2ZT7A 1EVLA 4KQEA 1YGBA 2EJFA 4YCWA 4YRKA 3M4PA 2ARUA 2E1HA 2QHTA 2QHSA 2J3LA 3RKYA 2I4LA 2ZT5A 4LVJA 1EIYB 1GGMA 2CJAA 2CGHA 2ZR2A 3RUXA 2AMCB 2C8MA 2CIMA 3REXA 3VQWA 3W3SA 4WJ4A 1WQWA 5F5WA 2AKWB 2I4NA 1KMNA 4BW9A 5K1PA 4P71A 4CH6A 3DSQA 3OD1A 1SETA 3TEGA 4CS2A 4P75A 4TVAA 2FYKA 2XGTA 4YRQA 3QO7A 4CH5A 3A5ZA 2ZGWA 2ALYA 4K86A 3A7UA 3P8TA 2ZR3A 3NELA 3R07A 1HTTA 4CS4A 3VQVA 2ZT6A 4YP0A 3HXVA 3WQZA 1E1OA 3A74A 3NENA 2EAYA 1E22A 4X5OA 3CMQA 2P0LA 5C52B 4TVAB 4LVIA 3A7RA 3M4QA 2ZZEA 4YRGA 2ALYB 3QO8A 1EQRA 1E24A 1WQ7A 4HWOA 3RIRA 2A8EA 1QE0A 4RDXA 3ERRA 4YRMA 3QNEA 4XTVA 3VQYA 4ZTUB 1ATIA 1J5WA 1YB3A 1WYDA 3IKMB 4P73A 2DKGA 3L1AA 4HWRA 3VQXA 2DEQA 1X2HA 4CS3A 4EO4A 3G1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVL A;  4LVM A;  4LVJ A;  4LVK A;  4HT4 A;  4LVI A;  2NS6 A; 
#chains in the Genus database with same CATH topology
 3EFS A;  4XU0 A;  1WLE A;  2E10 A;  4XU1 A;  2C7I A;  2DXU A;  12AS A;  2ZZG A;  2E3C A;  4P3O A;  3V8L A;  2I4O A;  2E41 A;  4YRI A;  4ZTZ B;  1YFT A;  3RAC A;  3V7C A;  2PMF A;  1H4Q A;  2DJZ A;  4YRR A;  1H4V B;  1E1T A;  4DQ2 A;  2DQ0 A;  3QO5 A;  2DU5 A;  3MEY A;  1EVK A;  4Q6G A;  3HY1 A;  4PG3 A;  2DVE A;  4XTZ A;  3RL6 A;  1KMM A;  2DDZ A;  1SER A;  4P71 C;  3HRK A;  1G5I A;  1USY A;  2Q7E A;  4UP8 A;  1EOV A;  1X55 A;  2QHV A;  4E51 A;  2Q5H A;  2DQ3 A;  1VQZ A;  3PZC A;  3L4G A;  3V7R A;  4HT4 A;  4P72 A;  2ZTG A;  2EJG A;  4YRL A;  3NEM A;  3V8K A;  1ADY A;  1LYL A;  2RHQ A;  3A5Y A;  2DZC A;  2E5A A;  2DXT A;  5C53 B;  1HC7 A;  1PYS A;  4NCX A;  3BFM A;  4HVC A;  4YRT A;  4HWS A;  4DPG A;  2XTI A;  1H4T A;  4RQF A;  4P3P A;  3HY0 A;  3KFU A;  2ZNI A;  3L4G B;  1ADJ A;  1WU7 A;  2RHS A;  3ICA A;  4HWT A;  4CH4 A;  4WI1 A;  2J3M A;  2RHQ B;  2EWN A;  2EL9 A;  1PYS B;  2G4C A;  3BJU A;  3E9I A;  4P73 C;  4UPA A;  2Q5I A;  2ZXF A;  4TVW A;  1NNH A;  4XTY A;  3LSS A;  2CJ9 A;  1YFS A;  4YPF A;  3MF2 A;  4H2S A;  2DTO A;  1YFR A;  4H2X A;  1EFW A;  4TQF A;  4LVM A;  2RHS B;  3IG2 A;  4RQE A;  1B70 A;  2E65 A;  1JJC A;  2ZZF A;  1NYQ A;  4L87 A;  1WNL A;  4H2W A;  3HXU A;  2ODR C;  2ZNJ A;  2DZ9 A;  5ELN A;  4HA8 A;  1G5H A;  4CH3 A;  1C0A A;  2ZIM A;  1B76 A;  1NYR A;  1WPY A;  3A31 A;  5ELO A;  3TEH A;  4LNS A;  4H2X B;  1Z7N A;  4RMF A;  2NS6 A;  2IY5 A;  4TQD A;  3RF1 A;  1B70 B;  5K1X A;  1JJC B;  1SRY A;  1BBU A;  3L2Z A;  1BIA A;  3MQZ A;  4H2U A;  1L0W A;  4EX5 A;  4TWA A;  4H2T A;  4XTX A;  1NJ1 A;  4YYE A;  1NJ2 A;  3FJP A;  4H02 A;  11AS A;  3TEH B;  3HTZ A;  4OP0 A;  2HNI A;  3V7S A;  1ASZ A;  4P75 C;  1FYF A;  4HWP A;  2Q7G A;  4YRC A;  4K88 A;  2IY5 B;  4H2V A;  4Q15 A;  4XEM A;  4KR3 A;  3REU A;  1ASY A;  4P3N A;  3A7A A;  4J15 A;  4K87 A;  1BBW A;  3UFG A;  3P8Y A;  4OLF A;  3E9H A;  3MF1 A;  4LVK A;  3HXX A;  4YRP A;  4YRS A;  2ZIO A;  3HFZ A;  3RKX A;  4TVY A;  1W66 A;  3RGL A;  2ZT8 A;  1NJ5 A;  5HGQ A;  4YRE A;  4KR2 A;  4P74 A;  4O2D A;  3V8J A;  3UGT A;  2E64 A;  3LC0 A;  3RKW A;  1KOG A;  4UP7 A;  3TUP A;  4G84 A;  3UGQ A;  1G51 A;  2ZIN A;  1X56 A;  1X54 A;  4YDQ A;  2P5I A;  4XTU A;  3HFZ B;  4BWA A;  3HRI A;  3NET A;  3PCO A;  4AH6 A;  2CJB A;  2PME A;  1X2G A;  2ZCE A;  4H2Y A;  4TTV A;  2QHU A;  4LVL A;  1HXD A;  2EJ9 A;  4G85 A;  1B7Y A;  5E3I A;  4YRO A;  1BIB A;  1SES A;  3IKL A;  5C51 B;  4ZIB A;  3HFV A;  1N9W A;  3PCO B;  1NJ8 A;  4XTW A;  5KNN A;  3A32 A;  4XU3 A;  3HXZ A;  4WF2 A;  4XEO A;  3IAL A;  1RIQ A;  3LSQ A;  2ART A;  3I7F A;  1USY C;  3P8V A;  3HXY A;  4WJ3 M;  3EFR A;  2I4M A;  1B7Y B;  4YRF A;  2Q7H A;  4UP9 A;  2ARS A;  2ODR D;  3VBB A;  1X01 A;  1B8A A;  3QTC A;  4P72 C;  4YCV A;  1IL2 A;  4YRN A;  1NJ6 A;  1H4S A;  1EIY A;  1QF6 A;  4YRJ A;  3HXW A;  2DTH A;  3UH0 A;  2AMC A;  4PHC A;  2DTI A;  1Z7M A;  2AKW A;  4XU2 A;  4P74 C;  4YCU A;  2DU7 A;  2ZT7 A;  1EVL A;  4KQE A;  1YGB A;  2EJF A;  4YCW A;  4YRK A;  3M4P A;  2ARU A;  2E1H A;  2QHT A;  2QHS A;  2J3L A;  3RKY A;  2I4L A;  2ZT5 A;  4LVJ A;  1EIY B;  1GGM A;  2CJA A;  2CGH A;  2ZR2 A;  3RUX A;  2AMC B;  2C8M A;  2CIM A;  3REX A;  3VQW A;  3W3S A;  4WJ4 A;  1WQW A;  5F5W A;  2AKW B;  2I4N A;  1KMN A;  4BW9 A;  5K1P A;  4P71 A;  4CH6 A;  3DSQ A;  3OD1 A;  1SET A;  3TEG A;  4CS2 A;  4P75 A;  4TVA A;  2FYK A;  2XGT A;  4YRQ A;  3QO7 A;  4CH5 A;  3A5Z A;  2ZGW A;  2ALY A;  4K86 A;  3A7U A;  3P8T A;  2ZR3 A;  3NEL A;  3R07 A;  1HTT A;  4CS4 A;  3VQV A;  2ZT6 A;  4YP0 A;  3HXV A;  3WQZ A;  1E1O A;  3A74 A;  3NEN A;  2EAY A;  1E22 A;  4X5O A;  3CMQ A;  2P0L A;  5C52 B;  4TVA B;  4LVI A;  3A7R A;  3M4Q A;  2ZZE A;  4YRG A;  2ALY B;  3QO8 A;  1EQR A;  1E24 A;  1WQ7 A;  4HWO A;  3RIR A;  2A8E A;  1QE0 A;  4RDX A;  3ERR A;  4YRM A;  3QNE A;  4XTV A;  3VQY A;  4ZTU B;  1ATI A;  1J5W A;  1YB3 A;  1WYD A;  3IKM B;  4P73 A;  2DKG A;  3L1A A;  4HWR A;  3VQX A;  2DEQ A;  1X2H A;  4CS3 A;  4EO4 A;  3G1Z A; 
#chains in the Genus database with same CATH homology
 3EFS A;  4XU0 A;  1WLE A;  2E10 A;  4XU1 A;  2C7I A;  2DXU A;  12AS A;  2ZZG A;  2E3C A;  4P3O A;  3V8L A;  2I4O A;  2E41 A;  4YRI A;  4ZTZ B;  1YFT A;  3RAC A;  3V7C A;  2PMF A;  1H4Q A;  2DJZ A;  4YRR A;  1H4V B;  1E1T A;  4DQ2 A;  2DQ0 A;  3QO5 A;  2DU5 A;  3MEY A;  1EVK A;  4Q6G A;  3HY1 A;  4PG3 A;  2DVE A;  4XTZ A;  3RL6 A;  1KMM A;  2DDZ A;  1SER A;  4P71 C;  3HRK A;  1G5I A;  1USY A;  2Q7E A;  4UP8 A;  1EOV A;  1X55 A;  2QHV A;  4E51 A;  2Q5H A;  2DQ3 A;  1VQZ A;  3PZC A;  3L4G A;  3V7R A;  4HT4 A;  4P72 A;  2ZTG A;  2EJG A;  4YRL A;  3NEM A;  3V8K A;  1ADY A;  1LYL A;  2RHQ A;  3A5Y A;  2DZC A;  2E5A A;  2DXT A;  5C53 B;  1HC7 A;  1PYS A;  4NCX A;  3BFM A;  4HVC A;  4YRT A;  4HWS A;  4DPG A;  2XTI A;  1H4T A;  4RQF A;  4P3P A;  3HY0 A;  3KFU A;  2ZNI A;  3L4G B;  1ADJ A;  1WU7 A;  2RHS A;  3ICA A;  4HWT A;  4CH4 A;  4WI1 A;  2J3M A;  2RHQ B;  2EWN A;  2EL9 A;  1PYS B;  2G4C A;  3BJU A;  3E9I A;  4P73 C;  4UPA A;  2Q5I A;  2ZXF A;  4TVW A;  1NNH A;  4XTY A;  3LSS A;  2CJ9 A;  1YFS A;  4YPF A;  3MF2 A;  4H2S A;  2DTO A;  1YFR A;  4H2X A;  1EFW A;  4TQF A;  4LVM A;  2RHS B;  3IG2 A;  4RQE A;  1B70 A;  2E65 A;  1JJC A;  2ZZF A;  1NYQ A;  4L87 A;  1WNL A;  4H2W A;  3HXU A;  2ODR C;  2ZNJ A;  2DZ9 A;  5ELN A;  4HA8 A;  1G5H A;  4CH3 A;  1C0A A;  2ZIM A;  1B76 A;  1NYR A;  1WPY A;  3A31 A;  5ELO A;  3TEH A;  4LNS A;  4H2X B;  1Z7N A;  4RMF A;  2NS6 A;  2IY5 A;  4TQD A;  3RF1 A;  1B70 B;  5K1X A;  1JJC B;  1SRY A;  1BBU A;  3L2Z A;  1BIA A;  3MQZ A;  4H2U A;  1L0W A;  4EX5 A;  4TWA A;  4H2T A;  4XTX A;  1NJ1 A;  4YYE A;  1NJ2 A;  3FJP A;  4H02 A;  11AS A;  3TEH B;  3HTZ A;  4OP0 A;  2HNI A;  3V7S A;  1ASZ A;  4P75 C;  1FYF A;  4HWP A;  2Q7G A;  4YRC A;  4K88 A;  2IY5 B;  4H2V A;  4Q15 A;  4XEM A;  4KR3 A;  3REU A;  1ASY A;  4P3N A;  3A7A A;  4J15 A;  4K87 A;  1BBW A;  3UFG A;  3P8Y A;  4OLF A;  3E9H A;  3MF1 A;  4LVK A;  3HXX A;  4YRP A;  4YRS A;  2ZIO A;  3HFZ A;  3RKX A;  4TVY A;  1W66 A;  3RGL A;  2ZT8 A;  1NJ5 A;  5HGQ A;  4YRE A;  4KR2 A;  4P74 A;  4O2D A;  3V8J A;  3UGT A;  2E64 A;  3LC0 A;  3RKW A;  1KOG A;  4UP7 A;  3TUP A;  4G84 A;  3UGQ A;  1G51 A;  2ZIN A;  1X56 A;  1X54 A;  4YDQ A;  2P5I A;  4XTU A;  3HFZ B;  4BWA A;  3HRI A;  3NET A;  3PCO A;  4AH6 A;  2CJB A;  2PME A;  1X2G A;  2ZCE A;  4H2Y A;  4TTV A;  2QHU A;  4LVL A;  1HXD A;  2EJ9 A;  4G85 A;  1B7Y A;  5E3I A;  4YRO A;  1BIB A;  1SES A;  3IKL A;  5C51 B;  4ZIB A;  3HFV A;  1N9W A;  3PCO B;  1NJ8 A;  4XTW A;  5KNN A;  3A32 A;  4XU3 A;  3HXZ A;  4WF2 A;  4XEO A;  3IAL A;  1RIQ A;  3LSQ A;  2ART A;  3I7F A;  1USY C;  3P8V A;  3HXY A;  4WJ3 M;  3EFR A;  2I4M A;  1B7Y B;  4YRF A;  2Q7H A;  4UP9 A;  2ARS A;  2ODR D;  3VBB A;  1X01 A;  1B8A A;  3QTC A;  4P72 C;  4YCV A;  1IL2 A;  4YRN A;  1NJ6 A;  1H4S A;  1EIY A;  1QF6 A;  4YRJ A;  3HXW A;  2DTH A;  3UH0 A;  2AMC A;  4PHC A;  2DTI A;  1Z7M A;  2AKW A;  4XU2 A;  4P74 C;  4YCU A;  2DU7 A;  2ZT7 A;  1EVL A;  4KQE A;  1YGB A;  2EJF A;  4YCW A;  4YRK A;  3M4P A;  2ARU A;  2E1H A;  2QHT A;  2QHS A;  2J3L A;  3RKY A;  2I4L A;  2ZT5 A;  4LVJ A;  1EIY B;  1GGM A;  2CJA A;  2CGH A;  2ZR2 A;  3RUX A;  2AMC B;  2C8M A;  2CIM A;  3REX A;  3VQW A;  3W3S A;  4WJ4 A;  1WQW A;  5F5W A;  2AKW B;  2I4N A;  1KMN A;  4BW9 A;  5K1P A;  4P71 A;  4CH6 A;  3DSQ A;  3OD1 A;  1SET A;  3TEG A;  4CS2 A;  4P75 A;  4TVA A;  2FYK A;  2XGT A;  4YRQ A;  3QO7 A;  4CH5 A;  3A5Z A;  2ZGW A;  2ALY A;  4K86 A;  3A7U A;  3P8T A;  2ZR3 A;  3NEL A;  3R07 A;  1HTT A;  4CS4 A;  3VQV A;  2ZT6 A;  4YP0 A;  3HXV A;  3WQZ A;  1E1O A;  3A74 A;  3NEN A;  2EAY A;  1E22 A;  4X5O A;  3CMQ A;  2P0L A;  5C52 B;  4TVA B;  4LVI A;  3A7R A;  3M4Q A;  2ZZE A;  4YRG A;  2ALY B;  3QO8 A;  1EQR A;  1E24 A;  1WQ7 A;  4HWO A;  3RIR A;  2A8E A;  1QE0 A;  4RDX A;  3ERR A;  4YRM A;  3QNE A;  4XTV A;  3VQY A;  4ZTU B;  1ATI A;  1J5W A;  1YB3 A;  1WYD A;  3IKM B;  4P73 A;  2DKG A;  3L1A A;  4HWR A;  3VQX A;  2DEQ A;  1X2H A;  4CS3 A;  4EO4 A;  3G1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...