4LVLA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt+3'thiophosphate). mn-bound crystal structure at ph 6.8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
196
structure length
196
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVFETHSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Dna binding protein/dna
molecule keywords Plasmid recombination enzyme
total genus 61
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lvlA01
4LVMA 4LVLA 4LVIA 4HT4A 4LVJA 2NS6A 4LVKA
chains in the Genus database with same CATH superfamily
3L1AA 4TVAB 1QE0A 4ZTUB 1EVLA 4XTZA 1G51A 1B7YA 3REXA 4YRGA 3RKXA 1B7YB 4TVWA 1SETA 2I4OA 3RF1A 4YRIA 3V8JA 1X54A 3RL6A 4G85A 2I4MA 2CJAA 4L87A 2IY5A 1JJCB 1ADYA 2AKWB 4Q15A 4RQFA 4P72C 4XTWA 1IL2A 1HC7A 4RQEA 4PHCA 2ZNIA 3TUPA 2ZT8A 3HFZA 1X56A 2PMEA 1YFSA 2I4NA 3EFRA 5ELNA 4LVJA 1H4SA 2AMCA 12ASA 1NJ1A 4PG3A 4CH5A 4HWPA 1NJ2A 3A5YA 1QF6A 4UP7A 1PYSA 4YRLA 4H2VA 4YPFA 2Q7EA 4P3PA 4YRRA 3ERRA 2ODRD 1PYSB 2DEQA 5HGQA 4H2UA 4EO4A 3TEHB 4YRSA 2AMCB 1KOGA 4YCUA 4DQ2A 2PMFA 4XTXA 3FJPA 3LSQA 1EIYA 1LYLA 4CH4A 2AKWA 4J15A 1USYC 3V7RA 4H2XB 1N9WA 3QO8A 4XU0A 3HRIA 3OD1A 1ASZA 4OP0A 4ZTZB 4YP0A 1HTTA 2RHSB 3A74A 4LVLA 1RIQA 2ZT6A 3A32A 1E1OA 4YRMA 2A8EA 4LNSA 4KR3A 4HT4A 1ASYA 2ZIOA 2DVEA 3L4GB 3UFGA 2ARSA 1KMMA 4RMFA 4XU3A 3MF1A 4TVAA 4YRKA 2ZGWA 4P73C 4XEOA 2C8MA 1NJ6A 1B76A 4KR2A 4TVYA 1SRYA 3RIRA 2QHTA 4WI1A 4LVMA 2E64A 1JJCA 4WJ4A 3KFUA 2DXTA 4O2DA 3CMQA 3HTZA 4P74C 3P8YA 5F5WA 3V8KA 3HXVA 3R07A 3G1ZA 1HXDA 4YRCA 4K87A 4DPGA 3UH0A 2ZT5A 3HXYA 4K86A 1G5HA 1BIAA 4P75C 4LVKA 3MF2A 4HWRA 1SERA 4CS3A 1BIBA 5C53B 2NS6A 2DQ0A 3QO7A 2E3CA 3VQWA 4ZIBA 4XEMA 4WJ3M 2ZIMA 3RUXA 2ZTGA 2XTIA 4H2SA 4TQDA 2CIMA 2QHUA 3NETA 4CH3A 3A7AA 2QHSA 3VBBA 4K88A 3RACA 2ZZGA 5C52B 1Z7NA 3HFVA 2DTIA 2EAYA 3EFSA 2Q7HA 4UPAA 4UP9A 3UGQA 3PCOA 1J5WA 1X2GA 4P72A 4G84A 2DJZA 5E3IA 3W3SA 3V7CA 2Q5HA 2DDZA 4YCVA 2ARTA 1X55A 2CJBA 2DKGA 3NEMA 4P71C 1KMNA 2ZZEA 1E24A 3HXUA 3BJUA 4H2WA 2RHQB 1W66A 3BFMA 1H4TA 2QHVA 1B70A 2I4LA 2HNIA 2RHQA 3IALA 3UGTA 1NYRA 1WLEA 2ZINA 2P5IA 3HXZA 4H2YA 2FYKA 1B8AA 3RGLA 4H2TA 2E1HA 2EJFA 4YREA 1E1TA 2DU5A 4EX5A 1EVKA 1H4VB 3ICAA 2DZ9A 1G5IA 3HY0A 1GGMA 2ALYB 3P8VA 2ZZFA 5K1XA 4YDQA 4BWAA 4UP8A 3REUA 3V8LA 4P3OA 3A5ZA 2EWNA 3MEYA 4YRFA 1C0AA 2DTOA 4HWSA 4RDXA 11ASA 2ZXFA 2DQ3A 4P73A 3RKWA 1YB3A 4Q6GA 1ADJA 2ZCEA 4HWTA 2E5AA 2DTHA 4YRNA 2ALYA 1NYQA 3VQVA 4TTVA 1YFRA 2J3LA 3A31A 4AH6A 1YGBA 3RKYA 3MQZA 2ODRC 4OLFA 1X01A 1VQZA 1L0WA 1Z7MA 2ZR2A 3L4GA 1WU7A 4YRPA 2Q5IA 1YFTA 2ARUA 2E41A 2RHSA 2CGHA 3IKMB 2EJ9A 4CS2A 3QTCA 2ZNJA 4P71A 4CS4A 3HXXA 3P8TA 3HXWA 4P75A 4BW9A 1EIYB 5K1PA 4YROA 2ZT7A 1NNHA 3DSQA 4P3NA 5C51B 1WQ7A 2DXUA 3HRKA 4HWOA 3LSSA 3L2ZA 1WNLA 2P0LA 1X2HA 3NELA 3NENA 2E10A 3VQYA 3PZCA 1B70B 1USYA 3HY1A 1WYDA 4H2XA 2DZCA 4CH6A 4XTVA 4E51A 4H02A 3A7UA 3I7FA 3VQXA 3M4QA 3E9IA 2G4CA 4HA8A 4TWAA 2DU7A 5KNNA 3IKLA 3LC0A 3V7SA 1SESA 3QNEA 2C7IA 4X5OA 1H4QA 4HVCA 1ATIA 2XGTA 4XTYA 3A7RA 1FYFA 3PCOB 3IG2A 3TEHA 1WQWA 4YRQA 1EOVA 4XU1A 4WF2A 4LVIA 1BBWA 1EQRA 4P74A 2J3MA 1EFWA 3TEGA 2CJ9A 4TQFA 4NCXA 3M4PA 1E22A 4XTUA 3WQZA 4YRTA 3HFZB 1NJ8A 1NJ5A 2E65A 1BBUA 4YYEA 4YCWA 4KQEA 4YRJA 2EJGA 5ELOA 2EL9A 2ZR3A 3E9HA 3QO5A 1WPYA 2Q7GA 4XU2A 2IY5B
chains in the Genus database with same CATH topology
3L1AA 4TVAB 1QE0A 4ZTUB 1EVLA 4XTZA 1G51A 1B7YA 3REXA 4YRGA 3RKXA 1B7YB 4TVWA 1SETA 2I4OA 3RF1A 4YRIA 3V8JA 1X54A 3RL6A 4G85A 2I4MA 2CJAA 4L87A 2IY5A 1JJCB 1ADYA 2AKWB 4Q15A 4RQFA 4P72C 4XTWA 1IL2A 1HC7A 4RQEA 4PHCA 2ZNIA 3TUPA 2ZT8A 3HFZA 1X56A 2PMEA 1YFSA 2I4NA 3EFRA 5ELNA 4LVJA 1H4SA 2AMCA 12ASA 1NJ1A 4PG3A 4CH5A 4HWPA 1NJ2A 3A5YA 1QF6A 4UP7A 1PYSA 4YRLA 4H2VA 4YPFA 2Q7EA 4P3PA 4YRRA 3ERRA 2ODRD 1PYSB 2DEQA 5HGQA 4H2UA 4EO4A 3TEHB 4YRSA 2AMCB 1KOGA 4YCUA 4DQ2A 2PMFA 4XTXA 3FJPA 3LSQA 1EIYA 1LYLA 4CH4A 2AKWA 4J15A 1USYC 3V7RA 4H2XB 1N9WA 3QO8A 4XU0A 3HRIA 3OD1A 1ASZA 4OP0A 4ZTZB 4YP0A 1HTTA 2RHSB 3A74A 4LVLA 1RIQA 2ZT6A 3A32A 1E1OA 4YRMA 2A8EA 4LNSA 4KR3A 4HT4A 1ASYA 2ZIOA 2DVEA 3L4GB 3UFGA 2ARSA 1KMMA 4RMFA 4XU3A 3MF1A 4TVAA 4YRKA 2ZGWA 4P73C 4XEOA 2C8MA 1NJ6A 1B76A 4KR2A 4TVYA 1SRYA 3RIRA 2QHTA 4WI1A 4LVMA 2E64A 1JJCA 4WJ4A 3KFUA 2DXTA 4O2DA 3CMQA 3HTZA 4P74C 3P8YA 5F5WA 3V8KA 3HXVA 3R07A 3G1ZA 1HXDA 4YRCA 4K87A 4DPGA 3UH0A 2ZT5A 3HXYA 4K86A 1G5HA 1BIAA 4P75C 4LVKA 3MF2A 4HWRA 1SERA 4CS3A 1BIBA 5C53B 2NS6A 2DQ0A 3QO7A 2E3CA 3VQWA 4ZIBA 4XEMA 4WJ3M 2ZIMA 3RUXA 2ZTGA 2XTIA 4H2SA 4TQDA 2CIMA 2QHUA 3NETA 4CH3A 3A7AA 2QHSA 3VBBA 4K88A 3RACA 2ZZGA 5C52B 1Z7NA 3HFVA 2DTIA 2EAYA 3EFSA 2Q7HA 4UPAA 4UP9A 3UGQA 3PCOA 1J5WA 1X2GA 4P72A 4G84A 2DJZA 5E3IA 3W3SA 3V7CA 2Q5HA 2DDZA 4YCVA 2ARTA 1X55A 2CJBA 2DKGA 3NEMA 4P71C 1KMNA 2ZZEA 1E24A 3HXUA 3BJUA 4H2WA 2RHQB 1W66A 3BFMA 1H4TA 2QHVA 1B70A 2I4LA 2HNIA 2RHQA 3IALA 3UGTA 1NYRA 1WLEA 2ZINA 2P5IA 3HXZA 4H2YA 2FYKA 1B8AA 3RGLA 4H2TA 2E1HA 2EJFA 4YREA 1E1TA 2DU5A 4EX5A 1EVKA 1H4VB 3ICAA 2DZ9A 1G5IA 3HY0A 1GGMA 2ALYB 3P8VA 2ZZFA 5K1XA 4YDQA 4BWAA 4UP8A 3REUA 3V8LA 4P3OA 3A5ZA 2EWNA 3MEYA 4YRFA 1C0AA 2DTOA 4HWSA 4RDXA 11ASA 2ZXFA 2DQ3A 4P73A 3RKWA 1YB3A 4Q6GA 1ADJA 2ZCEA 4HWTA 2E5AA 2DTHA 4YRNA 2ALYA 1NYQA 3VQVA 4TTVA 1YFRA 2J3LA 3A31A 4AH6A 1YGBA 3RKYA 3MQZA 2ODRC 4OLFA 1X01A 1VQZA 1L0WA 1Z7MA 2ZR2A 3L4GA 1WU7A 4YRPA 2Q5IA 1YFTA 2ARUA 2E41A 2RHSA 2CGHA 3IKMB 2EJ9A 4CS2A 3QTCA 2ZNJA 4P71A 4CS4A 3HXXA 3P8TA 3HXWA 4P75A 4BW9A 1EIYB 5K1PA 4YROA 2ZT7A 1NNHA 3DSQA 4P3NA 5C51B 1WQ7A 2DXUA 3HRKA 4HWOA 3LSSA 3L2ZA 1WNLA 2P0LA 1X2HA 3NELA 3NENA 2E10A 3VQYA 3PZCA 1B70B 1USYA 3HY1A 1WYDA 4H2XA 2DZCA 4CH6A 4XTVA 4E51A 4H02A 3A7UA 3I7FA 3VQXA 3M4QA 3E9IA 2G4CA 4HA8A 4TWAA 2DU7A 5KNNA 3IKLA 3LC0A 3V7SA 1SESA 3QNEA 2C7IA 4X5OA 1H4QA 4HVCA 1ATIA 2XGTA 4XTYA 3A7RA 1FYFA 3PCOB 3IG2A 3TEHA 1WQWA 4YRQA 1EOVA 4XU1A 4WF2A 4LVIA 1BBWA 1EQRA 4P74A 2J3MA 1EFWA 3TEGA 2CJ9A 4TQFA 4NCXA 3M4PA 1E22A 4XTUA 3WQZA 4YRTA 3HFZB 1NJ8A 1NJ5A 2E65A 1BBUA 4YYEA 4YCWA 4KQEA 4YRJA 2EJGA 5ELOA 2EL9A 2ZR3A 3E9HA 3QO5A 1WPYA 2Q7GA 4XU2A 2IY5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVM A;  4LVL A;  4LVI A;  4HT4 A;  4LVJ A;  2NS6 A;  4LVK A; 
#chains in the Genus database with same CATH topology
 3L1A A;  4TVA B;  1QE0 A;  4ZTU B;  1EVL A;  4XTZ A;  1G51 A;  1B7Y A;  3REX A;  4YRG A;  3RKX A;  1B7Y B;  4TVW A;  1SET A;  2I4O A;  3RF1 A;  4YRI A;  3V8J A;  1X54 A;  3RL6 A;  4G85 A;  2I4M A;  2CJA A;  4L87 A;  2IY5 A;  1JJC B;  1ADY A;  2AKW B;  4Q15 A;  4RQF A;  4P72 C;  4XTW A;  1IL2 A;  1HC7 A;  4RQE A;  4PHC A;  2ZNI A;  3TUP A;  2ZT8 A;  3HFZ A;  1X56 A;  2PME A;  1YFS A;  2I4N A;  3EFR A;  5ELN A;  4LVJ A;  1H4S A;  2AMC A;  12AS A;  1NJ1 A;  4PG3 A;  4CH5 A;  4HWP A;  1NJ2 A;  3A5Y A;  1QF6 A;  4UP7 A;  1PYS A;  4YRL A;  4H2V A;  4YPF A;  2Q7E A;  4P3P A;  4YRR A;  3ERR A;  2ODR D;  1PYS B;  2DEQ A;  5HGQ A;  4H2U A;  4EO4 A;  3TEH B;  4YRS A;  2AMC B;  1KOG A;  4YCU A;  4DQ2 A;  2PMF A;  4XTX A;  3FJP A;  3LSQ A;  1EIY A;  1LYL A;  4CH4 A;  2AKW A;  4J15 A;  1USY C;  3V7R A;  4H2X B;  1N9W A;  3QO8 A;  4XU0 A;  3HRI A;  3OD1 A;  1ASZ A;  4OP0 A;  4ZTZ B;  4YP0 A;  1HTT A;  2RHS B;  3A74 A;  4LVL A;  1RIQ A;  2ZT6 A;  3A32 A;  1E1O A;  4YRM A;  2A8E A;  4LNS A;  4KR3 A;  4HT4 A;  1ASY A;  2ZIO A;  2DVE A;  3L4G B;  3UFG A;  2ARS A;  1KMM A;  4RMF A;  4XU3 A;  3MF1 A;  4TVA A;  4YRK A;  2ZGW A;  4P73 C;  4XEO A;  2C8M A;  1NJ6 A;  1B76 A;  4KR2 A;  4TVY A;  1SRY A;  3RIR A;  2QHT A;  4WI1 A;  4LVM A;  2E64 A;  1JJC A;  4WJ4 A;  3KFU A;  2DXT A;  4O2D A;  3CMQ A;  3HTZ A;  4P74 C;  3P8Y A;  5F5W A;  3V8K A;  3HXV A;  3R07 A;  3G1Z A;  1HXD A;  4YRC A;  4K87 A;  4DPG A;  3UH0 A;  2ZT5 A;  3HXY A;  4K86 A;  1G5H A;  1BIA A;  4P75 C;  4LVK A;  3MF2 A;  4HWR A;  1SER A;  4CS3 A;  1BIB A;  5C53 B;  2NS6 A;  2DQ0 A;  3QO7 A;  2E3C A;  3VQW A;  4ZIB A;  4XEM A;  4WJ3 M;  2ZIM A;  3RUX A;  2ZTG A;  2XTI A;  4H2S A;  4TQD A;  2CIM A;  2QHU A;  3NET A;  4CH3 A;  3A7A A;  2QHS A;  3VBB A;  4K88 A;  3RAC A;  2ZZG A;  5C52 B;  1Z7N A;  3HFV A;  2DTI A;  2EAY A;  3EFS A;  2Q7H A;  4UPA A;  4UP9 A;  3UGQ A;  3PCO A;  1J5W A;  1X2G A;  4P72 A;  4G84 A;  2DJZ A;  5E3I A;  3W3S A;  3V7C A;  2Q5H A;  2DDZ A;  4YCV A;  2ART A;  1X55 A;  2CJB A;  2DKG A;  3NEM A;  4P71 C;  1KMN A;  2ZZE A;  1E24 A;  3HXU A;  3BJU A;  4H2W A;  2RHQ B;  1W66 A;  3BFM A;  1H4T A;  2QHV A;  1B70 A;  2I4L A;  2HNI A;  2RHQ A;  3IAL A;  3UGT A;  1NYR A;  1WLE A;  2ZIN A;  2P5I A;  3HXZ A;  4H2Y A;  2FYK A;  1B8A A;  3RGL A;  4H2T A;  2E1H A;  2EJF A;  4YRE A;  1E1T A;  2DU5 A;  4EX5 A;  1EVK A;  1H4V B;  3ICA A;  2DZ9 A;  1G5I A;  3HY0 A;  1GGM A;  2ALY B;  3P8V A;  2ZZF A;  5K1X A;  4YDQ A;  4BWA A;  4UP8 A;  3REU A;  3V8L A;  4P3O A;  3A5Z A;  2EWN A;  3MEY A;  4YRF A;  1C0A A;  2DTO A;  4HWS A;  4RDX A;  11AS A;  2ZXF A;  2DQ3 A;  4P73 A;  3RKW A;  1YB3 A;  4Q6G A;  1ADJ A;  2ZCE A;  4HWT A;  2E5A A;  2DTH A;  4YRN A;  2ALY A;  1NYQ A;  3VQV A;  4TTV A;  1YFR A;  2J3L A;  3A31 A;  4AH6 A;  1YGB A;  3RKY A;  3MQZ A;  2ODR C;  4OLF A;  1X01 A;  1VQZ A;  1L0W A;  1Z7M A;  2ZR2 A;  3L4G A;  1WU7 A;  4YRP A;  2Q5I A;  1YFT A;  2ARU A;  2E41 A;  2RHS A;  2CGH A;  3IKM B;  2EJ9 A;  4CS2 A;  3QTC A;  2ZNJ A;  4P71 A;  4CS4 A;  3HXX A;  3P8T A;  3HXW A;  4P75 A;  4BW9 A;  1EIY B;  5K1P A;  4YRO A;  2ZT7 A;  1NNH A;  3DSQ A;  4P3N A;  5C51 B;  1WQ7 A;  2DXU A;  3HRK A;  4HWO A;  3LSS A;  3L2Z A;  1WNL A;  2P0L A;  1X2H A;  3NEL A;  3NEN A;  2E10 A;  3VQY A;  3PZC A;  1B70 B;  1USY A;  3HY1 A;  1WYD A;  4H2X A;  2DZC A;  4CH6 A;  4XTV A;  4E51 A;  4H02 A;  3A7U A;  3I7F A;  3VQX A;  3M4Q A;  3E9I A;  2G4C A;  4HA8 A;  4TWA A;  2DU7 A;  5KNN A;  3IKL A;  3LC0 A;  3V7S A;  1SES A;  3QNE A;  2C7I A;  4X5O A;  1H4Q A;  4HVC A;  1ATI A;  2XGT A;  4XTY A;  3A7R A;  1FYF A;  3PCO B;  3IG2 A;  3TEH A;  1WQW A;  4YRQ A;  1EOV A;  4XU1 A;  4WF2 A;  4LVI A;  1BBW A;  1EQR A;  4P74 A;  2J3M A;  1EFW A;  3TEG A;  2CJ9 A;  4TQF A;  4NCX A;  3M4P A;  1E22 A;  4XTU A;  3WQZ A;  4YRT A;  3HFZ B;  1NJ8 A;  1NJ5 A;  2E65 A;  1BBU A;  4YYE A;  4YCW A;  4KQE A;  4YRJ A;  2EJG A;  5ELO A;  2EL9 A;  2ZR3 A;  3E9H A;  3QO5 A;  1WPY A;  2Q7G A;  4XU2 A;  2IY5 B; 
#chains in the Genus database with same CATH homology
 3L1A A;  4TVA B;  1QE0 A;  4ZTU B;  1EVL A;  4XTZ A;  1G51 A;  1B7Y A;  3REX A;  4YRG A;  3RKX A;  1B7Y B;  4TVW A;  1SET A;  2I4O A;  3RF1 A;  4YRI A;  3V8J A;  1X54 A;  3RL6 A;  4G85 A;  2I4M A;  2CJA A;  4L87 A;  2IY5 A;  1JJC B;  1ADY A;  2AKW B;  4Q15 A;  4RQF A;  4P72 C;  4XTW A;  1IL2 A;  1HC7 A;  4RQE A;  4PHC A;  2ZNI A;  3TUP A;  2ZT8 A;  3HFZ A;  1X56 A;  2PME A;  1YFS A;  2I4N A;  3EFR A;  5ELN A;  4LVJ A;  1H4S A;  2AMC A;  12AS A;  1NJ1 A;  4PG3 A;  4CH5 A;  4HWP A;  1NJ2 A;  3A5Y A;  1QF6 A;  4UP7 A;  1PYS A;  4YRL A;  4H2V A;  4YPF A;  2Q7E A;  4P3P A;  4YRR A;  3ERR A;  2ODR D;  1PYS B;  2DEQ A;  5HGQ A;  4H2U A;  4EO4 A;  3TEH B;  4YRS A;  2AMC B;  1KOG A;  4YCU A;  4DQ2 A;  2PMF A;  4XTX A;  3FJP A;  3LSQ A;  1EIY A;  1LYL A;  4CH4 A;  2AKW A;  4J15 A;  1USY C;  3V7R A;  4H2X B;  1N9W A;  3QO8 A;  4XU0 A;  3HRI A;  3OD1 A;  1ASZ A;  4OP0 A;  4ZTZ B;  4YP0 A;  1HTT A;  2RHS B;  3A74 A;  4LVL A;  1RIQ A;  2ZT6 A;  3A32 A;  1E1O A;  4YRM A;  2A8E A;  4LNS A;  4KR3 A;  4HT4 A;  1ASY A;  2ZIO A;  2DVE A;  3L4G B;  3UFG A;  2ARS A;  1KMM A;  4RMF A;  4XU3 A;  3MF1 A;  4TVA A;  4YRK A;  2ZGW A;  4P73 C;  4XEO A;  2C8M A;  1NJ6 A;  1B76 A;  4KR2 A;  4TVY A;  1SRY A;  3RIR A;  2QHT A;  4WI1 A;  4LVM A;  2E64 A;  1JJC A;  4WJ4 A;  3KFU A;  2DXT A;  4O2D A;  3CMQ A;  3HTZ A;  4P74 C;  3P8Y A;  5F5W A;  3V8K A;  3HXV A;  3R07 A;  3G1Z A;  1HXD A;  4YRC A;  4K87 A;  4DPG A;  3UH0 A;  2ZT5 A;  3HXY A;  4K86 A;  1G5H A;  1BIA A;  4P75 C;  4LVK A;  3MF2 A;  4HWR A;  1SER A;  4CS3 A;  1BIB A;  5C53 B;  2NS6 A;  2DQ0 A;  3QO7 A;  2E3C A;  3VQW A;  4ZIB A;  4XEM A;  4WJ3 M;  2ZIM A;  3RUX A;  2ZTG A;  2XTI A;  4H2S A;  4TQD A;  2CIM A;  2QHU A;  3NET A;  4CH3 A;  3A7A A;  2QHS A;  3VBB A;  4K88 A;  3RAC A;  2ZZG A;  5C52 B;  1Z7N A;  3HFV A;  2DTI A;  2EAY A;  3EFS A;  2Q7H A;  4UPA A;  4UP9 A;  3UGQ A;  3PCO A;  1J5W A;  1X2G A;  4P72 A;  4G84 A;  2DJZ A;  5E3I A;  3W3S A;  3V7C A;  2Q5H A;  2DDZ A;  4YCV A;  2ART A;  1X55 A;  2CJB A;  2DKG A;  3NEM A;  4P71 C;  1KMN A;  2ZZE A;  1E24 A;  3HXU A;  3BJU A;  4H2W A;  2RHQ B;  1W66 A;  3BFM A;  1H4T A;  2QHV A;  1B70 A;  2I4L A;  2HNI A;  2RHQ A;  3IAL A;  3UGT A;  1NYR A;  1WLE A;  2ZIN A;  2P5I A;  3HXZ A;  4H2Y A;  2FYK A;  1B8A A;  3RGL A;  4H2T A;  2E1H A;  2EJF A;  4YRE A;  1E1T A;  2DU5 A;  4EX5 A;  1EVK A;  1H4V B;  3ICA A;  2DZ9 A;  1G5I A;  3HY0 A;  1GGM A;  2ALY B;  3P8V A;  2ZZF A;  5K1X A;  4YDQ A;  4BWA A;  4UP8 A;  3REU A;  3V8L A;  4P3O A;  3A5Z A;  2EWN A;  3MEY A;  4YRF A;  1C0A A;  2DTO A;  4HWS A;  4RDX A;  11AS A;  2ZXF A;  2DQ3 A;  4P73 A;  3RKW A;  1YB3 A;  4Q6G A;  1ADJ A;  2ZCE A;  4HWT A;  2E5A A;  2DTH A;  4YRN A;  2ALY A;  1NYQ A;  3VQV A;  4TTV A;  1YFR A;  2J3L A;  3A31 A;  4AH6 A;  1YGB A;  3RKY A;  3MQZ A;  2ODR C;  4OLF A;  1X01 A;  1VQZ A;  1L0W A;  1Z7M A;  2ZR2 A;  3L4G A;  1WU7 A;  4YRP A;  2Q5I A;  1YFT A;  2ARU A;  2E41 A;  2RHS A;  2CGH A;  3IKM B;  2EJ9 A;  4CS2 A;  3QTC A;  2ZNJ A;  4P71 A;  4CS4 A;  3HXX A;  3P8T A;  3HXW A;  4P75 A;  4BW9 A;  1EIY B;  5K1P A;  4YRO A;  2ZT7 A;  1NNH A;  3DSQ A;  4P3N A;  5C51 B;  1WQ7 A;  2DXU A;  3HRK A;  4HWO A;  3LSS A;  3L2Z A;  1WNL A;  2P0L A;  1X2H A;  3NEL A;  3NEN A;  2E10 A;  3VQY A;  3PZC A;  1B70 B;  1USY A;  3HY1 A;  1WYD A;  4H2X A;  2DZC A;  4CH6 A;  4XTV A;  4E51 A;  4H02 A;  3A7U A;  3I7F A;  3VQX A;  3M4Q A;  3E9I A;  2G4C A;  4HA8 A;  4TWA A;  2DU7 A;  5KNN A;  3IKL A;  3LC0 A;  3V7S A;  1SES A;  3QNE A;  2C7I A;  4X5O A;  1H4Q A;  4HVC A;  1ATI A;  2XGT A;  4XTY A;  3A7R A;  1FYF A;  3PCO B;  3IG2 A;  3TEH A;  1WQW A;  4YRQ A;  1EOV A;  4XU1 A;  4WF2 A;  4LVI A;  1BBW A;  1EQR A;  4P74 A;  2J3M A;  1EFW A;  3TEG A;  2CJ9 A;  4TQF A;  4NCX A;  3M4P A;  1E22 A;  4XTU A;  3WQZ A;  4YRT A;  3HFZ B;  1NJ8 A;  1NJ5 A;  2E65 A;  1BBU A;  4YYE A;  4YCW A;  4KQE A;  4YRJ A;  2EJG A;  5ELO A;  2EL9 A;  2ZR3 A;  3E9H A;  3QO5 A;  1WPY A;  2Q7G A;  4XU2 A;  2IY5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...