4LVLA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt+3'thiophosphate). mn-bound crystal structure at ph 6.8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
196
structure length
196
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVFETHSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid recombination enzyme
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Dna binding protein/dna
total genus 61
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lvlA01
4LVMA 4LVJA 4LVLA 4HT4A 2NS6A 4LVKA 4LVIA
chains in the Genus database with same CATH superfamily
2I4NA 4YRCA 1B8AA 3RUXA 2E41A 2Q7HA 4UPAA 3UH0A 2ARTA 4E51A 3FJPA 1EQRA 2DJZA 4CS3A 3QTCA 2DDZA 3HXZA 1FYFA 11ASA 3M4PA 2Q5IA 4XEOA 1BBWA 4UP8A 2DQ3A 4TTVA 2DTIA 3A5ZA 2ZR3A 2DKGA 4O2DA 1QF6A 3L2ZA 1YB3A 1EOVA 2RHSA 1E22A 2FYKA 4XU3A 2A8EA 1X56A 3QO7A 4YCUA 3REUA 1B7YA 4CS2A 2E65A 2I4MA 1LYLA 1WQWA 2ARSA 1WQ7A 3HTZA 4H2UA 4YRTA 1NYQA 1SESA 3KFUA 1YFTA 3NELA 3L4GB 3TEGA 3HRKA 2DQ0A 3BFMA 3IG2A 4P3NA 1EIYA 4OP0A 3TEHB 4CS4A 4EX5A 3DSQA 5ELOA 4CH3A 4HWPA 3RKWA 2ALYB 2ZIOA 2ZT7A 4OLFA 1ASYA 2DU7A 2DTHA 1N9WA 2ODRC 1H4TA 3A32A 3P8VA 4HWOA 3VBBA 5E3IA 4P72C 2G4CA 4H2SA 4XU1A 3E9HA 3EFSA 1SERA 4EO4A 4YP0A 5K1XA 4YDQA 4ZIBA 1NJ5A 3RACA 4TWAA 3A7AA 3HFZA 2HNIA 2E1HA 3P8YA 3UGQA 1E1OA 4WF2A 4XTXA 2IY5B 3UFGA 4ZTZB 2C7IA 1JJCA 4CH5A 4K87A 1YGBA 3V7RA 4KR3A 3HXYA 5K1PA 1X2HA 1ADYA 2AMCA 5HGQA 3RKXA 3LSQA 4KR2A 3RL6A 4YCVA 4P72A 2ODRD 1ATIA 2ZR2A 2EAYA 4HA8A 4P75C 1HXDA 2QHSA 4YRGA 1EVLA 1G5HA 2DXTA 4H2XA 1H4SA 3W3SA 4RQEA 4XU2A 2PMEA 2DVEA 1BIBA 1VQZA 2EJFA 4P74C 3NEMA 2EL9A 2ZIMA 1WNLA 2ZNJA 1USYA 2EWNA 3RGLA 4BW9A 3A7UA 3R07A 4WJ4A 1Z7NA 4ZTUB 3RF1A 4Q15A 4CH4A 3ICAA 4PG3A 1GGMA 1B76A 3NENA 2EJGA 1X54A 3V8JA 1EVKA 2CIMA 1C0AA 5ELNA 5C53B 3A31A 2CGHA 1KMNA 5F5WA 1QE0A 3CMQA 3HRIA 3PCOA 1B70B 2ZTGA 5KNNA 1L0WA 2RHQB 2J3LA 1X55A 4LVJA 4RMFA 1IL2A 1YFSA 1J5WA 2ZXFA 4YRJA 3NETA 2AKWA 1G51A 3MF1A 5C51B 1WYDA 2E3CA 3REXA 4LVMA 4TVAB 2QHTA 4LVLA 1E1TA 2PMFA 3LC0A 3MEYA 3V7CA 1PYSB 3HFVA 4YRFA 2DXUA 2ZINA 4YRLA 4UP9A 4LVIA 1WU7A 3IKLA 3OD1A 2ZT8A 4XU0A 3L1AA 2E5AA 4P3PA 4P3OA 3MQZA 2DEQA 4RDXA 1RIQA 2ZZGA 4TQFA 4AH6A 2RHSB 5C52B 4YRMA 4YRQA 4TVYA 3QNEA 1NJ1A 3L4GA 3ERRA 2EJ9A 1B7YB 2ZGWA 1NJ6A 4H2WA 3MF2A 3TEHA 3PCOB 4YREA 2ALYA 2Q5HA 1KMMA 4P71C 2E64A 4DQ2A 2CJAA 1EFWA 1BIAA 1WLEA 1EIYB 2Q7GA 3RKYA 12ASA 3VQXA 2NS6A 2QHUA 4HWTA 2CJBA 4KQEA 4WJ3M 4NCXA 2J3MA 2ZZEA 4H02A 4G85A 3RIRA 1G5IA 3E9IA 3EFRA 4K86A 2C8MA 2XTIA 3A74A 3HY0A 3A7RA 1W66A 1E24A 3UGTA 4HWSA 4P75A 3VQVA 2IY5A 4YPFA 1BBUA 1ASZA 4XTUA 3V7SA 4TVWA 3HFZB 4P71A 3V8LA 1HTTA 4H2TA 4P74A 1JJCB 3LSSA 4YYEA 4G84A 1NNHA 4YCWA 3IALA 3VQYA 2P5IA 4K88A 3WQZA 3A5YA 1H4VB 1Z7MA 3M4QA 2AMCB 2Q7EA 2ZZFA 4XTVA 2DU5A 2DZCA 2CJ9A 4XTZA 4H2VA 3TUPA 4LNSA 3HXVA 2I4LA 4TQDA 4XTYA 2ZNIA 2QHVA 3QO5A 4H2XB 2I4OA 1SRYA 3HXXA 4WI1A 4HWRA 4P73C 1NYRA 1ADJA 2E10A 4BWAA 3HXUA 1YFRA 4UP7A 3HXWA 4J15A 4YROA 1X01A 4XEMA 3BJUA 4LVKA 3IKMB 1NJ8A 1SETA 1B70A 4YRKA 4XTWA 4YRSA 3PZCA 4PHCA 2ZT5A 4Q6GA 4YRRA 2RHQA 3QO8A 1H4QA 3G1ZA 4X5OA 2ZT6A 4L87A 4RQFA 1USYC 4YRIA 4H2YA 3P8TA 4DPGA 1NJ2A 2DZ9A 4YRPA 2ARUA 2DTOA 3HY1A 1X2GA 1WPYA 3V8KA 4P73A 1KOGA 2XGTA 2ZCEA 4YRNA 4HT4A 4HVCA 4TVAA 3VQWA 3I7FA 4CH6A 2AKWB 1HC7A 2P0LA 1PYSA
chains in the Genus database with same CATH topology
2I4NA 4YRCA 1B8AA 3RUXA 2E41A 2Q7HA 4UPAA 3UH0A 2ARTA 4E51A 3FJPA 1EQRA 2DJZA 4CS3A 3QTCA 2DDZA 3HXZA 1FYFA 11ASA 3M4PA 2Q5IA 4XEOA 1BBWA 4UP8A 2DQ3A 4TTVA 2DTIA 3A5ZA 2ZR3A 2DKGA 4O2DA 1QF6A 3L2ZA 1YB3A 1EOVA 2RHSA 1E22A 2FYKA 4XU3A 2A8EA 1X56A 3QO7A 4YCUA 3REUA 1B7YA 4CS2A 2E65A 2I4MA 1LYLA 1WQWA 2ARSA 1WQ7A 3HTZA 4H2UA 4YRTA 1NYQA 1SESA 3KFUA 1YFTA 3NELA 3L4GB 3TEGA 3HRKA 2DQ0A 3BFMA 3IG2A 4P3NA 1EIYA 4OP0A 3TEHB 4CS4A 4EX5A 3DSQA 5ELOA 4CH3A 4HWPA 3RKWA 2ALYB 2ZIOA 2ZT7A 4OLFA 1ASYA 2DU7A 2DTHA 1N9WA 2ODRC 1H4TA 3A32A 3P8VA 4HWOA 3VBBA 5E3IA 4P72C 2G4CA 4H2SA 4XU1A 3E9HA 3EFSA 1SERA 4EO4A 4YP0A 5K1XA 4YDQA 4ZIBA 1NJ5A 3RACA 4TWAA 3A7AA 3HFZA 2HNIA 2E1HA 3P8YA 3UGQA 1E1OA 4WF2A 4XTXA 2IY5B 3UFGA 4ZTZB 2C7IA 1JJCA 4CH5A 4K87A 1YGBA 3V7RA 4KR3A 3HXYA 5K1PA 1X2HA 1ADYA 2AMCA 5HGQA 3RKXA 3LSQA 4KR2A 3RL6A 4YCVA 4P72A 2ODRD 1ATIA 2ZR2A 2EAYA 4HA8A 4P75C 1HXDA 2QHSA 4YRGA 1EVLA 1G5HA 2DXTA 4H2XA 1H4SA 3W3SA 4RQEA 4XU2A 2PMEA 2DVEA 1BIBA 1VQZA 2EJFA 4P74C 3NEMA 2EL9A 2ZIMA 1WNLA 2ZNJA 1USYA 2EWNA 3RGLA 4BW9A 3A7UA 3R07A 4WJ4A 1Z7NA 4ZTUB 3RF1A 4Q15A 4CH4A 3ICAA 4PG3A 1GGMA 1B76A 3NENA 2EJGA 1X54A 3V8JA 1EVKA 2CIMA 1C0AA 5ELNA 5C53B 3A31A 2CGHA 1KMNA 5F5WA 1QE0A 3CMQA 3HRIA 3PCOA 1B70B 2ZTGA 5KNNA 1L0WA 2RHQB 2J3LA 1X55A 4LVJA 4RMFA 1IL2A 1YFSA 1J5WA 2ZXFA 4YRJA 3NETA 2AKWA 1G51A 3MF1A 5C51B 1WYDA 2E3CA 3REXA 4LVMA 4TVAB 2QHTA 4LVLA 1E1TA 2PMFA 3LC0A 3MEYA 3V7CA 1PYSB 3HFVA 4YRFA 2DXUA 2ZINA 4YRLA 4UP9A 4LVIA 1WU7A 3IKLA 3OD1A 2ZT8A 4XU0A 3L1AA 2E5AA 4P3PA 4P3OA 3MQZA 2DEQA 4RDXA 1RIQA 2ZZGA 4TQFA 4AH6A 2RHSB 5C52B 4YRMA 4YRQA 4TVYA 3QNEA 1NJ1A 3L4GA 3ERRA 2EJ9A 1B7YB 2ZGWA 1NJ6A 4H2WA 3MF2A 3TEHA 3PCOB 4YREA 2ALYA 2Q5HA 1KMMA 4P71C 2E64A 4DQ2A 2CJAA 1EFWA 1BIAA 1WLEA 1EIYB 2Q7GA 3RKYA 12ASA 3VQXA 2NS6A 2QHUA 4HWTA 2CJBA 4KQEA 4WJ3M 4NCXA 2J3MA 2ZZEA 4H02A 4G85A 3RIRA 1G5IA 3E9IA 3EFRA 4K86A 2C8MA 2XTIA 3A74A 3HY0A 3A7RA 1W66A 1E24A 3UGTA 4HWSA 4P75A 3VQVA 2IY5A 4YPFA 1BBUA 1ASZA 4XTUA 3V7SA 4TVWA 3HFZB 4P71A 3V8LA 1HTTA 4H2TA 4P74A 1JJCB 3LSSA 4YYEA 4G84A 1NNHA 4YCWA 3IALA 3VQYA 2P5IA 4K88A 3WQZA 3A5YA 1H4VB 1Z7MA 3M4QA 2AMCB 2Q7EA 2ZZFA 4XTVA 2DU5A 2DZCA 2CJ9A 4XTZA 4H2VA 3TUPA 4LNSA 3HXVA 2I4LA 4TQDA 4XTYA 2ZNIA 2QHVA 3QO5A 4H2XB 2I4OA 1SRYA 3HXXA 4WI1A 4HWRA 4P73C 1NYRA 1ADJA 2E10A 4BWAA 3HXUA 1YFRA 4UP7A 3HXWA 4J15A 4YROA 1X01A 4XEMA 3BJUA 4LVKA 3IKMB 1NJ8A 1SETA 1B70A 4YRKA 4XTWA 4YRSA 3PZCA 4PHCA 2ZT5A 4Q6GA 4YRRA 2RHQA 3QO8A 1H4QA 3G1ZA 4X5OA 2ZT6A 4L87A 4RQFA 1USYC 4YRIA 4H2YA 3P8TA 4DPGA 1NJ2A 2DZ9A 4YRPA 2ARUA 2DTOA 3HY1A 1X2GA 1WPYA 3V8KA 4P73A 1KOGA 2XGTA 2ZCEA 4YRNA 4HT4A 4HVCA 4TVAA 3VQWA 3I7FA 4CH6A 2AKWB 1HC7A 2P0LA 1PYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVM A;  4LVJ A;  4LVL A;  4HT4 A;  2NS6 A;  4LVK A;  4LVI A; 
#chains in the Genus database with same CATH topology
 2I4N A;  4YRC A;  1B8A A;  3RUX A;  2E41 A;  2Q7H A;  4UPA A;  3UH0 A;  2ART A;  4E51 A;  3FJP A;  1EQR A;  2DJZ A;  4CS3 A;  3QTC A;  2DDZ A;  3HXZ A;  1FYF A;  11AS A;  3M4P A;  2Q5I A;  4XEO A;  1BBW A;  4UP8 A;  2DQ3 A;  4TTV A;  2DTI A;  3A5Z A;  2ZR3 A;  2DKG A;  4O2D A;  1QF6 A;  3L2Z A;  1YB3 A;  1EOV A;  2RHS A;  1E22 A;  2FYK A;  4XU3 A;  2A8E A;  1X56 A;  3QO7 A;  4YCU A;  3REU A;  1B7Y A;  4CS2 A;  2E65 A;  2I4M A;  1LYL A;  1WQW A;  2ARS A;  1WQ7 A;  3HTZ A;  4H2U A;  4YRT A;  1NYQ A;  1SES A;  3KFU A;  1YFT A;  3NEL A;  3L4G B;  3TEG A;  3HRK A;  2DQ0 A;  3BFM A;  3IG2 A;  4P3N A;  1EIY A;  4OP0 A;  3TEH B;  4CS4 A;  4EX5 A;  3DSQ A;  5ELO A;  4CH3 A;  4HWP A;  3RKW A;  2ALY B;  2ZIO A;  2ZT7 A;  4OLF A;  1ASY A;  2DU7 A;  2DTH A;  1N9W A;  2ODR C;  1H4T A;  3A32 A;  3P8V A;  4HWO A;  3VBB A;  5E3I A;  4P72 C;  2G4C A;  4H2S A;  4XU1 A;  3E9H A;  3EFS A;  1SER A;  4EO4 A;  4YP0 A;  5K1X A;  4YDQ A;  4ZIB A;  1NJ5 A;  3RAC A;  4TWA A;  3A7A A;  3HFZ A;  2HNI A;  2E1H A;  3P8Y A;  3UGQ A;  1E1O A;  4WF2 A;  4XTX A;  2IY5 B;  3UFG A;  4ZTZ B;  2C7I A;  1JJC A;  4CH5 A;  4K87 A;  1YGB A;  3V7R A;  4KR3 A;  3HXY A;  5K1P A;  1X2H A;  1ADY A;  2AMC A;  5HGQ A;  3RKX A;  3LSQ A;  4KR2 A;  3RL6 A;  4YCV A;  4P72 A;  2ODR D;  1ATI A;  2ZR2 A;  2EAY A;  4HA8 A;  4P75 C;  1HXD A;  2QHS A;  4YRG A;  1EVL A;  1G5H A;  2DXT A;  4H2X A;  1H4S A;  3W3S A;  4RQE A;  4XU2 A;  2PME A;  2DVE A;  1BIB A;  1VQZ A;  2EJF A;  4P74 C;  3NEM A;  2EL9 A;  2ZIM A;  1WNL A;  2ZNJ A;  1USY A;  2EWN A;  3RGL A;  4BW9 A;  3A7U A;  3R07 A;  4WJ4 A;  1Z7N A;  4ZTU B;  3RF1 A;  4Q15 A;  4CH4 A;  3ICA A;  4PG3 A;  1GGM A;  1B76 A;  3NEN A;  2EJG A;  1X54 A;  3V8J A;  1EVK A;  2CIM A;  1C0A A;  5ELN A;  5C53 B;  3A31 A;  2CGH A;  1KMN A;  5F5W A;  1QE0 A;  3CMQ A;  3HRI A;  3PCO A;  1B70 B;  2ZTG A;  5KNN A;  1L0W A;  2RHQ B;  2J3L A;  1X55 A;  4LVJ A;  4RMF A;  1IL2 A;  1YFS A;  1J5W A;  2ZXF A;  4YRJ A;  3NET A;  2AKW A;  1G51 A;  3MF1 A;  5C51 B;  1WYD A;  2E3C A;  3REX A;  4LVM A;  4TVA B;  2QHT A;  4LVL A;  1E1T A;  2PMF A;  3LC0 A;  3MEY A;  3V7C A;  1PYS B;  3HFV A;  4YRF A;  2DXU A;  2ZIN A;  4YRL A;  4UP9 A;  4LVI A;  1WU7 A;  3IKL A;  3OD1 A;  2ZT8 A;  4XU0 A;  3L1A A;  2E5A A;  4P3P A;  4P3O A;  3MQZ A;  2DEQ A;  4RDX A;  1RIQ A;  2ZZG A;  4TQF A;  4AH6 A;  2RHS B;  5C52 B;  4YRM A;  4YRQ A;  4TVY A;  3QNE A;  1NJ1 A;  3L4G A;  3ERR A;  2EJ9 A;  1B7Y B;  2ZGW A;  1NJ6 A;  4H2W A;  3MF2 A;  3TEH A;  3PCO B;  4YRE A;  2ALY A;  2Q5H A;  1KMM A;  4P71 C;  2E64 A;  4DQ2 A;  2CJA A;  1EFW A;  1BIA A;  1WLE A;  1EIY B;  2Q7G A;  3RKY A;  12AS A;  3VQX A;  2NS6 A;  2QHU A;  4HWT A;  2CJB A;  4KQE A;  4WJ3 M;  4NCX A;  2J3M A;  2ZZE A;  4H02 A;  4G85 A;  3RIR A;  1G5I A;  3E9I A;  3EFR A;  4K86 A;  2C8M A;  2XTI A;  3A74 A;  3HY0 A;  3A7R A;  1W66 A;  1E24 A;  3UGT A;  4HWS A;  4P75 A;  3VQV A;  2IY5 A;  4YPF A;  1BBU A;  1ASZ A;  4XTU A;  3V7S A;  4TVW A;  3HFZ B;  4P71 A;  3V8L A;  1HTT A;  4H2T A;  4P74 A;  1JJC B;  3LSS A;  4YYE A;  4G84 A;  1NNH A;  4YCW A;  3IAL A;  3VQY A;  2P5I A;  4K88 A;  3WQZ A;  3A5Y A;  1H4V B;  1Z7M A;  3M4Q A;  2AMC B;  2Q7E A;  2ZZF A;  4XTV A;  2DU5 A;  2DZC A;  2CJ9 A;  4XTZ A;  4H2V A;  3TUP A;  4LNS A;  3HXV A;  2I4L A;  4TQD A;  4XTY A;  2ZNI A;  2QHV A;  3QO5 A;  4H2X B;  2I4O A;  1SRY A;  3HXX A;  4WI1 A;  4HWR A;  4P73 C;  1NYR A;  1ADJ A;  2E10 A;  4BWA A;  3HXU A;  1YFR A;  4UP7 A;  3HXW A;  4J15 A;  4YRO A;  1X01 A;  4XEM A;  3BJU A;  4LVK A;  3IKM B;  1NJ8 A;  1SET A;  1B70 A;  4YRK A;  4XTW A;  4YRS A;  3PZC A;  4PHC A;  2ZT5 A;  4Q6G A;  4YRR A;  2RHQ A;  3QO8 A;  1H4Q A;  3G1Z A;  4X5O A;  2ZT6 A;  4L87 A;  4RQF A;  1USY C;  4YRI A;  4H2Y A;  3P8T A;  4DPG A;  1NJ2 A;  2DZ9 A;  4YRP A;  2ARU A;  2DTO A;  3HY1 A;  1X2G A;  1WPY A;  3V8K A;  4P73 A;  1KOG A;  2XGT A;  2ZCE A;  4YRN A;  4HT4 A;  4HVC A;  4TVA A;  3VQW A;  3I7F A;  4CH6 A;  2AKW B;  1HC7 A;  2P0L A;  1PYS A; 
#chains in the Genus database with same CATH homology
 2I4N A;  4YRC A;  1B8A A;  3RUX A;  2E41 A;  2Q7H A;  4UPA A;  3UH0 A;  2ART A;  4E51 A;  3FJP A;  1EQR A;  2DJZ A;  4CS3 A;  3QTC A;  2DDZ A;  3HXZ A;  1FYF A;  11AS A;  3M4P A;  2Q5I A;  4XEO A;  1BBW A;  4UP8 A;  2DQ3 A;  4TTV A;  2DTI A;  3A5Z A;  2ZR3 A;  2DKG A;  4O2D A;  1QF6 A;  3L2Z A;  1YB3 A;  1EOV A;  2RHS A;  1E22 A;  2FYK A;  4XU3 A;  2A8E A;  1X56 A;  3QO7 A;  4YCU A;  3REU A;  1B7Y A;  4CS2 A;  2E65 A;  2I4M A;  1LYL A;  1WQW A;  2ARS A;  1WQ7 A;  3HTZ A;  4H2U A;  4YRT A;  1NYQ A;  1SES A;  3KFU A;  1YFT A;  3NEL A;  3L4G B;  3TEG A;  3HRK A;  2DQ0 A;  3BFM A;  3IG2 A;  4P3N A;  1EIY A;  4OP0 A;  3TEH B;  4CS4 A;  4EX5 A;  3DSQ A;  5ELO A;  4CH3 A;  4HWP A;  3RKW A;  2ALY B;  2ZIO A;  2ZT7 A;  4OLF A;  1ASY A;  2DU7 A;  2DTH A;  1N9W A;  2ODR C;  1H4T A;  3A32 A;  3P8V A;  4HWO A;  3VBB A;  5E3I A;  4P72 C;  2G4C A;  4H2S A;  4XU1 A;  3E9H A;  3EFS A;  1SER A;  4EO4 A;  4YP0 A;  5K1X A;  4YDQ A;  4ZIB A;  1NJ5 A;  3RAC A;  4TWA A;  3A7A A;  3HFZ A;  2HNI A;  2E1H A;  3P8Y A;  3UGQ A;  1E1O A;  4WF2 A;  4XTX A;  2IY5 B;  3UFG A;  4ZTZ B;  2C7I A;  1JJC A;  4CH5 A;  4K87 A;  1YGB A;  3V7R A;  4KR3 A;  3HXY A;  5K1P A;  1X2H A;  1ADY A;  2AMC A;  5HGQ A;  3RKX A;  3LSQ A;  4KR2 A;  3RL6 A;  4YCV A;  4P72 A;  2ODR D;  1ATI A;  2ZR2 A;  2EAY A;  4HA8 A;  4P75 C;  1HXD A;  2QHS A;  4YRG A;  1EVL A;  1G5H A;  2DXT A;  4H2X A;  1H4S A;  3W3S A;  4RQE A;  4XU2 A;  2PME A;  2DVE A;  1BIB A;  1VQZ A;  2EJF A;  4P74 C;  3NEM A;  2EL9 A;  2ZIM A;  1WNL A;  2ZNJ A;  1USY A;  2EWN A;  3RGL A;  4BW9 A;  3A7U A;  3R07 A;  4WJ4 A;  1Z7N A;  4ZTU B;  3RF1 A;  4Q15 A;  4CH4 A;  3ICA A;  4PG3 A;  1GGM A;  1B76 A;  3NEN A;  2EJG A;  1X54 A;  3V8J A;  1EVK A;  2CIM A;  1C0A A;  5ELN A;  5C53 B;  3A31 A;  2CGH A;  1KMN A;  5F5W A;  1QE0 A;  3CMQ A;  3HRI A;  3PCO A;  1B70 B;  2ZTG A;  5KNN A;  1L0W A;  2RHQ B;  2J3L A;  1X55 A;  4LVJ A;  4RMF A;  1IL2 A;  1YFS A;  1J5W A;  2ZXF A;  4YRJ A;  3NET A;  2AKW A;  1G51 A;  3MF1 A;  5C51 B;  1WYD A;  2E3C A;  3REX A;  4LVM A;  4TVA B;  2QHT A;  4LVL A;  1E1T A;  2PMF A;  3LC0 A;  3MEY A;  3V7C A;  1PYS B;  3HFV A;  4YRF A;  2DXU A;  2ZIN A;  4YRL A;  4UP9 A;  4LVI A;  1WU7 A;  3IKL A;  3OD1 A;  2ZT8 A;  4XU0 A;  3L1A A;  2E5A A;  4P3P A;  4P3O A;  3MQZ A;  2DEQ A;  4RDX A;  1RIQ A;  2ZZG A;  4TQF A;  4AH6 A;  2RHS B;  5C52 B;  4YRM A;  4YRQ A;  4TVY A;  3QNE A;  1NJ1 A;  3L4G A;  3ERR A;  2EJ9 A;  1B7Y B;  2ZGW A;  1NJ6 A;  4H2W A;  3MF2 A;  3TEH A;  3PCO B;  4YRE A;  2ALY A;  2Q5H A;  1KMM A;  4P71 C;  2E64 A;  4DQ2 A;  2CJA A;  1EFW A;  1BIA A;  1WLE A;  1EIY B;  2Q7G A;  3RKY A;  12AS A;  3VQX A;  2NS6 A;  2QHU A;  4HWT A;  2CJB A;  4KQE A;  4WJ3 M;  4NCX A;  2J3M A;  2ZZE A;  4H02 A;  4G85 A;  3RIR A;  1G5I A;  3E9I A;  3EFR A;  4K86 A;  2C8M A;  2XTI A;  3A74 A;  3HY0 A;  3A7R A;  1W66 A;  1E24 A;  3UGT A;  4HWS A;  4P75 A;  3VQV A;  2IY5 A;  4YPF A;  1BBU A;  1ASZ A;  4XTU A;  3V7S A;  4TVW A;  3HFZ B;  4P71 A;  3V8L A;  1HTT A;  4H2T A;  4P74 A;  1JJC B;  3LSS A;  4YYE A;  4G84 A;  1NNH A;  4YCW A;  3IAL A;  3VQY A;  2P5I A;  4K88 A;  3WQZ A;  3A5Y A;  1H4V B;  1Z7M A;  3M4Q A;  2AMC B;  2Q7E A;  2ZZF A;  4XTV A;  2DU5 A;  2DZC A;  2CJ9 A;  4XTZ A;  4H2V A;  3TUP A;  4LNS A;  3HXV A;  2I4L A;  4TQD A;  4XTY A;  2ZNI A;  2QHV A;  3QO5 A;  4H2X B;  2I4O A;  1SRY A;  3HXX A;  4WI1 A;  4HWR A;  4P73 C;  1NYR A;  1ADJ A;  2E10 A;  4BWA A;  3HXU A;  1YFR A;  4UP7 A;  3HXW A;  4J15 A;  4YRO A;  1X01 A;  4XEM A;  3BJU A;  4LVK A;  3IKM B;  1NJ8 A;  1SET A;  1B70 A;  4YRK A;  4XTW A;  4YRS A;  3PZC A;  4PHC A;  2ZT5 A;  4Q6G A;  4YRR A;  2RHQ A;  3QO8 A;  1H4Q A;  3G1Z A;  4X5O A;  2ZT6 A;  4L87 A;  4RQF A;  1USY C;  4YRI A;  4H2Y A;  3P8T A;  4DPG A;  1NJ2 A;  2DZ9 A;  4YRP A;  2ARU A;  2DTO A;  3HY1 A;  1X2G A;  1WPY A;  3V8K A;  4P73 A;  1KOG A;  2XGT A;  2ZCE A;  4YRN A;  4HT4 A;  4HVC A;  4TVA A;  3VQW A;  3I7F A;  4CH6 A;  2AKW B;  1HC7 A;  2P0L A;  1PYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...