4LVLA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt+3'thiophosphate). mn-bound crystal structure at ph 6.8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
196
structure length
196
Chain Sequence
b'SYMVARMQKMKAGNLGGAFKHNERVFETHSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid recombination enzyme
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Dna binding protein/dna
total genus 61
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lvlA01
4LVJA 4LVIA 4LVMA 2NS6A 4HT4A 4LVLA 4LVKA
chains in the Genus database with same CATH superfamily
4TVAB 3VBBA 3TEGA 2QHTA 3HY0A 1X2GA 3V7CA 2ZT7A 1X56A 3UGTA 3VQWA 4DPGA 2RHSB 1WLEA 4UPAA 3VQXA 5KNNA 3W3SA 2I4MA 11ASA 4LVMA 2DU7A 3PCOA 1PYSB 3REUA 1QF6A 4H2YA 4P75A 4H2XB 2C8MA 3VQYA 5K1PA 2PMEA 4PHCA 4YROA 3A7UA 1JJCB 2EJ9A 3HXUA 1N9WA 4BWAA 3E9IA 2DTOA 2DXUA 4K86A 4XU3A 4PG3A 4HVCA 4LVIA 2ODRC 2FYKA 4YPFA 2ZNJA 1JJCA 2Q7GA 4P74A 3HXVA 2DEQA 3IALA 3M4QA 3REXA 1NYQA 3HXYA 4YDQA 2RHQA 4UP9A 3RGLA 3RKWA 2EAYA 2ZT8A 4J15A 1WQWA 1NJ6A 12ASA 1B7YA 4KR3A 4XU1A 5F5WA 2ZTGA 2CGHA 1YB3A 3PZCA 4YRCA 2E64A 1SRYA 4P74C 4HT4A 3G1ZA 3L2ZA 1EQRA 1X2HA 3A5YA 3L1AA 1L0WA 4HWRA 3RUXA 2AKWA 3LSQA 4XU2A 4YRTA 4XU0A 5HGQA 2DDZA 4LVJA 3EFSA 3RKYA 2EWNA 2ZIOA 4YP0A 3ERRA 3P8TA 3UH0A 3HFZB 3FJPA 3NELA 1WPYA 4LNSA 1QE0A 4L87A 1EVKA 2CJ9A 1GGMA 4G84A 4P3OA 3CMQA 1ATIA 3V7SA 4TQDA 4CH3A 1YFTA 2DU5A 4K87A 4O2DA 2ZINA 2Q5HA 1USYC 3NENA 4YCWA 3RKXA 1E1TA 2C7IA 1NNHA 2ODRD 1B76A 1X54A 3QTCA 2ZXFA 2I4OA 1B70B 4TVAA 2E3CA 2Q5IA 5C52B 3IKMB 2RHSA 3HXXA 4YRQA 1EFWA 4WI1A 3QO8A 4Q6GA 1B70A 2DQ3A 2Q7HA 1PYSA 2ZT5A 3I7FA 3MF1A 1B8AA 1ASYA 4H2XA 2EL9A 4CH5A 4OLFA 4KQEA 4YCUA 4WF2A 1G5IA 3A7RA 4YRPA 1BIAA 4H2VA 2PMFA 3MQZA 4TQFA 4H2TA 3P8VA 1BBWA 2ZZGA 4YRRA 2E41A 4H2SA 2DTHA 4YRJA 3V8KA 1SETA 2ZZEA 3HRKA 3P8YA 2E5AA 3E9HA 1WU7A 2QHVA 2E1HA 3A74A 3KFUA 1H4SA 4YRKA 5ELOA 2G4CA 3WQZA 3A5ZA 3MF2A 1X01A 3TEHB 4ZIBA 4TVWA 4CS3A 4E51A 2DQ0A 3A7AA 3IG2A 3NEMA 4YRSA 4H2UA 1HC7A 2DXTA 4ZTZB 4CH4A 4H2WA 2DTIA 4HWPA 1W66A 1USYA 4CS4A 4KR2A 1G5HA 2E65A 4HWSA 2ZR3A 1NJ5A 2ARTA 3HXWA 3UFGA 3HY1A 2IY5B 4TWAA 4YREA 2J3MA 4P72A 3V8LA 3NETA 4NCXA 3HFZA 4XTZA 5ELNA 1H4VB 1HXDA 4RQFA 5K1XA 2XGTA 4RMFA 1NJ1A 2E10A 2CJAA 3A31A 3HTZA 1RIQA 2ZZFA 2ALYB 2QHUA 3L4GB 2HNIA 1EIYB 4YRIA 1KOGA 3HFVA 1H4TA 2ZCEA 4P3NA 4P72C 3V7RA 3QO5A 2ALYA 3HXZA 2I4NA 1ASZA 3QO7A 1BBUA 2QHSA 2DJZA 2P5IA 3M4PA 3ICAA 1J5WA 4P71A 3RL6A 3PCOB 3RACA 1X55A 2P0LA 4TVYA 4HWOA 1KMNA 4YYEA 2CIMA 4P3PA 1EVLA 2ZIMA 4YRNA 1FYFA 2AMCB 4XTVA 4XTWA 3RF1A 5E3IA 1YFSA 2EJFA 3UGQA 4YRGA 4RQEA 2DZ9A 4ZTUB 3IKLA 2AMCA 1C0AA 3LC0A 3MEYA 3V8JA 3RIRA 5C51B 2NS6A 2Q7EA 4DQ2A 1LYLA 4P71C 1ADYA 2DVEA 2A8EA 2DZCA 2J3LA 4UP7A 2RHQB 3LSSA 1E22A 3TUPA 2ARSA 4P73A 2ZT6A 1B7YB 1NJ8A 4P75C 4BW9A 1KMMA 1WNLA 4HA8A 1YFRA 3DSQA 1SESA 4Q15A 4HWTA 4LVKA 1YGBA 3TEHA 4XTYA 1E1OA 2ZR2A 4YRFA 2AKWB 1Z7MA 4YCVA 1H4QA 2EJGA 4K88A 1NJ2A 3BJUA 4P73C 2DKGA 3EFRA 4EO4A 1WQ7A 3VQVA 4OP0A 4H02A 4CS2A 4LVLA 2IY5A 4X5OA 4XTUA 4XEOA 5C53B 4XEMA 2ARUA 1HTTA 4CH6A 1G51A 4TTVA 1BIBA 2ZGWA 3HRIA 3R07A 4YRMA 4WJ3M 3A32A 2ZNIA 3OD1A 1ADJA 4G85A 4YRLA 4UP8A 1NYRA 1SERA 1WYDA 2I4LA 3L4GA 1EIYA 1Z7NA 4WJ4A 3QNEA 4XTXA 1EOVA 2CJBA 3BFMA 1VQZA 4EX5A 4RDXA 1E24A 1IL2A 4AH6A 2XTIA
chains in the Genus database with same CATH topology
4TVAB 3VBBA 3TEGA 2QHTA 3HY0A 1X2GA 3V7CA 2ZT7A 1X56A 3UGTA 3VQWA 4DPGA 2RHSB 1WLEA 4UPAA 3VQXA 5KNNA 3W3SA 2I4MA 11ASA 4LVMA 2DU7A 3PCOA 1PYSB 3REUA 1QF6A 4H2YA 4P75A 4H2XB 2C8MA 3VQYA 5K1PA 2PMEA 4PHCA 4YROA 3A7UA 1JJCB 2EJ9A 3HXUA 1N9WA 4BWAA 3E9IA 2DTOA 2DXUA 4K86A 4XU3A 4PG3A 4HVCA 4LVIA 2ODRC 2FYKA 4YPFA 2ZNJA 1JJCA 2Q7GA 4P74A 3HXVA 2DEQA 3IALA 3M4QA 3REXA 1NYQA 3HXYA 4YDQA 2RHQA 4UP9A 3RGLA 3RKWA 2EAYA 2ZT8A 4J15A 1WQWA 1NJ6A 12ASA 1B7YA 4KR3A 4XU1A 5F5WA 2ZTGA 2CGHA 1YB3A 3PZCA 4YRCA 2E64A 1SRYA 4P74C 4HT4A 3G1ZA 3L2ZA 1EQRA 1X2HA 3A5YA 3L1AA 1L0WA 4HWRA 3RUXA 2AKWA 3LSQA 4XU2A 4YRTA 4XU0A 5HGQA 2DDZA 4LVJA 3EFSA 3RKYA 2EWNA 2ZIOA 4YP0A 3ERRA 3P8TA 3UH0A 3HFZB 3FJPA 3NELA 1WPYA 4LNSA 1QE0A 4L87A 1EVKA 2CJ9A 1GGMA 4G84A 4P3OA 3CMQA 1ATIA 3V7SA 4TQDA 4CH3A 1YFTA 2DU5A 4K87A 4O2DA 2ZINA 2Q5HA 1USYC 3NENA 4YCWA 3RKXA 1E1TA 2C7IA 1NNHA 2ODRD 1B76A 1X54A 3QTCA 2ZXFA 2I4OA 1B70B 4TVAA 2E3CA 2Q5IA 5C52B 3IKMB 2RHSA 3HXXA 4YRQA 1EFWA 4WI1A 3QO8A 4Q6GA 1B70A 2DQ3A 2Q7HA 1PYSA 2ZT5A 3I7FA 3MF1A 1B8AA 1ASYA 4H2XA 2EL9A 4CH5A 4OLFA 4KQEA 4YCUA 4WF2A 1G5IA 3A7RA 4YRPA 1BIAA 4H2VA 2PMFA 3MQZA 4TQFA 4H2TA 3P8VA 1BBWA 2ZZGA 4YRRA 2E41A 4H2SA 2DTHA 4YRJA 3V8KA 1SETA 2ZZEA 3HRKA 3P8YA 2E5AA 3E9HA 1WU7A 2QHVA 2E1HA 3A74A 3KFUA 1H4SA 4YRKA 5ELOA 2G4CA 3WQZA 3A5ZA 3MF2A 1X01A 3TEHB 4ZIBA 4TVWA 4CS3A 4E51A 2DQ0A 3A7AA 3IG2A 3NEMA 4YRSA 4H2UA 1HC7A 2DXTA 4ZTZB 4CH4A 4H2WA 2DTIA 4HWPA 1W66A 1USYA 4CS4A 4KR2A 1G5HA 2E65A 4HWSA 2ZR3A 1NJ5A 2ARTA 3HXWA 3UFGA 3HY1A 2IY5B 4TWAA 4YREA 2J3MA 4P72A 3V8LA 3NETA 4NCXA 3HFZA 4XTZA 5ELNA 1H4VB 1HXDA 4RQFA 5K1XA 2XGTA 4RMFA 1NJ1A 2E10A 2CJAA 3A31A 3HTZA 1RIQA 2ZZFA 2ALYB 2QHUA 3L4GB 2HNIA 1EIYB 4YRIA 1KOGA 3HFVA 1H4TA 2ZCEA 4P3NA 4P72C 3V7RA 3QO5A 2ALYA 3HXZA 2I4NA 1ASZA 3QO7A 1BBUA 2QHSA 2DJZA 2P5IA 3M4PA 3ICAA 1J5WA 4P71A 3RL6A 3PCOB 3RACA 1X55A 2P0LA 4TVYA 4HWOA 1KMNA 4YYEA 2CIMA 4P3PA 1EVLA 2ZIMA 4YRNA 1FYFA 2AMCB 4XTVA 4XTWA 3RF1A 5E3IA 1YFSA 2EJFA 3UGQA 4YRGA 4RQEA 2DZ9A 4ZTUB 3IKLA 2AMCA 1C0AA 3LC0A 3MEYA 3V8JA 3RIRA 5C51B 2NS6A 2Q7EA 4DQ2A 1LYLA 4P71C 1ADYA 2DVEA 2A8EA 2DZCA 2J3LA 4UP7A 2RHQB 3LSSA 1E22A 3TUPA 2ARSA 4P73A 2ZT6A 1B7YB 1NJ8A 4P75C 4BW9A 1KMMA 1WNLA 4HA8A 1YFRA 3DSQA 1SESA 4Q15A 4HWTA 4LVKA 1YGBA 3TEHA 4XTYA 1E1OA 2ZR2A 4YRFA 2AKWB 1Z7MA 4YCVA 1H4QA 2EJGA 4K88A 1NJ2A 3BJUA 4P73C 2DKGA 3EFRA 4EO4A 1WQ7A 3VQVA 4OP0A 4H02A 4CS2A 4LVLA 2IY5A 4X5OA 4XTUA 4XEOA 5C53B 4XEMA 2ARUA 1HTTA 4CH6A 1G51A 4TTVA 1BIBA 2ZGWA 3HRIA 3R07A 4YRMA 4WJ3M 3A32A 2ZNIA 3OD1A 1ADJA 4G85A 4YRLA 4UP8A 1NYRA 1SERA 1WYDA 2I4LA 3L4GA 1EIYA 1Z7NA 4WJ4A 3QNEA 4XTXA 1EOVA 2CJBA 3BFMA 1VQZA 4EX5A 4RDXA 1E24A 1IL2A 4AH6A 2XTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVJ A;  4LVI A;  4LVM A;  2NS6 A;  4HT4 A;  4LVL A;  4LVK A; 
#chains in the Genus database with same CATH topology
 4TVA B;  3VBB A;  3TEG A;  2QHT A;  3HY0 A;  1X2G A;  3V7C A;  2ZT7 A;  1X56 A;  3UGT A;  3VQW A;  4DPG A;  2RHS B;  1WLE A;  4UPA A;  3VQX A;  5KNN A;  3W3S A;  2I4M A;  11AS A;  4LVM A;  2DU7 A;  3PCO A;  1PYS B;  3REU A;  1QF6 A;  4H2Y A;  4P75 A;  4H2X B;  2C8M A;  3VQY A;  5K1P A;  2PME A;  4PHC A;  4YRO A;  3A7U A;  1JJC B;  2EJ9 A;  3HXU A;  1N9W A;  4BWA A;  3E9I A;  2DTO A;  2DXU A;  4K86 A;  4XU3 A;  4PG3 A;  4HVC A;  4LVI A;  2ODR C;  2FYK A;  4YPF A;  2ZNJ A;  1JJC A;  2Q7G A;  4P74 A;  3HXV A;  2DEQ A;  3IAL A;  3M4Q A;  3REX A;  1NYQ A;  3HXY A;  4YDQ A;  2RHQ A;  4UP9 A;  3RGL A;  3RKW A;  2EAY A;  2ZT8 A;  4J15 A;  1WQW A;  1NJ6 A;  12AS A;  1B7Y A;  4KR3 A;  4XU1 A;  5F5W A;  2ZTG A;  2CGH A;  1YB3 A;  3PZC A;  4YRC A;  2E64 A;  1SRY A;  4P74 C;  4HT4 A;  3G1Z A;  3L2Z A;  1EQR A;  1X2H A;  3A5Y A;  3L1A A;  1L0W A;  4HWR A;  3RUX A;  2AKW A;  3LSQ A;  4XU2 A;  4YRT A;  4XU0 A;  5HGQ A;  2DDZ A;  4LVJ A;  3EFS A;  3RKY A;  2EWN A;  2ZIO A;  4YP0 A;  3ERR A;  3P8T A;  3UH0 A;  3HFZ B;  3FJP A;  3NEL A;  1WPY A;  4LNS A;  1QE0 A;  4L87 A;  1EVK A;  2CJ9 A;  1GGM A;  4G84 A;  4P3O A;  3CMQ A;  1ATI A;  3V7S A;  4TQD A;  4CH3 A;  1YFT A;  2DU5 A;  4K87 A;  4O2D A;  2ZIN A;  2Q5H A;  1USY C;  3NEN A;  4YCW A;  3RKX A;  1E1T A;  2C7I A;  1NNH A;  2ODR D;  1B76 A;  1X54 A;  3QTC A;  2ZXF A;  2I4O A;  1B70 B;  4TVA A;  2E3C A;  2Q5I A;  5C52 B;  3IKM B;  2RHS A;  3HXX A;  4YRQ A;  1EFW A;  4WI1 A;  3QO8 A;  4Q6G A;  1B70 A;  2DQ3 A;  2Q7H A;  1PYS A;  2ZT5 A;  3I7F A;  3MF1 A;  1B8A A;  1ASY A;  4H2X A;  2EL9 A;  4CH5 A;  4OLF A;  4KQE A;  4YCU A;  4WF2 A;  1G5I A;  3A7R A;  4YRP A;  1BIA A;  4H2V A;  2PMF A;  3MQZ A;  4TQF A;  4H2T A;  3P8V A;  1BBW A;  2ZZG A;  4YRR A;  2E41 A;  4H2S A;  2DTH A;  4YRJ A;  3V8K A;  1SET A;  2ZZE A;  3HRK A;  3P8Y A;  2E5A A;  3E9H A;  1WU7 A;  2QHV A;  2E1H A;  3A74 A;  3KFU A;  1H4S A;  4YRK A;  5ELO A;  2G4C A;  3WQZ A;  3A5Z A;  3MF2 A;  1X01 A;  3TEH B;  4ZIB A;  4TVW A;  4CS3 A;  4E51 A;  2DQ0 A;  3A7A A;  3IG2 A;  3NEM A;  4YRS A;  4H2U A;  1HC7 A;  2DXT A;  4ZTZ B;  4CH4 A;  4H2W A;  2DTI A;  4HWP A;  1W66 A;  1USY A;  4CS4 A;  4KR2 A;  1G5H A;  2E65 A;  4HWS A;  2ZR3 A;  1NJ5 A;  2ART A;  3HXW A;  3UFG A;  3HY1 A;  2IY5 B;  4TWA A;  4YRE A;  2J3M A;  4P72 A;  3V8L A;  3NET A;  4NCX A;  3HFZ A;  4XTZ A;  5ELN A;  1H4V B;  1HXD A;  4RQF A;  5K1X A;  2XGT A;  4RMF A;  1NJ1 A;  2E10 A;  2CJA A;  3A31 A;  3HTZ A;  1RIQ A;  2ZZF A;  2ALY B;  2QHU A;  3L4G B;  2HNI A;  1EIY B;  4YRI A;  1KOG A;  3HFV A;  1H4T A;  2ZCE A;  4P3N A;  4P72 C;  3V7R A;  3QO5 A;  2ALY A;  3HXZ A;  2I4N A;  1ASZ A;  3QO7 A;  1BBU A;  2QHS A;  2DJZ A;  2P5I A;  3M4P A;  3ICA A;  1J5W A;  4P71 A;  3RL6 A;  3PCO B;  3RAC A;  1X55 A;  2P0L A;  4TVY A;  4HWO A;  1KMN A;  4YYE A;  2CIM A;  4P3P A;  1EVL A;  2ZIM A;  4YRN A;  1FYF A;  2AMC B;  4XTV A;  4XTW A;  3RF1 A;  5E3I A;  1YFS A;  2EJF A;  3UGQ A;  4YRG A;  4RQE A;  2DZ9 A;  4ZTU B;  3IKL A;  2AMC A;  1C0A A;  3LC0 A;  3MEY A;  3V8J A;  3RIR A;  5C51 B;  2NS6 A;  2Q7E A;  4DQ2 A;  1LYL A;  4P71 C;  1ADY A;  2DVE A;  2A8E A;  2DZC A;  2J3L A;  4UP7 A;  2RHQ B;  3LSS A;  1E22 A;  3TUP A;  2ARS A;  4P73 A;  2ZT6 A;  1B7Y B;  1NJ8 A;  4P75 C;  4BW9 A;  1KMM A;  1WNL A;  4HA8 A;  1YFR A;  3DSQ A;  1SES A;  4Q15 A;  4HWT A;  4LVK A;  1YGB A;  3TEH A;  4XTY A;  1E1O A;  2ZR2 A;  4YRF A;  2AKW B;  1Z7M A;  4YCV A;  1H4Q A;  2EJG A;  4K88 A;  1NJ2 A;  3BJU A;  4P73 C;  2DKG A;  3EFR A;  4EO4 A;  1WQ7 A;  3VQV A;  4OP0 A;  4H02 A;  4CS2 A;  4LVL A;  2IY5 A;  4X5O A;  4XTU A;  4XEO A;  5C53 B;  4XEM A;  2ARU A;  1HTT A;  4CH6 A;  1G51 A;  4TTV A;  1BIB A;  2ZGW A;  3HRI A;  3R07 A;  4YRM A;  4WJ3 M;  3A32 A;  2ZNI A;  3OD1 A;  1ADJ A;  4G85 A;  4YRL A;  4UP8 A;  1NYR A;  1SER A;  1WYD A;  2I4L A;  3L4G A;  1EIY A;  1Z7N A;  4WJ4 A;  3QNE A;  4XTX A;  1EOV A;  2CJB A;  3BFM A;  1VQZ A;  4EX5 A;  4RDX A;  1E24 A;  1IL2 A;  4AH6 A;  2XTI A; 
#chains in the Genus database with same CATH homology
 4TVA B;  3VBB A;  3TEG A;  2QHT A;  3HY0 A;  1X2G A;  3V7C A;  2ZT7 A;  1X56 A;  3UGT A;  3VQW A;  4DPG A;  2RHS B;  1WLE A;  4UPA A;  3VQX A;  5KNN A;  3W3S A;  2I4M A;  11AS A;  4LVM A;  2DU7 A;  3PCO A;  1PYS B;  3REU A;  1QF6 A;  4H2Y A;  4P75 A;  4H2X B;  2C8M A;  3VQY A;  5K1P A;  2PME A;  4PHC A;  4YRO A;  3A7U A;  1JJC B;  2EJ9 A;  3HXU A;  1N9W A;  4BWA A;  3E9I A;  2DTO A;  2DXU A;  4K86 A;  4XU3 A;  4PG3 A;  4HVC A;  4LVI A;  2ODR C;  2FYK A;  4YPF A;  2ZNJ A;  1JJC A;  2Q7G A;  4P74 A;  3HXV A;  2DEQ A;  3IAL A;  3M4Q A;  3REX A;  1NYQ A;  3HXY A;  4YDQ A;  2RHQ A;  4UP9 A;  3RGL A;  3RKW A;  2EAY A;  2ZT8 A;  4J15 A;  1WQW A;  1NJ6 A;  12AS A;  1B7Y A;  4KR3 A;  4XU1 A;  5F5W A;  2ZTG A;  2CGH A;  1YB3 A;  3PZC A;  4YRC A;  2E64 A;  1SRY A;  4P74 C;  4HT4 A;  3G1Z A;  3L2Z A;  1EQR A;  1X2H A;  3A5Y A;  3L1A A;  1L0W A;  4HWR A;  3RUX A;  2AKW A;  3LSQ A;  4XU2 A;  4YRT A;  4XU0 A;  5HGQ A;  2DDZ A;  4LVJ A;  3EFS A;  3RKY A;  2EWN A;  2ZIO A;  4YP0 A;  3ERR A;  3P8T A;  3UH0 A;  3HFZ B;  3FJP A;  3NEL A;  1WPY A;  4LNS A;  1QE0 A;  4L87 A;  1EVK A;  2CJ9 A;  1GGM A;  4G84 A;  4P3O A;  3CMQ A;  1ATI A;  3V7S A;  4TQD A;  4CH3 A;  1YFT A;  2DU5 A;  4K87 A;  4O2D A;  2ZIN A;  2Q5H A;  1USY C;  3NEN A;  4YCW A;  3RKX A;  1E1T A;  2C7I A;  1NNH A;  2ODR D;  1B76 A;  1X54 A;  3QTC A;  2ZXF A;  2I4O A;  1B70 B;  4TVA A;  2E3C A;  2Q5I A;  5C52 B;  3IKM B;  2RHS A;  3HXX A;  4YRQ A;  1EFW A;  4WI1 A;  3QO8 A;  4Q6G A;  1B70 A;  2DQ3 A;  2Q7H A;  1PYS A;  2ZT5 A;  3I7F A;  3MF1 A;  1B8A A;  1ASY A;  4H2X A;  2EL9 A;  4CH5 A;  4OLF A;  4KQE A;  4YCU A;  4WF2 A;  1G5I A;  3A7R A;  4YRP A;  1BIA A;  4H2V A;  2PMF A;  3MQZ A;  4TQF A;  4H2T A;  3P8V A;  1BBW A;  2ZZG A;  4YRR A;  2E41 A;  4H2S A;  2DTH A;  4YRJ A;  3V8K A;  1SET A;  2ZZE A;  3HRK A;  3P8Y A;  2E5A A;  3E9H A;  1WU7 A;  2QHV A;  2E1H A;  3A74 A;  3KFU A;  1H4S A;  4YRK A;  5ELO A;  2G4C A;  3WQZ A;  3A5Z A;  3MF2 A;  1X01 A;  3TEH B;  4ZIB A;  4TVW A;  4CS3 A;  4E51 A;  2DQ0 A;  3A7A A;  3IG2 A;  3NEM A;  4YRS A;  4H2U A;  1HC7 A;  2DXT A;  4ZTZ B;  4CH4 A;  4H2W A;  2DTI A;  4HWP A;  1W66 A;  1USY A;  4CS4 A;  4KR2 A;  1G5H A;  2E65 A;  4HWS A;  2ZR3 A;  1NJ5 A;  2ART A;  3HXW A;  3UFG A;  3HY1 A;  2IY5 B;  4TWA A;  4YRE A;  2J3M A;  4P72 A;  3V8L A;  3NET A;  4NCX A;  3HFZ A;  4XTZ A;  5ELN A;  1H4V B;  1HXD A;  4RQF A;  5K1X A;  2XGT A;  4RMF A;  1NJ1 A;  2E10 A;  2CJA A;  3A31 A;  3HTZ A;  1RIQ A;  2ZZF A;  2ALY B;  2QHU A;  3L4G B;  2HNI A;  1EIY B;  4YRI A;  1KOG A;  3HFV A;  1H4T A;  2ZCE A;  4P3N A;  4P72 C;  3V7R A;  3QO5 A;  2ALY A;  3HXZ A;  2I4N A;  1ASZ A;  3QO7 A;  1BBU A;  2QHS A;  2DJZ A;  2P5I A;  3M4P A;  3ICA A;  1J5W A;  4P71 A;  3RL6 A;  3PCO B;  3RAC A;  1X55 A;  2P0L A;  4TVY A;  4HWO A;  1KMN A;  4YYE A;  2CIM A;  4P3P A;  1EVL A;  2ZIM A;  4YRN A;  1FYF A;  2AMC B;  4XTV A;  4XTW A;  3RF1 A;  5E3I A;  1YFS A;  2EJF A;  3UGQ A;  4YRG A;  4RQE A;  2DZ9 A;  4ZTU B;  3IKL A;  2AMC A;  1C0A A;  3LC0 A;  3MEY A;  3V8J A;  3RIR A;  5C51 B;  2NS6 A;  2Q7E A;  4DQ2 A;  1LYL A;  4P71 C;  1ADY A;  2DVE A;  2A8E A;  2DZC A;  2J3L A;  4UP7 A;  2RHQ B;  3LSS A;  1E22 A;  3TUP A;  2ARS A;  4P73 A;  2ZT6 A;  1B7Y B;  1NJ8 A;  4P75 C;  4BW9 A;  1KMM A;  1WNL A;  4HA8 A;  1YFR A;  3DSQ A;  1SES A;  4Q15 A;  4HWT A;  4LVK A;  1YGB A;  3TEH A;  4XTY A;  1E1O A;  2ZR2 A;  4YRF A;  2AKW B;  1Z7M A;  4YCV A;  1H4Q A;  2EJG A;  4K88 A;  1NJ2 A;  3BJU A;  4P73 C;  2DKG A;  3EFR A;  4EO4 A;  1WQ7 A;  3VQV A;  4OP0 A;  4H02 A;  4CS2 A;  4LVL A;  2IY5 A;  4X5O A;  4XTU A;  4XEO A;  5C53 B;  4XEM A;  2ARU A;  1HTT A;  4CH6 A;  1G51 A;  4TTV A;  1BIB A;  2ZGW A;  3HRI A;  3R07 A;  4YRM A;  4WJ3 M;  3A32 A;  2ZNI A;  3OD1 A;  1ADJ A;  4G85 A;  4YRL A;  4UP8 A;  1NYR A;  1SER A;  1WYD A;  2I4L A;  3L4G A;  1EIY A;  1Z7N A;  4WJ4 A;  3QNE A;  4XTX A;  1EOV A;  2CJB A;  3BFM A;  1VQZ A;  4EX5 A;  4RDX A;  1E24 A;  1IL2 A;  4AH6 A;  2XTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...