4LVLA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt+3'thiophosphate). mn-bound crystal structure at ph 6.8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
196
structure length
196
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVFETHSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Dna binding protein/dna
molecule keywords Plasmid recombination enzyme
total genus 61
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lvlA01
4LVLA 2NS6A 4HT4A 4LVMA 4LVJA 4LVIA 4LVKA
chains in the Genus database with same CATH superfamily
4PG3A 5F5WA 3IG2A 3UGQA 2E65A 1B70B 3DSQA 4UP7A 4H2XB 1G5HA 3A32A 2DTIA 2ZCEA 1NYQA 1G5IA 3HY1A 1X54A 4CS4A 1WNLA 1BBUA 1JJCA 4BWAA 4LVKA 3A7AA 1KMNA 1HTTA 1WYDA 2DKGA 3ICAA 2ZT6A 2ZGWA 3HFVA 1Z7MA 3HRIA 3VQYA 4PHCA 3IKLA 2AMCB 2HNIA 4HVCA 4UP9A 2C8MA 2I4MA 1ADYA 3PCOA 3G1ZA 4LVJA 4YRIA 1C0AA 3MQZA 3NETA 4XTXA 1NJ1A 3MEYA 3V8JA 2RHSB 3HXWA 3TEHA 1ASYA 3V7CA 4LVLA 4HT4A 4TVYA 2PMFA 3ERRA 2ZXFA 2AKWA 3RACA 2QHSA 2ODRC 3IALA 4ZTUB 2CGHA 4WJ4A 1BBWA 3I7FA 11ASA 4KR3A 2ZZEA 4YRCA 1HXDA 1E1OA 1B70A 4OP0A 2EAYA 4H2UA 1SRYA 2DZ9A 2PMEA 4P3PA 3VQWA 1NYRA 1QF6A 1NNHA 1PYSA 1SERA 4ZTZB 3QTCA 1JJCB 4XTZA 3HFZA 3EFSA 2DQ3A 1KOGA 4WJ3M 4TTVA 1X01A 4H02A 1YB3A 1ASZA 1USYA 3V7RA 3NELA 4K88A 3QNEA 4P74A 1RIQA 1IL2A 4YCVA 1H4SA 4G85A 2DU7A 2CJBA 2G4CA 3MF1A 3OD1A 4XTUA 1H4VB 3UH0A 3VQVA 2XTIA 1X56A 3L4GB 4XU0A 4WI1A 3IKMB 4YRTA 3HY0A 2E41A 2NS6A 4OLFA 1YFTA 4P73A 2ZINA 4RMFA 2P0LA 5ELOA 2ZNJA 2AKWB 2ZZGA 3RKWA 3A7UA 3A5YA 1B7YB 2EJGA 2QHUA 4YROA 2DXTA 2ARUA 2J3LA 4YRNA 4XTWA 3RIRA 4L87A 1ADJA 4P72A 4DPGA 4YRPA 3HXZA 3NEMA 4XU1A 1FYFA 3UFGA 1Z7NA 2I4NA 5C52B 3KFUA 1EVKA 1EIYA 3HXUA 1X2HA 4H2SA 4Q15A 5K1XA 2E10A 4UP8A 2DXUA 3V8KA 4XU3A 1EOVA 4YCUA 3M4QA 3R07A 2ZIMA 4XTYA 2J3MA 4P71C 4H2TA 1BIBA 2ALYA 3A5ZA 2RHQB 4HWSA 3L1AA 4LVMA 4HWOA 3QO8A 1HC7A 2FYKA 3RF1A 4YRKA 3E9IA 4TVAB 4XEMA 1EFWA 2E3CA 1WQ7A 4RQEA 3P8YA 2QHTA 3BJUA 1SESA 4H2YA 2AMCA 4P75A 1H4TA 2EJFA 3PCOB 4LNSA 4P71A 3RGLA 2EJ9A 1L0WA 4CH5A 4YPFA 2EWNA 1E24A 4ZIBA 3W3SA 2Q7GA 3NENA 1VQZA 4KR2A 4CS3A 4CH3A 3BFMA 3LC0A 4HWRA 2XGTA 4YRFA 5KNNA 3HXYA 3TEHB 12ASA 1J5WA 4YP0A 4YREA 4XTVA 3WQZA 2E5AA 4NCXA 5E3IA 2E1HA 3EFRA 5K1PA 4HWPA 1SETA 3HXXA 3RUXA 1KMMA 1E22A 4BW9A 1N9WA 3CMQA 2ZZFA 2DQ0A 4TVWA 3RL6A 4LVIA 2DZCA 4G84A 4O2DA 1B8AA 1PYSB 4YDQA 3P8VA 3P8TA 4YCWA 4TWAA 1X2GA 2C7IA 3V8LA 2ALYB 3VBBA 3TUPA 2Q5IA 2Q7EA 1LYLA 2ZT7A 2Q5HA 4YRJA 1USYC 3HRKA 4P3NA 3REXA 3FJPA 4YRQA 3RKYA 3REUA 2DVEA 1ATIA 2IY5B 2E64A 3QO7A 5C51B 4X5OA 2ODRD 3UGTA 1WQWA 3VQXA 4CH4A 3PZCA 4H2VA 3L4GA 4TQFA 2A8EA 3MF2A 4EO4A 1EQRA 1X55A 4CH6A 2ZR2A 3A74A 2ZT8A 4K86A 4YRGA 2DTOA 2ZIOA 1BIAA 2Q7HA 4YRLA 4K87A 3LSSA 3E9HA 4P72C 4EX5A 3HXVA 1WU7A 4YRSA 1NJ2A 2ZT5A 5ELNA 2DTHA 3L2ZA 1YFRA 4H2WA 3A31A 4YRRA 3TEGA 4H2XA 5C53B 2EL9A 2ZR3A 2CJ9A 4XEOA 4CS2A 1B76A 1NJ5A 4WF2A 4RDXA 2ZNIA 2I4LA 3HFZB 2DU5A 1EIYB 4XU2A 3V7SA 2DJZA 1EVLA 1YFSA 4HWTA 1NJ6A 2P5IA 4AH6A 1H4QA 4DQ2A 1NJ8A 4Q6GA 3M4PA 5HGQA 3HTZA 4YYEA 1WPYA 2ARSA 1GGMA 2DDZA 2RHQA 4P74C 4P73C 1WLEA 2IY5A 4TQDA 3RKXA 1W66A 2DEQA 4E51A 2CJAA 4TVAA 1E1TA 2QHVA 3LSQA 2I4OA 2CIMA 4J15A 4RQFA 1QE0A 4HA8A 1B7YA 1YGBA 4KQEA 4UPAA 2RHSA 1G51A 2ZTGA 3A7RA 4P3OA 2ARTA 4P75C 4YRMA 3QO5A
chains in the Genus database with same CATH topology
4PG3A 5F5WA 3IG2A 3UGQA 2E65A 1B70B 3DSQA 4UP7A 4H2XB 1G5HA 3A32A 2DTIA 2ZCEA 1NYQA 1G5IA 3HY1A 1X54A 4CS4A 1WNLA 1BBUA 1JJCA 4BWAA 4LVKA 3A7AA 1KMNA 1HTTA 1WYDA 2DKGA 3ICAA 2ZT6A 2ZGWA 3HFVA 1Z7MA 3HRIA 3VQYA 4PHCA 3IKLA 2AMCB 2HNIA 4HVCA 4UP9A 2C8MA 2I4MA 1ADYA 3PCOA 3G1ZA 4LVJA 4YRIA 1C0AA 3MQZA 3NETA 4XTXA 1NJ1A 3MEYA 3V8JA 2RHSB 3HXWA 3TEHA 1ASYA 3V7CA 4LVLA 4HT4A 4TVYA 2PMFA 3ERRA 2ZXFA 2AKWA 3RACA 2QHSA 2ODRC 3IALA 4ZTUB 2CGHA 4WJ4A 1BBWA 3I7FA 11ASA 4KR3A 2ZZEA 4YRCA 1HXDA 1E1OA 1B70A 4OP0A 2EAYA 4H2UA 1SRYA 2DZ9A 2PMEA 4P3PA 3VQWA 1NYRA 1QF6A 1NNHA 1PYSA 1SERA 4ZTZB 3QTCA 1JJCB 4XTZA 3HFZA 3EFSA 2DQ3A 1KOGA 4WJ3M 4TTVA 1X01A 4H02A 1YB3A 1ASZA 1USYA 3V7RA 3NELA 4K88A 3QNEA 4P74A 1RIQA 1IL2A 4YCVA 1H4SA 4G85A 2DU7A 2CJBA 2G4CA 3MF1A 3OD1A 4XTUA 1H4VB 3UH0A 3VQVA 2XTIA 1X56A 3L4GB 4XU0A 4WI1A 3IKMB 4YRTA 3HY0A 2E41A 2NS6A 4OLFA 1YFTA 4P73A 2ZINA 4RMFA 2P0LA 5ELOA 2ZNJA 2AKWB 2ZZGA 3RKWA 3A7UA 3A5YA 1B7YB 2EJGA 2QHUA 4YROA 2DXTA 2ARUA 2J3LA 4YRNA 4XTWA 3RIRA 4L87A 1ADJA 4P72A 4DPGA 4YRPA 3HXZA 3NEMA 4XU1A 1FYFA 3UFGA 1Z7NA 2I4NA 5C52B 3KFUA 1EVKA 1EIYA 3HXUA 1X2HA 4H2SA 4Q15A 5K1XA 2E10A 4UP8A 2DXUA 3V8KA 4XU3A 1EOVA 4YCUA 3M4QA 3R07A 2ZIMA 4XTYA 2J3MA 4P71C 4H2TA 1BIBA 2ALYA 3A5ZA 2RHQB 4HWSA 3L1AA 4LVMA 4HWOA 3QO8A 1HC7A 2FYKA 3RF1A 4YRKA 3E9IA 4TVAB 4XEMA 1EFWA 2E3CA 1WQ7A 4RQEA 3P8YA 2QHTA 3BJUA 1SESA 4H2YA 2AMCA 4P75A 1H4TA 2EJFA 3PCOB 4LNSA 4P71A 3RGLA 2EJ9A 1L0WA 4CH5A 4YPFA 2EWNA 1E24A 4ZIBA 3W3SA 2Q7GA 3NENA 1VQZA 4KR2A 4CS3A 4CH3A 3BFMA 3LC0A 4HWRA 2XGTA 4YRFA 5KNNA 3HXYA 3TEHB 12ASA 1J5WA 4YP0A 4YREA 4XTVA 3WQZA 2E5AA 4NCXA 5E3IA 2E1HA 3EFRA 5K1PA 4HWPA 1SETA 3HXXA 3RUXA 1KMMA 1E22A 4BW9A 1N9WA 3CMQA 2ZZFA 2DQ0A 4TVWA 3RL6A 4LVIA 2DZCA 4G84A 4O2DA 1B8AA 1PYSB 4YDQA 3P8VA 3P8TA 4YCWA 4TWAA 1X2GA 2C7IA 3V8LA 2ALYB 3VBBA 3TUPA 2Q5IA 2Q7EA 1LYLA 2ZT7A 2Q5HA 4YRJA 1USYC 3HRKA 4P3NA 3REXA 3FJPA 4YRQA 3RKYA 3REUA 2DVEA 1ATIA 2IY5B 2E64A 3QO7A 5C51B 4X5OA 2ODRD 3UGTA 1WQWA 3VQXA 4CH4A 3PZCA 4H2VA 3L4GA 4TQFA 2A8EA 3MF2A 4EO4A 1EQRA 1X55A 4CH6A 2ZR2A 3A74A 2ZT8A 4K86A 4YRGA 2DTOA 2ZIOA 1BIAA 2Q7HA 4YRLA 4K87A 3LSSA 3E9HA 4P72C 4EX5A 3HXVA 1WU7A 4YRSA 1NJ2A 2ZT5A 5ELNA 2DTHA 3L2ZA 1YFRA 4H2WA 3A31A 4YRRA 3TEGA 4H2XA 5C53B 2EL9A 2ZR3A 2CJ9A 4XEOA 4CS2A 1B76A 1NJ5A 4WF2A 4RDXA 2ZNIA 2I4LA 3HFZB 2DU5A 1EIYB 4XU2A 3V7SA 2DJZA 1EVLA 1YFSA 4HWTA 1NJ6A 2P5IA 4AH6A 1H4QA 4DQ2A 1NJ8A 4Q6GA 3M4PA 5HGQA 3HTZA 4YYEA 1WPYA 2ARSA 1GGMA 2DDZA 2RHQA 4P74C 4P73C 1WLEA 2IY5A 4TQDA 3RKXA 1W66A 2DEQA 4E51A 2CJAA 4TVAA 1E1TA 2QHVA 3LSQA 2I4OA 2CIMA 4J15A 4RQFA 1QE0A 4HA8A 1B7YA 1YGBA 4KQEA 4UPAA 2RHSA 1G51A 2ZTGA 3A7RA 4P3OA 2ARTA 4P75C 4YRMA 3QO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVL A;  2NS6 A;  4HT4 A;  4LVM A;  4LVJ A;  4LVI A;  4LVK A; 
#chains in the Genus database with same CATH topology
 4PG3 A;  5F5W A;  3IG2 A;  3UGQ A;  2E65 A;  1B70 B;  3DSQ A;  4UP7 A;  4H2X B;  1G5H A;  3A32 A;  2DTI A;  2ZCE A;  1NYQ A;  1G5I A;  3HY1 A;  1X54 A;  4CS4 A;  1WNL A;  1BBU A;  1JJC A;  4BWA A;  4LVK A;  3A7A A;  1KMN A;  1HTT A;  1WYD A;  2DKG A;  3ICA A;  2ZT6 A;  2ZGW A;  3HFV A;  1Z7M A;  3HRI A;  3VQY A;  4PHC A;  3IKL A;  2AMC B;  2HNI A;  4HVC A;  4UP9 A;  2C8M A;  2I4M A;  1ADY A;  3PCO A;  3G1Z A;  4LVJ A;  4YRI A;  1C0A A;  3MQZ A;  3NET A;  4XTX A;  1NJ1 A;  3MEY A;  3V8J A;  2RHS B;  3HXW A;  3TEH A;  1ASY A;  3V7C A;  4LVL A;  4HT4 A;  4TVY A;  2PMF A;  3ERR A;  2ZXF A;  2AKW A;  3RAC A;  2QHS A;  2ODR C;  3IAL A;  4ZTU B;  2CGH A;  4WJ4 A;  1BBW A;  3I7F A;  11AS A;  4KR3 A;  2ZZE A;  4YRC A;  1HXD A;  1E1O A;  1B70 A;  4OP0 A;  2EAY A;  4H2U A;  1SRY A;  2DZ9 A;  2PME A;  4P3P A;  3VQW A;  1NYR A;  1QF6 A;  1NNH A;  1PYS A;  1SER A;  4ZTZ B;  3QTC A;  1JJC B;  4XTZ A;  3HFZ A;  3EFS A;  2DQ3 A;  1KOG A;  4WJ3 M;  4TTV A;  1X01 A;  4H02 A;  1YB3 A;  1ASZ A;  1USY A;  3V7R A;  3NEL A;  4K88 A;  3QNE A;  4P74 A;  1RIQ A;  1IL2 A;  4YCV A;  1H4S A;  4G85 A;  2DU7 A;  2CJB A;  2G4C A;  3MF1 A;  3OD1 A;  4XTU A;  1H4V B;  3UH0 A;  3VQV A;  2XTI A;  1X56 A;  3L4G B;  4XU0 A;  4WI1 A;  3IKM B;  4YRT A;  3HY0 A;  2E41 A;  2NS6 A;  4OLF A;  1YFT A;  4P73 A;  2ZIN A;  4RMF A;  2P0L A;  5ELO A;  2ZNJ A;  2AKW B;  2ZZG A;  3RKW A;  3A7U A;  3A5Y A;  1B7Y B;  2EJG A;  2QHU A;  4YRO A;  2DXT A;  2ARU A;  2J3L A;  4YRN A;  4XTW A;  3RIR A;  4L87 A;  1ADJ A;  4P72 A;  4DPG A;  4YRP A;  3HXZ A;  3NEM A;  4XU1 A;  1FYF A;  3UFG A;  1Z7N A;  2I4N A;  5C52 B;  3KFU A;  1EVK A;  1EIY A;  3HXU A;  1X2H A;  4H2S A;  4Q15 A;  5K1X A;  2E10 A;  4UP8 A;  2DXU A;  3V8K A;  4XU3 A;  1EOV A;  4YCU A;  3M4Q A;  3R07 A;  2ZIM A;  4XTY A;  2J3M A;  4P71 C;  4H2T A;  1BIB A;  2ALY A;  3A5Z A;  2RHQ B;  4HWS A;  3L1A A;  4LVM A;  4HWO A;  3QO8 A;  1HC7 A;  2FYK A;  3RF1 A;  4YRK A;  3E9I A;  4TVA B;  4XEM A;  1EFW A;  2E3C A;  1WQ7 A;  4RQE A;  3P8Y A;  2QHT A;  3BJU A;  1SES A;  4H2Y A;  2AMC A;  4P75 A;  1H4T A;  2EJF A;  3PCO B;  4LNS A;  4P71 A;  3RGL A;  2EJ9 A;  1L0W A;  4CH5 A;  4YPF A;  2EWN A;  1E24 A;  4ZIB A;  3W3S A;  2Q7G A;  3NEN A;  1VQZ A;  4KR2 A;  4CS3 A;  4CH3 A;  3BFM A;  3LC0 A;  4HWR A;  2XGT A;  4YRF A;  5KNN A;  3HXY A;  3TEH B;  12AS A;  1J5W A;  4YP0 A;  4YRE A;  4XTV A;  3WQZ A;  2E5A A;  4NCX A;  5E3I A;  2E1H A;  3EFR A;  5K1P A;  4HWP A;  1SET A;  3HXX A;  3RUX A;  1KMM A;  1E22 A;  4BW9 A;  1N9W A;  3CMQ A;  2ZZF A;  2DQ0 A;  4TVW A;  3RL6 A;  4LVI A;  2DZC A;  4G84 A;  4O2D A;  1B8A A;  1PYS B;  4YDQ A;  3P8V A;  3P8T A;  4YCW A;  4TWA A;  1X2G A;  2C7I A;  3V8L A;  2ALY B;  3VBB A;  3TUP A;  2Q5I A;  2Q7E A;  1LYL A;  2ZT7 A;  2Q5H A;  4YRJ A;  1USY C;  3HRK A;  4P3N A;  3REX A;  3FJP A;  4YRQ A;  3RKY A;  3REU A;  2DVE A;  1ATI A;  2IY5 B;  2E64 A;  3QO7 A;  5C51 B;  4X5O A;  2ODR D;  3UGT A;  1WQW A;  3VQX A;  4CH4 A;  3PZC A;  4H2V A;  3L4G A;  4TQF A;  2A8E A;  3MF2 A;  4EO4 A;  1EQR A;  1X55 A;  4CH6 A;  2ZR2 A;  3A74 A;  2ZT8 A;  4K86 A;  4YRG A;  2DTO A;  2ZIO A;  1BIA A;  2Q7H A;  4YRL A;  4K87 A;  3LSS A;  3E9H A;  4P72 C;  4EX5 A;  3HXV A;  1WU7 A;  4YRS A;  1NJ2 A;  2ZT5 A;  5ELN A;  2DTH A;  3L2Z A;  1YFR A;  4H2W A;  3A31 A;  4YRR A;  3TEG A;  4H2X A;  5C53 B;  2EL9 A;  2ZR3 A;  2CJ9 A;  4XEO A;  4CS2 A;  1B76 A;  1NJ5 A;  4WF2 A;  4RDX A;  2ZNI A;  2I4L A;  3HFZ B;  2DU5 A;  1EIY B;  4XU2 A;  3V7S A;  2DJZ A;  1EVL A;  1YFS A;  4HWT A;  1NJ6 A;  2P5I A;  4AH6 A;  1H4Q A;  4DQ2 A;  1NJ8 A;  4Q6G A;  3M4P A;  5HGQ A;  3HTZ A;  4YYE A;  1WPY A;  2ARS A;  1GGM A;  2DDZ A;  2RHQ A;  4P74 C;  4P73 C;  1WLE A;  2IY5 A;  4TQD A;  3RKX A;  1W66 A;  2DEQ A;  4E51 A;  2CJA A;  4TVA A;  1E1T A;  2QHV A;  3LSQ A;  2I4O A;  2CIM A;  4J15 A;  4RQF A;  1QE0 A;  4HA8 A;  1B7Y A;  1YGB A;  4KQE A;  4UPA A;  2RHS A;  1G51 A;  2ZTG A;  3A7R A;  4P3O A;  2ART A;  4P75 C;  4YRM A;  3QO5 A; 
#chains in the Genus database with same CATH homology
 4PG3 A;  5F5W A;  3IG2 A;  3UGQ A;  2E65 A;  1B70 B;  3DSQ A;  4UP7 A;  4H2X B;  1G5H A;  3A32 A;  2DTI A;  2ZCE A;  1NYQ A;  1G5I A;  3HY1 A;  1X54 A;  4CS4 A;  1WNL A;  1BBU A;  1JJC A;  4BWA A;  4LVK A;  3A7A A;  1KMN A;  1HTT A;  1WYD A;  2DKG A;  3ICA A;  2ZT6 A;  2ZGW A;  3HFV A;  1Z7M A;  3HRI A;  3VQY A;  4PHC A;  3IKL A;  2AMC B;  2HNI A;  4HVC A;  4UP9 A;  2C8M A;  2I4M A;  1ADY A;  3PCO A;  3G1Z A;  4LVJ A;  4YRI A;  1C0A A;  3MQZ A;  3NET A;  4XTX A;  1NJ1 A;  3MEY A;  3V8J A;  2RHS B;  3HXW A;  3TEH A;  1ASY A;  3V7C A;  4LVL A;  4HT4 A;  4TVY A;  2PMF A;  3ERR A;  2ZXF A;  2AKW A;  3RAC A;  2QHS A;  2ODR C;  3IAL A;  4ZTU B;  2CGH A;  4WJ4 A;  1BBW A;  3I7F A;  11AS A;  4KR3 A;  2ZZE A;  4YRC A;  1HXD A;  1E1O A;  1B70 A;  4OP0 A;  2EAY A;  4H2U A;  1SRY A;  2DZ9 A;  2PME A;  4P3P A;  3VQW A;  1NYR A;  1QF6 A;  1NNH A;  1PYS A;  1SER A;  4ZTZ B;  3QTC A;  1JJC B;  4XTZ A;  3HFZ A;  3EFS A;  2DQ3 A;  1KOG A;  4WJ3 M;  4TTV A;  1X01 A;  4H02 A;  1YB3 A;  1ASZ A;  1USY A;  3V7R A;  3NEL A;  4K88 A;  3QNE A;  4P74 A;  1RIQ A;  1IL2 A;  4YCV A;  1H4S A;  4G85 A;  2DU7 A;  2CJB A;  2G4C A;  3MF1 A;  3OD1 A;  4XTU A;  1H4V B;  3UH0 A;  3VQV A;  2XTI A;  1X56 A;  3L4G B;  4XU0 A;  4WI1 A;  3IKM B;  4YRT A;  3HY0 A;  2E41 A;  2NS6 A;  4OLF A;  1YFT A;  4P73 A;  2ZIN A;  4RMF A;  2P0L A;  5ELO A;  2ZNJ A;  2AKW B;  2ZZG A;  3RKW A;  3A7U A;  3A5Y A;  1B7Y B;  2EJG A;  2QHU A;  4YRO A;  2DXT A;  2ARU A;  2J3L A;  4YRN A;  4XTW A;  3RIR A;  4L87 A;  1ADJ A;  4P72 A;  4DPG A;  4YRP A;  3HXZ A;  3NEM A;  4XU1 A;  1FYF A;  3UFG A;  1Z7N A;  2I4N A;  5C52 B;  3KFU A;  1EVK A;  1EIY A;  3HXU A;  1X2H A;  4H2S A;  4Q15 A;  5K1X A;  2E10 A;  4UP8 A;  2DXU A;  3V8K A;  4XU3 A;  1EOV A;  4YCU A;  3M4Q A;  3R07 A;  2ZIM A;  4XTY A;  2J3M A;  4P71 C;  4H2T A;  1BIB A;  2ALY A;  3A5Z A;  2RHQ B;  4HWS A;  3L1A A;  4LVM A;  4HWO A;  3QO8 A;  1HC7 A;  2FYK A;  3RF1 A;  4YRK A;  3E9I A;  4TVA B;  4XEM A;  1EFW A;  2E3C A;  1WQ7 A;  4RQE A;  3P8Y A;  2QHT A;  3BJU A;  1SES A;  4H2Y A;  2AMC A;  4P75 A;  1H4T A;  2EJF A;  3PCO B;  4LNS A;  4P71 A;  3RGL A;  2EJ9 A;  1L0W A;  4CH5 A;  4YPF A;  2EWN A;  1E24 A;  4ZIB A;  3W3S A;  2Q7G A;  3NEN A;  1VQZ A;  4KR2 A;  4CS3 A;  4CH3 A;  3BFM A;  3LC0 A;  4HWR A;  2XGT A;  4YRF A;  5KNN A;  3HXY A;  3TEH B;  12AS A;  1J5W A;  4YP0 A;  4YRE A;  4XTV A;  3WQZ A;  2E5A A;  4NCX A;  5E3I A;  2E1H A;  3EFR A;  5K1P A;  4HWP A;  1SET A;  3HXX A;  3RUX A;  1KMM A;  1E22 A;  4BW9 A;  1N9W A;  3CMQ A;  2ZZF A;  2DQ0 A;  4TVW A;  3RL6 A;  4LVI A;  2DZC A;  4G84 A;  4O2D A;  1B8A A;  1PYS B;  4YDQ A;  3P8V A;  3P8T A;  4YCW A;  4TWA A;  1X2G A;  2C7I A;  3V8L A;  2ALY B;  3VBB A;  3TUP A;  2Q5I A;  2Q7E A;  1LYL A;  2ZT7 A;  2Q5H A;  4YRJ A;  1USY C;  3HRK A;  4P3N A;  3REX A;  3FJP A;  4YRQ A;  3RKY A;  3REU A;  2DVE A;  1ATI A;  2IY5 B;  2E64 A;  3QO7 A;  5C51 B;  4X5O A;  2ODR D;  3UGT A;  1WQW A;  3VQX A;  4CH4 A;  3PZC A;  4H2V A;  3L4G A;  4TQF A;  2A8E A;  3MF2 A;  4EO4 A;  1EQR A;  1X55 A;  4CH6 A;  2ZR2 A;  3A74 A;  2ZT8 A;  4K86 A;  4YRG A;  2DTO A;  2ZIO A;  1BIA A;  2Q7H A;  4YRL A;  4K87 A;  3LSS A;  3E9H A;  4P72 C;  4EX5 A;  3HXV A;  1WU7 A;  4YRS A;  1NJ2 A;  2ZT5 A;  5ELN A;  2DTH A;  3L2Z A;  1YFR A;  4H2W A;  3A31 A;  4YRR A;  3TEG A;  4H2X A;  5C53 B;  2EL9 A;  2ZR3 A;  2CJ9 A;  4XEO A;  4CS2 A;  1B76 A;  1NJ5 A;  4WF2 A;  4RDX A;  2ZNI A;  2I4L A;  3HFZ B;  2DU5 A;  1EIY B;  4XU2 A;  3V7S A;  2DJZ A;  1EVL A;  1YFS A;  4HWT A;  1NJ6 A;  2P5I A;  4AH6 A;  1H4Q A;  4DQ2 A;  1NJ8 A;  4Q6G A;  3M4P A;  5HGQ A;  3HTZ A;  4YYE A;  1WPY A;  2ARS A;  1GGM A;  2DDZ A;  2RHQ A;  4P74 C;  4P73 C;  1WLE A;  2IY5 A;  4TQD A;  3RKX A;  1W66 A;  2DEQ A;  4E51 A;  2CJA A;  4TVA A;  1E1T A;  2QHV A;  3LSQ A;  2I4O A;  2CIM A;  4J15 A;  4RQF A;  1QE0 A;  4HA8 A;  1B7Y A;  1YGB A;  4KQE A;  4UPA A;  2RHS A;  1G51 A;  2ZTG A;  3A7R A;  4P3O A;  2ART A;  4P75 C;  4YRM A;  3QO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...