4LVNB

Crystal structure of pfsub1-prodomain-nimp.m7 fab complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
212
structure length
207
Chain Sequence
DIVLTQSPATMSASLGQRVSMSCSASSSVSTSYFHWYQQKPGSSPKLWIYSTSNLASGVPGRFSGSGSGTSYSLSISSMEAEDAATYYCHQFHRSPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTRHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin-like serine protease
publication title The malaria parasite egress protease SUB1 is a calcium-dependent redox switch subtilisin.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/inhibitor/immune system
total genus 43
structure length 207
sequence length 212
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lvnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lvnB01
3ULVF 1UM5L 1MVFA 4FQJH 1WBZB 1QSEE 2WINB 4M00A 4F7EB 5J1AB 3OAYH 1EEQA 2I9LB 3RKPA 3KPRB 3O11A 1PSKL 1FZKB 5FOJA 3BPCA 5H94A 4I2XB 3VU2A 5DK2A 5EU6D 3BDYL 4NHUB 3BN9C 3WHE0 4MD4B 2YUVA 2R2BB 4LSUL 4NQEE 4CMMB 3BD3A 4GXVL 4X6DF 5DEZA 3VFSA 1LDPH 4P2QE 3IVKA 5D6DA 5EA0H 5HHVH 1CD1B 2Q7YB 4MCYA 4ZNCD 4ZUTA 2MNUA 3VWKC 4PJCA 1NC2A 3TBYB 1ZA3A 4KQ4L 3OJVC 1ZLWK 1BLNA 1X6LA 4YHLL 3QFJD 5DHVH 3MRMA 3G5XB 4X7DC 2Q76A 4OZGF 2NY3C 3BEVA 3OKNB 2FIKA 5ECJE 3PL6C 3GSRB 1MAML 1IAII 4U1MA 4NYLB 2YZ1A 3UTZA 4QRTA 1U8OA 5HDBF 4ODTL 1JGEB 4RBPH 2YC1B 1IBGL 4JFXA 1YPZA 3AREC 4B7LA 3Q5YA 5I9QB 2QHRL 1WCBB 3WXVL 3BP6A 1JBJA 5DRNA 1AGFB 3QDME 4MJ6B 4DUWA 4RFEA 3VG9B 3VRLF 1OTTC 3NIDF 1G1YA 3VXOA 1UJ3A 1H9VA 2WUCH 3MOBL 5DURD 1JZ5A 2CRZA 2CUHA 2GIYA 1FO0L 1YECH 1U3YA 4P2RE 3WUWB 4D9QE 4BUGA 4Y1AB 4PYHA 2CGRL 2DTML 1G6VK 2R0KL 1AKJA 1SEQH 2IG2H 3SDCA 3UTSD 3WDJA 4AQ1B 3B2UD 4MWFB 4Y16B 1U58B 4LLWA 1BZ9A 5EU5B 1QYGL 3D39A 2VQ1B 1G7PB 1N8ZB 4AY0A 2X4QB 4RMTA 4R8WH 3TCXA 5F44A 2IALB 4R96B 1UH2A 4OCNC 4I13B 5C0DB 4LVHB 4S1DC 3FCTB 4M6OL 3WN5B 1G7LA 2OP4H 5HPMA 1AXTH 4Y8DC 2IH3B 5E8NA 2H2SD 3RVWC 3SOBL 5JW5A 1DZBA 4OUOA 2VXVL 5IT2H 4HS3B 4AIXA 5DD5H 2DS4A 4ETQA 1G6RH 1KN2L 1QRKA 4I4WA 1OGTA 1CXFA 5F71A 3B83A 2K7PA 2J5LB 1UA6L 4DCQA 4JDVB 5J7CC 3UJIH 4JM4L 4KJPC 4G8EA 2YS4A 4UT9L 5I8KH 3EZ8A 4NNXA 3IXAB 4KRLB 4Z8FL 4OQTH 2ICCA 1OF2A 3GGWB 1JYXA 5I1HL 1JNHB 1S5IL 2Y4SA 5F6HI 3KPSA 5AAWA 1WBXA 4LNVA 2PW2B 2F19L 1Y18B 3HAEA 3SKMA 2DQIL 4HIJB 1ZE3C 3MCLL 4HS8H 4P4KD 3ALXA 4XAKD 4WNQA 4JHWL 3DGGB 1RK0A 2IH1B 1OY3B 4Q9BA 2A38A 1X5XA 1I3RA 2HT4C 1P5UA 5J13B 4E5XA 2ZOKA 4PTTB 4I2XE 3I50L 2QADD 5D7SL 4ZG1A 5CJQL 1OAZL 2IANB 5FK9A 3WL9B 5C0RH 1HKLH 1T0NB 3VG0L 5JIIA 4HJ0C 5MENA 4OGXL 3KYMB 4ZNEE 3TIEA 2DI9A 5TQ0L 1W72B 4AL8L 4L8SC 2HJLA 4RWYL 1AQDB 4YFLI 2HJFB 1KPUA 4M7LT 1IGYA 1NCDL 1I9EA 3SDXF 1KJVB 4HAGA 5GS0C 1LGVA 3TZVB 3T2NH 3QZWA 2PTVA 1DANT 2YK1L 3GJFH 1YMMD 2B5IC 2VYRE 2XQBH 4F57H 4ERSH 1UB6B 5KS9A 4FQXC 5I75B 5K9JL 2EO9A 2OTWA 2VITA 1Q9OA 3O41A 1YQ2A 2ORBH 1A2YB 3HS0A 3RZCA 1E4WL 1HSAB 5C0CD 4PJ9A 1T2JA 4J8RB 2NX5B 3NGBC 2EH7H 4UV4L 5D5MB 3OF6D 4L3EA 2A6IA 4KDTA 2HH0L 4MAYB 3GHEH 4Z7OE 1FRGL 4K94C 4H26B 1MRDL 4NKDA 4J3OC 3MRJA 5D7LD 2NW3B 3UP1A 4RGMB 4HGKC 3IU3A 5B8CC 4G8FB 1GOGA 4YHYC 3ULVL 4J3SA 2XZQL 4JO3L 2OMNA 5E0QA 5CEZL 2UZIL 4WHYG 2R4RH 4QY8B 4XVTH 1E4XI 3V4UL 1XH3A 2CLZB 2GSGB 4TSBH 5C07B 1OSZA 4L9DA 2EIEA 4HDIB 4UTAH 4GRLC 4PP1C 1L0YA 1TQCB 3TYGH 3MGAA 1EO5A 4EDWH 1FIEA 1DEEA 2ATPA 3RVUC 1AD0B 2DQTH 1KTKE 2YUWA 4Y1AE 3FO0H 2WBJC 2OZ4A 2XFXA 1FZJA 5A2KH 5EBMB 3K8MA 1ZK9A 4JY6A 1T4KB 1CYGA 5FF6B 3O3DA 4N9GB 1KB5B 2YZ8A 3AS2A 1R24A 4F58H 1ZGLB 3MBXH 1FH5H 1Q94B 4OF7A 3BI9X 2XACC 4ZUUB 3VXSB 3NZHH 4JEGB 1S3KH 2ED9A 2H41A 3GI8H 2J6EA 1R5VA 4DW2L 4XPBL 2OXHA 1U93B 1XGYH 1JP5A 2FZ3B 2J8UB 1QSED 2MPAL 5ITBH 4YUEH 4LLYA 3IT8D 2P4AB 1PD6A 5DRWB 4HGWB 2EC9U 4YIQB 5GS3A 4D9RE 3Q3GA 3F62A 4JVUA 1M05B 5T3ZH 1A9BA 4XAWH 4WGWB 2KPNA 4PRIB 1R3LA 3SO3C 5F7HA 1H3VA 1MHCA 3QRGH 1MHEB 2X4RA 1FP5A 4NQED 2PYFB 5CZXC 4ODSH 3PP3K 4M43H 1IM9B 3CFKA 3QXVA 3QAZC 4JDZA 3QYCA 4NQDB 1WZLA 4X99B 5JOFB 4G8IB 1ORQB 2Z4QA 5EC1B 1A7NL 1U8QB 4P2QD 2PF6A 3QQ3B 4FQ2H 2DQGL 3E3QE 3O4OB 4R4ND 2X2YA 2Q8AH 5JO5B 1D3CA 4N8VG 3MOQA 4MJIB 4RAVA 3QPXH 1MCDA 1J0KA 5D1XD 2YUZA 1CQKA 5DJ6A 2IQAA 5TJWK 1S7UB 4R4FL 5BW7A 3HAEG 4PG2A 2HTLC 4RMWA 2HFFB 1P7QA 2DN7A 3LSOA 2A74B 2E6JA 4YHPB 4U4BA 1F3JB 3U9PL 2X4PA 4HMCA 1OLLA 3ILPA 1OM3H 1OARL 1YEHH 1MFEL 1MRFH 4N1HB 3U2SB 4N90E 3QIUA 2IANE 3QUYB 5TDPA 4D9LL 5EZJB 1TMCB 5KZCB 1R3JB 4LLQA 5GRJL 2H45A 1HOCB 2F9BT 4KHXH 1UWEH 5LGJA 5GGUB 3UAJD 5D1QB 1A1MB 2HT2C 2BY1A 4BJLA 2O5YH 4OGAC 4TSCH 3QDMD 3CXDH 3IDJA 4FXGA 5EBLB 1T1WB 5L9DH 2OL3A 4JFYA 3SE9L 3KXFB 3G5ZA 4G9DB 1UYWL 1QTYT 4L3CA 3LRGA 1ND0B 1KTLB 4A6YH 2NR6D 2IPUG 2UWEF 4X98A 4P2RD 5DD1L 3QZWG 1DBJL 5ID0A 3DHMA 5DC0A 4YWGL 4D9QD 2XIDA 1UXWA 3QT2A 5IFJA 3N1GC 2X89A 1S9XA 4G6JL 1JPGB 3FQNB 1TVBA 3ZDYE 1A6UH 5FKAA 2NX5E 1PY9A 5D5ME 4GAJH 4HUWA 4P5MB 5IFHH 2DI7A 5HI3D 3RUGB 1NFKA 3SJVD 1CBVH 3QWOA 1HQ4B 4LNRB 3PJSB 4MDIB 3JWNC 4R6UA 1K3IA 2YUXA 2OYPA 5C6PB 3QXDB 3S3SA 5CUSL 1U8HB 3SKNA 1YEJL 5C07E 5DMIL 4JO4H 1XT5A 2KH2B 1FORH 4R90H 4PJ8C 5IB1A 4HKBB 5JZ7C 2X4TB 2JIXD 5TQ2L 2K1MA 3WHXA 2VDLH 3LRSB 1RIHH 1MIML 1QNZL 3FL7A 2BHUA 1WGOA 3HNTL 4L9LA 5E6ZA 5IR1B 4PV9B 3IDIB 2FX8L 4GBXD 1BVLA 2YD6A 3QUZC 4GAGL 3UYRL 3EGSB 5JXEA 1J0YA 3CUPA 3WIFA 2Z8SA 3L95A 5EC2B 1JHTB 2FYYA 3TJEL 4HHAB 3VXSE 5B3JF 4PGCA 2FJHB 3MLXL 2JKXA 3MV7B 1KIRA 3M1BB 4TVSa 3TM6A 2ZCKL 1A3LL 3S36H 5H37H 3V6ZB 4PRPA 2J8UE 2CRIA 5KOVC 1T21A 1OHQA 1WVZA 3FQRB 1YEKL 2KL6A 4XWOD 3VFGH 5GRVL 3VI4E 2CK0H 3WS6A 1I3GL 3RY5A 4X6CF 1JMZA 3WLWD 3EJZD 4M8VA 4PREB 5HDLA 5C9JA 3QDGA 3LKRB 4D2NA 1MCOL 4PRIE 1S5HA 1KN4H 1HSBB 4JM2A 1H5BA 4NC1C 2VOTA 2MTPA 4H1LB 1CVRA 1FDLL 3K4ZA 3DX6B 2P7TB 4NQDE 4P59L 1XF1A 5GGSB 4ORZC 3I2CH 1L0QA 4KZEL 3BPNC 3I3BA 1CGUA 2DLIA 2NY4C 3MTRA 4PJAE 3QXAA 3NIFE 2CLVB 5JHLL 3MLYL 3WV0A 1AI1H 5C7XH 3DBXA 2QBWA 3H0TB 1INQA 3VXQA 3JTSA 3GMQB 3V4VH 2Q86B 2X6MA 3JWOH 1IVLA 1IEBA 4G3YH 3U4EA 3IF1A 2ZKHH 1QQDB 2DQUH 3ZE0F 5FO9B 5I19H 4JZOA 3QUKA 2Z8RA 3BP7B 2A2QT 1NDMA 4JRYB 1RUAL 4LEXL 1YYMH 2KZWA 3O8XB 4LARL 4UUJA 5E8EA 5KSVB 1HZHH 4D8PA 2GY7B 5GHWH 4Z7WA 3L5XH 1R5WB 4QGTA 3K81A 1UJTA 2R0LL 2DQDH 4N0FB 4ONFL 4S1SL 3O6LH 1HDMA 5ENWA 2A9MH 3W0WB 4YX2H 3STBA 4CN1A 2YN3A 3VRIA 4TPRH 4PLKC 2VDKL 3VFVA 1JK8B 3I6KA 4X5XA 3ZYIA 2ADIA 4KKCD 1CICC 3W9DA 4PRHA 3KXFE 4QRUA 2BHZA 1CDGA 2FBOJ 3EOAB 5L2KA 1W72H 3D85A 5HGAA 2VXQL 3IDUA 5DT1H 3SDDB 4E41A 4F15B 1ED3B 3QIBC 4WW2A 2JK5B 3M17B 3IDXL 3DX8B 4LCWB 4Y1AD 2BCKB 1TPXC 5F7DB 3RVTC 3KVQA 2F54A 1E4KC 4EN3B 5FGCB 2HG5B 1F5WA 3UBXI 5MEOA 2R0ZL 4N0CD 4LGRB 4LIQL 4XMPL 3T8XA 2SEBA 3RDTA 4ZQKB 4YR6B 4PLJD 1MCHA 3WDIA 3RUGE 4OTXH 3P2TA 1CE1L 3VXTA 4LRIA 1MWAB 5FOBB 3GMMB 5BS0B 3NTCH 5EO9B 4OLWH 4CVXB 4WHDA 2EIZB 3VXMA 4NNYB 2BNQB 1MNUH 5EUOF 3T0BA 3WJJC 5ANMB 5JIHA 3TO2B 3MLSH 2VZUA 4F7TA 1H3WM 4KV5F 4MS8D 1TDQA 2DWEB 3KLAB 1SEBA 3TN0C 4CVUA 3HNSL 5D70L 1ZLUH 1OTSC 3IFNH 1EZVX 3EHBD 4OZGB 1QR1B 5CWSA 1AIFB 4K07A 1HHIA 5B4MD 5KW9L 3QJFA 3SE8H 1WZMA 1ZWIA 3F12B 3HC4L 3BMVA 3NH7H 3CU7A 1RJYB 5F9JA 3P77A 4OZIA 1NSNL 1FNHA 5GS0L 1XIWB 2R23B 4IHOB 4YPGB 3MRHA 5FGBA 2VDOH 2OQJA 3NFNA 3BRFA 4LOUD 1FPTL 3BFOA 2NYYC 1R6VA 3MV7E 1KTRL 3VDBA 3QHTC 3UDWC 1KB5H 1AGDB 3VFOA 4WY7L 1AGCA 3QNZA 2J3SA 1Z9SA 1T7ZA 1YEDA 4YBQD 3ROOA 5BVJB 3BEWB 4TYUA 4M62L 1QSFA 1NCTA 4KQ3L 2YMXL 3QDJD 4Y4KA 2NXYC 3GK8L 1ZLSH 3FB6B 2F74A 3H7BA 1SBSH 5DRXB 2IAND 4JB9H 4K94L 4NQCE 4FFWC 5GGRY 4Q0XL 2DQJH 4LLVB 3T09A 2GTWB 4GSDL 3F7PC 2H32A 3BZFA 4H5SB 2IMNA 2OS7A 3FT3A 4M6MH 4K7PX 1AQKL 5F1OB 3O3BA 3SCMB 1UM5H 2FNBA 4KU1A 3QUXD 1KULA 3RWCB 2VLLA 2A6JA 4NKIL 1P4LA 4AIZA 2CIKB 1QA9B 3TZVD 4Y4FC 1I7UB 1NFDF 1P69B 2FJGA 3TWCL 4QHKJ 2HN7A 1U8LB 3DOSA 1JPFA 4KXZI 5BJTA 4HIHA 2E9IA 3NCYS 1CGVA 5E1AA 1I3UA 1E6OL 3WIHL 3FRPG 4HCRL 5HBBA 4KI5E 3RWDA 4LSUH 1HHHB 4WVRA 3CVIL 2VLRA 2LE9A 4LHUB 5TGBA 3QNXB 3HR5A 3ES6B 3VFTA 4U6VL 1EH9A 2NX5D 5E9DA 5B38B 4JRYE 1JPST 1KB9J 3QJHA 3ORJA 4MAYD 3QFJA 2NZ9C 3R8BB 4YAQB 1SM3L 3I9GL 4EUPA 5HHPB 4P23B 3LAFA 1HK6A 4KQ4H 3O2DL 4X5LA 4YHLH 5CEXA 3IETA 3VFPB 5C07D 5IKCB 4U1IA 4ZDHB 1QFHA 3TVMD 1FNSL 1R3KB 4APQC 4EI6A 1AJ7H 3KS0J 1X5JA 1MAMH 1OP5K 5K9KB 2R1XA 3OGCA 4ODTH 1S7RB 4LCWE 4RGOH 1MFDL 4J23A 1MUJB 4AM0A 1OGAA 2QHRH 3WXVH 3Q0HA 1RZ8B 4BFEA 3IJHA 4XNQB 2R2HA 3BAEL 1QLFA 2C7UB 4NJAL 5GXBB 1DQJA 3ZKXB 3CH1A 4CADB 5T33L 8FABB 1J1PL 5TFSH 1J87A 2IF7A 3LKOB 1RIVL 5IESH 1EV2E 3ARBA 3OHXA 3BGFC 3MOBH 3VXSD 5BS0E 1CU4L 3VFNB 1FO0H 4KK8D 3UTSA 3SDXB 5KSBA 4KJYB 1YNTA 4ELMA 1QG3A 1BPVA 2DTMH 4I0PB 2BNQE 1NAKH 2C4FT 3L3DB 2R0KH 3QHZH 3CFDB 5GGSY 2V2TB 3MGOA 5ANME 1PDKA 1L9NA 3TBVA 2D03L 3QI9C 1QYGH 1PYWA 5GS2H 4PJ5A 3HMWL 1HH6A 4HJGB 4OZFA 2AV1A 1SJHB 5D6DC 5DTFA 1A3RL 3QWRD 4OZGE 3TNMA 2EDJA 4OCLC 4ODHL 3U1SL 4PRID 5MHSD 4GRWH 4G6KL 4M6OH 5C0GA 1WIOA 2AXGB 3SOBH 3V0AC 1MFAL 5IJKA 2VXVH 1IM9D 4TTDD 1ZHKA 4NQDD 3MLTB 4OLUL 4F3FA 1KN2H 1NC4B 5DJCB 1UZ6F 3BKJL 1UCTA 1DVFC 5E2UH 4PYGA 3OKDB 5KVEL 1UA6H 1WISA 4X7FC 4JM4H 1XF2A 4U1KA 4PFEA 5BRZA 3K8KA 4UT9H 3C6LB 4NKMA 1M71B 3U4BH 1X5FA 1J1XL 4ZYKB 4ZFZA 5EOTB 3T4AB 4Z8FH 1K9TA 1JVKA 2BSRB 3N1QC 3HR6A 3S4SB 4Z78A 1Q0YL 1S5IH 4LFHG 4ZXBC 3DV6B 5DLML 5I17A 3KPTA 4IOIB 3QUYD 3MLRL 4MHHG 3Q48A 1ADQL 3QH3A 2F19H 4M7KH 5E7BA 4WIQA 4UOJA 1F8TL 2VISA 3DVIA 3O2VL 1WT5C 3MZTA 2ZUQB 4JO2H 4U6TA 3OJDB 5B39G 5D1QD 4ONGH 4JHWH 2PXYD 1JWMA 5DHYB 5IVXB 4Z7UA 1XF4A 1PJ9A 4U6XA 4PRNA 3KXFD 5C0BB 2WP3O 32C2A 3WNPA 4ZFOL 1MCJA 3I50H 5D7SH 3FZUD 5CJQH 1OAZH 3B43A 1J86A 1SJEA 1Z2KA 2DQCL 4TNWF 3GSVB 1KLGA 3R0MA 4OGXH 3HE6B 5TQ0H 3PQYB 4AL8H 4AEFA 2BNRB 3DRTB 5EBWB 1I8IB 1N3NB 4RWYH 5I1KL 4R26L 1NCDH 4ZUVB 3PABB 3WJLA 4V2BA 3I75A 1BOGB 1ZHLA 2P8PB 4MMXC 5FIEA 2NLJA 4RAUB 5IFAH 2YK1H 3NAAH 1XF5B 1DE4A 3N1PC 5D6CA 1K4CB 15C8L 4XCFL 3VH8G 4MJ2A 5ADPL 2E9JA 2PO6C 3ULUF 1JRHL 5F9WB 2GAZA 4HWBL 4O2EB 3OF6A 3SKJH 4EUPG 1F6AA 4GW5B 3O3AA 4O51B 4OB5L 1E4WH 5IQ9A 2DL2A 2VKXA 1MJ8L 4QYOB 1RY7B 1CLZL 5EZOL 9CGTA 1L7TL 4CVZB 1ZHBA 4NN6C 2HH0H 3U46B 4XMKL 1FRGH 4WO4C 1IFHL 1M1SA 4PJHB 3MJ8B 5KANG 4BSVB 4YDLC 3QEUB 4HS6B 1WWCA 1FHGA 4BSWA 4FS0A 3B5TA 3EJYC 5SV4A 3TA3C 1LQSR 3VFWB 2XZQH 3ULVH 2BVTA 4JO3H 3IJSA 5FEBA 5CEZH 1OD7A 2UZIH 4BKLB 5L6YL 3QIWD 3LDBC 6FABL 5DFVD 3V4UH 3CH8A 3MNZB 3W9EB 2EC8A 2P45B 3TBWA 3OXSB 2P42B 1CFQB 3MJ7A 3P3YA 5DK3A 4G9FE 3SDXE 4MSWB 1DDHA 4MLIA 2NMSA 3MXWL 4Z77B 4J1UB 4GKNA 1VGEL 5E95B 1P9MC 5J12B 1KBGH 4B5EA 2BZDA 4QXGH 1IE5A 2UWEB 1XZ0B 4FQHB 3OB0H 1TVHB 1RQ5A 3N06B 4MNHB 1BM3L 4FTVD 5EH1A 1AC0A 5L0QB 3BQUB 2AJZB 1QLRA 2C3VA 4NQCD 2AKRB 1CFBA 4KTYA 4DW2H 2NQCA 3VA6A 4XPBH 3FQUB 2A6DA 4PJCF 3DUUB 4K23L 1FYTD 1N64L 1WWAX 3T08A 2MPAH 2Q20A 5CD5D 2YWZA 4EBQH 1I1YB 4PGBA 1UENA 1CG9B 4HX1A 4QRPB 3TBTB 4FQQA 1A6ZB 2E9BA 1Q38A 3IXTB 5I8CB 3UTTD 3RJQB 2XTLA 5DMJB 3HCVB 2JJTA 3BP4A 3U36A 2DF3A 3FT4A 4H0IA 4KI5D 1G7QB 3A6CH 5AG9A 4LLMB 3KYOA 1ZVSA 5IBLD 3AGVA 2BNUB 4OKDA 2VC2L 5DUPL 3F7YA 4OLEA 2R69H 4XP5L 1A7NH 4HWZA 4JRYD 2DQGH 4ODWB 3MRKB 1AGBB 3O8XD 2C3GA 4MNQB 1F13A 3ARFA 3SGKC 3H3KA 4QXTA 3HI5L 4M61A 1I1RA 4GS7C 4R4FH 2GJ6A 1OT1A 3QCVL 1GIGH 4NO3A 4PY7B 1F4HA 5DD6A 5IVXE 4RNRA 5T1MA 5HGHA 4JKPL 4CVWA 5C0BE 2O61A 2DIJA 1MI5B 3IS0X 4NQXA 2DMKA 4KK6C 1OARH 1MFEH 3MFGB 4OCSL 4D9LH 5HDOA 1AHWB 3QDMA 1FFOA 2PW1B 5GRJH 4YDKL 5IIEA 3RIFF 5BVPL 3T2QA 4EN3D 3U6RB 1D5MB 1E27A 3QCUL 3PQYE 2P5WA 1B90A 4P2OB 5D2NB 3RHWK 3MGTA 1RHHB 2FB4L 4ZFFA 3GSUA 5B3NA 4PRDA 4Y19B 3SE9H 3L5IA 1J9CT 1WUNT 1UYWH 1NCAL 4LLDB 5CGTA 3I85A 5BS0D 2CLRB 4KC3B 5DD1H 3DTXB 1W0WA 3IDGA 4YWGH 5E56A 2CDGB 1HILA 4KGLA 4XCYA 2AVGA 5DD0L 4OF3A 4OSUL 5L7XL 2X09A 2Y36H 2FEDD 4JZJA 3FOLA 3SJVA 2MSPA 4QCIB 3DVGA 2BX5A 4ESKA 3PXJA 1UXSA 2IQ9L 2BVQB 2XKUA 2Z35A 5A16A 1NLDL 5EWIL 4PJHE 5GRYA 3NIGE 5CUSH 2VABB 3B9EA 5DMIH 1IC5H 1XIWD 2ZSVA 4LCCB 4XNZB 3LQZA 3O6FB 4ZS6D 4OZ4A 1A6PA 3L7EB 4FQIL 1RFDL 5F3HA 5KSAC 4KK5C 5I2IA 5HYSG 4WTWA 2HVKA 3UZQA 2W9DL 1KEML 1MIMH 3Q1SL 1J0ZA 1VENA 1QNZH 3G04A 2FD6H 4ZPVB 3HNTH 3LVEA 2UWEE 5HSFA 3AY4A 3G9VA 3STLB 3GSOA 3F5WB 2FX8H 4GAGH 4LLUB 4XPHL 1W0YT 4PBVC 3EYQC 3UYRH 3RX7A 4XGZA 5E6IA 3KPNB 4WRLA 2A0LD 2AJYL 2BOBA 4OI7A 1S9VA 1WBZA 4IRSC 5ESVA 3C6SA 5KSUA 5E08L 3MLXH 2NY1B 2Z93B 4NQVA 4UMGA 4C83A 2ZCKH 5IK3B 1A3LH 4FXKA 5KS9F 3FB5B 1RMFH 3PG2A 1EEYB 3GSWB 1BF2A 1CT8B 1KPVB 1JNNL 4XNUL 1YEKH 4QRPE 4XX1E 1A14L 4F7CB 4MXVF 1U8MA 1I3GH 2YBRB 3FN0L 2BVUA 2O5XL 2FHFA 5GS1B 4I48A 4ALAH 4LVNB 4P3CL 3P11L 4LEOB 3SDAC 2N1KA 3NA9L 4IRZL 1WC7A 4W4NA 4MB3A 1FDLH 1BIIB 5D7JC 4HUXB 1DLFL 3RL1B 4P59H 1LO4H 1KCSL 2OMBA 1GGBL 5BMFH 1ETZA 1JYNA 4WI6A 3P40A 4KZEH 4PJFF 4MA8L 3G6AB 1B4RA 4MNQE 3L5WB 1SHMA 2FWOA 3TO4B 4HC1L 1U3HA 4PRBA 3HFML 4DZ8B 5JHLH 3MLYH 4QF1B 1IC7L 3T77B 1K5NA 5JOEA 5DJ8B 1VEOA 3EYSL 5HI5D 4HUNB 3S3JA 4ONOA 4F37K 2HFEB 3FONB 4NQSA 4BH8B 1JZ8A 4U1SB 2VL4A 1MI5E 1WFOA 1QBAA 3K2MC 4HULB 4CAGA 4XBEL 2PUQT 3C8DA 1EGJA 2CDEA 1KENL 1RUAH 4C57C 1A9EB 1L7IL 4LEXH 5C0JA 4MJ6A 1PG7H 4UDUB 1KGCE 1DN2A 1IAOB 2AK4A 5C09E 5D2NE 5M7QA 1U8PA 2VB5A 1F11B 2R0LH 3ISWA 4LGPB 4S1SH 3HZVA 4P2YA 3DIFB 3QPQC 3MRRB 4S0SD 1F97A 4JLRB 2VDKH 2YA0A 4Y19E 1WBYA 2YXMA 2ESVB 4Y0GA 1A5FH 3K4DA 5C08B 3P4OA 1O0VA 2VXQH 1KIQB 4G9FD 1QFWM 4F2MB 2HKHL 3IDXH 1D5XA 3ARYA 5ICZA 3CNKA 3OKKB 5D7IB 1G7PA 1NGWB 1NFDB 4I0PD 4L5FL 4P57B 2DOCA 1EA9C 1JGDB 2R0ZH 3RNKB 1NGYA 2MQ3A 3V6OA 3FCTA 4M4RA 3AB0B 2M8XA 3MBEC 4P3DB 5D93B 4OCMC 1OQXA 5DQDL 5DJDA 1CE1H 3ZE0E 4WFFE 4P5TB 3TYFA 2X4OA 4XC3L 3B5GA 5IVZB 3VWJC 4X4XA 2I5YL 2HMIC 4QNPF 1RJZA 2A83B 3LKQB 2HJKA 4O2CA 1NC4D 3CIQA 5LBSL 3TIDB 2PCPA 3VFUA 5HYEA 3FB7A 5DI8A 3C60A 3KPLA 4QWWD 3E8UL 4KHTH 3IXAA 4OZHB 3HNSH 3SGEI 2AJ3B 3JSSA 3H2WA 2P48B 2GT9A 2NY6B 3EO0B 1BFVL 3C6LD 5K9OA 4MA3A 3MNWB 1KB9K 1MCCA 5KW9H 4IIQA 2YD8A 1LE5B 3E2HB 3HC4H 1NEZA 1Y18A 4HIEB 2ADGA 5DK0A 1OAUL 4M1GL 5D72L 3ELAT 4XHQA 2OR9L 1NSNH 5E00A 3C9NB 2JF1A 3T1FA 3L3IB 4Q9QH 2V5RA 4ODBD 5MP6L 1MCWM 5FCSH 4IS6B 1FPTH 3EO9L 2C1PB 3D9AL 1MEXL 1QBBA 3AFLA 3V79C 4WY7H 4WW2C 1MAJA 2DKUA 2BDNL 4ZUWA 2BSED 3BUYB 3MO1B 2FL5B 2H2PC 3QDJA 2ICWB 1RZJC 1KLUB 2VQUA 3SY0B 4DZBB 5IW1B 4MA7H 3U7YH 1CFSA 2IBZY 4AENA 5C0BD 1D9KC 1DSFL 3KPQB 4KQ3H 2CQVA 3FRUB 3ZHDA 4G7VL 3GKWL 3GK8H 3C8KA 5SV3A 1W0VA 1ZANL 1LEKB 1AQDA 4LCYA 4AMKL 3QUXA 4Q0XH 5F6HJ 5HPOA 4GSDH 3MUZ1 3PQYD 4YXKH 4I18B 3B9AA 1CE6B 3MLUL 1AQKH 5D1ZB 3RBSA 3CX2A 5IOPA 2P5EA 4YBLB 4NKIH 3ARTA 1RZ7L 1XCQB 3MV9A 3TJHC 2AJVL 1UB5B 4WUUB 4OV5B 5JTWA 5EORL 3IDMA 4EDXB 2I9TB 1S7TB 4JCMA 3TWCH 1WFUA 3BH9A 1ONQB 4DN3L 1RZFL 3REVB 3UMTA 2XZAL 3BPOB 3WKNA 2ZG2A 3I3EA 3EYVB 5JORB 3WIHH 3RVXD 4ORGA 1CVSC 2DLHA 1BZ7B 2F58L 1RI8A 2Z31A 5HD8D 3U7AA 5GGQL 2B0SL 3L3OA 1I8MA 2F53B 1FV1A 1RUML 4ODUB 4QY8A 3X12B 4X83A 1T80A 1IKFL 3I9GH 1EJ6A 2ADJB 5CJ5A 4ENED 2V2XA 3TVMA 3FN9A 1CFNA 3DROB 3GSNL 2VO5A 2XWBB 3VGDA 1T66C 5IHZA 3CSYA 2ESVE 1GAFH 4J4PA 5C08E 5DVLA 1UZ8B 2VIRB 4ZO6A 2X4SB 3SGJA 1EEZA 5DDHB 5FF6A 1FVCA 4N9GA 5EO1A 1MFDH 1RURL 5D7IE 1NFDE 2FDBP 3UO1L 1ZGLA 3W81A 3MRPB 1K4DB 3BAEH 4K7FA 1QFWL 4NJAH 5IEKB 5T33H 5BZDA 1J1PH 1UFUA 5TDOB 5BV7C 4ZO9A 3OKEB 1RIVH 4XCEB 1N0XL 1U93A 3MRGB 3VCLB 5DMKB 2RGSA 3VD5A 2W60A 3NVQA 2HVJB 1CU4H 2J8UA 2QTEA 4JAMB 1B3JA 3T65B 4IMKA 3CVHA 3ZDXF 1GOFA 5EIIA 5TH2A 3IJYA 4QRRB 2DYPA 1KELL 1NUGA 4YIQA 4M7ZB 3PWLB 3ME0A 1N6UA 3HMXH 4XP1L 3L5HA 3V7AE 4H25B 1FLTX 1SYSB 4QRPD 1F4AA 2D03H 3VXRE 3M45A 4N8CL 1T1ZA 1UH4A 1KLFA 1FLRL 1MHEA 4OZHE 3HMWH 1RUKH 1Z5LA 2PYFA 2W0PA 1A3RH 1IM9A 3JWDL 1U2CA 1G7IB 5FUCC 4P4RA 5IB4A 4ODHH 3U1SH 2H1PL 4RQQA 1ORQA 4HBCL 1D7FA 2NZIA 1TQBC 1U8QA 4NUJA 5IHBA 5I1DA 1NAMA 1I9IL 1WTLA 2A1WL 1MFAH 2XZZA 5DGQA 3ZTJH 5EU7E 4PJIA 4POYA 5JLZA 4JQVA 3D2UA 2QKIA 4KGJA 4OLUH 5GSRB 4PJAA 5I1AA 1RAMA 4X6FA 1I85C 3D0VA 1P1ZA 1G7JA 4OJFL 3K8LA 5DJ2A 4MNQD 5KVEH 3BP5B 3HRPA 1H8OA 2AQ2A 4DN4L 2YEZB 4WW2F 2XZCL 5DYOA 3ZDZF 2BK8A 4K2UL 5TDNA 1J1XH 1A7BA 3O11B 2P47B 3AM8A 1Q0YH 3BPCB 1N6QL 1MI5D 3OL2A 5H94B 1ITBB 5DK2B 5BZWA 1C5CL 5E24E 4WW1A 4TQEL 5DLMH 5E8DL 4RZCA 3MLRH 2EDBA 4HWEL 4NO5A 1F8TH 2PXYA 3VD7A 3O2VH 1KGCD 4ZOCA 2M26A 5JOPE 5CKAA 4NM8L 5C09D 1J12A 1INEL 3KXFA 3B2UC 3VFSB 3IVKB 4G9DA 5HGDB 4XI5D 4QTHA 4GQ9L 4HK3N 4MCYB 4Y19D 4WUUE 2DDQL 1FYHB 4YHIA 3A6BL 1VHPA 4ZUTB 4PJCB 1NC2B 1K2DA 1JPGA 1BLNB 4POZC 2A9NL 4PIRF 1NKOA 1EJOL 1G9MC 4KVCL 3CZFA 3MRMB 5JNYA 2DQCH 4QTIL 3BWUC 2W65A 1QPXA 1FSKB 2Q76B 5I8OL 5HHOE 1OAXH 2W07A 1CD9B 2ERJB 4U1GB 3U0TA 3RUGA 1XAUA 3LB6C 4MJ4A 4U1MB 3OR7A 3UTZB 4QRTB 1KEGL 1JRHI 1U8OB 4QRSA 1EVTC 4R26H 1S8DA 4MDIA 4XMLH 2XYCA 3ZT7A 3BD4A 4G6ML 2NTFA 1OSPL 2JJWA 4JFXB 1FFNA 1YPZB 4OZIF 2OL3L 2F53E 4BZYA 4NDMA 4WFFD 3RKDC 5DRNB 1F45A 4XCFH 1J8KA 4H8WC 3VGGA 1QPPA 4RFEB 5I6XC 4XTRC 3WFCL 3C5ZC 2VDRL 2UZXB 1UWXH 5IWLC 4HWBH 5KN5A 3VXOB 1UJ3B 1CDIA 3O6FD 3OAUH 2NNAA 2V5SA 2F15A 1O5DT 1MJ8H 1CLZH 5EZOH 5LQBL 1L7TH 2ZNWA 1KXQE 3LH2L 4ZO7A 4XMKH 1AKJB 2QSQA 1IFHH 2ED8A 4P4KC 3SDCB 1I1AA 3QIWA 3NPZB 4YC2C 4LLWB 1BZ9B 2X5PA 5JQHC 3GI9L 3D39B 4R7DA 3T4YA 5I1GL 5EC2A 1RZIA 5HYFA 3LD8C 5L6YH 1CI5A 2QADC 3JUZA 3FB8B 2Q87A 1LO3H 5HPMB 4G80A 5JW5B 1PGRB 3AC0A 5C0AE 2I07A 3QRFM 4ETQB 4JPIA 1H3XA 1EVUA 1QEWA 3MXWH 4I4WB 1VGEH 1OGTB 4WFHD 4FTVA 1X5IA 2CKBL 4LSVH 4M5ZL 1JF1A 4DCQB 3IB4A 3LKRA 4NQCA 3MROA 3ULUE 3LCYA 4G8EB 5A40E 3ARPA 3FFCE 5I71C 1BM3H 3WJLC 2Y6SC 4H1LA 4NNXB 4GUPA 5GJSL 2IFGA 3MRLA 1T7VA 1FC1A 1FYTA 1MREL 1OF2B 3L3HA 4JFQA 4UAOB 2BSSA 2DBLL 4HFWA 3KPSB 4JPWH 1Q8MA 3OG6B 2VDNL 1WBXB 4K23H 1J11A 4JFDA 2H9GA 1IC4L 1N64H 4TOYL 3HAEB 3SKMB 5JPMA 5E2TH 3UTTA 2ILLA 1YN7A 4JE4B 4F8QA 5KAQG 2KQNA 5IHLB 2RB8A 5E7FA 4WNQB 1PKOA 1RK0B 4WI9A 3LKPA 1CDUA 4H88H 4YBHA 2Q7NA 3QQNA 4U0RC 1I3RB 2ZUXA 4E5XB 1T04B 2XNAA 3X17A 2ZOKB 1IAKA 2VC2H 5DUPH 5KSVA 3QB7C 4K7PL 1J0JA 1LHZA 2KZ1B 5FK9B 1GRWA 5HI4D 4OD1L 5GGVY 4UNTA 4DEPB 2IC2A 1XGQB 2YD3A 2X05A 2VH5L 5MENB 1CCZA 3TIEB 3LV3A 1X7QB 1U6AL 3HI5H 2HJLB 1FL5A 1KPUB 1IGYB 4XXDA 4ELMF 1VFBA 1T3FA 4YDJA 3QCVH 4FRWA 3QZWB 1FVDA 1JPTL 3ARDA 2KBGA 4ODVH 5DQ9A 4YXLL 3TFKD 4ZOAA 4U6HB 1EHXA 2ESVD 2AGJL 5C08D 5KS9B 4O9HL 1LO5B 2OTWB 5F7DA 2DWDB 5IJVA 4AZ8A 2IAMC 1SY6L 4ZOEA 2VITB 2YPKA 4OCSH 1EMTL 1Q9OB 3O41B 1UEMA 2XY2A 1U8IA 1QFUL 2X9XA 3HS0B 4GRMA 3RZCB 2X44D 4Z76A 4PJ9B 4CKVX 3QCUH 4XVSL 5DA0B 1VESA 1X9QA 3WBDA 4L3EB 2A6IB 2P8MA 5FOBA 4PJDB 5BS0A 4DQOH 3S5LA 1YPZE 5EO9A 4NKDB 1MQ8A 4NNYA 3IU3B 4XPAH 1NCAH 1BF8A 1DQTA 3MC0A 3UCRA 1PZ5A 5BO1L 1XH3B 1OSZB 5IBTL 1RZJL 3NN8A 4KDWA 4UBDD 5DD0H 4GG6E 5L7XH 1EXUA 4R4NC 3H9SA 1DEEB 4HMDA 2ATPB 2EDKA 3NFPA 3VXRD 5IBUG 2IQ9H 1HXMA 3WHE1 2ZWLT 3OAYK 1YJDC 1FZJB 1NLDH 3EIFA 5EWIH 1ODAA 4HLJA 4KKLD 4TULH 5JIPA 5D1XC 4JY6B 4JFFD 4M1DL 2WWKO 2FHCA 3O3DB 2YN5A 3D39E 1Q0XL 2MHAA 4OCYL 5GGVH 4FABL 4GXUN 1K3ZA 5LWYH 1RVFL 4Z7UF 1AGDA 3S98A 4DK6A 1R5VB 4FQIH 1RFDH 5FYLD 1HCVA 3BT2L 3BEWA 3WFEL 3UAJC 2W9DH 1KEMH 3Q1SH 4LLYB 3B8SA 4ODXA 3KYNB 4M3KB 2UVEA 1MHPL 4Y4HB 4YH6A 3Q3GB 2EEBA 4LLVA 1GOHA 4MJ5A 4XPHH 2I60L 5FYJE 1A9BB 2VXSL 1F90L 1R3LB 2NR6C 3O9WA 2ZNXA 1MHCB 4QEGA 3FQWA 2AJYH 4M1CC 4JQXA 2X4RB 4NP4L 3RWCA 1T0PB 3CFKB 5JOPD 3EOYG 4JDZB 3KPSE 3ULUH 4H1LG 4RBPK 2Z4QB 1KNOA 1OL0A 3DMMD 5D1ZD 1L9MA 4XP6L 2JLLA 3NABL 4Z7QF 5HI3C 3H3BC 1JNNH 4RAVB 4WUUD 4XCNA 1A14H 3NCCB 3SGDI 3TF7C 5DJ6B 2IQAB 1YN6A 3C8HA 1YY8A 3AREB 3FN0H 5BQ7A 2O5XH 1P7QB 3ES6A 4P3CH 3P11H 5DHXB 5I1IL 3LSOB 4DTGH 1XGRA 4HKXB 3HE7A 4UQ2A 2X4PB 2D9CA 4IRZH 5HHOD 5ADOH 3BWAA 3EDJA 3ILPB 3VD4A 4JG0L 3PP4L 5FM4A 3FFDA 1G0YR 1JNJA 4PD4J 1RU9L 3QIUB 5TDPB 1GGBH 4XHJD 4LLQB 4MB5A 1CGSH 5BV7L 2YRPA 4MA8H 5MENE 4N1EA 1IGML 2F53D 5DHVA 5LGJB 5FFLA 2VLME 3HFMH 1IC7H 1QFOA 1UADC 3IDJB 4FXGB 4HQQL 2QHLA 3EYSH 5J57B 3F7QA 2QL1A 3AROA 4JFYB 2K7QA 1LILA 1YY9C 3VMOA 3EDEA 4GBXC 4MXWH 4L3CB 5KJRL 1ZTXL 4OBRA 1CL7H 1BBDL 5KS9E 3MUGA 4QOKA 2R39A 3GMRA 4XBEH 4X98B 1V5JA 4WI4A 4KFZC 5ID0B 2DLFL 1KENH 1UXWB 1MELA 5IFJB 4KMQA 1L7IH 3GRWA 4LCUA 1S9XB 3KGRA 4KTDL 1TVBB 1KIPA 2IADA 4MXVE 5FKAB 5JPNA 4ZAKA 4HUWB 4L3EE 3WCYA 1M4KA 4OFVA 4Z6AT 1KFAL 5D8JL 4PJDE 4I3RL 1D5BB 3MLVL 4FFZH 4G9FA 4I8DA 3Q6FA 4NPYB 3QWOB 3WLWC 5FO8A 12E8L 1MLCA 1JCKA 1EO7A 2FJFA 2V2TA 3U0PA 2YR3A 3H3PL 3BW9A 5E70A 5C0AD 3WIIL 2BVOB 4MQTB 4TUJA 4UT7H 3D18A 4WHYH 4L5FH 5IB1B 4HEME 3A67L 4PJEA 3WHXB 1VPOL 1A0QL 3I02A 4PGDA 1GCFA 5E4IA 1X3DA 1WZKA 3FQXA 3FFCD 4AEIL 5DQDH 5KVDH 5IHUL 4L9LB 1IQDB 1X5HA 2QEJA 4EI5A 5DJCA 2W9EL 1FNGB 1HHKA 2VUYA 1DBML 3GHBH 2R9HD 2I5YH 3CUPB 1WFNA 2LTQB 3WIFB 3L95B 2FYYB 5LBSH 4FQJL 5ACMA 5IF0A 4PGCB 1MY7A 5E5MA 1KIRB 4U49A 3E8UH 5H2BA 3ZT6A 1NL0L 2G60L 4Y5XA 5I9QC 4PRPB 1G9ML 4R0LA 1EAPA 3GJFK 3HHRB 1T21B 1BFVH 1U42A 3VG9C 4JHZA 1T2QL 1DTUA 4KKCC 3SE3A 5CP3A 3GIZL 1OAUH 1NLBL 3MOAH 5C9JB 3QDGB 2R1WA 3O81A 3OJDA 4X5WA 3KYAA 1S5HB 4DKAA 1AFVL 5MP6H 5EA0L 4JM2B 4D0DA 1H5BB 2RQ8A 4H8WL 1WICA 3D9AH 4PTUA 1MEXH 4N0CC 2BDNH 4Q6YA 4Y16C 1KJ2A 3VGAB 1FGNL 4PLJC 3NGBB 3QXAB 1BAFH 3DBXB 4LVHC 35C8H 1INQB 1NC2D 4FN0A 4G7VH 3GKWH 3VXQB 3JTSB 4QNPE 3WN5C 1L4IA 3TESA 3VFMB 3DETD 1IEBB 1Z3GH 1ZANH 3U4EB 1GPOL 5FECA 3HAEH 3STZA 4AMKH 4ZUVA 1BOGA 3GJFA 3QG6A 4JZOB 3QUKB 4RMUA 3RI5K 3TT3L 4UT6L 3MZGB 3HLAA 2VR5A 1Z6JT 3AMKA 4MCZA 5E99L 4MS8C 1LK2A 2J5LC 3DJ9A 5GRWA 5B38G 5HYJB 4GRLB 1RZ7H 4UUJB 2BXYA 2IBGA 5E8EB 4D8PB 4Z7WB 3KAAA 5EORH 3EHBC 1HDMB 5ENWB 4DN3H 2WUCL 4GMTH 4NBZB 1PBYA 1X6NA 5C0EA 2XZAH 3VRIB 2EEDA 1KCVH 3VXNA 3LN5A 3B3IA 3VFVB 4X5XB 3S97C 2ADIB 1Y6NR 3W9DB 2CXKA 4PRHB 4QRUB 5HYQB 2GK2A 5CMAB 1T7WA 4J3TA 5IMMA 5L2KB 3JWOC 3D85B 5HGAB 2IG2L 2F58H 3E3QC 4E41B 5CEYA 4U0QB 4LOUC 3CFIC 5GGQH 3VFWA 2F54B 1AKJD 5HGBA 1RUMH 3SDCD 5MEOB 4U1LA 2F8VA 1IKFH 2EIBA 3T8XB 2SEBB 3RDTB 3D39D 3K4AA 3GSNH 4LKXA 5J13C 4KROB 3VXTB 5DEFA 1E0OB 4Q58C 5FYKU 2VUOA 3HKFA 4OBSA 1QFWI 4FG6D 2G5RA 3H7LA 4G8GE 3VXMB 3ZO0A 1KXTB 4ZTPH 2OR7A 2PTTA 2EDNA 1WQVT 3UO1H 4KPHL 5I8KL 1B0GA 3Q2CA 25C8L 3QO0A 2X70A 3TZVC 1T20A 3K46A 1SEBB 1QFWH 1CDBA 2WP3T 2OK0H 4OQTL 5I1LA 1O7SA 4K3DL 1OD9A 4U3HA 3FHAA 5CWSB 5FYJD 4R4BA 5I75C 1H8SA 2AK1L 3QJFB 1ZWIB 2PKDA 1CDJA 5LAXA 5F9JB 3P77B 4OZIB 2VDQH 1QACA 5FUOL 1YEIL 1KELH 3QCTL 5HHNA 3MRHB 3BMWA 1BHGA 2OQJB 3IXTA 3NFNB 5I8CA 1P84J 4XP1H 4MAYC 4Z7OF 4N8CH 4D0CA 3EFDL 3VFOB 4GW4A 1G7QA 1FLRH 4PRPE 1AGCB 5GJTL 3QNZB 3SBWA 4RGMC 1KTDA 4S0TD 3JWDH 4YGVB 1YEDB 3ROOB 4EQ2A 2H1PH 1GC1L 1S7XA 5C0RL 1HKLL 1QSFB 4JVWA 2J6EH 4Q7DA 2OTUB 1AGBA 4Y4KB 4MNQA 3S4SG 4WV1A 1JZ4A 2F74B 3H7BB 5J89A 3IKKA 4BK5A 1TQCC 3QDGE 4S1QL 3X14A 4HUUA 1KSRA 4OJFH 5MEND 2H32B 3IKCA 4XRCB 3BZFB 4LPXA 1PG7X 3FT3B 2VLMD 3CDGA 4NFBA 4DOHE 3UZVB 4DN4H 3O3BB 4F57L 4C4KO 2VLLB 2EDWA 1QR4A 2XZCH 1P4LB 4AIZB 3JV6A 1TFHA 3VXPA 1N6QH 1HCFX 2HN7B 5BJTB 3T04D 1JPFB 2RIKA 4HD9A 4M7LL 1XGUA 2H26A 1YJDL 5E8DH 5E1AB 4Y5VA 5C09A 2B1AL 2O26U 2EH7L 3RWDB 1Q1JL 3T0EA 4HWEH 3IFPA 3PWJA 2VLRB 2AEQL 5TGBB 3RZCD 2APXA 3B9KA 3HR5B 4PJ9D 3MJ9L 5JA9A 3VFTB 4XZUA 5E9DB 1INEH 4IMKC 2VJXA 4L3ED 4HEPG 4A6YA 2YD1A 3QEQA 5HYJE 4F7PB 3I3DA 2CLRA 4GQ9H 2P1YA 3QFJB 4WFGE 1JZ7A 4Z7WE 2DDQH 4HZLA 4EUPB 3A6BH 5IROA 4EIZC 4DFHA 5HY9A 5J9PA 2A9NH 1EJOH 4LSTH 4KVCH 4JANA 5CEXB 1ES0B 3IETB 4EDWL 2DBJA 4IRJD 2MQ0A 4U1IB 4TTDC 4K3HA 4KI1A 3TCLA 2GQHA 4EI6B 5L2KE 2DIBA 3KHOA 2R1XB 3OGCB 4E41E 3V0VA 1KEGH 4UIKL 3ZDZE 1J5OL 2EEAA 3L3GA 4G6MH 1OSPH 5AG8A 3PP3H 1QSZA 1BGXH 2OL3H 4AM0B 2F54E 3JXAA 3KPMA 1OGAB 4RIRB 1PFCA 4RCAA 3IJHB 1BVKA 2R2HB 5ACLA 3AU1A 1QLFB 3OKMA 3TP4A 3BGAA 3NZHL 1DQJB 1FAIL 1A21A 3WFCH 2VDRH 3ARBB 3OHXB 5T5FL 4K8RH 5DRZA 3QUYC 3UTSB 5F7FA 1V3MA 1D6EA 1T83C 5KSBB 1YNTB 4ELMB 3DO7A 5LQBH 3LH2H 1IGJA 4DVRH 4K7PY 2OR8A 2NXZB 1JV5A 4R2GB 5D1QC 4ZSOE 3B9VA 5AAMA 3F5WA 2EE9A 2FSEA 5I76A 5T3ZL 3TBVB 2GKIA 1K8DA 5EOCL 4OD2A 3GI9H 1PYWB 1VSCA 5I1GH 4PJ5B 3QRGL 4Y4HD 4OZFB 2AV1B 5DTFB 3ZT5A 3E0GA 4Y2DA 3TNMB 5DS8A 2VE6A 3FZUC 4RRPA 5C0GB 3FB5A 5TE7L 4LVEA 1PX3A 1EX0A 2B7DT 1WIPA 2C1OA 4FQ2L 3VWKD 2OJEA 1QD0A 3OBAA 4UB0L 4LPYA 4MQ7A 1ZHKB 4OZIE 2XKSA 4UILL 2E7LA 4F3FB 2IEPA 4Q97A 3ZDYF 1JGLL 3O45A 3S96A 2ZUYA 3X3FL 2YBRA 3QWQB 5D5MF 4F9PA 2CKBH 2VAJA 2QLVB 3BZEA 3H9ZA 2Z8VC 4XX1G 1XF2B 1H3GA 4U1KB 2OCFD 1WITA 5BRZB 4IMLA 4LHJB 2EICA 5EZIH 3ARED 4ZFZB 1MRFL 5GJSH 1HHGA 1P7QD 3RL1A 3TPKA 1PAMA 1TZIA 1OVZA 3P0YH 3FT2B 4Z78B 4KZDL 1QSFE 3SE4C 4KHXL 4BZ1H 1E28A 5LKNA 2VDNH 1OTTD 5IM7A 5I17B 2O5YL 3QH3B 4TSCL 1JGVL 2VISB 1FBIL 3ZMRA 5F1IA 1MJJA 3KPOA 1K6QL 4LGSB 5I1JL 2BP3A 3AAZB 4MXQD 3UX9B 1JWMB 4RSVA 4Z7UB 4U6XB 5IEHA 4PRNB 5CBAB 1NANI 2V5YA 1A9EA 32C2B 3PWUB 4NN7B 4K7PH 1A6UL 4N9OB 4OD1H 1SJEB 1DLHA 1F11A 2EDDA 4X9GA 1QO3A 1WTGT 1KLGB 2OM5A 4L8BA 4GAJL 2X89D 4S1DD 4CN6A 2VLRE 4PJ7A 5I15L 1IKNC 1D5IH 1CBVL 4MQXD 2J8UF 2WANA 5E9DE 1ZLUK 3PWVA 4J12A 3I75B 1ZHLB 1T5WA 1II4E 2NLJB 5DZNA 1JF6A 3HPLB 1LMKA 4JFPA 5D6CB 4CN4A 3OKKA 4YHOH 4O9HH 5HVGB 4P57A 2KDGA 5J1TC 1FORL 3GIVA 4R90L 5ICYA 4RFNB 1SY6H 4XH2A 1EMTH 4G8GD 2GAZB 3ILQD 4O58L 4CU8A 4ZUSA 1FC2D 2VDLL 5GSVA 3O3AB 1HXYA 1G9NC 4P3DA 4I5BA 4XVSH 3FN3A 2YA1A 4JKLA 4NNPL 5CD5C 3TC9A 1LD9A 3UBXA 2UY6A 1ZHBB 5KAQF 4PJIF 2FX9L 4ZTOL 4R9HA 4PJAF 1CTNA 2LABA 4X7TA 1OGAE 2ENSA 4BSWB 1ZGLM 4LSRH 1CGXA 4YLQT 2A83A 2VXUH 3W5MA 2MJWA 3IJSB 3D6GA 4KI5C 5SWSD 5ILTL 5IBLC 5BO1H 3VXRA 2G75A 1RZJH 5FUZL 3TBWB 3MJ7B 3UTSE 5KSBE 3O8XC 4JFFA 4ELME 5L88H 4ZMAT 4PD4K 4GKNB 4HIEA 1V3LA 1CFVL 1TZGH 4M1DH 3LRHA 3VXUD 1ZHNB 3MNVA 4JPVL 1KN4L 1Q0XH 5IB5A 3MCKA 4PJ5E 4FABH 2HP4A 3A0OA 5GS0D 4P9MH 3ULVC 3QDGD 1QLRB 2C3VB 4MYWB 3SDDC 4F15C 1JI2A 2FBJL 4JM2D 2FL5A 3C5SA 1KLUA 2A6DB 4IDLA 3BT2H 4EN3C 3ARSA 4YNYA 3WFEH 4PGBB 4HX1B 1CLOL 4FQQB 3JWOL 1QOKA 3RUGF 1ACZA 1X4XA 5BRZE 3MUY1 2I60H 2E3VA 2VXSH 1F90H 3BP4B 3U36B 3DMMA 3FT4B 4JGMA 4MHHI 4NP4H 2HRPL 4K3JL 3F7YB 4JHBA 5GHWL 1UB5A 3LQAH 6CGTA 2FEDC 1UACH 4HWZB 2X9WA 1PEWA 1FE8L 4XP6H 3MR9A 1J8HA 5HYJD 3NABH 4GRLD 3ARFB 3CDYA 1U92A 4QXTB 4WFGD 4M61B 5JORA 3GSQA 4PP2A 5CLWA 3DI2B 3TH2T 5HHOA 2GJ6B 2WBJD 4OQ1A 5E8PA 1W72L 3MA9L 1GZQA 4NO3B 5DD6B 5FDWA 5T1MB 4RNRB 4Z7UE 5HGHB 4XCCL 5I1IH 1P4IL 1VB9A 3Q6GL 2O61B 1GGIL 5E5RB 1I8LC 3WEXA 4LF3A 4NQXB 4JG0H 3PP4H 4UDTA 5L2KD 1XIWC 1SVCP 3D85D 4ODUA 3TT1H 43CAA 4B50A 3QDMB 4AT6B 1FFOB 1YNKL 1MLBA 2DTSA 5IIEB 2F54D 1DQLH 2BY2A 4FQCL 1E27B 4IOSD 2P5WB 3MLPA 4OTXL 1S7QA 3MGTB 1S9WA 4ZFFB 3GSUB 4ZFGH 3B2VL 3RDTD 4HQQH 4KRNA 4OLWL 4PRDB 3RY4A 3RWEA 4KROD 4JDTL 3CFEA 2VDPL 5KJRH 3MACL 1BBDH 2A0LC 3NBNA 5GZND 3MLSL 4WWID 1W0WB 2DLFH 3IDGB 3D0LA 4LU5L 2VLKE 2BVEA 2N7AA 4XCYB 3S35X 2LV4A 3SCMC 4JZJB 1CXLA 3FOLB 3SJVB 3HZYA 5KANI 3DVGB 4EUPH 3INUL 1UXSB 4PLOB 1FFRA 3U7WH 4WJ5A 1FO0A 4DGYL 2Z35B 3HI6L 3K0WA 5A16B 3QEGL 3MLVH 4I3RH 5HXMA 5C0AA 1NH6A 3GSXA 5F89B 5IW6A 4P48A 2JB6A 4OI9A 3UBXG 1Q9WA 3AS1A 4RISL 5FHAL 1BMGA 4YEEA 3IGAA 1CS6A 5MERA 4PV8A 1KB5L 2ZSVB 3LQZB 3FFCA 5F3HB 1MJUL 2UY7A 3A67H 3V7AG 5DD3L 5I2IB 1OP3H 4M9OA 4QXUL 2HVKB 2IBBA 3V5KA 2EXWD 3RWHA 5MEQA 4WTZA 1F42A 1MSPA 5ABDE 4AEIH 3G04B 4P23C 2MKWA 4QHUA 3SQOL 3M8OL 5IHUH 1ZLSL 3NOIA 3K3QA 1NUFA 2AV7A 4X6EB 1LK3L 4BUHA 3GSOB 1QSFD 1DBMH 4Y4KD 1MOEA 1RUQH 4N68A 3VE0B 3I84A 3KHQA 4FNLL 4XGZB 5E6IB 3DYPA 2BOBB 3MCG1 1S9VB 4OAWA 5ESVB 1D6VL 1C7TA 3C6SB 5C8JA 2YEZA 5KSUB 4NQVB 4C83B 1XGPA 4FXKB 1MVUA 3PV6A 1NL0H 1SJVA 2G60H 2NW2A 3IAGC 5EDXA 1G9MH 1BQHA 3RRQA 1OP5H 4NT6A 5K9QI 1TXKA 3ZKXC 4CW1A 1UM4H 1T2QH 4BH7A 1U8MB 5DJ0A 1QP1A 3GIZH 5KVFL 1NLBH 3RGVA 4I48B 4XBGA 1HQRB 5DFTA 4E9LA 3ARWA 1AFVH 1CGYA 4XNXH 1WC7B 4LP5A 4K9EC 5HGDA 3QHFL 3G9AB 2VLRD 4I0PC 2QQNH 4QO1A 4H8WH 4DKFL 5K33A 5E9DD 4HKZA 1ETZB 4YPJA 3NACL 1FGNH 1T89C 4MX7A 2FWOB 1U3HB 4PRBB 5D2LA 1K5NB 3PF2A 5ALBL 3LEXA 1GGCL 1X5AA 2GJ6E 4XXCA 4AQOA 2XY1A 1AJ7L 5IMOB 2PYEA 3NCJL 4NQSB 1GPOH 2RR3A 3PDOA 4IJ3B 4ONHA 4RGOL 4P46A 4JFEA 3ZLQC 3TT3H 4UT6H 1NMCB 2ZJSH 3QQ9C 4LHQB 2CDEB 2BY3A 5E99H 2M1KA 1U8NA 3ROLA 1HINL 4HXBL 1N7ML 5C0JB 4U6YA 4WTXA 2E7MA 4G43A 2H3NA 2Y07L 3OQ3B 4HK3J 4TTGA 1OGAD 2AK4B 2P5WE 3OB0K 5TFSL 1U8PB 5CJXC 3V5HA 1P84K 2DM2A 3C6LC 3HZVB 5IESL 3D48R 3WS3A 4GG6A 4NKOB 5C1MB 4BZ2L 1A64A 1WBYB 1FJ1A 4HK0A 4RMQA 3ARBD 1DEDA 3MX0A 3P4OB 1NAKL 4Q6IA 3QHZL 4HJJL 5T5NG 4YXHL 1D5XB 2IGFL 5ICZB 1CXEA 2ZUQC 2NXZD 5DXWA 4R2GD 4Y5YA 3MFFA 1A6VL 1VADA 3R06A 3SJVE 5DFWH 3U48A 4CGTA 1NGYB 3FB8A 4PJ5D 2X1WL 5BCAA 1WIUA 1C8PA 2WLZA 4X7SL 4JCLA 5DJDB 4LKCA 1TCRA 3DX9A 4BQCA 2NY4D 3DPBA 1AH1A 3TYFB 2X4OB 5JHDA 1BQLL 3MRBB 2VMFA 4L4VE 5E2UL 3DRQA 1JE6A 3LS5H 1EUUA 4X4XB 4X6DA 3HE6C 2X7LA 2Z91A 3RWFA 1RJZB 4O2CB 2HJKB 1NMAL 1X5ZA 5FM5M 4W6WB 2PCPB 1JTPA 3VFUB 3FB7B 4GAYA 5DI8B 3GMNA 4KPHH 3C60B 5C70A 5DF0A 4XVUD 3KPLB 2AJXL 3ZL4L 5A2IH 25C8H 2UV3A 3U4BL 3D5OF 4QRQA 1BECA 5SX5K 4Z7NE 1A6TA 4K3DH 2Y9RT 5BRZD 2FO1A 2GT9B 4DFIA 5K9OB 4IM8A 4MA3B 2AK1H 1CDHA 4IIQB 2HTKD 5F9WC 4M7KL 1NEZB 1YYLL 2ADGB 4WTZG 5DK0B 1I4FA 3KJ4B 2A73A 5EIQA 1KCUH 2MKLC 4LSQH 4JO2L 5E00B 5FUOH 1YEIH 4WWKA 3MXVL 3T1FB 3BIAX 1CICD 2FHBA 3QCTH 3V8OA 4ONGL 5HD8C 3GJEA 4WI2A 4MAUH 2EKSA 5EZLA 3DSNA 2GY5A 5D96B 3QIBD 2FLBT 1P7KA 5JDSA 2WK2A 5HVWA 3EFDH 4OIIH 5LVEA 4ZUWB 5GJTH 3LKNA 1T04A 3QDJB 4ENEC 5CSBA 3CAFA 5F7EL 1GC1H 4CDGC 3TPUA 1G9NL 1CFSB 4AENB 3QA3B 1XGQA 1DANU 5EU3A 1BQHG 3C8KB 1W0VB 1J0IA 1X7QA 1A1NA 1J10A 4S1QH 4G6AD 1BFOA 4LCYB 5CBEA 3QUXB 1DQQA 1A4KA 2W92A 4ISVA 1JFQL 2R1YA 5T3XE 1NGXA 5IFAL 3NAAL 1Z9LA 4J6RH 4U6HA 3BH8B 5J12C 5F6IB 5IOPB 2P5EB 2W0FB 1LO5A 3MV9B 1MCKA 2DWDA 4MNGA 4O5LH 3REWA 3IDMB 5KVGH 4LSDA 4NBXB 3EJJX 3BH9B 4OFYD 3SKJL 5L0QC 4M7JL 5J11B 3BQUC 4PJEF 4M7LH 2DD8L 5DJXA 2ICWJ 1YJDH 2B1AH 2VLKD 1Q1JH 3FO9A 3IU4H 4ORGB 2AEQH 4PJDA 5TE4H 4KRPB 3CX5J 3MJ9H 3F7VA 3TBSB 2EDQA 2Z31B 1NMBL 1I8MB 3L3OB 1IAIM 3N85L 1FV1B 5C6TL 3MLWL 2EO1A 4IRJA 2AK4E 3RY6A 2V2XB 3TVMB 1CFNB 1UWGH 4GKZA 4OF6A 1C08A 5F8QC 4CMHB 3I6LD 2EDFA 1S7WB 5KTEH 5IHZB 3CSYB 4NHCL 4HG4J 3ZYOA 4K3GA 4XB7A 5AUMA 1KBGL 4UIKH 1EEZB 4QXGL 1FVCB 1MWAL 1J5OH 5EO1B 3ARGB 2J88L 5GRVK 3EDKA 2YRLA 1N4XL 4BFGA 5IB3A 1CR9L 5MEPA 4K7FB 3NFSL 3V6OE 4E42A 5IVXF 1VKXA 1FAIH 5BZDB 2AERT 3ZTNL 4L29A 2X4NA 1DL7L 2QQKH 3OGOE 4J3VA 4QHLA 2W60B 5T5FH 1AHWC 3CVHB 4WENB 4L8CA 4EBQL 5EIIB 5DJZB 5TH2B 2LAGB 3IJYB 2DYPB 3RAJL 4P2OC 3KYNA 5D2NC 3WUZA 2ZPKL 1OAQL 4Y4HA 1MCWW 4NJ9L 4XI5C 5EOCH 2BMKA 1NKRA 3FO1A 2WBWB 1T1ZB 3A6CL 3VWKA 1Z5LB 1H0DA 3G6JA 2APTA 2R69L 4P4RB 5IB4B 4RQQB 4YFLF 4OF0A 4MD5B 5TE7H 4NUJB 5I1DB 1NAMB 2LAAA 4PJIB 1H3UA 4LPWA 4UB0H 5JLZB 3PL6A 5FYKE 2W0LA 3D2UB 2QKIB 5I1AB 4PJAB 4UILH 4X6FB 4N0YL 3D0VB 1P1ZB 1JGLH 3VJ6A 3LQMA 2OJZL 4PB9H 3X3FH 1G7JB 5T1DL 3QSKB 5DJ2B 1A6WL 3AREA 3ARFD 1GIGL 5HHQA 3TH4T 4OKVA 2VWEE 4XBPB 1VFAA 4O02H 5K93A 5ESAA 4PJHF 2D9QB 2WQRA 4HKXA 4DJMA 1ZGLP 4AK1A 2GJ6D 3DI3B 5DYOB 1N5AA 2D7NA 3QDJE 5TDNB 1NFIA 3UTOA 5L2JA 3TV3L 4FQPA 4V1DA 3NIGF 5AYUL 4KZDH 5ETUB 5BZWB 4LCCC 5A2JH 4JQIL 4WW1B 5IQ7L 4XNZC 3O6FC 4RZCB 4P99A 4NCC2 1Y6MR 2E27H 3KWWA 4NO5B 4U7SA 2PXYB 1JGVH 3WNNA 1AY1L 1FBIH 1NBQA 2P5WD 1K6QH 4Y89A 5I1JH 1YA5A 2WWKT 4X9HA 1RD6A 4FA8A 1LE9A 2P5EE 2XTJB 4QTHB 3MV9E 5E2JA 2VZ3A 3T0AA 4YHIB 1JYVA 4P5KB 3RWGA 4XPFH 1K2DB 1IEHA 2Y36L 4I3SL 4OM1L 4L1HA 3CZFB 5JNYB 1MCLA 2NY1C 2W65B 2MWCA 4YO0A 5FV1L 3O4LA 2UUDK 5GGTA 3BIKA 3U0TB 2F5BH 5I15H 1D5BA 2FECI 3OR7B 4NPYA 3QULB 1G0XA 4FMFA 4QRSB 1A3QA 1S8DB 2DKSA 3QP3A 2NTFB 3EBAA 2CO7B 1FFNB 1DVFD 3AUVA 2CK2A 4G8GA 4NDMB 5DSCA 1U95A 2BVOA 5GS1C 1IC5L 2DJ4A 4LVNC 3HG1E 2XN9A 4L4VD 3LN4A 5C0ND 5KN5B 5IBUB 4O58H 1CZ8L 1IAIL 3GRWL 1GGYA 3GMPA 2EDRA 3MQIA 4PJXA 4XVJL 2C4XA 2NNAB 2AJUL 4NNPH 2FD6L 4ZXBD 1IQDA 2FX9H 3PDGA 5EB9A 4ZTOH 3TO4C 5F93C 1FNGA 1I1AB 3QIWB 5SWSA 5I0ZA 4JRWA 2EZ0D 4K9EL 4R7DB 3T4YB 5DGRA 1RZIB 5ILTH 5E94B 4FQLL 1IAMA 3U4AA 5E6ID 5IP4A 5HI4C 1RMFL 5FUZH 2MCPL 5ICXA 4G80B 3NZ8A 1CN4A 2H6PA 5F1SA 2NY2B 3VXUA 2I07B 4MA1B 4L8SA 4JPIB 1T0MA 1A7RL 2W59A 1QEWB 3B5HA 4JKKA 1RK1A 1TZHA 1X5YA 4FTVB 1CFVH 2XWJA 1JF1B 1UQSA 4NQCB 4ALAL 3MROB 3G6DL 5MHSE 4MDJA 4JPVH 3TFKC 5DVOA 4A2LA 1EHAA 1MCEA 4FQXA 2XKNA 4GUPB 1LO4L 3MRLB 1FYTB 3OAZH 3L3HB 4JFQB 2FBJH 5BMFL 2BSSB 4GJTB 3BVNA 5T3XD 4HFWB 5LGHL 4PJIE 2DRUA 2YD2A 1A6AA 5FO7A 4JFDB 2H9GB 2KKQA 3RX8A 5JPMB 3UTTB 1NDGA 3HRZB 5IB2A 1YN7B 3AB0C 4GFTB 4XB8A 1CLOH 1ZLVH 3P4MB 3QFDA 5D93C 3VFMA 1U3HD 1JZ2A 4NO0D 4F7MB 4P5TC 2ZUSA 4X4YA 3ARXA 3O3UN 3LKPB 1P7HL 2FRGP 2YSSA 2HRPH 3DO3A 3ESUF 4HGMA 2XNAB 4K3JH 5HYJA 1PG7L 1IAKB 4GRLA 4UBDC 3T0WA 4PPTA 3JUYA 3P0VL 1FE8H 2R56L 1KJ2L 2WBJA 3E6HB 5E4EB 4LLAA 3LV3B 3WIHA 4HCRA 4KKLC 2AK4D 5I73B 2L4OA 1IM3A 1FL5B 3S6CA 2OBGA 1N26A 2X4UB 5HYQA 2NY6C 1A5FL 5CMAA 3F6LA 4WDIA 4XXDB 5CHNA 1URLA 4YK4B 1VFBB 1T3FB 4YDJB 4D94A 4F9LC 3MA9H 1FL6A 1FVDB 1YC7A 2XTJE 2P24A 3ARDB 1YNLL 3E2HC 5DQ9B 1IQWL 4XCCH 1P4IH 3Q6GH 5EU7C 5FM8A 1XMWA 1GGIH 4UZGA 2LFGA 4FHBD 1IGCL 5IJVB 2YPKB 4YFEA 3DUSB 5CSGA 1U8IB 3NA4A 3O2DA 1YNKH 3DLQR 4S1RL 4GRMB 4Z76B 4FQCH 3DX7A 3BKCL 4NKQB 5SWQA 3UZEA 5DUBA 5C86A 3B2VH 3BKYL 2P8MB 1FFQA 3RQ3A 3S5LB 3HI1A 1RZGB 4JDTH 4LL9A 2VDPH 3CK0L 3MACH 4ZSOA 4S10A 4Z7VA 1KYOJ 4WEBL 3CXHJ 1JHLL 1PZ5B 3T0XA 4LU5H 5J8OA 4KHTL 4I18C 3NN8B 5CIPA 3HB3C 4NZTH 5D1ZC 1OW0C 3RTQC 1EXUB 2Q8BL 3H9SB 2IJ0C 3C60D 4YBLC 3NFPB 3INUH 4G42A 2P44B 1HXMB 3PGCA 2ATKA 4DGYH 3HI6H 5D4QA 3QEGH 5E2VH 3AS3A 1DBBH 5JW3H 1E4XL 3BPOC 4Q9QL 3EDFA 1RV6X 4RISH 2MHAB 5FHAH 2E7HA 5DZOA 4LQ1A 5FYKD 4HIIA 1HN1A 3OXRA 4JN2A 1FFPA 4XHJC 1NCWH 1MJUH 1VERA 5DD3H 4KK6D 4C56B 2GI7A 3DVNA 4YGVA 1MFBL 1UCBL 4QXUH 1DR9A 3IDYB 4MA7L 3U7YL 2AABH 1S78C 3WSQL 3JVGC 2OTUA 4ODXB 4FTVE 3SQOH 3M8OH 3DWTA 4NFDA 1MCBA 3MMEA 1LK3H 5EU4B 2EE6A 4AYFA 4MJ5B 4NSKA 4TVPE 4NO2A 4FNLH 4XRCA 4YXKL 4PUBL 1Q72L 3O9WB 3O0RL 3FQWB 2F8OA 1FYTE 1DCLA 1D6VH 4M8QA 5D7IF 4DKEL 1KNOB 3PE9A 3VGBA 4JFDE 1F4YL 2P5ED 3UTTE 3MV9D 5EFIA 3I6GA 1ADQA 4XCNB 2XQYK 3D87B 4I3GA 2AS5M 5C0IA 4HXAH 1YN6B 2D7TL 5ISZA 1FCCA 5KVFH 1YY8B 5BQ7B 4YDVA 2L0DA 4PJGA 5FB8A 4KJWC 1XGRB 1EHLL 3HE7B 4UQ2B 4O2FA 3GZKA 4M6NL 3BWAB 3OB8A 3BDXA 3QHFH 4EIGB 3FFDB 4NCC1 4F7PA 2RBLA 4KRPD 4W70A 4M7ZC 4DKFH 2WIIA 3FAWA 1LEGA 4U3CA 2Z31D 1IJ9A 4ZFOA 3NACH 4N0UA 3ULUC 3FO2A 5DVNA 2CPCA 5DHVB 3HPJB 3KPPA 5DMYA 4OZHF 5K59F 1ES0A 2FX7H 4WU7A 5ALBH 3CMGA 1GAFL 1GGCH 3HG1D 4TNVF 1JPSH 3NCJH 1WLHA 3QUZA 4UV7H 1JWUA 2R9HC 1E6JL 2G5BA 3AXLA 4I77L 5ERWA 4J4PD 2M2DA 4NUGL 3MUGB 4QOKB 3GMRB 5C6WH 3MSPA 3MRFA 4C55A 4RIRA 3KR3L 1R3HA 2X41A 1EPFA 1HINH 1N7MH 4HXBH 3LZFH 4JZNA 4LCUB 2B1HL 4P0DA 4Y8AA 3ARGD 2Y07H 2DQEL 2RCSL 3HC0A 1KIPB 3QXWA 4HWBA 2IADB 3OWEA 5JPNB 4ZAKB 3BESR 1ZAGA 3DURA 5DJAA 3MV8D 4JREB 3EAKA 1SYVA 3X13A 1U9KA 2D31A 4G9FB 5FM5O 3Q6FB 5F9AC 4KKAD 4BZ2H 5JQ6L 3BPLB 5TE6L 3UTPE 1BD2D 3ECBA 2JTDA 5EO0A 5FO8B 4JKMA 3FOMA 1Y6KR 4HW6A 1MLCB 4HJJH 2FJFB 3U0PB 3JTTA 3HMXL 4YXHH 1PKQE 3BW9B 1Q9LA 2E7BA 3MUHL 3T0VA 2IGFH 4OLVL 1RZKH 4TUJB 3D18B 1VDGA 2DYPD 1A6VH 4C4KT 1RUKL 5D71H 3BHBA 3P9MA 1QLEH 5BXFA 5AD0A 3H9SE 3MUJA 4PJEB 4PJBA 5D7JD 3I02B 1B0RA 5SX4H 1IGTA 1JTTA 4PGDB 4ELKA 3FQXB 5FDYA 3WFHA 4MGXA 3H42L 4X7SH 4ACPA 1G6RB 4IOFD 3BN3B 1CWVA 3DETC 4NRXB 3BYTA 4EI5B 1BQLH 4OD3L 2HA1A 1HHKB 1FQ9C 4XPGL 1FSKC 5I1EL 3ZKMD 1NPUA 4KJQC 4V2CB 3D2UD 2ERJC 4U1GC 1NMAH 1CD8A 3EO1A 5IF0B 5E5MB 2AJXH 3ZL4H 3CLEL 5H2BB 2FH6A 4C56E 1RHFA 3CX5K 4Y5XB 4C54A 4OLZH 1DBAH 4R0LB 2GJZA 2ZUWA 2ARJA 1EAPB 3FT2A 4I0KA 1FCGA 3O6ML 1BFSA 2Y5EA 1CICA 4WEUD 1I9RH 2YPLA 4JFOB 4NRZA 1YYLH 2E7CA 3QPQD 1UJ3C 3B9DA 2Z92A 2R1WB 4X5WB 3MXVH 1FG9C 1TIUA 3QIBA 2JE8A 5I1CL 5T5NF 5J4MA 3MJGX 3AAZA 4D0DB 1E4KA 3MRCA 4HG4K 4PTUB 3SDCC 5CBAA 3PWUA 3K80A 1KJ2B 3N50A 3HN3A 4H1LH 3SPVA 3BRDA 2XTJD 5JW4M 2CJUL 5F7EH 1G9NH 3PDDA 5F1KC 4DKDC 1OAXL 1A47A 2CKNA 3MBED 3H9HA 3WO4B 2WV3A 1V7NH 4FG6C 5FECB 3STZB 4XMLL 5HGGS 3QG6B 3GJFB 3WJJA 1JFQH 3K2UL 3HLAB 3RPKA 3HPLA 4HV8A 4MCZB 1LK2B 4OFYA 1GJIA 3ARZA 3TN0A 1F58H 4DGIH 4RX4D 4FZ8H 1CK0L 2WLYA 4F8TA 2VLKA 3O3EA 3QR2A 3N1MC 4W6YB 4OI8A 4OFPA 2BSTA 4JFHE 4M7JH 4GRWF 5C0EB 2DD8H 3VXNB 3OAUL 3LN5B 3B3IB 4UAOC 3G5VA 1FIGL 1PW3A 4MB4A 5IMMB 4BM7A 3R0NA 2Y06L 3AMLA 4QOKE 3C5JA 5CEYB 3D25A 1NMBH 3UDWA 2EE3A 4NWUL 5HGBB 2JB5L 3N85H 4WGVB 5C6TH 1H15A 1I1AD 3MLWH 4U1LB 5FAAA 4OFKA 3DXAD 4BQ9A 5GISH 2WMPA 1LO3L 5H8DA 1EIBA 4LKXB 1VEMA 5DEFB 3BXNA 4NHCH 5CJOL 3S35L 4RGNB 1KJ3L 1D9KD 1GL4B 4DEPC 3CSBA 3PHQA 3H8NA 4LSVL 2NY2D 2YRZA 1MWAH 4QKXB 1ZHNA 4NZDA 3X3GL 2PTTB 4FQ1L 2GTZB 2W0KA 2J88H 1LP9A 5GIRA 1B0GB 4XC1L 1R0AL 1N4XH 4Y4FA 5CINH 3QO0B 1CR9H 2X70B 1T20B 4PJEE 5LCVL 3NFSH 2FEEL 1I75A 5I1LB 5IGXL 3ZTNH 1NGQL 4TVPD 1DL7H 4JPWL 1KV3A 3D1MC 4OZFG 2R29L 4R4BB 1Y0LA 3EZJB 5E2TL 5D2LF 1N6VA 5CFHA 5LAXB 3RZCC 4PJ9C 3RA7L 3RAJH 4JFDD 1F4WL 2ZPKH 5HHNB 1OAQH 4NZJA 4NJ9H 5T1LA 5EPMA 4KDTC 5KOMC 5FA4A 2YHGA 5F7KC 4H88L 1YPZF 4D0CB 2EKJA 4DGVH 4GW4B 2FR4A 1KTDB 1RJLA 4GW1B 4B53A 1C1EH 1S7XB 4UOW1 2XG4A 2XWTA 2EXYC 3RFZC 1NCUA 1T1XA 4RMRA 3D3VD 4WV1B 4APQA 1JUFA 3ZKND 3WFBL 4GG6F 4JG1L 4N0YH 3X14B 4HUUB 1CTOA 3ALPA 1F4XH 5TPWL 2OJZH 4GAFB 3SKOA 1VCAA 5T1DH 1A6WH 3IKCB 3THML 5CGYC 2XICA 3CDGB 4ODVL 3P73A 3S3PA 2E6PA 3JV6B 3L1OL 3ARDD 3TV3H 3LMJL 3VXPB 3HUJA 5AYUH 3JWDC 4AT6A 4JFZL 4HC1A 5IQ7H 1XGUB 3BJ91 2H26B 4JQIH 5C09B 4Y5VB 1WFTA 5F7LB 3T0EB 3IFPB 2H8PA 3PWJB 1AY1H 1QFPA 4DQOL 3B9KB 3ZE1F 5FHBL 4XZUB 1IZKA 1F00I 1EFXA 4DUXA 1KCRL 3U30B 4A6YB 3QI9A 4XPAL 1WF5A 3QEQB 5GRXG 4UQ3A 4Y4HC 3UTPD 2VERN 4HZLB 5H35A 5HY9B 4LBEA 4UU9B 4W6XB 3S37X 5J9PB 4I3SH 4OM1H 4JANB 1H3PL 1BEYH 2B2XL 2GSIA 3TCLB 1CXHA 5J06A 3VI3E 2R2EA 2UVFA 4TULL 1DVFA 1DN0A 2L7JA 3H9SD 3V0VB 3EYUL 2VLJA 5F89A 3HZKA 4M48L 3L3GB 3JV4A 3RIFK 3KPMB 4L4VA 5GGVL 1HHJB 3MLZL 5BW7C 2COQA 1BVKB 3CMOH 2QSTA 4PG2C 2P8LB 3AU1B 3V6BR 4IDJL 4KMLB 3OKMB 5LWYL 3PWPD 3P0GB 4JHAL 5SWZA 1CZ8H 1IAIH 4ZXBA 3GRWH 5CD3B 1QZ1A 3JZ7A 3WFDH 1MRCL 4RGNE 2VSDA 3QIUC 5DRZB 3PNWA 4XVJH 2AJUH 1D6EB 3WD5L 3RPIA 3HNVH 3DO7B 1WT5A 4C56D 1F3DH 1IGJB 4X6EA 1XCTA 1JV5B 3L7FA 1IL1A 2B8OT 4MXQC 2FSEB 5I76B 4M3JA 3VE0A 4K9EH 1K8DB 5JIKA 4OD2B 1GH7A 2ZP0T 4FFVD 1K8IA 1O7VA 4Y2DB 4FQLH 5DS8B 1I7RA 3ULUL 2VE6B 1IC1A 1KCKA 3O9WD 5F97E 2MCPH 2C1OB 1CF8L 2RFXA 1I8KA 2OJEB 3T0DA 4MQ7B 4POZD 2IPTH 3GB7A 4K8RC 4L4TA 1ULVA 4WUKL 1A7RH 3O45B 4YZFE 3S96B 4MQXC 4A2MA 5T3ZE 5EIVA 1KC5L 1LVEA 3BZEB 3LB6D 4WU5A 1HQRA 4KVNL 3G6DH 4PJDF 4DTGL 4LAJH 5F7WC 2VRAA 4IMLB 2X42A 5EUKA 5ADOL 3RNQA 2PO6A 1HHGB 4C58B 1TZIB 3HE7D 2Q3ZA 3ILQC 3RKDD 1CGSL 4GO6B 5LGHH 3MA7B 5DEGA 5FXCH 4XTRD 1E28B 5E8OA 2ZSWA 3C5ZD 3FTGB 5IM7B 4RDQF 2IPUK 1KYOK 4N8VA 4NO0A 3C08L 3CXHK 5D9SA 5F1NA 1UC6A 1WWBX 5LGKA 2APWA 4YJZL 1A22B 1MJ7L 4WO4A 5IMOA 5F1IB 1MJJB 3KPOB 3U9UA 4YFDB 2QSVA 3V2AR 3BOVA 3VGFA 1FG2A 2G2RA 4JFHD 4MXWL 5CP3H 1GHFH 4L9LC 3TA3A 1CL7L 4OLYL 4EOWL 4M4PA 5INDA 2MQCA 5IEHB 2IFFL 3GNML 5CZVH 4CJ0A 3LHPL 5CJBA 2KUTA 5IVNA 5JXEC 2LTQC 1OAYH 3KPRE 1FZMA 4QOKD 4AEHL 1OAKH 3K74B 3DYMA 1DLHB 3P0VH 4OCWL 1QO3B 1XF3A 1VEPA 2ADFL 2R56H 4L8BB 1KJ2H 3T0EE 4PJ7B 1P9MA 4NKOA 4FFZL 3EYFA 4RA3A 4ZAKD 3FKUS 4PY8I 3PWVB 1T5XB 1YUHA 3UXFA 2GITA 1T5WB 3QEQE 4YHNA 3WS6C 1YNLH 3GMOA 1IQWH 4JFPB 5L8KB 1J0HA 3CDCA 2ZG1A 3BO8A 3GUTB 4UT7L 1P6AB 2DM7A 3EOBA 1IGCH 4TUKH 3GIVB 5ICYB 4XH2B 4JM2C 1H5BC 2Y6SD 4ZUSB 3F65A 3GSNA 4S1RH 5GSVB 3G6JF 1HXYB 1FNEA 3NPSB 4I5BB 1C5BL 3BKCH 4QT5B 3EYOA 2PNDA 3QNYA 3VGAC 5KVDL 1PLGL 1LD9B 3UBXB 3BKYH 2UYLA 2QSCL 4X7TB 1HE7A 3GHBL 3MRBA 1CIUA 4KUZL 5F88A 4PBWD 1OCWL 3CK0H 1V3KA 4W81A 4EI5D 1AR1D 1IARB 5A3IC 4WEBH 2D0GA 3S34L 1JHLH 2PETA 1QBLL 2MFNA 3VXRB 1YC8A 1ZA6A 2G75B 5GPRA 5I66A 4PJFA 2Q8BH 1FL3A 1QVOA 1TTGA 4JFFB 3SGKA 1HI6A 1MCFA 2YOCA 3LKSA 1UVQA 5HDQH 5F8RC 1MH5A 5I8EB 4XWGL 3MOAL 4Z0XA 5GZOD 2DM4A 1E4XH 3MNVB 5IB5B 3MCKB 4S2SB 5JA8B 1V7MH 2YPVH 4LVOB 3TEUA 2CIIA 1G7HA 1XR8A 4U05A 1HYSC 5FYJL 4CJ1A 3C5SB 2ZOLA 4WFHE 1MFBH 1UCBH 2IAMD 4YNYB 2VR4A 4LPUA 5MI0B 4HT1L 3WSQH 1IZJA 3QA3A 1BAFL 3FAXA 4WFEE 35C8L 3RDTC 3MV11 1OWWA 1Z3GL 1VFMA 4KROC 2GHWB 2BJMH 4LRIC 1ZS8B 5INCB 4PUBH 1Q72H 3BZ4A 5GZNC 4K3EH 4GKSA 3O0RH 4HKJA 3DMMB 4JRXA 5EN2B 3UJTL 3BH8A 3GBMH 3J7HA 3QBTB 2W0FA 5DQJA 2C3XA 3RZWA 4DKEH 5C0FA 4LSPH 2EC9T 3ARRA 1F4YH 2ZCLH 3MR9B 1J8HB 4GMTL 3BJLA 1U92B 1I7ZA 1KCVL 3GSQB 4PJXF 4PP2B 4Z0BL 1C16A 5HHOB 5I74B 2I25N 1CIDA 2D7TH 5E8PB 3K1DA 1GZQB 5FDWB 4EZMA 4M93B 1P2CB 3TBSA 2O5ZH 1EHLH 1YEGL 5KVMC 3T3PF 3CFJA 4M6NH 3WEXB 4LF3B 4UDTB 3WDHA 2JJVA 5BOZG 1DUZA 3QUMA 1HH9A 2BOCA 5FGBC 43CAB 5KSAA 2X10A 2ARWA 3X11A 3GM0A 4LDOB 5DR5H 4HMEA 3VFRA 1MLBB 3HG1A 4U1NA 3LQAC 2EXWC 4KK9D 1ZMYA 2OSLA 4PJ7E 1S7QB 1S7WA 1S9WB 2VZSA 1IGFL 3PGDA 3V6FA 1IEAA 4HFUL 43C9A 1MIEH 1ZSDA 3SQBA 4AG4H 4CNIA 1M7XA 1HEZA 4NWTL 3RWEB 2R8SL 3O2WL 1E6JH 4Y4KC 4EEEA 3F58L 3CFEB 4I77H 4RGND 4ZTPL 3ARGA 4NUGH 1HKFA 1HYRC 4IRSA 4MVBD 5FCUL 3D0LB 1YMHA 3KR3H 4NN5B 5FKPA 4JM2F 3MV8A 1QRNA 2B1HH 2OK0L 4M1CD 2DQEH 2RCSH 5D7KE 5GGRB 2GCYB 3HZYB 1NJ9A 3OKLA 1BD2A 4Y7MA 1T7YA 1Z0MA 4WJ5B 1FO0B 3OMZA 1OTUD 5JQ6H 3QDAA 5C0AB 5TE6H 4HSQA 5DJZA 3GSXB 4UIMA 5JW4R 3KLHD 2VDQL 5IW6B 1ORSA 2JB6B 1LEIA 2OZ4L 1Q9WB 3SDAA 1KJMA 3RIAK 1REIA 5D7JA 4OLVH 3IGAB 3K1KC 5MERB 4PV8B 4U31A 2JCCA 3QG7L 5K59E