4LVKA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt+3'phosphate). mn-bound crystal structure at ph 4.6
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
195
structure length
191
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Dna binding protein/dna
molecule keywords Plasmid recombination enzyme
total genus 56
structure length 191
sequence length 195
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lvkA01
4LVIA 4LVKA 4LVJA 4LVLA 2NS6A 4LVMA 4HT4A
chains in the Genus database with same CATH superfamily
3FJPA 4XEMA 1EFWA 1IL2A 3LC0A 2E64A 4LNSA 4ZTZB 4LVJA 1EIYB 2ZZEA 4WJ4A 2XTIA 1YB3A 4P73C 4YRQA 3VQXA 3TUPA 4K86A 4YRCA 3UFGA 2ZT6A 4YYEA 4YDQA 2CJ9A 2E3CA 4RDXA 1PYSB 2G4CA 3L1AA 4G84A 3P8TA 4H2WA 1C0AA 3HXUA 1X01A 4YRRA 4YRLA 1NJ5A 4Q15A 4BWAA 4HWRA 3M4PA 4TQFA 1NJ8A 1LYLA 3LSSA 4H2XB 4KQEA 3M4QA 3VBBA 2DVEA 2ZT7A 1L0WA 1H4SA 2ZT8A 4H2UA 4YPFA 3RL6A 4YRFA 3V7RA 4YRJA 1B76A 3L4GA 1ASZA 1BIBA 5ELNA 4KR3A 4ZIBA 4UP9A 3G1ZA 3HXVA 3VQVA 1NYRA 3HFVA 3RKYA 2RHSB 3RACA 2E1HA 1X56A 1BBWA 1N9WA 3L2ZA 1SERA 4YCWA 3V8JA 4CS4A 4YREA 4EO4A 2EJFA 1Z7MA 3P8YA 4P72C 3A7RA 2DU7A 1ATIA 2NS6A 1HXDA 3HFZA 1WU7A 1SRYA 2A8EA 4YRPA 3RGLA 4H2TA 2EJ9A 3HRKA 4P71C 1B8AA 5ELOA 1H4TA 1KMNA 2QHVA 3VQYA 1VQZA 2E41A 3QO8A 1B70B 2ZINA 3MEYA 3V8LA 1NYQA 4PG3A 3WQZA 1X2HA 4Q6GA 4NCXA 2C8MA 1SESA 2Q5HA 3A74A 3OD1A 5K1XA 1W66A 2ZIMA 2ZNIA 3RF1A 4H2YA 3TEHB 2RHSA 2I4NA 3ERRA 4CH6A 3PCOB 4O2DA 4XU1A 2DXTA 3HXWA 1BBUA 4XTZA 4HT4A 4H2XA 2XGTA 3PZCA 4UP8A 4XTYA 1B70A 4H2VA 3NELA 4TTVA 4EX5A 1NJ1A 2EJGA 4LVLA 3ICAA 3W3SA 4RMFA 4HWSA 3MQZA 1FYFA 2ALYA 2P0LA 1HTTA 4OLFA 1ASYA 3E9HA 2DQ3A 3R07A 4YCVA 1H4QA 1USYA 4WF2A 1B7YB 12ASA 4YRSA 11ASA 3HXZA 1G5IA 1QF6A 1YFSA 1RIQA 2ZGWA 4WJ3M 2ZR3A 4PHCA 3NENA 2DKGA 1E22A 4YP0A 3UGQA 4E51A 3RKXA 3TEGA 4HWPA 4TWAA 5HGQA 1G5HA 2ZT5A 1NJ2A 2P5IA 2QHUA 4HA8A 1GGMA 2Q5IA 1WQWA 2CJBA 3A7UA 3QO7A 2DTOA 4LVKA 4P72A 3MF2A 3HTZA 4TVYA 2DXUA 1HC7A 5E3IA 4CH4A 1X55A 1WPYA 3A32A 4H2SA 2E10A 4X5OA 4KR2A 2DU5A 2EWNA 1ADJA 4P71A 4DQ2A 1EVLA 1WYDA 4H02A 4YRTA 3IALA 4BW9A 4P74A 3HFZB 3HRIA 3PCOA 1BIAA 4WI1A 1QE0A 2DZ9A 2DTHA 3EFRA 2ZZFA 4XEOA 3CMQA 4UP7A 4J15A 2CIMA 3RIRA 4YRKA 2ZIOA 2HNIA 5C51B 3BJUA 3QO5A 3NETA 2RHQA 1EQRA 2ZNJA 2ZXFA 2Q7HA 4TVAB 3HXYA 2ARSA 3IG2A 3P8VA 1J5WA 4YRGA 2IY5A 2Q7GA 1WLEA 3IKLA 1B7YA 3REUA 4CH5A 4CS2A 4P75A 4CH3A 4YRMA 2PMFA 3HY1A 4RQFA 4AH6A 3HXXA 2EAYA 2ALYB 1E1TA 2E65A 4XTXA 1WQ7A 4CS3A 1Z7NA 5C52B 3I7FA 3REXA 1SETA 1WNLA 3VQWA 2AKWA 2I4LA 2ZCEA 4HWTA 1YFRA 4DPGA 3A7AA 2C7IA 4HVCA 2QHTA 2IY5B 2DZCA 4K88A 1EVKA 1KOGA 2DJZA 4UPAA 2ZZGA 2ARTA 3UGTA 2AKWB 2RHQB 1NJ6A 3MF1A 5F5WA 2E5AA 2DDZA 4P74C 4P3OA 4YROA 4YCUA 2FYKA 1X54A 1G51A 2AMCB 4K87A 3L4GB 4XU3A 4YRNA 3NEMA 4G85A 3UH0A 3RKWA 3LSQA 4P3NA 4RQEA 3BFMA 2I4OA 1YGBA 2DEQA 3QTCA 4TVWA 2ODRD 4XTWA 1KMMA 1USYC 4XU0A 1EOVA 1X2GA 3DSQA 3IKMB 1H4VB 3A31A 4OP0A 3RUXA 2DQ0A 2ARUA 2J3LA 4P3PA 3A5YA 3V7SA 1YFTA 3V7CA 1JJCA 2AMCA 1E1OA 1NNHA 4XTUA 1E24A 3E9IA 2ZR2A 4XU2A 5K1PA 4LVIA 5KNNA 4P75C 3HY0A 2ZTGA 4HWOA 1PYSA 3KFUA 2Q7EA 4YRIA 4ZTUB 3EFSA 3QNEA 3A5ZA 1EIYA 2CJAA 2QHSA 4TQDA 4TVAA 5C53B 1JJCB 2ODRC 2I4MA 4P73A 2CGHA 2EL9A 3TEHA 4LVMA 4L87A 2PMEA 1ADYA 2DTIA 4XTVA 3V8KA 2J3MA
chains in the Genus database with same CATH topology
3FJPA 4XEMA 1EFWA 1IL2A 3LC0A 2E64A 4LNSA 4ZTZB 4LVJA 1EIYB 2ZZEA 4WJ4A 2XTIA 1YB3A 4P73C 4YRQA 3VQXA 3TUPA 4K86A 4YRCA 3UFGA 2ZT6A 4YYEA 4YDQA 2CJ9A 2E3CA 4RDXA 1PYSB 2G4CA 3L1AA 4G84A 3P8TA 4H2WA 1C0AA 3HXUA 1X01A 4YRRA 4YRLA 1NJ5A 4Q15A 4BWAA 4HWRA 3M4PA 4TQFA 1NJ8A 1LYLA 3LSSA 4H2XB 4KQEA 3M4QA 3VBBA 2DVEA 2ZT7A 1L0WA 1H4SA 2ZT8A 4H2UA 4YPFA 3RL6A 4YRFA 3V7RA 4YRJA 1B76A 3L4GA 1ASZA 1BIBA 5ELNA 4KR3A 4ZIBA 4UP9A 3G1ZA 3HXVA 3VQVA 1NYRA 3HFVA 3RKYA 2RHSB 3RACA 2E1HA 1X56A 1BBWA 1N9WA 3L2ZA 1SERA 4YCWA 3V8JA 4CS4A 4YREA 4EO4A 2EJFA 1Z7MA 3P8YA 4P72C 3A7RA 2DU7A 1ATIA 2NS6A 1HXDA 3HFZA 1WU7A 1SRYA 2A8EA 4YRPA 3RGLA 4H2TA 2EJ9A 3HRKA 4P71C 1B8AA 5ELOA 1H4TA 1KMNA 2QHVA 3VQYA 1VQZA 2E41A 3QO8A 1B70B 2ZINA 3MEYA 3V8LA 1NYQA 4PG3A 3WQZA 1X2HA 4Q6GA 4NCXA 2C8MA 1SESA 2Q5HA 3A74A 3OD1A 5K1XA 1W66A 2ZIMA 2ZNIA 3RF1A 4H2YA 3TEHB 2RHSA 2I4NA 3ERRA 4CH6A 3PCOB 4O2DA 4XU1A 2DXTA 3HXWA 1BBUA 4XTZA 4HT4A 4H2XA 2XGTA 3PZCA 4UP8A 4XTYA 1B70A 4H2VA 3NELA 4TTVA 4EX5A 1NJ1A 2EJGA 4LVLA 3ICAA 3W3SA 4RMFA 4HWSA 3MQZA 1FYFA 2ALYA 2P0LA 1HTTA 4OLFA 1ASYA 3E9HA 2DQ3A 3R07A 4YCVA 1H4QA 1USYA 4WF2A 1B7YB 12ASA 4YRSA 11ASA 3HXZA 1G5IA 1QF6A 1YFSA 1RIQA 2ZGWA 4WJ3M 2ZR3A 4PHCA 3NENA 2DKGA 1E22A 4YP0A 3UGQA 4E51A 3RKXA 3TEGA 4HWPA 4TWAA 5HGQA 1G5HA 2ZT5A 1NJ2A 2P5IA 2QHUA 4HA8A 1GGMA 2Q5IA 1WQWA 2CJBA 3A7UA 3QO7A 2DTOA 4LVKA 4P72A 3MF2A 3HTZA 4TVYA 2DXUA 1HC7A 5E3IA 4CH4A 1X55A 1WPYA 3A32A 4H2SA 2E10A 4X5OA 4KR2A 2DU5A 2EWNA 1ADJA 4P71A 4DQ2A 1EVLA 1WYDA 4H02A 4YRTA 3IALA 4BW9A 4P74A 3HFZB 3HRIA 3PCOA 1BIAA 4WI1A 1QE0A 2DZ9A 2DTHA 3EFRA 2ZZFA 4XEOA 3CMQA 4UP7A 4J15A 2CIMA 3RIRA 4YRKA 2ZIOA 2HNIA 5C51B 3BJUA 3QO5A 3NETA 2RHQA 1EQRA 2ZNJA 2ZXFA 2Q7HA 4TVAB 3HXYA 2ARSA 3IG2A 3P8VA 1J5WA 4YRGA 2IY5A 2Q7GA 1WLEA 3IKLA 1B7YA 3REUA 4CH5A 4CS2A 4P75A 4CH3A 4YRMA 2PMFA 3HY1A 4RQFA 4AH6A 3HXXA 2EAYA 2ALYB 1E1TA 2E65A 4XTXA 1WQ7A 4CS3A 1Z7NA 5C52B 3I7FA 3REXA 1SETA 1WNLA 3VQWA 2AKWA 2I4LA 2ZCEA 4HWTA 1YFRA 4DPGA 3A7AA 2C7IA 4HVCA 2QHTA 2IY5B 2DZCA 4K88A 1EVKA 1KOGA 2DJZA 4UPAA 2ZZGA 2ARTA 3UGTA 2AKWB 2RHQB 1NJ6A 3MF1A 5F5WA 2E5AA 2DDZA 4P74C 4P3OA 4YROA 4YCUA 2FYKA 1X54A 1G51A 2AMCB 4K87A 3L4GB 4XU3A 4YRNA 3NEMA 4G85A 3UH0A 3RKWA 3LSQA 4P3NA 4RQEA 3BFMA 2I4OA 1YGBA 2DEQA 3QTCA 4TVWA 2ODRD 4XTWA 1KMMA 1USYC 4XU0A 1EOVA 1X2GA 3DSQA 3IKMB 1H4VB 3A31A 4OP0A 3RUXA 2DQ0A 2ARUA 2J3LA 4P3PA 3A5YA 3V7SA 1YFTA 3V7CA 1JJCA 2AMCA 1E1OA 1NNHA 4XTUA 1E24A 3E9IA 2ZR2A 4XU2A 5K1PA 4LVIA 5KNNA 4P75C 3HY0A 2ZTGA 4HWOA 1PYSA 3KFUA 2Q7EA 4YRIA 4ZTUB 3EFSA 3QNEA 3A5ZA 1EIYA 2CJAA 2QHSA 4TQDA 4TVAA 5C53B 1JJCB 2ODRC 2I4MA 4P73A 2CGHA 2EL9A 3TEHA 4LVMA 4L87A 2PMEA 1ADYA 2DTIA 4XTVA 3V8KA 2J3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVI A;  4LVK A;  4LVJ A;  4LVL A;  2NS6 A;  4LVM A;  4HT4 A; 
#chains in the Genus database with same CATH topology
 3FJP A;  4XEM A;  1EFW A;  1IL2 A;  3LC0 A;  2E64 A;  4LNS A;  4ZTZ B;  4LVJ A;  1EIY B;  2ZZE A;  4WJ4 A;  2XTI A;  1YB3 A;  4P73 C;  4YRQ A;  3VQX A;  3TUP A;  4K86 A;  4YRC A;  3UFG A;  2ZT6 A;  4YYE A;  4YDQ A;  2CJ9 A;  2E3C A;  4RDX A;  1PYS B;  2G4C A;  3L1A A;  4G84 A;  3P8T A;  4H2W A;  1C0A A;  3HXU A;  1X01 A;  4YRR A;  4YRL A;  1NJ5 A;  4Q15 A;  4BWA A;  4HWR A;  3M4P A;  4TQF A;  1NJ8 A;  1LYL A;  3LSS A;  4H2X B;  4KQE A;  3M4Q A;  3VBB A;  2DVE A;  2ZT7 A;  1L0W A;  1H4S A;  2ZT8 A;  4H2U A;  4YPF A;  3RL6 A;  4YRF A;  3V7R A;  4YRJ A;  1B76 A;  3L4G A;  1ASZ A;  1BIB A;  5ELN A;  4KR3 A;  4ZIB A;  4UP9 A;  3G1Z A;  3HXV A;  3VQV A;  1NYR A;  3HFV A;  3RKY A;  2RHS B;  3RAC A;  2E1H A;  1X56 A;  1BBW A;  1N9W A;  3L2Z A;  1SER A;  4YCW A;  3V8J A;  4CS4 A;  4YRE A;  4EO4 A;  2EJF A;  1Z7M A;  3P8Y A;  4P72 C;  3A7R A;  2DU7 A;  1ATI A;  2NS6 A;  1HXD A;  3HFZ A;  1WU7 A;  1SRY A;  2A8E A;  4YRP A;  3RGL A;  4H2T A;  2EJ9 A;  3HRK A;  4P71 C;  1B8A A;  5ELO A;  1H4T A;  1KMN A;  2QHV A;  3VQY A;  1VQZ A;  2E41 A;  3QO8 A;  1B70 B;  2ZIN A;  3MEY A;  3V8L A;  1NYQ A;  4PG3 A;  3WQZ A;  1X2H A;  4Q6G A;  4NCX A;  2C8M A;  1SES A;  2Q5H A;  3A74 A;  3OD1 A;  5K1X A;  1W66 A;  2ZIM A;  2ZNI A;  3RF1 A;  4H2Y A;  3TEH B;  2RHS A;  2I4N A;  3ERR A;  4CH6 A;  3PCO B;  4O2D A;  4XU1 A;  2DXT A;  3HXW A;  1BBU A;  4XTZ A;  4HT4 A;  4H2X A;  2XGT A;  3PZC A;  4UP8 A;  4XTY A;  1B70 A;  4H2V A;  3NEL A;  4TTV A;  4EX5 A;  1NJ1 A;  2EJG A;  4LVL A;  3ICA A;  3W3S A;  4RMF A;  4HWS A;  3MQZ A;  1FYF A;  2ALY A;  2P0L A;  1HTT A;  4OLF A;  1ASY A;  3E9H A;  2DQ3 A;  3R07 A;  4YCV A;  1H4Q A;  1USY A;  4WF2 A;  1B7Y B;  12AS A;  4YRS A;  11AS A;  3HXZ A;  1G5I A;  1QF6 A;  1YFS A;  1RIQ A;  2ZGW A;  4WJ3 M;  2ZR3 A;  4PHC A;  3NEN A;  2DKG A;  1E22 A;  4YP0 A;  3UGQ A;  4E51 A;  3RKX A;  3TEG A;  4HWP A;  4TWA A;  5HGQ A;  1G5H A;  2ZT5 A;  1NJ2 A;  2P5I A;  2QHU A;  4HA8 A;  1GGM A;  2Q5I A;  1WQW A;  2CJB A;  3A7U A;  3QO7 A;  2DTO A;  4LVK A;  4P72 A;  3MF2 A;  3HTZ A;  4TVY A;  2DXU A;  1HC7 A;  5E3I A;  4CH4 A;  1X55 A;  1WPY A;  3A32 A;  4H2S A;  2E10 A;  4X5O A;  4KR2 A;  2DU5 A;  2EWN A;  1ADJ A;  4P71 A;  4DQ2 A;  1EVL A;  1WYD A;  4H02 A;  4YRT A;  3IAL A;  4BW9 A;  4P74 A;  3HFZ B;  3HRI A;  3PCO A;  1BIA A;  4WI1 A;  1QE0 A;  2DZ9 A;  2DTH A;  3EFR A;  2ZZF A;  4XEO A;  3CMQ A;  4UP7 A;  4J15 A;  2CIM A;  3RIR A;  4YRK A;  2ZIO A;  2HNI A;  5C51 B;  3BJU A;  3QO5 A;  3NET A;  2RHQ A;  1EQR A;  2ZNJ A;  2ZXF A;  2Q7H A;  4TVA B;  3HXY A;  2ARS A;  3IG2 A;  3P8V A;  1J5W A;  4YRG A;  2IY5 A;  2Q7G A;  1WLE A;  3IKL A;  1B7Y A;  3REU A;  4CH5 A;  4CS2 A;  4P75 A;  4CH3 A;  4YRM A;  2PMF A;  3HY1 A;  4RQF A;  4AH6 A;  3HXX A;  2EAY A;  2ALY B;  1E1T A;  2E65 A;  4XTX A;  1WQ7 A;  4CS3 A;  1Z7N A;  5C52 B;  3I7F A;  3REX A;  1SET A;  1WNL A;  3VQW A;  2AKW A;  2I4L A;  2ZCE A;  4HWT A;  1YFR A;  4DPG A;  3A7A A;  2C7I A;  4HVC A;  2QHT A;  2IY5 B;  2DZC A;  4K88 A;  1EVK A;  1KOG A;  2DJZ A;  4UPA A;  2ZZG A;  2ART A;  3UGT A;  2AKW B;  2RHQ B;  1NJ6 A;  3MF1 A;  5F5W A;  2E5A A;  2DDZ A;  4P74 C;  4P3O A;  4YRO A;  4YCU A;  2FYK A;  1X54 A;  1G51 A;  2AMC B;  4K87 A;  3L4G B;  4XU3 A;  4YRN A;  3NEM A;  4G85 A;  3UH0 A;  3RKW A;  3LSQ A;  4P3N A;  4RQE A;  3BFM A;  2I4O A;  1YGB A;  2DEQ A;  3QTC A;  4TVW A;  2ODR D;  4XTW A;  1KMM A;  1USY C;  4XU0 A;  1EOV A;  1X2G A;  3DSQ A;  3IKM B;  1H4V B;  3A31 A;  4OP0 A;  3RUX A;  2DQ0 A;  2ARU A;  2J3L A;  4P3P A;  3A5Y A;  3V7S A;  1YFT A;  3V7C A;  1JJC A;  2AMC A;  1E1O A;  1NNH A;  4XTU A;  1E24 A;  3E9I A;  2ZR2 A;  4XU2 A;  5K1P A;  4LVI A;  5KNN A;  4P75 C;  3HY0 A;  2ZTG A;  4HWO A;  1PYS A;  3KFU A;  2Q7E A;  4YRI A;  4ZTU B;  3EFS A;  3QNE A;  3A5Z A;  1EIY A;  2CJA A;  2QHS A;  4TQD A;  4TVA A;  5C53 B;  1JJC B;  2ODR C;  2I4M A;  4P73 A;  2CGH A;  2EL9 A;  3TEH A;  4LVM A;  4L87 A;  2PME A;  1ADY A;  2DTI A;  4XTV A;  3V8K A;  2J3M A; 
#chains in the Genus database with same CATH homology
 3FJP A;  4XEM A;  1EFW A;  1IL2 A;  3LC0 A;  2E64 A;  4LNS A;  4ZTZ B;  4LVJ A;  1EIY B;  2ZZE A;  4WJ4 A;  2XTI A;  1YB3 A;  4P73 C;  4YRQ A;  3VQX A;  3TUP A;  4K86 A;  4YRC A;  3UFG A;  2ZT6 A;  4YYE A;  4YDQ A;  2CJ9 A;  2E3C A;  4RDX A;  1PYS B;  2G4C A;  3L1A A;  4G84 A;  3P8T A;  4H2W A;  1C0A A;  3HXU A;  1X01 A;  4YRR A;  4YRL A;  1NJ5 A;  4Q15 A;  4BWA A;  4HWR A;  3M4P A;  4TQF A;  1NJ8 A;  1LYL A;  3LSS A;  4H2X B;  4KQE A;  3M4Q A;  3VBB A;  2DVE A;  2ZT7 A;  1L0W A;  1H4S A;  2ZT8 A;  4H2U A;  4YPF A;  3RL6 A;  4YRF A;  3V7R A;  4YRJ A;  1B76 A;  3L4G A;  1ASZ A;  1BIB A;  5ELN A;  4KR3 A;  4ZIB A;  4UP9 A;  3G1Z A;  3HXV A;  3VQV A;  1NYR A;  3HFV A;  3RKY A;  2RHS B;  3RAC A;  2E1H A;  1X56 A;  1BBW A;  1N9W A;  3L2Z A;  1SER A;  4YCW A;  3V8J A;  4CS4 A;  4YRE A;  4EO4 A;  2EJF A;  1Z7M A;  3P8Y A;  4P72 C;  3A7R A;  2DU7 A;  1ATI A;  2NS6 A;  1HXD A;  3HFZ A;  1WU7 A;  1SRY A;  2A8E A;  4YRP A;  3RGL A;  4H2T A;  2EJ9 A;  3HRK A;  4P71 C;  1B8A A;  5ELO A;  1H4T A;  1KMN A;  2QHV A;  3VQY A;  1VQZ A;  2E41 A;  3QO8 A;  1B70 B;  2ZIN A;  3MEY A;  3V8L A;  1NYQ A;  4PG3 A;  3WQZ A;  1X2H A;  4Q6G A;  4NCX A;  2C8M A;  1SES A;  2Q5H A;  3A74 A;  3OD1 A;  5K1X A;  1W66 A;  2ZIM A;  2ZNI A;  3RF1 A;  4H2Y A;  3TEH B;  2RHS A;  2I4N A;  3ERR A;  4CH6 A;  3PCO B;  4O2D A;  4XU1 A;  2DXT A;  3HXW A;  1BBU A;  4XTZ A;  4HT4 A;  4H2X A;  2XGT A;  3PZC A;  4UP8 A;  4XTY A;  1B70 A;  4H2V A;  3NEL A;  4TTV A;  4EX5 A;  1NJ1 A;  2EJG A;  4LVL A;  3ICA A;  3W3S A;  4RMF A;  4HWS A;  3MQZ A;  1FYF A;  2ALY A;  2P0L A;  1HTT A;  4OLF A;  1ASY A;  3E9H A;  2DQ3 A;  3R07 A;  4YCV A;  1H4Q A;  1USY A;  4WF2 A;  1B7Y B;  12AS A;  4YRS A;  11AS A;  3HXZ A;  1G5I A;  1QF6 A;  1YFS A;  1RIQ A;  2ZGW A;  4WJ3 M;  2ZR3 A;  4PHC A;  3NEN A;  2DKG A;  1E22 A;  4YP0 A;  3UGQ A;  4E51 A;  3RKX A;  3TEG A;  4HWP A;  4TWA A;  5HGQ A;  1G5H A;  2ZT5 A;  1NJ2 A;  2P5I A;  2QHU A;  4HA8 A;  1GGM A;  2Q5I A;  1WQW A;  2CJB A;  3A7U A;  3QO7 A;  2DTO A;  4LVK A;  4P72 A;  3MF2 A;  3HTZ A;  4TVY A;  2DXU A;  1HC7 A;  5E3I A;  4CH4 A;  1X55 A;  1WPY A;  3A32 A;  4H2S A;  2E10 A;  4X5O A;  4KR2 A;  2DU5 A;  2EWN A;  1ADJ A;  4P71 A;  4DQ2 A;  1EVL A;  1WYD A;  4H02 A;  4YRT A;  3IAL A;  4BW9 A;  4P74 A;  3HFZ B;  3HRI A;  3PCO A;  1BIA A;  4WI1 A;  1QE0 A;  2DZ9 A;  2DTH A;  3EFR A;  2ZZF A;  4XEO A;  3CMQ A;  4UP7 A;  4J15 A;  2CIM A;  3RIR A;  4YRK A;  2ZIO A;  2HNI A;  5C51 B;  3BJU A;  3QO5 A;  3NET A;  2RHQ A;  1EQR A;  2ZNJ A;  2ZXF A;  2Q7H A;  4TVA B;  3HXY A;  2ARS A;  3IG2 A;  3P8V A;  1J5W A;  4YRG A;  2IY5 A;  2Q7G A;  1WLE A;  3IKL A;  1B7Y A;  3REU A;  4CH5 A;  4CS2 A;  4P75 A;  4CH3 A;  4YRM A;  2PMF A;  3HY1 A;  4RQF A;  4AH6 A;  3HXX A;  2EAY A;  2ALY B;  1E1T A;  2E65 A;  4XTX A;  1WQ7 A;  4CS3 A;  1Z7N A;  5C52 B;  3I7F A;  3REX A;  1SET A;  1WNL A;  3VQW A;  2AKW A;  2I4L A;  2ZCE A;  4HWT A;  1YFR A;  4DPG A;  3A7A A;  2C7I A;  4HVC A;  2QHT A;  2IY5 B;  2DZC A;  4K88 A;  1EVK A;  1KOG A;  2DJZ A;  4UPA A;  2ZZG A;  2ART A;  3UGT A;  2AKW B;  2RHQ B;  1NJ6 A;  3MF1 A;  5F5W A;  2E5A A;  2DDZ A;  4P74 C;  4P3O A;  4YRO A;  4YCU A;  2FYK A;  1X54 A;  1G51 A;  2AMC B;  4K87 A;  3L4G B;  4XU3 A;  4YRN A;  3NEM A;  4G85 A;  3UH0 A;  3RKW A;  3LSQ A;  4P3N A;  4RQE A;  3BFM A;  2I4O A;  1YGB A;  2DEQ A;  3QTC A;  4TVW A;  2ODR D;  4XTW A;  1KMM A;  1USY C;  4XU0 A;  1EOV A;  1X2G A;  3DSQ A;  3IKM B;  1H4V B;  3A31 A;  4OP0 A;  3RUX A;  2DQ0 A;  2ARU A;  2J3L A;  4P3P A;  3A5Y A;  3V7S A;  1YFT A;  3V7C A;  1JJC A;  2AMC A;  1E1O A;  1NNH A;  4XTU A;  1E24 A;  3E9I A;  2ZR2 A;  4XU2 A;  5K1P A;  4LVI A;  5KNN A;  4P75 C;  3HY0 A;  2ZTG A;  4HWO A;  1PYS A;  3KFU A;  2Q7E A;  4YRI A;  4ZTU B;  3EFS A;  3QNE A;  3A5Z A;  1EIY A;  2CJA A;  2QHS A;  4TQD A;  4TVA A;  5C53 B;  1JJC B;  2ODR C;  2I4M A;  4P73 A;  2CGH A;  2EL9 A;  3TEH A;  4LVM A;  4L87 A;  2PME A;  1ADY A;  2DTI A;  4XTV A;  3V8K A;  2J3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...