4LVKA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt+3'phosphate). mn-bound crystal structure at ph 4.6
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
195
structure length
191
Chain Sequence
b'SYMVARMQKMKAGNLGGAFKHNERVSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid recombination enzyme
molecule tags Dna binding protein/dna
source organism Streptococcus agalactiae
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
total genus 56
structure length 191
sequence length 195
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lvkA01
4LVJA 4LVMA 4LVKA 4HT4A 4LVIA 2NS6A 4LVLA
chains in the Genus database with same CATH superfamily
1FYFA 3IALA 3UGQA 3UFGA 3WQZA 3UGTA 1H4SA 2DTOA 2ZR3A 2Q5IA 1H4VB 4H2XA 3UH0A 4Q6GA 3IKMB 1X2HA 3A7RA 4UPAA 2QHVA 1SRYA 2E64A 4YRPA 2EJ9A 3PZCA 4XTXA 3VQYA 4H2UA 3HRIA 2P0LA 3RF1A 4P75C 2AMCB 1SERA 3HXVA 3REUA 2E10A 2ALYA 4TVWA 3IG2A 4EX5A 1E1TA 3MF1A 4PG3A 2EL9A 4KQEA 3R07A 2CJAA 4YCWA 2Q7HA 1EVLA 1EIYA 1EQRA 4K86A 2DU5A 4Q15A 3RGLA 2E41A 4P3PA 4YRGA 3V7CA 1Z7MA 3HXYA 2ARUA 4XTZA 3BJUA 2ZTGA 1RIQA 2E3CA 4WI1A 2EJGA 2ODRD 3V7SA 3EFRA 1HC7A 1H4QA 2ZIMA 3E9HA 4CH4A 2EJFA 11ASA 2I4MA 3ERRA 4H2WA 2DU7A 4XTYA 3HXUA 4LVJA 4P72A 2Q5HA 3RACA 2E1HA 4ZIBA 4XEMA 4YRFA 1G5IA 3MEYA 2P5IA 2I4OA 1WNLA 5C52B 1BIAA 4YP0A 4CS3A 3L4GB 4DQ2A 3VQWA 2IY5A 4G85A 2RHQB 5K1PA 4O2DA 4TVAA 2EWNA 3MF2A 4XEOA 2AKWB 3HY1A 1KMNA 4HA8A 4YRCA 5ELOA 4OLFA 4YRTA 1BIBA 3DSQA 2Q7GA 1B70A 4OP0A 1ASYA 3P8TA 3V7RA 1VQZA 3M4QA 4P72C 4YRRA 4J15A 4KR3A 3HFZB 2G4CA 4YROA 3QO5A 4P73A 2ZT5A 3PCOA 1ADJA 5C51B 4UP8A 1NJ5A 3MQZA 5KNNA 2ZGWA 2IY5B 3TEGA 4H2SA 2CIMA 2ZIOA 4TVAB 2AKWA 4LVMA 1IL2A 3RIRA 1X2GA 4YDQA 4YPFA 3A74A 4DPGA 4TWAA 3M4PA 4LVLA 1X54A 2ZZGA 2DZCA 1QE0A 1YFSA 4H2VA 3FJPA 4P71C 4PHCA 3ICAA 1NJ1A 2J3MA 4ZTUB 4XTWA 4XU0A 4ZTZB 2E5AA 4XU3A 3QTCA 2ALYB 3KFUA 1E24A 1ATIA 3TEHB 2Q7EA 1B7YB 5C53B 4K88A 1L0WA 3TUPA 4BWAA 3LSQA 1WQ7A 2ZT7A 2DJZA 4HT4A 4WF2A 1NYRA 1YB3A 3A5YA 2RHQA 2DXUA 2QHTA 5ELNA 1QF6A 2FYKA 1EIYB 2C7IA 2EAYA 2DZ9A 2CJBA 4KR2A 4RQFA 4YRSA 1WPYA 1ADYA 2QHUA 3G1ZA 1JJCA 4RQEA 2DDZA 2CJ9A 4TQFA 4E51A 1YFRA 4HWSA 3W3SA 3V8JA 4XU1A 4YRLA 1NJ6A 1J5WA 1B76A 3HFZA 2I4LA 3LSSA 3P8YA 3TEHA 3VQXA 4AH6A 4YRIA 5E3IA 3L2ZA 1NNHA 3A7AA 4P74A 4YRJA 4P3NA 2DXTA 3E9IA 3OD1A 2ZZFA 2ZR2A 1W66A 3NELA 3HFVA 1SESA 2ZNIA 1WU7A 1H4TA 4UP9A 4P3OA 4WJ3M 2XTIA 1ASZA 1X01A 4HWRA 1JJCB 1PYSB 2DEQA 4CH6A 1G5HA 4G84A 5K1XA 4LVKA 4TVYA 2RHSB 1USYA 2A8EA 1HTTA 4LVIA 2ARTA 5HGQA 3QO8A 4CS2A 2C8MA 1WYDA 3PCOB 3A5ZA 4NCXA 2I4NA 1X56A 2DQ0A 5F5WA 1SETA 2AMCA 3EFSA 1B7YA 2HNIA 4P71A 4YRQA 2PMFA 4L87A 1BBUA 4X5OA 3HY0A 4UP7A 4WJ4A 1EFWA 1WQWA 3HTZA 1GGMA 2QHSA 3L1AA 3QNEA 4RMFA 1Z7NA 1EVKA 4TTVA 3RKYA 4RDXA 4CS4A 4XTUA 4H2YA 3NETA 1G51A 4XU2A 4H2TA 4LNSA 4CH3A 2DKGA 1KOGA 1E22A 3A32A 3IKLA 3RL6A 4P73C 1KMMA 3BFMA 3I7FA 2DVEA 1PYSA 2XGTA 1E1OA 1WLEA 4CH5A 4YREA 3RUXA 1C0AA 2PMEA 1X55A 3LC0A 4YRNA 4XTVA 1USYC 3V8KA 3NENA 2ZXFA 4HWOA 4TQDA 2ZNJA 3HXWA 1N9WA 1NJ8A 1YGBA 4EO4A 2E65A 1B70B 12ASA 3NEMA 1HXDA 2RHSA 4HWPA 4P75A 4H2XB 4P74C 1BBWA 4YYEA 2DQ3A 4K87A 3RKWA 1B8AA 4YRKA 3CMQA 4YRMA 2DTIA 1NJ2A 2NS6A 3P8VA 2ZT6A 3L4GA 1LYLA 2ZT8A 4H02A 1EOVA 2ARSA 3VBBA 3A31A 2ZINA 2CGHA 2ODRC 2ZZEA 4HWTA 3HXXA 1YFTA 2ZCEA 4YCVA 2DTHA 3RKXA 1NYQA 3A7UA 3VQVA 3REXA 3HXZA 4BW9A 4HVCA 3QO7A 3HRKA 3V8LA 2J3LA 4YCUA
chains in the Genus database with same CATH topology
1FYFA 3IALA 3UGQA 3UFGA 3WQZA 3UGTA 1H4SA 2DTOA 2ZR3A 2Q5IA 1H4VB 4H2XA 3UH0A 4Q6GA 3IKMB 1X2HA 3A7RA 4UPAA 2QHVA 1SRYA 2E64A 4YRPA 2EJ9A 3PZCA 4XTXA 3VQYA 4H2UA 3HRIA 2P0LA 3RF1A 4P75C 2AMCB 1SERA 3HXVA 3REUA 2E10A 2ALYA 4TVWA 3IG2A 4EX5A 1E1TA 3MF1A 4PG3A 2EL9A 4KQEA 3R07A 2CJAA 4YCWA 2Q7HA 1EVLA 1EIYA 1EQRA 4K86A 2DU5A 4Q15A 3RGLA 2E41A 4P3PA 4YRGA 3V7CA 1Z7MA 3HXYA 2ARUA 4XTZA 3BJUA 2ZTGA 1RIQA 2E3CA 4WI1A 2EJGA 2ODRD 3V7SA 3EFRA 1HC7A 1H4QA 2ZIMA 3E9HA 4CH4A 2EJFA 11ASA 2I4MA 3ERRA 4H2WA 2DU7A 4XTYA 3HXUA 4LVJA 4P72A 2Q5HA 3RACA 2E1HA 4ZIBA 4XEMA 4YRFA 1G5IA 3MEYA 2P5IA 2I4OA 1WNLA 5C52B 1BIAA 4YP0A 4CS3A 3L4GB 4DQ2A 3VQWA 2IY5A 4G85A 2RHQB 5K1PA 4O2DA 4TVAA 2EWNA 3MF2A 4XEOA 2AKWB 3HY1A 1KMNA 4HA8A 4YRCA 5ELOA 4OLFA 4YRTA 1BIBA 3DSQA 2Q7GA 1B70A 4OP0A 1ASYA 3P8TA 3V7RA 1VQZA 3M4QA 4P72C 4YRRA 4J15A 4KR3A 3HFZB 2G4CA 4YROA 3QO5A 4P73A 2ZT5A 3PCOA 1ADJA 5C51B 4UP8A 1NJ5A 3MQZA 5KNNA 2ZGWA 2IY5B 3TEGA 4H2SA 2CIMA 2ZIOA 4TVAB 2AKWA 4LVMA 1IL2A 3RIRA 1X2GA 4YDQA 4YPFA 3A74A 4DPGA 4TWAA 3M4PA 4LVLA 1X54A 2ZZGA 2DZCA 1QE0A 1YFSA 4H2VA 3FJPA 4P71C 4PHCA 3ICAA 1NJ1A 2J3MA 4ZTUB 4XTWA 4XU0A 4ZTZB 2E5AA 4XU3A 3QTCA 2ALYB 3KFUA 1E24A 1ATIA 3TEHB 2Q7EA 1B7YB 5C53B 4K88A 1L0WA 3TUPA 4BWAA 3LSQA 1WQ7A 2ZT7A 2DJZA 4HT4A 4WF2A 1NYRA 1YB3A 3A5YA 2RHQA 2DXUA 2QHTA 5ELNA 1QF6A 2FYKA 1EIYB 2C7IA 2EAYA 2DZ9A 2CJBA 4KR2A 4RQFA 4YRSA 1WPYA 1ADYA 2QHUA 3G1ZA 1JJCA 4RQEA 2DDZA 2CJ9A 4TQFA 4E51A 1YFRA 4HWSA 3W3SA 3V8JA 4XU1A 4YRLA 1NJ6A 1J5WA 1B76A 3HFZA 2I4LA 3LSSA 3P8YA 3TEHA 3VQXA 4AH6A 4YRIA 5E3IA 3L2ZA 1NNHA 3A7AA 4P74A 4YRJA 4P3NA 2DXTA 3E9IA 3OD1A 2ZZFA 2ZR2A 1W66A 3NELA 3HFVA 1SESA 2ZNIA 1WU7A 1H4TA 4UP9A 4P3OA 4WJ3M 2XTIA 1ASZA 1X01A 4HWRA 1JJCB 1PYSB 2DEQA 4CH6A 1G5HA 4G84A 5K1XA 4LVKA 4TVYA 2RHSB 1USYA 2A8EA 1HTTA 4LVIA 2ARTA 5HGQA 3QO8A 4CS2A 2C8MA 1WYDA 3PCOB 3A5ZA 4NCXA 2I4NA 1X56A 2DQ0A 5F5WA 1SETA 2AMCA 3EFSA 1B7YA 2HNIA 4P71A 4YRQA 2PMFA 4L87A 1BBUA 4X5OA 3HY0A 4UP7A 4WJ4A 1EFWA 1WQWA 3HTZA 1GGMA 2QHSA 3L1AA 3QNEA 4RMFA 1Z7NA 1EVKA 4TTVA 3RKYA 4RDXA 4CS4A 4XTUA 4H2YA 3NETA 1G51A 4XU2A 4H2TA 4LNSA 4CH3A 2DKGA 1KOGA 1E22A 3A32A 3IKLA 3RL6A 4P73C 1KMMA 3BFMA 3I7FA 2DVEA 1PYSA 2XGTA 1E1OA 1WLEA 4CH5A 4YREA 3RUXA 1C0AA 2PMEA 1X55A 3LC0A 4YRNA 4XTVA 1USYC 3V8KA 3NENA 2ZXFA 4HWOA 4TQDA 2ZNJA 3HXWA 1N9WA 1NJ8A 1YGBA 4EO4A 2E65A 1B70B 12ASA 3NEMA 1HXDA 2RHSA 4HWPA 4P75A 4H2XB 4P74C 1BBWA 4YYEA 2DQ3A 4K87A 3RKWA 1B8AA 4YRKA 3CMQA 4YRMA 2DTIA 1NJ2A 2NS6A 3P8VA 2ZT6A 3L4GA 1LYLA 2ZT8A 4H02A 1EOVA 2ARSA 3VBBA 3A31A 2ZINA 2CGHA 2ODRC 2ZZEA 4HWTA 3HXXA 1YFTA 2ZCEA 4YCVA 2DTHA 3RKXA 1NYQA 3A7UA 3VQVA 3REXA 3HXZA 4BW9A 4HVCA 3QO7A 3HRKA 3V8LA 2J3LA 4YCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVJ A;  4LVM A;  4LVK A;  4HT4 A;  4LVI A;  2NS6 A;  4LVL A; 
#chains in the Genus database with same CATH topology
 1FYF A;  3IAL A;  3UGQ A;  3UFG A;  3WQZ A;  3UGT A;  1H4S A;  2DTO A;  2ZR3 A;  2Q5I A;  1H4V B;  4H2X A;  3UH0 A;  4Q6G A;  3IKM B;  1X2H A;  3A7R A;  4UPA A;  2QHV A;  1SRY A;  2E64 A;  4YRP A;  2EJ9 A;  3PZC A;  4XTX A;  3VQY A;  4H2U A;  3HRI A;  2P0L A;  3RF1 A;  4P75 C;  2AMC B;  1SER A;  3HXV A;  3REU A;  2E10 A;  2ALY A;  4TVW A;  3IG2 A;  4EX5 A;  1E1T A;  3MF1 A;  4PG3 A;  2EL9 A;  4KQE A;  3R07 A;  2CJA A;  4YCW A;  2Q7H A;  1EVL A;  1EIY A;  1EQR A;  4K86 A;  2DU5 A;  4Q15 A;  3RGL A;  2E41 A;  4P3P A;  4YRG A;  3V7C A;  1Z7M A;  3HXY A;  2ARU A;  4XTZ A;  3BJU A;  2ZTG A;  1RIQ A;  2E3C A;  4WI1 A;  2EJG A;  2ODR D;  3V7S A;  3EFR A;  1HC7 A;  1H4Q A;  2ZIM A;  3E9H A;  4CH4 A;  2EJF A;  11AS A;  2I4M A;  3ERR A;  4H2W A;  2DU7 A;  4XTY A;  3HXU A;  4LVJ A;  4P72 A;  2Q5H A;  3RAC A;  2E1H A;  4ZIB A;  4XEM A;  4YRF A;  1G5I A;  3MEY A;  2P5I A;  2I4O A;  1WNL A;  5C52 B;  1BIA A;  4YP0 A;  4CS3 A;  3L4G B;  4DQ2 A;  3VQW A;  2IY5 A;  4G85 A;  2RHQ B;  5K1P A;  4O2D A;  4TVA A;  2EWN A;  3MF2 A;  4XEO A;  2AKW B;  3HY1 A;  1KMN A;  4HA8 A;  4YRC A;  5ELO A;  4OLF A;  4YRT A;  1BIB A;  3DSQ A;  2Q7G A;  1B70 A;  4OP0 A;  1ASY A;  3P8T A;  3V7R A;  1VQZ A;  3M4Q A;  4P72 C;  4YRR A;  4J15 A;  4KR3 A;  3HFZ B;  2G4C A;  4YRO A;  3QO5 A;  4P73 A;  2ZT5 A;  3PCO A;  1ADJ A;  5C51 B;  4UP8 A;  1NJ5 A;  3MQZ A;  5KNN A;  2ZGW A;  2IY5 B;  3TEG A;  4H2S A;  2CIM A;  2ZIO A;  4TVA B;  2AKW A;  4LVM A;  1IL2 A;  3RIR A;  1X2G A;  4YDQ A;  4YPF A;  3A74 A;  4DPG A;  4TWA A;  3M4P A;  4LVL A;  1X54 A;  2ZZG A;  2DZC A;  1QE0 A;  1YFS A;  4H2V A;  3FJP A;  4P71 C;  4PHC A;  3ICA A;  1NJ1 A;  2J3M A;  4ZTU B;  4XTW A;  4XU0 A;  4ZTZ B;  2E5A A;  4XU3 A;  3QTC A;  2ALY B;  3KFU A;  1E24 A;  1ATI A;  3TEH B;  2Q7E A;  1B7Y B;  5C53 B;  4K88 A;  1L0W A;  3TUP A;  4BWA A;  3LSQ A;  1WQ7 A;  2ZT7 A;  2DJZ A;  4HT4 A;  4WF2 A;  1NYR A;  1YB3 A;  3A5Y A;  2RHQ A;  2DXU A;  2QHT A;  5ELN A;  1QF6 A;  2FYK A;  1EIY B;  2C7I A;  2EAY A;  2DZ9 A;  2CJB A;  4KR2 A;  4RQF A;  4YRS A;  1WPY A;  1ADY A;  2QHU A;  3G1Z A;  1JJC A;  4RQE A;  2DDZ A;  2CJ9 A;  4TQF A;  4E51 A;  1YFR A;  4HWS A;  3W3S A;  3V8J A;  4XU1 A;  4YRL A;  1NJ6 A;  1J5W A;  1B76 A;  3HFZ A;  2I4L A;  3LSS A;  3P8Y A;  3TEH A;  3VQX A;  4AH6 A;  4YRI A;  5E3I A;  3L2Z A;  1NNH A;  3A7A A;  4P74 A;  4YRJ A;  4P3N A;  2DXT A;  3E9I A;  3OD1 A;  2ZZF A;  2ZR2 A;  1W66 A;  3NEL A;  3HFV A;  1SES A;  2ZNI A;  1WU7 A;  1H4T A;  4UP9 A;  4P3O A;  4WJ3 M;  2XTI A;  1ASZ A;  1X01 A;  4HWR A;  1JJC B;  1PYS B;  2DEQ A;  4CH6 A;  1G5H A;  4G84 A;  5K1X A;  4LVK A;  4TVY A;  2RHS B;  1USY A;  2A8E A;  1HTT A;  4LVI A;  2ART A;  5HGQ A;  3QO8 A;  4CS2 A;  2C8M A;  1WYD A;  3PCO B;  3A5Z A;  4NCX A;  2I4N A;  1X56 A;  2DQ0 A;  5F5W A;  1SET A;  2AMC A;  3EFS A;  1B7Y A;  2HNI A;  4P71 A;  4YRQ A;  2PMF A;  4L87 A;  1BBU A;  4X5O A;  3HY0 A;  4UP7 A;  4WJ4 A;  1EFW A;  1WQW A;  3HTZ A;  1GGM A;  2QHS A;  3L1A A;  3QNE A;  4RMF A;  1Z7N A;  1EVK A;  4TTV A;  3RKY A;  4RDX A;  4CS4 A;  4XTU A;  4H2Y A;  3NET A;  1G51 A;  4XU2 A;  4H2T A;  4LNS A;  4CH3 A;  2DKG A;  1KOG A;  1E22 A;  3A32 A;  3IKL A;  3RL6 A;  4P73 C;  1KMM A;  3BFM A;  3I7F A;  2DVE A;  1PYS A;  2XGT A;  1E1O A;  1WLE A;  4CH5 A;  4YRE A;  3RUX A;  1C0A A;  2PME A;  1X55 A;  3LC0 A;  4YRN A;  4XTV A;  1USY C;  3V8K A;  3NEN A;  2ZXF A;  4HWO A;  4TQD A;  2ZNJ A;  3HXW A;  1N9W A;  1NJ8 A;  1YGB A;  4EO4 A;  2E65 A;  1B70 B;  12AS A;  3NEM A;  1HXD A;  2RHS A;  4HWP A;  4P75 A;  4H2X B;  4P74 C;  1BBW A;  4YYE A;  2DQ3 A;  4K87 A;  3RKW A;  1B8A A;  4YRK A;  3CMQ A;  4YRM A;  2DTI A;  1NJ2 A;  2NS6 A;  3P8V A;  2ZT6 A;  3L4G A;  1LYL A;  2ZT8 A;  4H02 A;  1EOV A;  2ARS A;  3VBB A;  3A31 A;  2ZIN A;  2CGH A;  2ODR C;  2ZZE A;  4HWT A;  3HXX A;  1YFT A;  2ZCE A;  4YCV A;  2DTH A;  3RKX A;  1NYQ A;  3A7U A;  3VQV A;  3REX A;  3HXZ A;  4BW9 A;  4HVC A;  3QO7 A;  3HRK A;  3V8L A;  2J3L A;  4YCU A; 
#chains in the Genus database with same CATH homology
 1FYF A;  3IAL A;  3UGQ A;  3UFG A;  3WQZ A;  3UGT A;  1H4S A;  2DTO A;  2ZR3 A;  2Q5I A;  1H4V B;  4H2X A;  3UH0 A;  4Q6G A;  3IKM B;  1X2H A;  3A7R A;  4UPA A;  2QHV A;  1SRY A;  2E64 A;  4YRP A;  2EJ9 A;  3PZC A;  4XTX A;  3VQY A;  4H2U A;  3HRI A;  2P0L A;  3RF1 A;  4P75 C;  2AMC B;  1SER A;  3HXV A;  3REU A;  2E10 A;  2ALY A;  4TVW A;  3IG2 A;  4EX5 A;  1E1T A;  3MF1 A;  4PG3 A;  2EL9 A;  4KQE A;  3R07 A;  2CJA A;  4YCW A;  2Q7H A;  1EVL A;  1EIY A;  1EQR A;  4K86 A;  2DU5 A;  4Q15 A;  3RGL A;  2E41 A;  4P3P A;  4YRG A;  3V7C A;  1Z7M A;  3HXY A;  2ARU A;  4XTZ A;  3BJU A;  2ZTG A;  1RIQ A;  2E3C A;  4WI1 A;  2EJG A;  2ODR D;  3V7S A;  3EFR A;  1HC7 A;  1H4Q A;  2ZIM A;  3E9H A;  4CH4 A;  2EJF A;  11AS A;  2I4M A;  3ERR A;  4H2W A;  2DU7 A;  4XTY A;  3HXU A;  4LVJ A;  4P72 A;  2Q5H A;  3RAC A;  2E1H A;  4ZIB A;  4XEM A;  4YRF A;  1G5I A;  3MEY A;  2P5I A;  2I4O A;  1WNL A;  5C52 B;  1BIA A;  4YP0 A;  4CS3 A;  3L4G B;  4DQ2 A;  3VQW A;  2IY5 A;  4G85 A;  2RHQ B;  5K1P A;  4O2D A;  4TVA A;  2EWN A;  3MF2 A;  4XEO A;  2AKW B;  3HY1 A;  1KMN A;  4HA8 A;  4YRC A;  5ELO A;  4OLF A;  4YRT A;  1BIB A;  3DSQ A;  2Q7G A;  1B70 A;  4OP0 A;  1ASY A;  3P8T A;  3V7R A;  1VQZ A;  3M4Q A;  4P72 C;  4YRR A;  4J15 A;  4KR3 A;  3HFZ B;  2G4C A;  4YRO A;  3QO5 A;  4P73 A;  2ZT5 A;  3PCO A;  1ADJ A;  5C51 B;  4UP8 A;  1NJ5 A;  3MQZ A;  5KNN A;  2ZGW A;  2IY5 B;  3TEG A;  4H2S A;  2CIM A;  2ZIO A;  4TVA B;  2AKW A;  4LVM A;  1IL2 A;  3RIR A;  1X2G A;  4YDQ A;  4YPF A;  3A74 A;  4DPG A;  4TWA A;  3M4P A;  4LVL A;  1X54 A;  2ZZG A;  2DZC A;  1QE0 A;  1YFS A;  4H2V A;  3FJP A;  4P71 C;  4PHC A;  3ICA A;  1NJ1 A;  2J3M A;  4ZTU B;  4XTW A;  4XU0 A;  4ZTZ B;  2E5A A;  4XU3 A;  3QTC A;  2ALY B;  3KFU A;  1E24 A;  1ATI A;  3TEH B;  2Q7E A;  1B7Y B;  5C53 B;  4K88 A;  1L0W A;  3TUP A;  4BWA A;  3LSQ A;  1WQ7 A;  2ZT7 A;  2DJZ A;  4HT4 A;  4WF2 A;  1NYR A;  1YB3 A;  3A5Y A;  2RHQ A;  2DXU A;  2QHT A;  5ELN A;  1QF6 A;  2FYK A;  1EIY B;  2C7I A;  2EAY A;  2DZ9 A;  2CJB A;  4KR2 A;  4RQF A;  4YRS A;  1WPY A;  1ADY A;  2QHU A;  3G1Z A;  1JJC A;  4RQE A;  2DDZ A;  2CJ9 A;  4TQF A;  4E51 A;  1YFR A;  4HWS A;  3W3S A;  3V8J A;  4XU1 A;  4YRL A;  1NJ6 A;  1J5W A;  1B76 A;  3HFZ A;  2I4L A;  3LSS A;  3P8Y A;  3TEH A;  3VQX A;  4AH6 A;  4YRI A;  5E3I A;  3L2Z A;  1NNH A;  3A7A A;  4P74 A;  4YRJ A;  4P3N A;  2DXT A;  3E9I A;  3OD1 A;  2ZZF A;  2ZR2 A;  1W66 A;  3NEL A;  3HFV A;  1SES A;  2ZNI A;  1WU7 A;  1H4T A;  4UP9 A;  4P3O A;  4WJ3 M;  2XTI A;  1ASZ A;  1X01 A;  4HWR A;  1JJC B;  1PYS B;  2DEQ A;  4CH6 A;  1G5H A;  4G84 A;  5K1X A;  4LVK A;  4TVY A;  2RHS B;  1USY A;  2A8E A;  1HTT A;  4LVI A;  2ART A;  5HGQ A;  3QO8 A;  4CS2 A;  2C8M A;  1WYD A;  3PCO B;  3A5Z A;  4NCX A;  2I4N A;  1X56 A;  2DQ0 A;  5F5W A;  1SET A;  2AMC A;  3EFS A;  1B7Y A;  2HNI A;  4P71 A;  4YRQ A;  2PMF A;  4L87 A;  1BBU A;  4X5O A;  3HY0 A;  4UP7 A;  4WJ4 A;  1EFW A;  1WQW A;  3HTZ A;  1GGM A;  2QHS A;  3L1A A;  3QNE A;  4RMF A;  1Z7N A;  1EVK A;  4TTV A;  3RKY A;  4RDX A;  4CS4 A;  4XTU A;  4H2Y A;  3NET A;  1G51 A;  4XU2 A;  4H2T A;  4LNS A;  4CH3 A;  2DKG A;  1KOG A;  1E22 A;  3A32 A;  3IKL A;  3RL6 A;  4P73 C;  1KMM A;  3BFM A;  3I7F A;  2DVE A;  1PYS A;  2XGT A;  1E1O A;  1WLE A;  4CH5 A;  4YRE A;  3RUX A;  1C0A A;  2PME A;  1X55 A;  3LC0 A;  4YRN A;  4XTV A;  1USY C;  3V8K A;  3NEN A;  2ZXF A;  4HWO A;  4TQD A;  2ZNJ A;  3HXW A;  1N9W A;  1NJ8 A;  1YGB A;  4EO4 A;  2E65 A;  1B70 B;  12AS A;  3NEM A;  1HXD A;  2RHS A;  4HWP A;  4P75 A;  4H2X B;  4P74 C;  1BBW A;  4YYE A;  2DQ3 A;  4K87 A;  3RKW A;  1B8A A;  4YRK A;  3CMQ A;  4YRM A;  2DTI A;  1NJ2 A;  2NS6 A;  3P8V A;  2ZT6 A;  3L4G A;  1LYL A;  2ZT8 A;  4H02 A;  1EOV A;  2ARS A;  3VBB A;  3A31 A;  2ZIN A;  2CGH A;  2ODR C;  2ZZE A;  4HWT A;  3HXX A;  1YFT A;  2ZCE A;  4YCV A;  2DTH A;  3RKX A;  1NYQ A;  3A7U A;  3VQV A;  3REX A;  3HXZ A;  4BW9 A;  4HVC A;  3QO7 A;  3HRK A;  3V8L A;  2J3L A;  4YCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...