4LVNB

Crystal structure of pfsub1-prodomain-nimp.m7 fab complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
212
structure length
207
Chain Sequence
DIVLTQSPATMSASLGQRVSMSCSASSSVSTSYFHWYQQKPGSSPKLWIYSTSNLASGVPGRFSGSGSGTSYSLSISSMEAEDAATYYCHQFHRSPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTRHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor/immune system
molecule keywords Subtilisin-like serine protease
publication title The malaria parasite egress protease SUB1 is a calcium-dependent redox switch subtilisin.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 43
structure length 207
sequence length 212
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lvnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lvnB01
1TZHA 4NO0B 4PJIA 2Q6WB 4YHZH 5GGSY 4OD3H 4GMTH 1DVFC 4YIQB 4P5KB 3BPOC 1LE9B 2YMXL 2FEEL 4WWKB 4DUXA 2OXGA 4BSWB 5GISH 2DDQH 2UY6A 4PTUB 4PGEB 4WWID 5B3JE 3ARFB 3CFIC 4HIEB 1HQ4B 3HZYA 3RU8H 4J7RA 1GPOL 4JN2B 2OTUB 2V2WB 2X70A 2AGJH 5CWSB 3MV9A 4C56A 5CGMA 2F53A 5HYSB 2CDEA 4KTYA 5JIPA 4DUWA 3DVNB 4NKIH 3ESUF 4YJZL 1UWGH 4J8RA 1XH3A 3B83A 3RGVC 3SCMC 4C54A 3G6DH 1BOYA 5DJ8A 3I50H 1S78D 5IF0A 1A7OH 4P2OD 1AH1A 4L29A 1JIBA 5C0BD 4JO2L 2IWGA 4FQXD 4H1LB 1V7NL 4KK8D 4TPRL 4LCWE 1R0AH 3GSUB 2RFXB 3JWDH 2Y5TB 3DGCR 4LCCA 5H8DA 2H26B 2D03L 3H8NA 3VGHA 3CH1B 4BH7B 4MNQD 4U6HA 1JVKA 3HG1E 43C9A 1SM3L 4HX1A 1S8DA 2FHBA 4WHTB 5D5MF 4ZS7L 1W72H 1ZANL 3W81A 2A6KA 4KUCD 3VXUE 3RZWA 3AGVA 3PF2A 2A83B 2YSSA 4PLJC 3MCKB 3WSQL 3TNNA 3U0TB 4POZC 2MFNA 5K9OA 4QOKB 4Y5YB 5JQHC 1AQDB 2AJSH 3JWDC 3LDBC 3ZDZE 4POYA 3MLUH 4RQQB 3E0GA 3MXVH 1T2XA 2X7LA 4AT6A 4XPGL 2GFBA 1KBGH 4ZUTB 5FDWA 2VE6A 4YNYA 5DK2B 3JTTA 1WBYA 4U6XB 2EEDA 4WU7A 1KXVC 1XGRB 5DMIL 4GBXC 2VXQH 1HINH 1JFQL 3S36H 1LD9B 3MV7D 2P48B 1J5OL 3IXTB 2R15A 1CDIA 5IMOA 4PRDB 1N8ZB 2O26U 3O3BA 3UBXG 4ORGA 3M1BB 5C07B 5HHOE 4DKAA 5C09B 4N5UA 1Q9KB 1WFOA 3QUZC 3LKPB 1A1MB 4Y2DD 3MFGB 3ZTJG 5ID1A 3GUTA 1NCDH 2OR9L 4KK5D 3VE0A 1J0ZA 4OCWH 4JRYB 1T1ZB 4KJYA 2VISB 1U92B 5HGHB 2XWBB 5C0RH 3O4OC 3X3GH 1NC4B 3VXRB 5C0CE 3SDYL 4WI2A 5GS0D 2BCKA 4QRRB 5FUZL 1DEDA 5F9DC 2CXGA 3SOBH 4OZGE 1Q0YH 4NQDA 1EH9A 4R97C 2B39A 1QO3B 3GMOB 1FFOA 1FZMA 4X0KA 1QEWA 2OQJB 5C0GA 2V2TB 1L7IL 5L6YL 1ZXQA 2AI0L 4P5TD 5FYJE 4U4BA 5C7XH 3KPSB 1DVFB 4X6BB 1FZKB 1EBPA 3BPOB 1BZ9A 4BSVB 5TE4L 2XG4A 3RVTC 1INQA 2NLJA 2V7NB 3RWHB 4BFBD 3FAXA 2LABA 3CCHB 4Z0XB 4ZODA 4L3EB 5DLML 5FHAL 3BHBA 4X8XA 7FABL 4DVRL 2Q87A 1K8IB 4M48L 2Q8BL 4M1GH 1FN4A 4PRAA 4X7TB 5SWZA 4BA8A 4MQ7B 2X1OA 4OF5A 3SDDA 1AXSA 4F58L 3GIZH 4N0CD 4PGBA 4AL8H 1OCWH 4JZJC 1A4KA 4AENA 4P4KC 4OB5L 5CEYA 1MFDL 1G7JA 2A9NH 3KXFB 4Q6IC 1NLBH 4LFHG 1AQKH 4D8PB 4AG4L 5I1IH 3RGVB 5J4MA 4PJ7A 2B1HL 1X3DA 3SCMB 4P23D 5A1AA 5KJRL 3PP3K 4JHBA 3T8XB 1DN2A 3ARGB 5ETUA 3ULUF 4S1QH 4UIKH 2IQAB 1MEXH 4JVUA 5CMAB 3EYFB 1AXIB 3HMXH 3L3DB 3D0LB 3QEHB 4WFHE 5LQBL 2FH6A 3A6OA 3N1MC 4UT7L 3TNMA 5ID0B 2XYCA 4NQVA 3V6OE 1EO8L 5EC1A 2MTPA 1IEAB 2K7QA 2VKWA 2PR4L 4NUGH 1I9RL 4EOWH 2MOVA 3RWFA 1QBLL 3FQXB 3FT2A 3FN9A 3T2OA 3UX9B 1RUQL 2F58H 1VA9A 1CWVA 5IB4B 3SN6N 3WFEL 5C86A 3DRTB 3OV6A 1R3JB 1KXTB 1ORQA 4CKVX 5KVGH 2HFFA 4ZFFA 3QZWG 5BRZA 4LLQA 1X5YA 4MDJB 4WI3A 2AQ2A 1J9CT 4DAGH 4OZ4A 2HRPL 3T4AA 2ZPKL 3IAPA 1WVZA 2YN5A 4JRXD 5DRXB 3KJ4B 1U3JA 3RWGB 1R3HB 3QXDA 2GJ6A 3C5JB 4WUUD 1UWXK 2YUWA 1RUKH 1EJOL 4BUHA 1LEIB 4OT1H 1W72B 2FIKA 1FIGL 3AMLA 2DYPA 4L8DA 2PXYD 1G7IB 2EXYC 2UUDH 4RDQF 4GBXB 3UTOA 4Y2OA 3WIHL 3OR6B 1JL8A 1DSFH 2FNBA 4X9FA 3MRLB 1XGYL 3MRPA 1UQSB 5ISZD 1IMHC 2QBWA 3G5VA 1FFNA 3ZSSA 1T7ZA 4BZ1L 3QUZB 1DE4B 1DLFH 4P49A 4GRLA 1GOGA 1JI1A 4NFCA 1X5IA 3Q1SH 1F4XL 3D18B 3CXDL 6FABH 1CK0H 2P44B 4JR9L 3MGOA 5ICZA 2WAHA 1CXIA 4HG4K 5DSCB 4HJGA 4XVSH 2LQRA 1H8NA 3FO9A 1JPSH 3GMQB 1KCUH 1QZ1A 5DJZA 4MQXC 1DBBH 1DQDL 4OUOA 1PKQB 2VC2L 1LO2L 3S37X 5LKNA 5EORL 5F9AC 4KK9C 3LN5A 3RNQA 4KQ4H 2FZ3B 5FM8A 3MLRL 1MOEA 4NKQB 4R97B 1ZHNA 2BK8A 5LXGL 5EA0H 1YN7A 5H2BB 3TZVB 3S35L 1EHXA 3S4SA 3K4DA 3GBMH 4OLYH 5KANG 4MA7H 3P30L 4RMQA 3MNZA 4OM0L 4JDZA 2FLRT 4H0GA 2E7LC 1SEBB 4UDUA 5DR5L 3RDTA 1CE6A 1OAUL 1TITA 3SGKA 3F7VB 4YFEA 5C0EA 1F6AB 4TUJA 2APVA 4Z95H 4D0CB 2X44D 4LEOA 1HNFA 5FO7B 1MAMH 4Z7VF 1H5BC 3JV4B 1NCTA 5DJYA 3O4LD 1J0YA 5F7EH 1C5CL 1OD9A 1J8HB 2CO7B 2OZ4L 5CILH 5CD3A 5KSBF 2H1PL 4JZJB 1Z9SA 2NQCA 2HA1A 2IANA 2ICEA 2Q3AA 4P4KB 5BZDB 1S7WA 2LU3A 3CFEA 3D69B 1KGCD 2O5ZL 3VJ6B 4CU7A 1GYAA 4FZEL 3GMPA 2GY5A 5GS0L 3FOLA 3MSPA 2Z8RA 1GGCL 4EDXB 3U0WH 1QLEH 3ROOA 4JPKL 5E24E 43CAA 1JV5A 3QIWC 1Z3GL 1QSFD 3TO4C 3KPRB 4X7SL 2HVJA 4I18A 3QWRD 5E7FA 1A6WH 4YZFF 1UB6A 1VSCA 1GC1L 3TPKA 3TLRA 3O6LH 4Y1AE 4QHKJ 4JRWA 3VXMA 1CFVL 1I3RA 1LILA 1FFRA 4QXUH 5EPMA 3IDNA 2NTSP 1FYHB 4FABL 4PY8J 5A40E 4HF5L 5JDJA 2EIBA 4N0UB 3GI9H 3FO2A 5KG9B 3QQ4A 2P1YA 3RVVC 3QI9C 4NOBA 4LHJB 2GSIA 4PJ5E 5CFHA 3G5ZA 3MRKB 4PRIE 3LMJH 4JFZL 4PP1C 3BWUC 1NMBL 1YEFH 3CVHA 5IIEA 1TENA 4M00A 5E4IA 3GMLB 4L3CB 1ADQH 1T4KB 4JZOA 4TNWF 5FO8B 3PWPB 1KPVA 3U9PL 1ZLWH 1HQRA 1LO3H 4DN4H 4HLZG 3CFJA 5DRWA 4MXVE 1RAMA 5EU4A 5LG1A 3HZVB 5HYJD 1IT9H 2J6EH 5HVHC 3V4VL 3LB6D 5DJDA 1IL1A 4NUJB 2YUXA 5JW5A 5LBSL 3BIAX 5B4MC 5ESVB 3U2SB 5FA3A 3QEQE 1QD0A 3FRUB 2VZOA 3QPQC 4JANB 1U8JA 4Q7DA 5JOPD 3ALWA 5C0NC 1J18A 3C6SA 2VIRB 5GZNC 1JYWA 2CXKA 3T08A 2ZUTA 1TETH 1Q9OA 5I8CB 3T0WA 4AK1A 3FCTB 5BS0B 4L1HA 1LDSA 5KSBA 4GH7B 1Q72L 1NBYB 3BKJH 1CT8B 5F3HA 2WIIB 3VRIB 4WFGD 4CMHC 5T5NG 1J0IA 1FPTH 3R0NA 4M6NL 2VXSL 3MUJA 4ELMB 4ZYKB 5LGHL 1YEHH 4ENED 4IHOA 4O4YH 2Y72A 5CKGA 4FFYL 5E0QA 5HHPB 3DWTA 5IW1A 1YNLL 1S7RB 2W65A 5GRVL 5J1AA 5I1HL 3VU2A 1IZJA 4BELD 3MLYL 1SEQH 3ELAT 3VG9C 3F6IA 5AAMA 4OQTL 4HJJH 9CGTA 4QHLB 3WFBL 1EHLH 5F7YC 4YLQT 1RVFL 1KYOK 3EYUL 1H3VA 2EDXA 1INEL 3OB8A 2NY1D 2E27H 3ARPA 3WJLC 5JW4R 3MUY1 3ZE0E 1OF2A 4HS6B 4M02A 5I1CH 3G6AA 3U4AA 3BRDA 5FFLA 4LRIA 4P5MB 3KPOA 4N1CA 4QLRA 2OYPA 4CNIA 1H5BB 2FX8L 1W0YT 4G5ZH 4R7DB 2QR0A 4L5FH 1G9NL 3ARYA 3L3JB 5TQ0L 1UXSB 2WSKA 3DI3B 4OD2A 4HHAA 5C0IB 5DQ9A 4ERSH 1EGJA 2CLZA 2DJ4A 5IJKA 1F13A 1OPGH 4LOUC 5DHYA 1I9JL 2DLFL 1RUPH 4LPUA 1LE5A 1AD9B 2DBJA 3B8YA 5L0QC 1W0WA 4WO4D 2A1WL 5J06A 1C5DB 1IGYB 4UINL 2GK2A 3IU3A 4KUZH 5LGJA 1H15A 4MJ4A 5BW7A 2FECL 2NXZC 4OI7A 5FUCE 3QIWB 1F6FB 1OT2A 4DUVA 4XPBL 4G8FB 2MHAB 3TO4B 2YPLB 4U0RC 4G6MH 4X4XB 2GYSA 2NNAA 1DQML 4GXUM 5E1AB 3QUML 1HHKA 1YQVH 4IRZL 1A5FH 3NN8B 4FQQA 5K9KA 5DQJA 5ESAB 3T1FA 5MI0C 3KLAA 4LVOC 1FGVL 3CZFA 1EPFA 2R39A 4ONFH 1FVCB 2V9RA 3MOBH 4YX2L 3BRGC 1Q8MA 1A3QA 1FC2D 3CVIL 4PJGF 3KS0J 2XA8H 2OK0H 1P4IH 2BSSB 1JHTB 1T1WB 3MCLH 4X4MA 3S36X 1DBJL 5TF0A 1FLRL 5F89A 4JM4L 5IQ7L 2X4SA 4CJ0A 1T1XA 4P3DA 3BKMH 3VDCA 1S9WA 1UXWA 2VLLA 3ZKNC 4RRPA 5CP7A 3HS0B 1IILE 3IETA 3GK8H 4XC3L 5FV1L 2ARJQ 4NC1C 1TJGH 5FYLH 4XMPL 3HN3A 1JMZA 3VD4A 5I17A 5DD3H 4D0BA 1TTGA 1MHPH 3TBVB 2NYYD 1NMAL 4U1IB 3VXSB 4CDGC 1F2QA 3EFFB 1FV1A 2LFGA 3H3BC 5HVHB 5BJTB 1YEJL 3RWEB 5IGXH 4UV7H 1JPST 5DEGA 5GJSH 2ICWB 2OP4L 2ZP0T 4LCCC 3ZE2E 2W0LA 1CF8H 3EYQC 4HKJB 4UT6H 4FZ8H 4X9BA 4K3DL 4FTVB 5CZVH 4I1NB 5KVFL 2R2HA 3UTTB 1A8JH 2P8MB 1ZV5A 2C3VB 4RSVA 1OAQL 4PRNA 1SBSH 3TJHD 5D70L 3KYKL 4LLUA 3ZO0A 4ODSH 1HI6A 3HUJF 2JIXA 3BMVA 2UZXB 5KN5B 3QZWB 5FEBA 1FJ1B 3WE6B 1SMOA 4KI5E 4NM8H 1DQJA 3HLAB 3D25B 4HIJA 3WLBB 4HBCH 2YD7A 3PV6B 4NO0D 3KPNA 4YGVA 5E08L 1X5JA 2I9LA 4JG1H 1UT9A 4OZIE 3OPZH 4WWKD 5FB8B 2YKLH 3CMOH 4U6YB 2DTMH 5D7LE 3LEYL 3OJDA 1K8DA 3ARFD 2XZZA 3GJFB 4XHJC 2QHRH 3O8XA 1T03L 3RWJA 1HILB 3VG9B 5C6TL 3VGEA 4HV8A 2DTSA 2BNQE 2ZUWA 4MAYA 3L6FA 5GGTA 4LAJH 4XP5L 4Z7QE 1KLFA 3JTSA 4EEEA 5E2TH 4PJGA 3CIQA 3HC3L 4DGVH 4TUKL 3QFDB 4Z18A 4ZD3H 3GKWL 5CINH 4I0KA 4P0DA 2CK0H 3L1OH 3GIVB 2N1KA 2JJUA 2C26A 4JGJA 4XBGB 3VDAA 3A6CH 4X98B 4WI7A 5AG8A 1EEZB 1FFPB 2BFVL 4JZNB 3SE9L 5DS8A 1S7VA 4F33B 4NSKB 1NDMA 1RMFH 4EI5B 1BWMA 2NY2D 4FQJL 1KB5L 1MLCA 5DD5L 5E8NB 5IVXF 2YZ8A 2LU7A 1D9KA 4YFLF 2CKNA 4GAGH 2ZOLA 4FQ2H 3G08A 4I0PA 2HT4C 3OXRB 5L0QB 4XPHH 1D5MA 1U8PB 1MLBA 1HSBB 4HPOH 1C08A 1A1OB 5ALCL 3LQAH 3OF6A 4FQ1L 2VN7A 3L5XL 4E5XA 2NXZB 4KHTL 4O58L 4L8BB 3T09A 5ILTH 1ROWA 2YOCA 1ZGLP 4PRPA 1TZHB 3BW9A 4PJIB 3DO3A 3THMH 1CR9L 4AEEA 1D6VL 5BVJA 5MI0B 5L2KA 4LVOB 4QOKD 2JCCE 3DURA 2P5WB 2CKBL 4DFIA 4I3SH 2KKQA 4F7EB 2OMBA 3HZYB 3KPTA 5DJCA 5I1AA 1IGCL 3LQAC 2WBJA 1VDGA 4NWTH 1WTGT 2AJ3A 2AW2A 3MV9B 4C56B 3SDDC 5D2LB 1K6QL 2F53B 5GGUA 1BJ1H 2CDEB 2GITB 5FK9A 4X9GA 1LQSR 4LLMA 4WY7H 3UBXA 2FGWL 2HRLA 1NGZA 2F54E 3LHPL 1A7PH 2XICA 2I5YL 4ODXB 4QRSA 3SE3A 4J8RB 2AJUL 1XH3B 1CLZL 2R56L 2FL5A 5C07D 5CEXA 4HBQA 2DLTA 3FB6A 3T0VA 3EJYD 4HKXB 4L29B 4LCWA 2J88L 4KROD 2D4FA 1T7XA 3NZ8A 4Y8AA 3LKNA 4RGNC 4OLUL 3OAUH 5JHDB 4N8VA 5A16A 4JRYD 3HG1A 4DKFL 3NACH 2F5AL 4OTXL 1CLCA 1IE5A 1S7TA 3O0RH 5EZIH 2DQGH 4LBEB 4XZUB 1NC4D 3VXRD 3VXUA 3DETD 43C9B 3LQZA 4HX1B 1Z0MA 1S8DB 4HEME 1F4YL 1HKFA 4AJ0A 4H25A 4QRRD 3HE6B 3PP4H 1EEYA 5FOJA 5IFAL 4LEXH 1H3PL 1AR2A 2FGZA 3TNNB 4JFDE 4UQ3A 4MB4A 3DPBA 2BVTA 3CFCH 5K9OB 4LLVA 1MQ8A 3FQTB 3QO1B 5IB2A 3K80A 3TCLA 4YXHH 5J57B 1Q0XH 4MVBC 4MD0A 4X6CB 5DC9B 5ACLA 3OKLA 3KPSD 1DVFD 5IT2L 1OLLA 4ODHL 5EZLB 2X7LB 4AT6B 5KBNC 1SJHB 1DQLL 4YNYB 5BO1H 4L3ED 2FJHA 5GGRA 3JTTB 4XHQA 1MY5A 3FB5A 2ILLA 2YPVH 3ARUA 3KNBA 3VXPB 4XCCL 3MRGA 3CX5K 4R90H 3W5MA 4TOYL 4Z9KB 2YS4A 3VFVB 3UJJH 4PUBH 3UYRH 3O3BB 1MRDL 4AEHH 1P1ZB 4ORGB 1WFTA 4WFED 4NNPH 2BERA 2DQJL 4OLEA 1KXQE 3ULUH 3KXFD 5F93C 4HWBL 5HDLA 4LGPB 4GRLC 3RGVD 2CO6B 2CUIA 1A0QH 3SCMD 1J1PL 4KY1H 5ID1B 3VWJA 3BH9A 1JGDB 2WINB 3ARGD 3GUTB 2AVGA 2R4SL 3VE0B 4K3GA 2YEZA 4KJYB 1EZVY 2P8LA 4KVNH 4HUXA 3MRHA 2CLRB 2X4NB 3KPMA 5DD1H 2HYMA 2NY6B 1MHCA 1FYTE 1MI5E 1BVLA 2RIKA 1GIGL 5H35A 2BCKB 1TVBA 2C3XA 3ULUC 2EE3A 5F1NB 2GT9B 5B39G 4L9LA 3CFKB 1YMMB 2PO6A 4LSPH 3AC0A 1FZMB 4X0KB 3OG6B 4DN3H 1QEWB 5C2BL 4PLJD 3P40A 4OGXL 4POZD 4OKVB 1XIWA 2EYTA 3RDTC 3DSFH 3V6FB 2HTKC 2BHZA 1BEYH 3H3KA 1JGLL 2R2BB 5D5MB 3SGKC 3MOQA 1INQB 2NLJB 4GFTB 8CGTA 1DQQB 4HKBB 1P5VA 5E56A 3BHBB 4F9LA 1S9XA 2J8OA 4Y4KA 3TV3L 4ALAL 1AO7B 4S0TD 4CMMA 1FN4B 4PRAB 1YY8A 1RFDL 4LL9A 4RIRA 3P9LB 4ODTL 1U6AL 1AXSB 3HI6H 4QGTA 3SDDB 3Q3GA 5FGSA 4PGBB 2D7TH 1J87A 2D3VA 1A4KB 4AENB 4CVUA 4GBXD 4LSTL 5CEYB 5GRJL 1A7NL 1MFAH 3RTQB 3MRMA 3LKSB 3QULB 3CSYA 2DM3A 3S3SA 3X11B 1PQZB 2M1KA 3QUZD 1R5VB 1PVHA 1ODAA 5AZEL 1XCTA 5C2UB 2QSCH 3VI3F 5ETUB 3FO1A 1ZT7A 4MZ2A 4OCYL 1VKXA 1QYGH 4JJHA 5EO0A 4NOFA 4RGNB 2GCYA 5EU5A 3TNMB 2AABL 3T1WA 4I18C 3UO1L 1JPTH 3VGFA 3CVHH 5F88B 4HGWA 1KSRA 3AUVA 5HHMB 3ILPA 3CMGA 5BOPA 4Q9BA 4ZDHA 5HI4C 1RURH 3F7QA 3RWFB 4O2FB 4MDIB 4NBXB 4OFIA 3HE7A 2EKSA 2VL5B 1OW0A 3V8CA 1ORQB 3IJYA 3TZVD 3W2DH 5BQ7A 1BOGA 3ETBF 5BRZB 1C1EL 3GNMH 2Y06H 4LLQB 4TSBL 2H3NA 1NBVL 1ZLUH 3LH2H 3UZVB 1NGXA 4JO3H 4OZ4B 4ZSOA 3EO9H 4P3CL 1I9EA 2VAJA 5IVZA 3MC0A 3QXDB 1SBBA 2V6HA 3RVTD 2JJTA 1MHHA 2Z93A 3S5LA 1X5HA 4Y5XA 1I8MA 1OGAB 3HI5L 4PJ8A 2QTEA 2G75A 2DYPB 4L8DB 4RNRA 4K23L 3KJ6L 3FONA 3B2UC 1J8HD 2CRMA 2XI9A 4NBYB 1DLHB 2HFGL 5CHNA 3MRPB 4P4RB 3MBEA 4JHAL 1XT5A 3FFDA 4P4KD 3D87B 1U8MA 3QEGH 1FFNB 3ULVE 1P5UA 3MBXH 1GVIA 5I1JH 4IDLA 1FCGA 2IGFH 4GRLB 2JB5H 3BP4A 3QFJA 4FQLL 1PY9A 3D6GA 1U8NB 1F3RB 3MJ9A 4ZUSA 4HWZA 1CICA 5ICZB 1IEBB 2GK0A 3QXAA 1YY9D 2AJYH 5CBAA 5KSAA 5CZXC 1H3TA 4HJGB 1QNZL 3KPRD 1KJVB 3I3DA 5C0FA 3FO9B 2VWEE 3U4BH 5DJZB 2VXUH 3T3PE 3ABZA 4NRZA 3QWQB 2OL3A 1T0PB 1ZK9A 2AEPH 5HI3C 1RV6X 4K3EL 3LN5B 3QA3B 1HZHL 3RNQB 3UJTL 4YUEL 1S7SA 4GXVH 1ZHNB 4OGZA 2W92A 1AGDB 1YN7B 4N5ED 3WFDL 4CVZB 1EGJH 3PHSA 5KVEL 1J11A 4UT9L 1CGWA 4JDZB 2AJVL 4Z8FH 1GGBH 2A6IA 4YHMH 1N6UA 2DI7A 1K4DA 4YHZL 4OD3L 1B88A 3I02A 5C0EB 2PYEA 3QAZC 4PREA 4TUJB 1ES0B 4LEOB 5GISL 3LKQA 4LRIC 4YHPB 2NW3B 3FN3A 4RISH 3RU8L 5CD3B 1IM9A 2AGJL 3IAQA 2EXYD 2ICEB 5I0ZA 1K4CA 1S7WB 2E9BA 3CFEB 5KS9E 5IJKC 5A2JH 3QDJE 5GZOC 5HDOA 3T0XA 1I7TA 1I8IA 3GMPB 1KV3A 1WBZA 1BIHA 4MQTB 3FOLB 5DD0H 3QO0A 5FM5O 5C0AD 2ATKA 4NKIL 4TVPH 1BM3H 1UWGL 3VRJA 1P69B 3CC5A 4X5WA 3ROOB 1IEHA 3REVB 3AXLA 2VITA 3G6DL 43CAB 3I50L 4NQTA 1JV5B 1A7OL 1EUTA 4LMQI 5BS0D 4PLKD 5K9JH 4YPGA 2IADA 2HWZH 2CLVA 4Y1AA 3FQRB 2K1MA 1UM5H 2HVJB 4I18B 3FFCA 3IKCB 5EU7C 1I1RA 4Z78A 1R0AL 3VWKA 4U2YA 5GRZA 3JWDL 3E2HC 1DJSA 1A9EA 3LS4L 3WXVH 3VXMB 4M62H 1B0GA 1R5WB 3H42H 4MQXD 2ZCKH 2VR4A 5EPMB 1T6VN 1R3LA 3HC4H 5D7JA 4ZFOB 2DWEA 3NFPA 1A6UH 1W72L 4OCXH 4PRIA 4MQSB 2HJFA 1HHGA 5ALBH 3QQ9C 3QQ4B 4QXTB 4HDIA 4BK4A 2C1OB 4YQXL 2WK2A 1KUMA 1IQDA 3DXAA 3G5ZB 2ITDB 4FFVC 4LPVA 2DQUH 2Q8AH 1DBKL 2V9QA 3AS0A 1P4LA 4KXZI 3CVHB 1ZS8A 4HFWA 3L3IA 4X6DE 3SDXF 2AJSL 4RZCB 3K2UH 4JZOB 1KPVB 2VDQH 1HQRB 3MLUL 3NH7H 4FXGB 2APFA 3MXVL 5DRWB 1HEZA 4RGMC 4M5YH 2IBGA 1KBGL 1MCOL 4JKWA 2J3SA 3GI8L 5EO9B 4YR6B 4OGAC 1HHJB 5DJDB 1IM3A 2QQNH 1YEEH 4ODVH 2VLKA 1XGQA 4M7KH 2VXQL 1F3DH 1CGSH 1XCQA 5FA3B 2HTLC 2QJDA 3SKOA 1U8JB 3MV8E 5FGRA 1I1YA 1UEMA 2G5RA 4AZ8A 3C6SB 4Z7VB 3EDFA 1Q9OB 1KTLA 2R0LH 2DMKA 5KSBB 3UBXI 4OQ1A 3IFPA 3P0VH 5F3HB 4XT1C 3QIWD 5HTSA 3VFSA 1CZ8H 1NCDL 2VDMH 3TO4D 2YPLD 2EO9A 3RIFK 3EZ8A 4OCWL 4CW1B 5T3ZD 4N8PA 3A67H 1URLA 3DTXA 3HAEA 4G42A 4V1DE 4XNMA 2ZWLT 3WD5H 3X3GL 2W65B 3BN3B 5GJTL 3WIIH 5CD5C 4X6FA 5DI8B 1JK8B 2GJZB 3RL2B 1FZJA 3HNTH 4WI6A 4APQA 1HIMH 2XFXA 1A6AA 3ZZ1A 3O8XC 1GZQA 4PJHF 1BZ7A 3C5SB 1DBML 1KELL 3TO2B 3VGGA 4G9DA 4MAYC 3RVVD 3QI9D 3VFOA 1QRNA 3MUGA 2JB6A 1I3UA 4PP1D 1WZMA 5C3LD 2ORBH 5C7XL 5E2VH 1OF2B 5AAWA 3QAZB 1KJ3H 1TQBB 1CD1B 4KXZH 4IM8A 3G6AB 5EUOE 4CNIB 1KPUA 4LSSH 3V52H 2HVKA 1EX0A 2CIIA 2QR0B 1HOCB 1IC4H 3IJHA 1N6QL 1UWEH 3T0AA 2IBBA 1HHIA 3VXSD 4M1GL 3ZMRA 5IJVB 2BOBA 4HHAB 4MMXC 5DQ9B 4ZTPH 2A73B 2CLZB 3GIZL 2AEQH 3ZT6A 5MHSD 1OCWL 5DHYB 5B4MD 1P6AB 5CBEA 3VMOA 2NPLX 4I9WD 4I0PC 4FTVD 3QPQD 3VD5A 2A9NL 1AQKL 5C0ND 4QO1A 3ROLA 3UTTD 4PBWD 3IU3B 5LGJB 4U1GC 5GZND 1H15B 3DROA 5KW9H 2BNUB 2IPTH 3QH3A 1KULA 3G5YA 4S1QL 4L9DA 1MQKH 2ZSWA 1HSAB 1MEXL 1H3GA 3A6BH 4MWFA 3U79A 1HCVA 2RAMA 1HHKB 4WDIB 4Y4FA 5F71A 1NSNH 2XN9A 5K9KB 5E9DE 3KLAB 3E2HB 2IPKA 3WO3B 3CZFB 4UDTA 3W9DA 2H32A 1B4RA 3K7UA 4NQXA 5F44A 2UVFA 3ZTJH 2BJMH 5FYKH 4AQOA 1IJ9A 4NUGL 2BVOA 4EOWL 4XP4H 1GH7A 5FUOH 2WBJC 1TLKA 1M6OA 1JZ8A 4F3FA 2F58L 3PWNA 4LRNH 5F89B 4D3CH 2EDQA 4MS8C 2X4SB 3QDAA 4P3DB 3LKOB 1T7WA 1U58A 2PTTA 1S9WB 1UXWB 2VLLB 4QRTA 5CP7B 4LF3B 3D3VE 1FBIH 1YC7A 3FO0H 3KG5A 5I17B 2Y1VA 3U30C 4D0BB 2IJ0C 3BGMB 5E6YA 5IK3A 1KTKE 1JHKL 1KCLA 4PJHA 5GSVB 2HKHH 4DK6A 1CGTA 3U9UA 4OT1L 1JN6A 1RHHA 2FYYA 1VEMA 3VFNA 3IF1A 4NM4L 1CU4H 1UM4L 3DUHA 1DSFL 5JIHA 5HGDA 1QVOA 4KGJA 5IOPA 1L0XA 1DTUA 4LOUD 4KDTA 3V95A 2JE8A 4WUKH 2WW8A 1ZEAH 4WTXA 2VN4A 4LLUB 5A2KH 1A3RH 1HI6B 3NAAH 3Q1SL 2WUCH 3LCYA 4GW5A 5E5MA 2NXZD 4MAUL 2VDKH 2C7UB 3VXTA 1CK0L 1DQJB 4HIJB 3R06A 2YK1H 4GXUN 1HH6A 3KPNB 4YGVB 4XVSL 3RX5A 2G5BA 4GS7B 1JPSL 2I9LB 1KCUL 4NT6A 4PJCE 5C9JB 3HB3C 2P5WD 4XNXH 1IGFH 1CFNB 5DC4B 4CDHA 2XNAA 5AWNH 2BNQA 4W6WB 4PG2A 1YN6A 4KQ4L 1JF1B 4ODWB 4XCEA 3RWJB 4HV8B 1BFVH 3MV9D 4M8QB 4C56D 3GBML 3L6FB 2ESVB 2F53D 4OLYL 2XQBH 1OT1A 4MA7L 3ZT5A 5JPNA 3JTSB 1NL0H 5DFTA 1RIVH 1VGKB 5E7BA 5C71A 5FKAA 4PJGB 2ZUYA 3F6LA 5E94A 3UPCA 3ZKND 4UOW1 5I30H 4M7LH 2V5YA 2AV1A 4JCMA 1QLRA 4QHUB 1MAML 5C0BE 2FCBA 2ZUQC 4HAFA 5DS8B 2YC1A 5F7EL 1NDMB 5HXMA 3PL6A 4B7IA 3DARA 5CILL 1MLCB 1IC1A 3GSRB 5T3ZL 3L3GA 4JKMA 5JHDD 3DV4A 3EYQD 2ZOLB 3G08B 1ZLVK 1UENA 1MLBB 1NGQH 4MNQE 4U1GB 4WIQA 2OM5A 5A2FA 2E3VA 2PW1A 5EG6C 4L9LC 5FYLD 3MNWB 3U0WL 2PO6C 3GBLA 1QLEL 1KIRA 3ZDXE 3OKOA 4PRPB 4YHIB 1BFTA 5B38A 2JCCA 3FZUC 4U1NB 5IR1B 1XIWC 3MOAH 1M7DB 5I1GH 5BVJB 1YJDH 1TTFA 1A6WL 5L2KB 2GQHA 1V3LA 3O6LL 1KIUA 5CUSH 4RWHA 5EC2A 5TPWH 4F37K 3HUJB 4OUUA 4F9LC 1EMTH 4Y4KC 5I1AB 5EBLB 2WBJB 1BLNA 4NO2A 2AJ3B 2BHYA 3IDJB 4XHJD 4CN4A 2F54A 3O6FC 2V2XA 3GI9L 5HDBF 5FK9B 5DJ0A 3MO1A 4LLMB 3BPLC 2X9YA 3ARQA 1NGZB 3BEVB 3MV7E 1IKFH 1ED3A 2R2EA 4ZUVB 1AR1C 2ZUUA 3LMJL 1BIIA 4LPWA 2EE6A 4PJAF 3MACH 1YJDC 2FL5B 1YEFL 3BVNA 1WLHA 4YHKH 3PGCA 3GSQA 4PPTA 3DUSA 4TRPH 5CEXB 3TESA 3U30B 2I27N 3FB6B 5EN2A 1ZWIA 3C2AH 1ADQL 1AGFB 2EIDA 3SKNA 3SGDI 4HPYL 4RCAA 1LO3L 1R6VA 4DN4L 3WNNA 4E41A 3NZ8B 3LKNB 1HWGB 4DVBB 1XGTA 4C55A 1IT9L 2J6EL 3MLPA 4N8VB 4XCYB 3I2CL 4NRYB 1RK0A 1S3KH 1S7TB 2NY6D 3LQZB 3PNWA 4PP2A 2XRAH 5B39A 5HD8C 4WGWB 4EIZC 4H25B 3HE7C 3S7GA 1TETL 1OW0C 3Q2CA 2L7JA 1YMMD 2JTDA 5IVXB 2A6JA 4L4VB 1JI2A 3BKJL 5DTFA 1QFPA 2OR8A 4LLVB 4WTZA 2WWMC 1IBGH 4LSUH 3TCLB 5IB2B 1QUNA 3GSVB 1FPTL 4MD0B 3OKLB 2ZOKB 3EO0A 1QBAA 2NY7H 3RP1A 1U93A 1YEHL 1PAMA 2JJTC 2DQDL 3MJ9H 4JFQA 4MLSA 2J1KA 5HHQA 4NKOA 2DLIA 2W0PA 3FB7B 2EICA 2FJHB 5E8DH 5GGRB 3EO1A 4PJ8C 2VOTA 2EDYA 3FB5B 3CXHJ 3QCTH 1TJHH 3CNKA 3KNBB 4WHDA 3STLA 4MNHA 1R3IL 3MRGB 4J3WA 4JQVA 1VFAA 5SWZD 5TF1H 3SDDD 1SEQL 2BX5A 3SQBA 2OL3H 1U3HB 4HJJL 5IW3A 3SGJA 4YHOH 3FQUA 3TJEH 1DZBA 3EDJA 2YD6A 1D3CA 2EDNA 4MB5A 3BH9B 4KTDH 1E4WL 5I1CL 3ES6B 1S7XA 5DYOA 1ZT4A 1CICC 4E9LA 4X4YB 2YEZB 4G5ZL 3SGDH 3BP5A 4L5FL 1DFBH 4Y89A 2BNRA 2P8LB 5KSAC 1MIMH 4XGZA 5ANME 4ZFGH 5JOFA 1FYTA 1MI5A 4RGND 4HUXB 3MRHB 4POUB 4PJAA 1WIOA 4ERSL 4F8TA 1T22B 1CS6A 4XNYH 5HHMD 1QR4A 1BVLB 5CP3H 1OPGL 5H35B 1KCRH 1RUPL 1TVBB 5EU3B 3P9MA 4CVWA 1UEYA 2EKJA 4R0LB 3RI5F 4L9LB 2FJFA 4AEIH 2XZQH 4KUZL 3NPSC 1AJ7H 4R4NC 4LASL 1J0KA 1T89A 5D6CB 1HXYA 3B9DA 3GMRB 5BRZD 4LQFH 5E00A 4S1RH 2EYTB 4K94H 2MNUA 1ZGLA 2P49B 1YQVL 2GAZB 4MVBD 1A5FL 1YEDA 3WNLA 4ONFL 4NO5B 3MOBL 3QG7H 2GJ6D 4JRXE 1QSZA 1S9XB 4Y4KB 4WUUE 1U9KA 2XA8L 1P4IL 4RIRB 1Z9LA 5HPOA 1OGAD 3Q3GB 1Z9OA 3O6FB 3MCLL 2DYPD 2ZZUT 3EIFA 3WHXA 5C8JA 2VZTA 3BPLB 4HD9A 2CR6A 3VA6A 1JZ3A 3MRMB 1FNEA 5LCVL 3OGCA 4PJEE 3CSYB 5ISZE 4K94C 4P46A 1U8IA 3GJFK 4EI6A 4Y4HB 4GRLD 1TJGL 3OQ3B 2E7MA 5FYLL 3FO1B 5DF0A 3O2WH 1ZT7B 5DD3L 3NCCB 1MHPL 1VKXB 3OZ9H 4BFEA 5EO0B 4BKLA 1CFSA 2GCYB 1PG7H 2ADGA 4FHBD 4FXKB 2P43B 3VFGH 5T3XL 4HGWB 5IGXL 4UV7L 3BKYH 1GGUA 5B22A 3VWKC 5GJSL 4M7JH 3E1F1 4ZDHB 3W9EA 4Z7OE 1CF8L 2QV2A 4FZ8L 3ZTNH 5CZVL 3VW3H 1B6DA 3BFOA 1YEKH 1LGVA 3ULUD 3HE7B 5D7JC 1DEEA 1SBSL 4WFFD 1NAMA 1ZLSH 1CGYA 3IJYB 5ITBH 5BQ7B 1BOGB 2BSRA 1G9MH 3MLZH 2FSEB 2VH5H 4HUUA 1DL7H 2H3NB 3TBYA 1RIHH 3EYSH 2WBWB 4NM8L 3DX8A 4J3OC 4ZSOB 4HBCL 3MODH 4M7LT 5IVZB 4LVHC 3MYZA 2HTKD 2E7CA 1NFDE 2HMIC 4JG1L 1MHHB 2GKIA 3TA3C 3OPZL 2YKLL 3CMOL 1S9YA 2X4RA 3S5LB 1JTOA 1GCFA 1I8MB 1MPAH 2DTML 4C4KT 1NAKH 4QRPB 5I8KH 4PJ8B 3QDGB 4N0YH 5D7KD 2CDFA 3O4LE 2QHRL 5H94A 2ICES 5CHNB 3HAEH 3QUYA 3FFDB 1G9MC 2IAND 5FXCH 4PJFF 3FKUS 1NGWB 2EDHA 2Q86A 1KGCE 5E2TL 5IM7A 5DD6B 4DGVL 3QFJB 1M7XA 4OV5A 4RWYH 1BFOA 5CINL 2CK0L 3L1OL 2W60A 5T1KA 4ZUSB 4D9RD 1CICB 4G7VH 2HJKA 2ATPA 4TNVF 5EULV 2WP3O 1PJ9A 5T5FH 5TGBA 3GGWA 5KSAB 1QSFE 5C0FB 3B2VH 4EDWH 2VZUA 2AAVA 1RMFL 1YA5A 2MPAH 1N64H 3C60B 1HDMA 4HZAA 3BKCH 3U1SH 1QRKA 5E6ZA 5IQ9A 5HI4D 3P3YA 3ZDYF 4GAGL 3VXMD 1F90H 4FQ2L 5DEFB 1MCJA 4KRNA 5F6HI 5HY9B 5D1ZA 4XPHL 2B5IC 4Q9CA 4HPOL 4JO4H 4ZQKB 3U82B 5KOVC 3NPSB 4Y19B 1QSEA 4APQC 3LQAL 1KC5H 3FQNB 2PCPB 1WAAF 2J8UF 4Z7NE 4PRHB 1I1FA 1BX2A 4NO3A 1IARB 5ILTL 3WO4C 1XF5A 1S7QA 2A6IB 4UQ2B 2JK5B 1LO5B 4ZFZB 1CL7I 1K4DB 3THML 3MLVH 3LPGA 3RY6A 2YBRB 1KNOA 3LV3B 3I02B 2PYEB 1ULVA 4F7TA 5FHBH 2YA1A 2B20A 2X41A 4I3SL 1TZIA 3FJTA 3UDWA 1BQHA 5C70A 5KS9A 2R0WH 1IM9B 3QDJA 4NWTL 3B2UD 5HYJE 1K4CB 3PGFH 2AK4B 2H32H 3MV01 4Q0XH 1ZVSA 2Y7QA 1I7TB 1I8IB 5EWIL 1WBZB 2OSLB 3QO0B 1KTRL 3W0WA 4LP5A 3M8OH 1A7PL 2W1NA 3C87A 5J12C 3VRJB 3MR9A 4U3CA 5JOPE 1P7HL 4X5WB 1WQVT 3AXLB 4W81A 2DRUA 4LKCA 5L7XH 4IRSA 4P2RA 5ICXA 2JJSA 3WJJA 2YD4A 3MRIA 5I1DB 5JA8B 4F8QA 3QEUB 1YDPA 2CLVB 4OCMC 3O2DA 2FBJL 3BZDA 2G60H 3FFCB 2P5EA 3CLFH 1VFBA 1JGEA 4G6JH 4WFGE 4Y4FC 5CZXD 3OAUL 4Z78B 5FYKU 1A9EB 2DF3A 3NACL 2MCG1 1B0GB 3QNZA 3EHBC 3FRPG 5JNYA 1BP3B 1H8SA 4Y7MA 3VGAC 5HI3D 3O0RL 5EZIL 2DQGL 2X4TA 1R3LB 3M45A 4XCNB 4QEGA 5D7JB 1SYVA 2DWEB 3NFPB 4NPYB 1JWSA 2HJFB 1L4IA 2APBA 5GGRY 1HHGB 1WWCA 4PJXE 3PP4L 5T33H 3H9SA 4J12A 4LEXL 1TXKA 2OBGA 4YO0B 1IQDB 3DXAB 4OI8A 4X6DA 1FLTX 4H8WH 3MRBA 3JWNC 1JUFB 1P4LB 3CFCL 1CGXA 1ZS8B 4HFWB 3LN9A 2BDNH 3L3IB 4YXHL 1LP9F 1Q0XL 1CL7H 3NIDF 5IW6B 1E0OB 4N9GA 1H9VA 3TA3B 3DUUA 1Q9LA 3RNKA 4J6RH 1WAAA 2J8UA 4XCFL 4EQ3A 1LWRA 4GG6F 1J1XH 4B5EA 3ZHKA 3UPAA 3W39A 1IM3B 2YPVL 4U1KA 1MCCA 2VLKB 1XGQB 4R90L 1A02N 1XCQB 1S5HA 2PW2A 5KAQF 3UTPE 4H8WC 3SKOB 1RQ5A 4PUBL 3UYRL 1P4BH 5GZOD 4KDTC 3ZYZA 4NNPL 4XWGL 4O51B 3TM6A 4PD4J 4OFYA 2FO1A 3ULUL 3EYOA 5HHVH 4FFWC 4QCIA 1KTLB 4KI5C 2FRGP 4KDWA 1A0QL 4A6YB 4KY1L 2G9HB 4IIQA 3BD4A 3GFUA 3L5JA 5HJ3A 1XMWA 4KAQH 3MUHL 4JFOB 1AY1H 2C3WA 3HAEB 4K55A 3DTXB 4KVNL 4MNGE 3O6KH 4G42B 3N85H 5DD1L 4XNMB 4M1CD 4X6FB 1J8KA 3B6SA 1Q1JH 3P73A 2B5IB 5IMLA 2EEAA 4PG2C 1FZJB 4APQB 5F9JA 1V7MH 1A6AB 2XFXB 2DOCA 4TVPD 1GZQB 3KAAA 3V5KA 3FT4A 3MV7B 3TT3L 4LSPL 4G9DB 3QQ9D 3P2TA 5IVNA 4JJ5A 3V0WH 3WO4B 4U7KA 4DN3L 1M05A 1QRNB 2FX7H 1QFUH 1ZA3B 3O3AA 5TE6H 1LMKA 3IU4H 5EUOA 1LEKA 4BH8B 3H6JA 5CGYC 5E70A 2VZ3A 3DSFL 1IGIH 5I1EH 5AYUH 1FDLH 4O5LH 5D1QA 5FGCE 3BPCA 1KPUB 1T1YA 1YQ2A 5CJBA 5I8OH 2VXVH 2HVKB 5FKPB 1F11A 2X89A 4MA3A 3MMEB 4MCYA 1KG0A 2BOBB 4YXLH 3MLSH 4I0CC 4OGAD 5IB1A 5DUPH 3HI6L 2D7TL 5DVKA 1CDHA 1LP9A 3SDXB 4GKSB 2HTLD 4Z0BH 1MFAL 4BQCA 4S1SH 3C5ZB 4XP9H 3T0DA 3ROLB 3NABH 1WFUA 5J12B 3FB8A 5CJOH 1NCWH 3DROB 4ZFOL 4GG6A 3TT1H 5DMGC 2PYFA 3HNSH 3VG0H 2JIXD 2ZSWB 1ZA6B 4MWFB 1RJYA 4QNPE 1QYGL 2UWEF 4CGTA 2D7QA 3KPQA 4HIIB 4Y4FB 5JUEL 1GAFH 2XN9B 4F7CB 3D2UA 2IPKB 5I8EB 2APXA 4UDTB 3CVHL 3W9DB 2H32B 3V0VA 4NQXB 1RY7B 3WKMH 3F12A 3QUKA 3WUWA 3VGAB 3WN5A 4BFIB 1RURL 1EV2E 4F9PA 4XAWL 4H26A 5CD5D 2BVOB 4XX1E 5IB5A 3NCEB 2DD8H 2F19H 1QFHA 4G9FA 3HPJA 3K74B 3IKKA 5JMOC 2WLZA 1BVZA 2DBLH 2XG5A 3ECBA 3PWNB 1RUMH 3VRLE 1T04A 3I9GH 3O8XD 3PGDB 3UZQA 1ZHKA 1E28A 3LRSB 4LSVH 3F7YA 5DXWA 5MEOA 2EDBA 4NNYA 3W2DL 2PTTB 4MAYD 1TVHA 3GNML 4QXWA 4QRTB 1DUZB 3LH2L 3EKCA 3SKUD 1JTTA 4JO3L 3EO9L 3S6CA 3L5IA 1MVUA 2E5EA 5F7WC 5IK3B 4FNLH 2HKFH 5E4EB 2H45A 4PJHB 5J11C 5JO5A 2CIKB 5TDOA 4XC1H 5E2WH 3U9UB 3BD5A 1RHHB 2R1WA 2FYYB 4HCRA 1KEML 1ITCA 3MJ7A 4J3TA 1PKOA 5IROA 4S10A 2EC9U 3U0PA 1RZ8B 5HGDB 4YAQA 15C8L 2EIZA 2Y23A 3BDXA 1I1AC 1OP3K 3QEGL 4I0PD 3NCYS 1UH3A 2BVEA 4EXKA 5I1JL 2IGFL 1MSPA 2JB5L 4DCQA 3OF6D 4R4BA 4GW5B 3D5OF 4Y16A 1SJEA 5C08A 3VXTB 3QRFM 2VDNH 5TDPA 4PJ9A 1EFXA 3R06B 1HH6B 3MCG1 1UH4A 2AJYL 4PRPD 2DICA 4G7YH 3U4BL 4NT6B 2VXUL 5L2KD 4L4TA 4XX1G 4NZJA 1FORL 3LRHA 4TN9A 4QOKE 5HGAA 2AEPL 4S1DC 2C3GA 4LNRA 2XNAB 4UU9A 2I60L 4LAQH 4ZPVA 4LSDA 1YN6B 2DL9A 2BVPB 3N1PC 1JNLH 5JMRA 4XCEB 4GXVL 1CFBA 5J89A 2UWEA 2WBJD 4JQVC 4GAYB 3OKYA 5HYSG 1EGJL 2ADIA 4MS8D 3Q5OA 3UC0H 3RWCA 4Z8FL 3GO1H 1A6TA 3V4PH 3SGJC 5E94B 4YHML 2R8SH 5J6HA 2AV1B 3NIFE 5C07E 1HH9A 3IDGA 3KPLA 5C09E 2ED8A 3MA9H 1QACA 1N7MH 2YRZA 4U31A 1PG7X 3DVIA 4H1LG 5FYKD 4XXDA 5ENWB 3P11H 2YC1B 3P4NA 1MELA 4RISL 3BZ4A 4KMTH 1M71A 4ZOAA 3UPRB 3O41A 1B3JA 2MKLC 3VH8B 2SEBA 4NZUH 3HG1D 4P59H 1GOHA 1JCKA 4MNQA 2BZDA 4HW6A 4JRYE 1ZHLA 2W07A 2XWTA 1NEZB 5DD0L 1U8LA 3VXUD 2OJEA 3CDYA 3VXRE 1CDUA 4HS3A 4TVPL 4UI2A 4GRWF 1WK0A 1KIRB 4QRRE 4NZRH 4UIMA 4XVJH 4K9EH 2W9LA 1T89C 5K9JL 2ED7A 3UTQB 5B38B 1JTPA 3QUMB 2HWZL 3BDBA 3L7FA 2ITCB 4XP1H 1UM5L 2ADFH 2W0KA 1MCPL 2IAMB 4OLXH 4PG9A 3KPSE 3WXVL 4M62L 2V5MA 3H42L 4OUUB 5FOBA 4FA8A 1BJ1J 4P9HH 2ZCKL 3HB3D 1Q9WA 2BXYA 1BLNB 4I3RH 4NO2B 2VYRE 4HWNA 3HC4L 5K59E 4L3EE 1A6UL 4OCXL 5CSGA 2Z8SA 5ALBL 3UTSB 3R8BB 4HEPG 4K9EC 4KJWC 4X99A 3FOMA 2KQNA 1U8KA 1AE6L 4KV5F 1BIIB 3OBAA 2H6PA 2DQUL 2Q8AL 5DJ2B 4P46C 3PGCB 4WFEE 2XY2A 3DUSB 3H3PH 1L9NA 4ZAKA 4EUPH 3KXFE 1MIEH 3K2UL 5J11B 3SKNB 2VDQL 3BN9C 3NH7L 4P9HC 5C0JA 1T5XB 4HKZA 1CD8A 1MWAA 4OFVA 4KKBC 4E41B 2ENSA 4M5YL 3B8SA 3ET9F 4ZO8A 1Q38A 1XGTB 1FL3A 1U3ZA 3U6RA 5IESH 4FQHB 5E1HB 2QQNL 1YEEL 3LZFH 4M7KL 5CAYB 3I6GA 1CGSL 2X4UA 1I1AB 1PYWB 3G04A 5F7FA 5F7MC 4PP2B 2BY3A 2IH1A 3DNKA 3UP1A 2IALA 1GGIH 1PGRB 2R0LL 3ZKSD 5JDSB 1TNMA 3D85A 2NX5B 1FNHA 3GSXA 4OIIH 5CCKH 1T0NA 3DO7A 1CZ8L 4K7PH 4NJ9H 2VDML 1LNUB 1PX4A 4DTGL 1D6EA 1YYML 4C83A 2E6JA 3TBWB 2FEDC 3A67L 1DANU 1GZPA 2VUOA 2APTA 4JREC 2Q7YA 4JFQB 2D7OA 4C4KO 1DBAH 5HHQB 4YDIH 1IGJB 4UTBH 3WIIL 1QKZL 3EO1B 4GUPA 4NZDA 3F58L 4Y4KD 1A9BB 1V5JA 3STLB 3JVGA 2G2RB 3HNTL 4PV9B 1HIML 2V7HA 3UROR 3O6FD 3QUYC 4XRCA 5DUBA 3CPLA 3B3IA 3N06B 1UVQA 1JPFA 4YWGH 5EO1B 2NY4C 3FQUB 1AR1D 1KIPB 1BVKA 5I16A 2ORBL 3RL1B 1UFUA 4U7SA 5E2VL 1XFPA 1CQKA 1U8HA 1KJ3L 1CXLA 3JZ7A 5E6IA 2D31A 4Y4HD 5ANMA 4G8GA 1ZT4B 5E99H 3D39A 3V52L 4M61A 2CUHA 2EDKA 4LHUB 3BP5B 1IC4L 3T2QA 2BNRB 2A9MH 1A1NA 4NKDA 1U91A 4ZTPL 2ERJC 2XA3A 2AEQL 4RA0C 3WS6A 3QRGH 3GB7A 3P9MB 3QDMB 2C5DC 1YZZA 5D1ZC 3S37H 1WIUA 3GJEA 5HD8D 2FJFB 1PKQE 4OLVH 2BY0A 3MRFA 3HE7D 5EOTA 4E0RA 1IAMA 1LDPH 5KW9L 2IPTL 1HXYB 4CAGA 4S11A 5E00B 1D5XA 3A6BL 3BESR 4MHHG 3T2PA 2WWMD 4JRXA 4JVWA 5A2LH 1NSNL 1T3FA 5BZWA 3RY6C 4D94A 1I7RB 1LO0H 1KFAH 3TC9A 2Y36H 3B5HA 2ZCLH 3QNXA 1V3MA 4MJ2A 1P84K 5SWQB 1NDGA 4HWEL 5FYKL 3UDWC 1KJ2B 1QA9A 2UZIH 1X5LA 4IOIA 3O2DH 4XP4L 4PJ8D 2CH8A 3QDGD 4MXWH 4K3JH 4LRNL 1J8HE 4D3CL 2KZ1B 1AC6A 4OM1H 1BBDH 3I85A 4RFOH 1TCRA 3X13B 4P46B 2VLMD 4Z7UF 2X10A 3QG6A 4PLNC 1M1SA 3NIGF 1FBIL 4XMKH 4EI6B 4J3VA 4I2XE 3N1QC 3QFJD 3REWA 3V7MA 1BREA 1KLGA 4IRSC 2JJSC 3WJJC 5GHWH 4X8JA 3OB0K 5I71C 1CICD 2HKHL 1CFSB 3L3HA 4KZDH 2KDGA 2ADGB 4Z76A 3RKPA 3GSOB 4O00A 5KSAD 4KQ3H 2VAAA 4OF3A 3NOIA 1DN0A 1CU4L 3KPRE 3W9EB 2XV6B 3HI1A 4WNQA 3OTTA 2NY5H 3C60D 1I7UA 5DURB 3EOTH 3AY4A 5KTEH 1XGPA 5DC0A 4C57C 4WUKL 1ZEAL 3H7BA 1DEEB 4EUPB 2X09A 1A3RL 4BJLA 3NAAL 1D5ZA 4Y19D 5GS1B 3RVXC 4R4ND 2BSRB 4G6AC 3QPXH 4M6OH 3R0MA 4HUUB 4G6FB 3TBYB 4PRHD 2VDKL 4N0UE 5HSFA 5D71H 3FN0H 3DX8B 5F7KC 2YK1L 2YPKA 5GRWA 1XR8B 3MRQA 4DJMA 4JREB 2NY5C 2YR3A 2PYED 2J5LB 1S9YB 3DHJA 4JKPH 2QSQA 3AROA 4HH9A 4XNXL 1IGFL 2A38A 5AWNL 3PWPE 4JKLA 2CDFB 1T5WA 3Q48A 3NFSH 1BMGA 1IM9D 4NBZB 1BFVL 1C7SA 4PTTA 1ONQA 3T04D 2AK4D 4M1DH 5FCUH 3KYMA 1FG2A 2XQBL 5DQDH 2Q86B 1RIVL 3IDIA 2QKIB 4WI4A 4DGYH 5IM7B 1CCZA 1C12A 5C0AE 3PP3H 3VD9A 4LPXA 5CJXA 5I30L 4M7LL 1CXFA 2W60B 5T1KB 4MLIA 1F00I 2HJKB 2ATPB 4IIQC 3GZKA 4ZXBC 5TGBB 4R8WH 5BS0E 3AS2A 1QFOA 4JDTH 5M94B 4Y1AD 1JNHA 4WJ5A 2K7PA 3FFCD 2ERJB 1HDMB 4Z7UA 2EYSA 3T0EA 1MCNA 5IQ9B 3FRPA 5EBWB 4DGIH 1OM3H 2MCPH 4ELME 2H41A 2AV7B 5D1ZB 3TIEA 1NGQL 1OD7A 1OAXH 4OBSA 2PTUA 1QSEB 1JF6A 4GG8B 5D7JD 3G6JF 3BJLA 2E8YA 3PXHA 3NCJH 4HWUA 2GIYA 5H37H 3VI4F 1XF5B 1S7QB 3WXWH 4U33A 3DXAD 3QQ3B 2DI9A 1KNOB 1SYSA 2DM2A 5I1GL 1YJDL 3PABB 1OSZA 2IG2H 4F7TB 5D1QC 1MCDA 3BH8B 3QUXA 1UWXH 5CUSL 2HMID 4I4WB 3VFRA 4MXQC 3RWDA 5TPWL 5EIIA 2JF1A 3TA3D 4RMTA 4PGJA 1EMTL 2I07B 2NY2B 1XZ0A 1JWMA 2ED9A 3PUCA 3LEXB 3SDAA 1V05A 2VLKD 1KT2A 4ODBD 1O5DT 1ZVSB 4R4FL 2Y7QB 4EBQH 1PEZA 1B9ZA 4BQ9A 3MRNA 1OWRM 4U7MA 3W0WB 5TDNA 4BM7A 3MR9B 1E6OH 3MACL 1EHAA 3UTZB 2O61A 4YHKL 3TN0A 3DYMA 1IKNA 4IRSB 4P2RB 4WW2A 5ICXB 4LHQB 1F4WH 2OI9C 3C2AL 3MRIB 2VKXA 5L6YH 4YXKH 1YDPB 3BEWB 5TH2B 3STZA 1IZKA 3O45A 4NCDA 4PJFB 3CFBB 1VFBB 1JGEB 2XT1B 2BHUA 4Z7WF 4HIXH 2YPLE 4PY7B 3V6BR 3VXQB 1UKQA 2MJWA 4P57A 5FHAH 5T3ZE 2EDEA 5JNYB 1S3KL 4JY4A 3WN5C 4MJIA 2AKRA 5M95B 4X9IA 4PJ7F 1W0VA 4M48H 4F9PC 4PJDF 3DBXA 4QKXB 1RZ7H 1W8NA 3P4LA 3CD4A 2D9QB 1EVTC 4HCRH 2XRAL 1JWSB 2Q3ZA 5F3BA 1EXUA 2X4QB 4APQD 3H9SB 5ICYA 2VDRH 5LWYL 3K3QA 1MFDH 2OX5A 3MRBB 3ZE1E 4X6EA 1P84J 2H2SC 1Z9MA 1QRND 5DEZA 3MROA 1IBGL 5F8RC 5EUKA 5BXFA 3V4UH 1UZ6F 4LSQH 2NY7L 4N9GB 2EXWC 2Y9RT 1L9MA 4KROB 4JQIL 3HZKA 3DUUB 1Q9LB 3RNKB 4EIGB 1XF2A 3G6JA 1P2CB 2I25N 2DQEH 3WYRA 1F3DJ 1O7VA 1T21A 1JYVA 3F65A 5E8DL 1SJXA 4OZFH 3QCTL 1ND0B 3D9AL 4U1KB 4YDJA 3VFMA 4P3WA 3CDCA 3VXSE 4D9LH 5TF1L 4M5ZL 3Q5YA 2R69H 4XNZC 2OL3L 2X4OA 4EXPX 5MHSE 4Q74A 2DKUA 1K3IA 4GRMB 4YHOL 3EYOB 3TJEL 4QCIB 4FTVE 3C5ZD 1AKJB 2V17H 3UTTE 4XI5C 4NQCA 1N59A 4KTDL 3RUGF 3E6HA 4Y16C 4ZXBB 3FMGH 2VXTH 4PJ9C 5F7UA 5HJ3B 2X1XR 3P4MA 3IGAA 3SY0A 1RIUL 3U46A 4ZFGL 4Y4FD 4JO1H 2KBGA 2XN9D 2OJZH 4AH2A 4EZMA 4P99A 5GRYA 4MJ5A 4XNYL 3SO5A 3EHBD 4Y5VA 3B6SB 2FH8A 3P73B 3SJVA 5IMLB 2R1XA 5HGGS 1ZVHA 3IXAB 3JV6A 1MUJA 4U1MA 4AEIL 2XZQL 3LPWA 2JELH 1AJ7L 5DVOA 4DKEH 4Z7WA 4XNQA 5HYEA 2P42B 4B7LA 4HZLA 4IBLT 4HC1H 3MJ8A 1PBYA 3CFDB 4LQFL 1BZQK 2K9UA 4S1RL 1KEGL 4K94L 1N2RA 4PJDA 5INCA 3EGSA 3EOBB 1Y18B 3TP4A 5D1QB 1PSKL 1T1YB 2DQFA 2VUYA 5ACMA 1F11B 2A2QT 4F57H 3L5WA 1RJZA 1KG0B 3B9KA 2YN3A 1RZJH 2XIDA 1NCUA 4NN7C 4FQIL 3BYYA 1RK1A 2MSPA 5JIKA 4HUVB 1QQDA 5FECA 4MD4A 1G1YA 1FH5H 1LP9B 2I9TA 4M3KB 2VC2H 1IAII 3WCYA 3BP7B 5T1LA 2P24A 3TIDB 4Z77A 3FB8B 2AP2A 5T1MA 4CJ1A 4FFWD 1JJUA 4GG6B 4PJBF 4B0MM 1FG9C 3NFNA 2PYFB 4LDLB 3O2WL 1YUHB 3ZKMD 4QXGH 4K7PX 3OZ9L 1RJYB 1RZJC 3KPQB 5IHLB 2B0SH 2Q6WA 3D2UB 4FP8H 5KSVA 1GGTA 3LDBB 3MA7A 3RIAK 3VFGL 3V0VB 3BKYL 4KDVA 4LCIH 3HR5A 4PJIE 3AMKA 4M7JL 4P2QA 2VERN 3WN5B 3WUWB 4YBQD 4PTUA 1CDYA 4U05A 3KR3H 1J05A 4H26B 3ZTNL 3RA7H 1A7RH 4IMLB 2UZYB 3VW3L 1MWAH 1YEKL 5DJAA 3ISWA 3RUGA 2P5WE 4G9FB 3V2AR 3T3ME 2BNQD 3WLWC 4NZTL 2YD8A 3ECBB 1T04B 4JVPA 3QISA 1ZHKB 5B21A 3EOAA 3LIZH 5ITBL 4NNYB 4TYUA 3BIKB 3KLHC 1G9ML 1TVHB 5GS0H 3MLZL 3MV9E 2VH5L 4C56E 2HLFC 3DVNA 35C8L 5D2LE 2F53E 1DL7L 3H7LA 1RIHL 3EYSL 4K7PY 4AYFA 3OKDA 1MVUB 4ZAKC 1WUNT 3NZHH 3MODL 4XAKD 3L5HA 1WEJH 4O02H 2AEWA 2BSED 2ZUXA 5TDOB 4NC1E 4A6YL 4O2CA 1WF5A 4X7SH 4NQEA 1MPAL 1LO4H 1NAKL 5I8KL 3MJ7B 4OCLC 4GQPH 4G8EA 4L8SA 2RFXA 4N0YL 3KGRA 1PZ5A 4XNZB 3O4OB 4F7MA 2H26A 1B4JH 4U6TA 4YAQB 4JFEB 2EIZB 5TFSH 4CADB 4GW4A 5GS0C 5JHDE 4BH7A 4GRWH 3U4EB 1TMCB 1IAIH 1QBML 4CVXB 4TUOA 4EKXA 1OGTA 3DIFA 4X80H 2XTJC 5A3IC 5FA4A 1SJEB 5DMGD 5FYLE 5C08B 3VFPB 7CGTA 5T1DH 3BO8A 3MCKA 4G7VL 4PJ9B 5IBUG 1GSMA 5TDPB 1EFXB 4NNXB 5DA0B 4OZFB 5T5FL 1WTLA 4Y5YA 3NTCH 3C08H 5AZ2H 4YGAB 3TWCH 3B2VL 4EDWL 2Z35A 3ZL4H 2IAMD 2MPAL 4L4TB 1N64L 3HRZB 5T3XE 3BKCL 3RIFF 3U1SL 4O2EB 4X6CE 1ORSB 4PJBA 1FNAA 4LNRB 4UU9B 4ZUTA 3GSNA 4ZPVB 3Q6GH 2D4DA 4D9QD 1FNSH 3CX2A 1G7HA 5K93A 4JO4L 2UWEB 3JVGC 3IRPX 1KC5L 1LD9A 3Q6FB 2ADIB 5JR1H 5EOCH 4EQ2A 1HHHB 2VNCA 4BQBA 4PRDA 3UTSD 3RWCB 1FL6B 2B1AH 4Q6IB 3M1BA 4I2XB 1A6TB 5C07A 2FECI 5C09A 2OTWA 5E5RB 4DK3A 3MLVL 5J6HB 4P48A 3LKPA 3B5GA 1A1MA 4NCC1 3IDGB 5FHBL 4NKMB 5E6IC 2NZIA 1RUAH 4KGLA 1R24A 5L8LB 1IC5L 2QLVB 3P4NB 4NN7B 4E41D 1T1ZA 3BZ4B 2R0WL 1M71B 3O41B 5HGHA 2EDDA 5I74C 3EZJB 2IQ9H 5DVLA 1ZHLB 5I2IA 1WZLA 1SJVA 1CVSC 3CK0H 2XWTB 1U8LB 1I1AD 2OJEB 3M8OL 1F45A 3GSWB 3QXWA 5IG7B 4LLYB 4YEFA 4UIMB 5L7XL 4P2YA 1T2QH 2OQJA 2V2TA 3UCRA 2NX5D 1MFCH 1YMME 3L7FB 4PFEA 2YRPA 2G60L 4X6BA 3CLFL 4O9HH 2QSTA 4G6JL 4LGRB 4BSVA 4U3HA 1IQWH 4PG9B 3RWHA 1MRCH 1II4E 4Z0XA 1K9TA 3K8KA 2AXGB 5FOBB 1CXKA 5D5ME 1EFQA 1K8IA 4S1DD 5GSRA 5F6IC 4ZTOL 3MRJA 2DLEA 5SV4A 1AO7E 3ARWA 4NJAH 5IMKA 3DVGB 5T33L 4HSQA 4X99B 4PYGA 1YEGH 4KPHH 5C0AB 1U8KB 3NMEA 4H8WL 1FZOA 2H6PB 5FM5M 4P2CG 4W4OA 4UINH 2WM0A 4ZAKB 3WDIA 2BDNL 5J0BA 5SWSA 1ZKAA 1CL7L 4XPBH 3ARGA 2FWOA 5C0JB 4HKZB 5E8EA 1MWAB 3EYFA 4J6RL 2XKNA 1OQXA 1HKLH 3U6RB 5DHXB 3RKDC 4LHUD 1J1XL 2BNRD 2Z0BA 4EN3A 3Q5TA 1R3KA 4LARH 1MI5D 4RGOH 4RGNE 4RAUA 1CLOH 4K7FA 4QF1A 1CE1H 2X4UB 2R2CA 1G0YR 3JUYA 3G04B 2EDRA 3PQYA 1P4BL 5HHME 2IH1B 3AY4C 1BJMA 1CVRA 1QFWI 3QDMD 4N8CL 4AM0B 1IAKA 2AXHA 5HHVL 2CR3A 2XTJB 5EH1A 2VABB 1R3JA 2MMXA 3PDDA 1H8OA 3GSXB 1TPXC 1T0NB 3DO7B 1BF2A 3S88H 4KAQL 2EH7H 4UNVA 5BRZE 1BD2B 1D6EB 1OVZA 1AY1L 4C83B 4ETQA 3O9WA 2JLLA 1R3HA 1GZPB 3O6KL 4J4PA 3CSGA 1X5GA 3N85L 1MNUH 4GRWB 1T0MA 3QCUH 2VLRA 4JLRA 4GUPB 4YK4C 1LEIA 2GJ6E 1Q1JL 4G43B 4OZHF 5EZJB 1V7ML 5AUMA 3ESVF 3OR6A 1OGAE 4NN5C 4JPIA 4CUCA 2HG5A 3CPLB 2GI7A 3B3IB 4OF6A 1G7QA 1IAIM 1UVQB 4YDVA 5DRNA 3V0WL 5MERA 1JPFB 1WWAX 2FX7L 2XPGA 1PX3A 1QFUL 4KH2A 2BMKA 5TE6L 2UYLA 1BVKB 1DE4A 3IU4L 4WHYH 3VXOA 4P46D 2WUBH 5D7IF 1IGIL 4KVCH 5E6IB 2D31B 2FX9H 5I1EL 3D18A 5AYUL 2MQ3A 4G8GB 4O5LL 3D39B 2FD6H 3BN9D 5I8OL 2VXVL 4M61B 4YDKH 1A21A 2VQUA 4KKBD 1A1NB 5IBTL 2DI8A 5DSCA 4NKDB 4YXLL 5I74B 1U91B 3MLSL 3BGAA 4XB8A 5DUPL 2GTWA 4QRQB 1IFHH 4KWUA 5IWLA 5F7NC 3T0EC 1PKQA 1YPZF 1LHZA 3GB7B 1ERNA 4S2SB 3VCLA 3ALXA 4Z0BL 1NFIB 3PXJA 2VDLH 4S1SL 5DURD 2OMNA 4XP9L 2A74B 1T03H 5DMJB 3NABL 4NP4H 3KHQA 3MRFB 5H2BA 3UJIH 3TZVA 5CJOL 3ULUE 1NCWL 1NEUA 1QFWH 2ZNWA 3PDOB 1U8OB 3QI9B 4M93C 1I3GH 4WFFE 3TT1L 5DK0A 1CXHA 3HNSL 3VG0L 2FO4A 2VLJB 2NCMA 1D5XB 5MENA 4RMWA 2AQ3A 4G6FD 5L9DL 2AS5M 1GAFL 2AEIT 3EYVB 1MCFA 2CGRH 1F6AA 3QNXB 3OJ2C 2FEDD 5GPRA 3QUXC 5CEZH 3WKML 5FO7A 1NDGB 1KJMA 1MF2L 2XXMB 5D96C 5C0DA 1KPRB 4IOIB 2IEPA 4XPFH 4F37F 5F6IB 2DD8L 1AFVL 2F19L 5DD5H 2DBLL 1RUML 3I9GL 3SDAC 5IV2B 4LSVL 3D69A 3VFWB 3QUYD 3VJ6A 3O3EA 1TCRB 5GRVK 5B3JF 3S97C 3O11B 2VQ1B 3QXUA 1FNGA 4D0DB 4FQ1H 3QG6B 2MKWA 4EDXA 3TBTB 2J7LA 3TN0C 2R0KH 3WKNA 1IKNC 3REWB 4M6MH 1KLGB 5JW4M 4WW2C 4OZHA 4HFUH 4Z5RA 1WC7A 2HKFL 3SPVA 3W11C 5I9QC 3KLSA 1JGVH 2VZ1A 5T1KD 4XC1L 4KMLB 1DUYB 4JFFB 4WU5A 4CMHB 4D9RE 1BAFH 1CR9H 2ZNXA 5E2WL 1UACH 2HP4A 1A4JA 3GM0A 4ZNCD 5I76B 1OAZH 4WRLA 3B5TA 4ENEC 1E6JL 1ZAGA 5ITFB 1DN0B 1MFBH 3V6ZB 5IEKA 3HI1B 5EU6B 4B53A 2R9HC 5D7IA 2D7NA 1J1OH 2VZVA 4QHMB 1A14H 1NMCC 1XGPB 1RJCA 4LIQE 3VXME 3H7BB 5D1ZD 3BYTA 3GEWB 4DW2H 1D5ZB 3BQUA 1B2WH 1QSED 3IFNH 2FGWH 1TPXB 4CU6A 1VACB 3QP3A 2VSDA 2AJUH 5MEPB 3C8KB 2R56H 3FTGA 3BZEA 1YPZA 1NUNB 5D2NA 3GM8A 4MD5B 2EECA 1JNNH 3MRQB 3WFZA 4L3CA 2CRYA 4G7YL 1T4KA 2J88H 3PWPA 5IVOA 4OCRH 3SE8L 5E03A 4YK4B 4HH9B 3K1KC 3QHFH 3AAZA 3LSOA 1RZFH 3S98A 1T5WB 1JNLL 1PEWA 4DKFH 4NUJA 2F5AH 3RBSA 3ZDZF 1BFSA 1ONQB 4WI8A 4DOHB 2Z8VC 1W8OA 4YBHA 1FG2B 4LLWA 3UC0L 1QR1B 3IDIB 1RULL 1X5ZA 3GO1L 3F5WA 1C12B 3V4PL 1QHPA 3W0WD 5IFAH 4KJQC 5I8CA 2R8SL 1S5IH 1MFNA 3OKKA 4L3AA 3FCTA 3P0GB 3RHWK 4N90D 4RDQG 4Z7VE 4IRSD 4P2RD 3MA9L 3L95B 4U0RB 5IBUB 1CT8A 1N7ML 3SHSA 4LLAA 4WJ5B 5KSBE 1CTNA 3PE9A 4TSCH 5HHNA 4ELMA 2P5ED 4LLDA 4ZYKA 4KMTL 4Z7UB 3T2NL 2EYSB 3T0EB 2Z31A 4P59L 5HHPA 1S7RA 4Y5VC 3QCVH 3RZCA 3TIEB 2HH0L 5J56B 3F62A 3NCMA 4I3GA 5BV7H 1KJ2L 2X70B 2P46B 5KVDH 2Y07H 4M93B 3K8MA 5BCAA 3DSNA 4YE4H 4QHLA 3N1FC 3H9SD 3RVXD 4NZRL 5DK3A 4G6AD 4XVJL 4K9EL 5D93C 1OP9A 2DQJH 3FHAA 3HPLA 4YZFE 2LU4A 1NKOA 4XP1L 1SYSB 4YDLC 3T4YA 1OSZB 4OI9A 4HS6A 4RAHA 4OZGF 5DJ8B 4OLXL 5IF0B 2CJUH 5EIIB 3RWDB 1H5BA 5D96B 2BVYA 4R7DA 5EB9A 4GT7A 3B9KC 8FABA 5MEQA 5BV7C 1YYLH 1AGEA 4YBLC 4I3RL 4LCUA 1NGYA 3C6LA 1OAYL 4LCCB 4LSRH 1AI1H 1I3VA 2R0ZH 3SDAB 2PNDA 4XVTH 1KT2B 2XZAH 4ZS6C 5I75C 3MRNB 5B3NA 4MSWA 1AD9A 4U6HB 3PV7A 5TDNB 4JY6A 4ZNEE 1QFWM 2A6KB 4QTHA 2O61B 4OFYD 3TN0B 1GXEA 3H3PL 1MREH 1BGXH 4NYLA 5I9QB 3OKEA 1NKRA 1AKJD 1MIEL 2YWZA 4G8FA 1KIQA 2YSSB 2MHAA 2DQCH 1X5XA 4OGXH 3TYGL 3O45B 4X4XA 4ZXBD 5E1AA 4HUWA 3ZYIA 1JGLH 1U2HA 5IESL 4GW1A 2MWCA 2CUMA 3KLDA 2N4IA 4P57B 1FVCA 5EU7E 5F6HJ 3LZFL 1L7TH 4MJIB 2AKRB 1NMCB 2GFBB 1W0VB 3E6FA 4TQEH 2BSSA 3DBXB 5FDWB 2VE6B 4ODTH 2KUTA 1WBYB 2C1PA 1T1WA 1VEOA 4WU7B 1CDCA 3GMNA 1Y6KR 1GGIL 2X1PA 1MCEA 4G8IA 4FMFA 4TVPE 5HHOA 4JG0H 5AEAA 5IMOB 5F96L 4IOSD 5F7HA 4OIIL 2WBKA 1D5BA 2GUOA 4W68A 4X6EB 5CCKL 3MROB 2P7TA 4K7PL 5EUKB 4NJ9L 3HS0A 3WDJA 4Q2ZA 1AP2A 4RMVA 5I6XC 3N9GH 3HZKB 4WENB 1XF2B 3G6JB 4UV4H 5D1QD 1DBAL 4YDIL 4MXQD 3EFFA 4UTBL 2QQKH 2X89D 3UO1H 4YDJB 5C0CA 5DUMH 4JE4B 2GHWB 4L8SC 4XH2A 2ICWA 3OAZK 3ZHDA 4HKJA 4CN1A 5GGVH 1FCCA 2X4OB 4OZGA 2I26N 5AG9A 2APWA 2P8MA 4ELKA 1OAKH 4YWGL 3GSNH 1E4KA 4HS8H 1X4XA 3B9EA 4NQDB 5C92A 5JW3H 4IOFC 3MUZ1 1FFOB 4NQCB 4YHNA 1N59B 3QZWA 3E6HB 5C0GB 1KTDA 2HT3C 3TFKC 1HE7A 1C8PA 4P3CH 2DAVA 3P4MB 1WZKA 2Q20A 2A9ML 3IGAB 4Y5YC 3BT2H 3SY0B 3U46B 1BZ9B 1BECA 2J2ZA 4IRJA 3D2UD 2IPUG 3BE1H 4N1HB 4YEEA 3I6LD 3LKRA 4Y5VB 3QRGL 1IC7H 1ZMYA 3SJVB 2R1XB 4K23H 3GJFA 1N0XH 4R3SA 4M9PA 3MX0A 3OAYK 5SWZB 3JV6B 3S37L 4G9FD 1MUJB 4U1MB 3ARDA 3FQWA 4JY5H 1UCTA 3INUH 2IMMA 3NBNA 4LPCA 4Z7WB 5DRZA 1AD0A 1L0QA 4HZLB 2IC2A 1WZ1H 1G7JB 3G5XA 2KPNA 3KVQA 4YDLB 4PJ7B 2ESVE 1N2RB 4PJDB 5INCB 3QFDA 3UYOD 3EGSB 4LMQE 1LO0L 4PJGE 2ZJSH 1KFAL 2Y36L 4Q9RH 2ZCLL 1JWUA 3L5WB 4NGHH 3V6OA 1RJZB 3B9KB 5BV7B 2UZIL 4YBLB 3O2DL 2F74A 4NSKA 4EI5A 1RK1B 4NQVB 3WEXA 1T83A 5FECB 4MD4B 1SHMA 5E8NA 5EC1B 3C8DA 4MXWL 2I9TB 1UA6H 4K3JL 4F2MA 5I75B 3BJ91 4OM1L 4X7EC 1BBDL 4JFED 4RFOL 5T1LB 1P6FA 2P24B 4Z77B 3FT2B 3P0YH 1G6RA 3V7AE 3T0BA 4XMKL 3NFNB 1KENL 1MFEH 4H0IA 1FHGA 4XI5D 4AQ1B 2HFFB 4ZFFB 3ULSA 4WHCA 5GHWL 3MZTA 1EVUA 4Y16D 1RZKH 5C08D 3X17A 1A2YA 3NGBC 4PJ9D 2FB4L 1EFXD 4KZDL 5KSVB 3T4AB 3MA7B 4KQ3L 1MCIA 4PRPE 3HR5B 2GJ6B 2P5WA 5J9PA 1YC8A 4P2QB 4L4TD 5SX5K 2NY5L 1J05B 5L2KE 4F7EA 1UJ3A 5DJAB 3RUGB 4M8VA 3EOTL 2FIKB 4A2MA 4B41A 5KTEL 1DCLA 4Q6YA 4M6AA 3HUJE 5D2LA 3EOAB 1YMHA 3QHTC 2GITA 1GHFH 4WI5A 5T5NF 4FOMA 4J1UA 3QPXL 4M6OL 4J2XA 1RZKC 2BVUA 3CUPA 3G5VB 1OARL 4ODXA 3FN0L 5D71L 1ZVYA 4W4OC 3OKDB 5I6XB 2WNGA 1QPXA 1S9VA 4HKXA 2VJXA 3ARGC 4UOW0 1YNKH 4O2CB 4JKPL 4NQEB 3MGOB 12E8L 1MRFL 5FCSH 1A64A 1SQ2N 5FYKE 4G8EB 4L8SB 1U95A 4JGUA 5JHDA 4JHWH 3LS4H 4MYWB 4EN3C 1NPUA 3NFSL 4OD1H 1PZ5B 4F7MB 3QWOA 1G9EA 5CLWA 1FAIH 4GW4B 3IFOA 4OLZH 4KZEH 1T2JA 4LBEA 4XZUA 4M1DL 3V7AG 5FCUL 4KC3B 4YH6A 5DQDL 4MXVF 3PHOA 4TUOB 1OGTB 3DIFB 3WFCH 4DGYL 4HIHA 3HE6A 1G7PA 4BQ6A 1XF3A 4YQXH 2DB8A 5TE7H 3S4SB 1L6ZA 1SY6A 3WMSA 5FA4B 3BO8B 2YRLA 1DBKH 3MNZB 4FFZH 4R8WL 3FQTA 3QO1A 4FG6C 2PF6A 4JDTL 4UDUB 3RDTB 3IB4A 5K9QI 5IVXE 1CE6B 4L4VE 4X6CA 1D7FA 2Z35B 4GMTL 4UTAH 1A3LH 5FGBA 2XWJA 3SKJH 3O9WC 3KJ4C 1F58H 5EZLA 4PIRF 4J4PC 1SJHA 2F15A 4PJBB 5ABDE 2EDWA 4DGIL 1OM3L 1MCOH 2DDQL 3GSNB 3GI8H 4NFBA 2MCPL 4YPJA 5DJYB 1G7HB 4UILH 5E8PA 1OAXL 4ORZC 3VXPA 3WLWD 3ARSA 2IANB 3VFVA 1FQ9C 3NCJL 3OXSA 4PR5A 3DECA 3TVMA 1P1ZA 1OTSC 3KLHD 3WXWL 4BZYA 1KB9J 3CDGA 2HLFD 2OTWB 5I73C 4ETYA 3LPFA 4TNVK 2IG2L 4ZAKD 5BMFH 5FM4A 5BW7C 4GQ9H 2OS7A 5FIEA 3LRGA 1R24B 1JGDA 2WINA 1GL4B 1Y0LA 3IDXH 4ZOCA 4FXLA 1UB6B 2W59A 4JFYA 4N8VG 3HCVA 2CLRA 2X4NA 2OCFD 2YXMA 4XPTH 3ZE0F 5IWLC 2DKMA 5I2IB 1TQCC 5GJTH 1I3RB 4EBQL 4NDMA 5JXEA 5F1NA 3IDNB 2GT9A 3VFTA 4KK9D 3HRPA 3OX8A 1E6OL 4PJ5A 4U1JA 1DBMH 3CFKA 1KELH 1YMMA 3FO2B 3TZVC 3ALPA 2AK1H 2W9DH 1P9MA 2AJZA 2XTJD 5A3ID 1F4WL 4I5BA 3S9DB 1C5BH 2GSIB 3D85D 2X9XA 4AIOA 4YXKL 1JHLH 3NGBB 4OKVA 5IIEB 3V6FA 2EZ0C 5EIQA 2R2BA 5D5MA 4HIXL 5DZLA 1DQQA 1BD2D 4HKBA 3AREA 2L0DA 3CFJB 1N6QH 2V5SA 1AO7A 5FF6A 5EU4B 3N50A 5CLTA 2B8OT 1RZ7L 3P9LA 5GSRB 2VQTA 3MXWH 1FRGH 4HCRL 3QEQA 2YD2A 2V9TA 1A6VH 1IL1B 3MRJB 5IMKB 5JW5B 3Q0HA 1T7VA 2EE9A 1HINL 2VDRL 3S36L 4L8CA 3RTQA 3S96A 5ADOH 1FZOB 3LKSA 3QULA 4R2GC 2XZCH 1ZE3C 3X11A 5HPMA 1PQZA 2DQHH 3V4UL 5SWSB 1R5VA 4LSQL 1NUDA 5E95B 5EIVA 2FWOB 4GO6B 5E6ID 5E8EB 3VD7A 2WWKO 4G6KH 4G8GD 1YY9C 4P9MH 4XPAH 2DQEL 3D39D 5GGTH 2XKNB 1PDKA 2WP3T 2EE2A 1N5YH 4EN3B 5F88A 1R3KB 4IHOB 4RAUB 4QF1B 4K7FB 4D9LL 4X7FC 5C0RL 1MCWM 1KLUA 1ZLVH 2R69L 1T6WA 5IW1B 2VSCA 3PQYB 3VXNA 5J1AB 4PGZA 3T65A 4O2FA 4MDIA 4QY8A 1IAKB 4WCYH 5J6GA 2X42A 4N5EC 3N1GC 4JDVA 1EIBA 3SOBL 1Q0YL 2V17L 2VL5A 5BVPH 2GJJA 3BQUC 5DVMA 3TYFA 3ZE2F 4PB9H 3QIBA 3MLXH 3U83A 3UYPA 4LCYA 4R7NA 2NY3C 3FMGL 2VXTL 4HT1H 5CKAA 2VLJD 5D2NC 1K85A 2F8VA 3ARTA 4GOSA 4QGYA 3SEPA 3O9WB 4ETQB 5I1KH 4JO1L 4DZBA 1BQLH 1JHKH 2OJZL 4ZSOE 2F8XC 4PRBA 1T0MB 3KPOB 2VLRB 4K2UH 2QHLA 4JLRB 4J3SA 4JQXA 3ZLQC 1OGAA 1MCLA 4KI5F 3L3OA 4NM4H 1UM4H 1XR9A 4OD2B 5AUMB 4GMSH 3BDYH 1J10A 4QRPE 1DLHA 2FATH 4JPIB 2JELL 3QDGE 1GJIA 4P4RA 4AL8L 2HG5B 1G7QB 1CFTA 4YDVB 1D9KC 5DRNB 5INDA 5MERB 4DKEL 4OZIF 2XPGB 1LE5B 2BMKB 1W0WB 2JKXA 5I73B 2UYLB 2YA2A 4HC1L 1NLBL 3VXOB 1UCBH 5I1IL 2VLME 1U8NA 3CGTA 3AM8A 2LE9A 3RX8A 4PLKC 5E5UB 4MAUH 3NA9H 3PDGA 3GDBA 3MRDA 4B50A 3QFJE 4UIKL 3PWVA 1IEBA 1H3UA 4AY0A 3ZSTA 2NNAB 4F57L 3HMXL 4Z7QF 4JFFD 1RZJL 3RQ3A 1KJVA 3R1GH 4FQQB 5DQJB 3RKDD 3T1FB 2GTWB 4UOJA 3MLWH 4HGKC 3FL7A 4X7DC 1TQCB 2B2XH 1FH5L 1LK3H 2Z31C 1BHGA 2PKDA 5EU6D 4WEBH 2BRRH 3VCLB 4RAVA 4UMGA 2E9WA 3QA3A 3RZCC 4XTRC 2ICWI 1AGDA 3VI3E 4CVZA 4RFEA 5DK0B 3ILQC 5KVGL 2FO4B 4QXGL 4Y19E 1T1XB 2HLAA 5MENB 3CXHK 1U42A 1J12A 1EUUA 1Z0NA 2Z9TA 1P53A 4PRHE 2B0SL 3SE3C 4DAGL 3HMWH 3J8F7 2L7UA 3IETB 4FP8L 3JUZA 1UG9A 2FR4A 3H2WA 1ES0A 4LCIL 4PV8A 1KJMB 4RGMB 4YHPA 2NW3A 5C0DB 3KR3L 2PYEE 3S5LG 4CN6A 2ZSVA 3AU1A 1RUKL 3RA7L 1A7RL 1FV1B 1MWAL 5T3ZH 5DEGB 3UEZA 3C6LC 4GJTB 4JCLA 3BPNC 4ONOA 3WHE0 2JCCF 3LIZL 4KKCC 2HFTA 3O3EB 2LV4A 2R2HB 4R2GB 1FNGB 3S34H 2FLBT 5I1LA 2AK4E 4PRNB 1PLGH 4TTGA 3O2VH 4RFNC 2Z91A 1DLFL 1CLYH 1V3KA 3NZHL 3REVA 2JIXB 4OZHB 4IEFB 4I8DA 1WC7B 1WEJL 4KK6C 4O02L 3SPVB 4Z5RB 1UZ8A 5JQ6H 1Z2KA 6FABL 1B0WA 4WU5B 3T77A 3FQRA 2VZSA 2RJMA 2NR6C 1A4JB 4BZ2H 1LO4L 3IKCA 4OZIA 3U7YH 4ONGH 5D7LA 2P45B 3QXVA 5IEKB 1NCBH 3OL2A 2Q1EA 4OSUH 3MLTA 4QWWC 3FFCE 3MFFA 5D7IB 1R5WA 4ZUUA 1DBBL 1B4JL 5GGVY 3T0ED 2QEJA 4WV1A 5TFSL 2FJGA 2YD5A 3OJDB 3R8QA 1K8DB 5I19H 1I8LA 1IAIL 2XACC 4QRUA 4ZFOA 5EFIA 3O8XB 1VADA 4LVEA 3BQUB 3CDFA 4X80L 5EA0L 4QXTA 2C1OA 2V5RA 4MAYB 2ITDA 2NY3B 5T1DL 2X1WL 1CD9B 3FTGB 3BZEB 1YPZB 3WUZA 5D2NB 4TTDC 3JSSA 3DXAE 3NTCL 5ESQA 3C08L 5AZ2L 4RZCA 3TWCL 5KANI 3ZL4L 4HPYH 4JFHD 5FYJH 3I3BA 4FXGA 5E8OA