4LVOC

Crystal structure of pfsub1-prodomain-nimp.m7 fab complex with added cacl2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
214
Chain Sequence
QVQLQESGPDLVKPSSSLKLTCTTTGYSISSGYSWHWIRQEPGKSLEWMGYIHYSGSTDYNDSLKARITITRDTASNMFFLQLSSVTSDDTAVYYCVIYRYDGQWVFDDWGAGTTVTVSSAKTTPPSVFPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPGVLQSGLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor/immune system
molecule keywords Subtilisin-like serine protease
publication title The malaria parasite egress protease SUB1 is a calcium-dependent redox switch subtilisin.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 43
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lvoC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lvoC01
2PW1A 4WWKA 1C5DB 4P2QB 1J9CT 2WBWB 4X9IA 3WHXB 1H15A 3O3AA 2AGJH 3QFJE 3KYOA 3NN8B 4PJBE 3WIHH 5HHOB 4FFYL 1SYVA 2CLZA 2W0LA 4LASH 1PQZA 3HI5H 5HJ3B 2JIXB 5GZOC 1CYGA 5I19L 3NCEB 5ICYB 3C09C 3P9WB 3VDAA 1DANU 3MRJA 3ARGD 4P4KB 1KTKE 3GSVB 5EC1A 4TNVK 4I9WD 2XTJB 2BZDA 4YWGL 3CH8A 4NOFA 5C0DB 4G5ZH 4JFFB 1DEEA 4NKMB 3MZTA 1TVBA 3P9LA 3QDGE 3QA3A 1TZGL 3T04D 5B8CB 2QQKL 2LTQB 1CVSC 1T1YB 2YC1B 2AI0H 4LEOB 5MP6L 5EH1A 2VXUL 4CU8A 2FEDD 1FSKB 4C58B 3OPZH 5GZNC 1J7VR 4OZFA 4Z95L 5ICZA 1NUDA 1YYLL 5KW9H 5JHDE 4JO2H 3S5LA 3THMH 3G6JB 2ZSWB 5HYSA 5CWSB 3IRZA 4P5MB 4PJHB 1YPZA 2VDKH 4WDIB 4XNUH 4YDVA 2R9HD 4I1NB 2A74A 2Q3ZA 3RGHA 4X4MA 2GIYA 5LAXB 1LEIB 1HINL 1B9ZA 4UAOB 1KJ2L 3UEZA 3GRWA 4P23D 4DTGH 4P46A 1JPFA 1G7LA 3L3DB 1BQHB 3FT2A 3WHE1 2V2WA 4N90D 2EDLA 5M7QA 3EKCA 5HYIA 1KN2H 2CIKB 4FQXA 4G9FE 5L6YL 3Q0HA 2QSCH 1D6EB 3GMRA 2J1KA 5IR1B 2P8LA 2IFFL 2NW2B 3MBEA 3F7RA 3MRLB 2PR4L 5KOMC 5K9QG 5TF1L 4DEPB 2L4OA 4TVPL 4Q9RL 5H35A 3SCMA 4K71B 2W92A 3K74B 4LDLB 3KPSB 4MNQB 1I1AC 2E7HA 3DMMB 2GY5A 4ZPTA 2VAJA 5IG7A 2H3NA 3BZ4A 3AM8A 4N9GA 2FWOA 1RI8A 3CFJA 2EIDA 1MAML 2HYMA 1BVKA 2X89D 1JZ4A 4LPYA 3O8XA 5EB9A 4OCNC 1XZ0A 3QI9A 2LTQC 3E6HA 5DJ0A 5DJAA 4Y4HC 2HFFB 4YBQD 5DHVA 3O2DA 1CIDA 4MAYB 4NM8H 4KQ3L 4XB8A 4HIEA 3T65B 4ZUVB 2YA1A 4GLRI 1CQYA 1I1FA 4CDGC 5DJ8B 1LP9A 1WIUA 3UPRA 4BQ8A 2F15A 2QHLA 3QCUL 5EZLB 4X98A 3RY4A 3VFUA 4JY4B 2W60B 5D93C 1IM9D 4WWID 1AHWA 5FYKL 5GS1A 2QHRH 5I0ZA 5AAWA 5FHBH 3HAEG 3HZKB 4DGYL 3NFSH 3BIBX 5JPMB 1LDSA 1A9BB 3A67L 7FABH 2B39A 1T5XB 5L2KA 2J2ZA 1QG3A 3D0LA 3BPCB 5DQDL 4JE4B 1FBIL 4X99B 3HE7B 4JQIH 3QSKB 1V3LA 5AWNL 3CVIH 1QFPA 2FHBA 4GSDL 5D9SA 3IGAB 5D1XC 2M2DA 4GRLD 4CN4A 4K07A 3QG7H 4PS4L 2ID5A 5CMAB 1NEZB 5CJXA 2E7LA 3FFCA 1F4WH 1N5AA 3DWTA 1IAKB 3U9PL 5H94A 4AEIL 4LLDB 1KJVB 4DVBB 3GJFK 4JREB 2APBA 3BKCL 1DVFB 2KKQA 4L8CB 4JDZB 4MJ6B 1B0GA 1PFCA 1RZIB 4XC3L 4Y5XA 3UDWA 5BXFA 3MLYL 4OFVA 5CSBA 32C2B 4IOFD 4PY8J 1RUMH 2CJUH 3JWOL 3F7VA 3FMGL 4L9LC 2Y06L 5I1KL 2YN3A 1HXYA 2BSTA 3V52H 5IP4A 4GRWE 2ZCHH 4LGRB 2NXYB 2HLFD 3ROLA 4YHML 4HKZA 1AD0A 5HPMB 1XCTB 4GBXD 5DJDB 2W9DH 5HPOA 3VFRB 3QUYB 3CSYA 1VESA 3UBXI 4HPOL 4AIZA 5HHNA 5HI4D 4AJ0A 3QEQE 3OAUL 5E2JA 2BVQA 1KLGA 4JY6B 2X10A 2IQ9H 4WUKH 4W68A 4PRAB 4Y2DC 4W81A 1UM5H 2FD6L 3F7QA 3HCVB 4YHOH 2Q7YB 3WFCL 3QIWC 5I0DA 3DO7B 2WNGA 4KK8C 1H3WM 1CDYA 4X4YB 4N8CH 2FHFA 3X12B 1Q9KA 4TUOA 1CDUA 1OW0C 3BD5A 3HE7C 4AY0A 4KK9C 3ZDZF 4XGZA 4FQCH 4HIJB 1LO4L 1XEDA 4X7FC 1QQDB 3T0EB 1CLCA 1NCWH 5ALBL 3CFKA 3C9NA 5EO0B 1ZSDB 3KNBA 1MQKL 3WFEH 4ZSOB 2BY2A 5BVJA 3P77B 1M6OB 1MCWW 1BP3B 2YD8A 3FRPA 1PYWB 2VLMD 5FM4A 1CDCA 3V4UH 2DYPB 2G5RA 3C6SA 5DUBB 1JYVA 4LPVA 1XGUA 5EO9B 4HKJB 1SEQH 4LSTL 5IFAL 2IAMB 4YDIL 1FYHB 1RIUH 4X5XA 3QXUA 3QPXL 4ONFL 3S88L 4P59H 5HHOE 1KPUA 4NPYB 4PJ9A 3MOBL 4HMCA 5DEZA 3LEXB 5DVKA 4XWOC 5EZJA 1T21B 5DFTA 3EOBA 3N1MC 4JVPA 1HNGA 4N0CD 3HNTL 1S9VB 4HF5H 3LEYL 5F6HJ 1UWEH 5EOQH 3GSUA 3OKOA 4HK0B 1IT9L 4IJ3C 4L5FL 4NHUA 1NBVH 3B9KB 25C8H 3GJEA 1MCLA 4KHXH 4PG2C 4K9EL 1AP2B 1ADQA 1D9KB 3PHOB 4Z7NE 2DJUA 3FRUB 4YE4H 4N8VB 1LP9F 4CU6A 4YXLL 5J3HD 4KJPC 3DGGB 4ZS7L 8FABB 2FATH 5I1EL 1WCBB 3HMXA 5GRUL 2IPTL 3OGCA 4X80L 4D0CB 1FLRL 2Y36L 1ACZA 3MRIA 3K80A 4MNHA 2DDQH 5FF6A 1IGCH 4OSUH 3SO3B 3FL7A 4JFOA 4LU5L 4V1DB 1VB9A 5HGBB 1JZ5A 5C92A 1N2RA 1RPQA 3EIFA 1BZQK 5DEGA 5JORB 1QPPA 4TVSa 1UA6H 3BP7B 2NY7H 1G9MH 1DQDH 3W5NA 1UXSA 2H9GB 2HVJB 3W2DH 2AJXH 1HXMA 5C0IA 4OIAA 4Z8FH 3V6ZA 1JHTB 4EN3C 4ZD3L 2QV2A 4WI8A 2C3VA 4XVSH 3MRPA 5CEYA 3B2UC 2IAMC 3PL6C 3CMOH 3ZE0F 4NNYB 1U36A 3KPLA 2VLRB 1FHGA 5IHUL 2UZYB 5FKPA 1XH3B 5EZOH 2X4NA 3KPSE 5TQ2L 4MNQE 1V05A 4GRWH 5IF0A 5B38G 5BQ7B 1E6OH 4S0SD 5C71A 3T3PE 4GO6B 3V0WH 4N0RA 1MRCL 1D9KC 4J2XA 1IC4L 3DV4B 4LBEA 4Z7QE 4OCWH 1Q1JH 2OK0H 2VXQH 3HB3C 4MXVE 3A6BL 2A2QT 5FKAA 5GJTL 5DWUL 5JR1H 1M7IB 2HRPH 4NKDB 5F7EL 2GSIB 5FUOL 3T3MF 4A6YA 1WUNT 5EIIA 1TQBB 1GOHA 1MNUL 5F7DB 4CRPA 1UCBL 3WKNA 5D7JB 1L9MA 2NLJA 3BKMH 1KCRH 5DJXB 4TYUA 3MGOA 3T09A 4OZGE 4NQDD 5CZKA 2PXYB 3M1BA 1ZV5A 4F7MA 2DM7A 2WQ8A 1IQWL 3O11A 4I3SL 5C8JB 3TBSB 3O4OB 2Z92A 2R1YA 2FJGA 1DQQA 1ZT1B 2P49B 4GG8A 3U2SA 2NQCA 1EMTL 3TO4C 2EC9U 5FGSA 5LGKA 3VXTA 2IGFH 1ZGLB 5EFIA 5GIRB 1CF8H 2OR9L 4JG1H 4M6OL 1XIWB 4WWKB 1WC7A 3VMOA 3QUXA 5FM8A 2FZ3A 2Q6WA 3VRJA 3T4YA 1I1AD 3CFBA 1SHMA 3VRIB 3OZ9H 3O3AB 4KUCF 4NQCD 3KYOB 1QFUL 3RNKA 5JXEC 1JPST 3BESR 2EZ0D 4KDVA 3KPPB 3QXVA 4H26B 1F58L 1SYVB 2CLZB 5D8JH 2DWDA 4EKXA 1J0KA 1QSEB 2UWEF 1BD2A 5J6GB 2JB5H 2DQJL 5CEXA 5EC1B 4DKAA 3S35H 4Z5RB 2XWBB 5IFHL 4UMGA 2FIKB 4RISL 3NCJH 1NMBH 1OAUL 1EVUA 2AERT 1Z9MA 5HVFB 1DEEB 3SDCC 1HOCB 1T04A 4OLZH 4X6CF 1T89A 1OGAB 2YWYA 3JVGA 1EJ6A 2Z91A 3IU4H 1EGJA 3FB6A 1KCVL 4EUPA 2FR4A 3RWIA 3MFFB 1WITA 4OZFB 2DQGL 5I16A 5ICZB 1QA9B 5J13C 1TQBC 3O4LD 4FFZH 3BVNA 3TV3H 1ZVYA 5TF0A 3CCHA 5D7JC 4MJID 2VIRA 4J3WA 3I6KA 2NZ9C 1YPZB 1AKJD 1MJJA 4L29B 4LSVL 2PXYC 1A3QA 4JPKH 4YDVB 4NO3A 3L7EB 4CMMA 1OAKH 2H8PA 5D1XD 2E27H 4B53A 3MV11 4IRJC 4ZNEA 1FYTA 1SEBA 4YDKL 4OAWA 5F7FA 1PGRB 1RHHA 1JPFB 1G7LB 4FN0A 4B7LA 2CMRL 1KTLA 3MLPA 4WWKC 1IKFL 2V2WB 2RFXA 3T0EE 5J1AB 3BJLA 3I2CH 3FO9A 4FQXB 1P7KA 2EDWA 4ZSOE 3GMRB 5EBLA 2P8LB 4PV8A 1S9KC 3MBEB 4TTGA 4RAVB 1OAYL 4UT7L 4I3RL 1N0XH 1OLZA 5H35B 3SCMB 2EDNA 4W6YB 3WHE0 3BPOB 3CAFA 5F96L 5C0NC 1FFPB 2R56H 2FBOJ 1SMOA 4OGAC 2XA3A 2CUIA 2H3NB 4NZTL 3CFJB 1C08A 1DDHB 1N5YL 2VR4A 1S7QA 3B9VA 3OB8A 4UV4L 3PP4H 5IB1A 1XZ0B 3P11H 3E6HB 4L4TD 3G6DL 1OPGL 3GI8H 4LSDA 5DMGD 2UZIH 1MCFA 2HT2C 4Y2DD 3RVUD 3HRPA 1G1CA 1K5NA 1JYWA 3F58L 4HFWA 4XPAL 1TZIB 4XC1L 4KK8D 3HI6L 2VKXA 1OB1A 1P2CA 2A77H 1WT5A 1K4CA 3VFUB 4X98B 4ODWB 1YN7B 2YD5A 4KK9D 2E6PA 5FOBA 4R0LA 4Y16D 4NO0A 5BW7A 3HNVH 5L2KB 3HC0A 5D71H 2AJZB 4MXQD 4R8WL 4WO4C 4YDLC 4ZYKA 4P46C 1E27A 3WBDA 4Q97A 2F5AL 3X3FH 4N1CA 4C56D 3HC3H 1CGUA 1LO3L 1SQ2N 3MUGB 3QP3A 2DQCH 3QIBA 1NH6A 4NQSA 3VXRA 4YFLF 4BH7B 3FFCB 3PGDA 1EAPA 2YRZA 2I07A 2V9QA 3QUMA 5HD8D 2F8OA 4PREB 1KPRB 4MMZC 3FO0L 5H94B 4YHPA 1F4HA 4ZTOL 3SCMC 3PQYB 3BD3A 1LE5B 1AD9B 4OZHF 1M7XA 3DX8A 5ADPH 3EZ8A 3WLWC 1HSAB 1D5IH 1E28A 3OSKA 4XP4L 3RI5K 2M26A 5EOCL 1UKSA 1PZ5A 3ILPA 4Y5XB 1F6FB 2YK1H 4W4NA 3LS4L 3MYJA 3UYPA 3F7VB 4H5SA 3O8XC 1BOGA 3QI9C 4KJPD 2BSTB 1HWHB 3ROLB 4HKZB 3FN0H 2BK8A 3V79C 1Z6JT 4JB9H 3CSYB 5BS0B 1JP5A 3ARVA 3FO2A 2BVQB 4PY8I 2ZPKH 2NX5E 3L5JA 4XMKL 1RMFL 4MQTB 3RPKA 5ACZB 5ECJE 4HWZB 4I3GA 4WJ5A 3VE0A 4TOYH 1AHWC 4X6BA 5GS1C 3TNMA 1KIPA 2P42B 1INEL 1NGPH 4EBQH 3PIQB 3EO9H 3KPQB 4PLOB 3O3EA 1I7UB 1K3IA 2BNQA 3MRMB 1OM3L 1IKNA 2P7TA 2YRLA 4XAKE 5ISZD 2BNRE 2OLDA 5E2UL 2HLAB 1X5IA 1Q9KB 1FL5A 3SJVA 1RUQL 3WV0A 1BX2A 1IAIL 1QNZL 5F1OB 4EN3D 4M4PA 1TZHA 2DQDH 4XGZB 1A3RH 1FFOA 1QRNA 4OLEA 5MEQB 3B2UD 1FZMB 1Z2KA 3PL6D 1FPTL 1N64L 5CJXC 2E7LC 5IW6A 5BVJB 4PD4K 3NZHH 2DLEA 1IGFL 3MLTA 1HNFA 2JCCF 2R23A 4Y19B 1NAKH 2XA8H 1XGUB 5KS9B 1JRHH 4QXTB 2VITA 5I1AB 4H20H 5C2BL 1LEGA 4LQ1A 3DIFA 1Q8MA 1KPUB 3TIEA 4KK5C 1BM3L 1ACYL 4D8PA 4Y5XC 3VMPA 5E9DA 4D0BA 1D5BA 3UDWC 5C0CD 1WBZA 5ESVA 5BO1L 5KANG 4CAGA 2DI9A 4U05A 3CFCL 4NO2B 3GSUB 5DHYA 3OKOB 5D7IA 5FYLL 5T5NG 3OQ3B 1YJDL 2APVA 2R0KL 2F58L 4OZ4A 1UYWL 4NHUB 3IDGA 3CC5B 3MOQA 1B88A 5DSCA 4E9LA 4RIRB 1AQDA 5DD3L 3G6AB 3S34H 3LDBB 1SMAA 5JDJA 1IGIL 3SDAD 3VA2C 1YEFH 4K3DH 5F6HI 3U36B 2AQ3A 2F9BT 4UTBL 4LLQA 4XI5D 2E6QA 1SVCP 1OF2B 2AJYH 4KZEH 3Q6GL 1MLCA 1CZ8L 2KDGA 1AI1H 2CQVA 1HHJA 2NY5C 3CMGA 2BDNL 5FF6B 4C4KT 3GJFA 3ARUA 1KNOA 4KQ4L 4MVBC 1YPZE 3S37H 5HI5C 5FYJH 3TWCH 3ETBF 1N2RB 5IESH 5ID1B 1ZGLM 4XCNB 4JO3H 2A83A 4X4ME 1CGSH 1CDJA 2VDOL 1EHNA 2CH8A 2GTWA 4GQ9L 5DEGB 4MCZB 1BGXL 1MRDL 1DBJH 4TUJB 1PLGL 3AUVA 4XTRD 1UXSB 1PG7H 3MZGB 1HXMB 4CNIB 1WF5A 2GCYA 2G60H 3QB7C 1J86A 5KSVA 5GGSB 1SJEA 3O2VH 2H26A 1MFAH 3C2AH 2NY0D 5L9DH 5CEYB 1Y0LB 1A9EA 2F8VA 3JV6A 1K6QH 4PJ9C 4YFEA 4ZXBB 5L2JA 4Z7VA 3SDCD 3TH2T 2IBZY 2Z31C 3FN9A 3U48A 2X4NB 5CKGA 4Q9QH 1UWXH 2EH8H 2HA1A 3K2UH 4ONHA 3WNPA 4M48H 2XZAH 4HW6A 2H2SD 5BCAA 2IJ0C 4ZAKC 3G6JF 1MFBL 3PWLA 4U0RB 3V6OA 1ZLVH 3BFOA 4GXVH 2OP4H 4PJGB 4RX4A 2X7LB 2ZCKH 4LBEB 3PWPD 2A73B 5JQ6L 2FECI 5I18L 5FKAB 5T1DL 3X11B 5L88H 1A1NA 5ILTH 2FX7L 4JG0H 5GQBA 3VGAB 1GOGA 3OV6A 2ERJC 5IB5A 3TN0A 4IRJD 3WO3B 1J0IA 4YPGB 1LP9E 1OLLA 2FJHA 1CDBA 3JV4A 3DHMA 5HY9A 4OM0H 3FQUA 4FZEL 4OZIB 4RFOL 3VI3F 5C08A 4JQVA 1A0QL 3CXHK 1OCWH 3RZWA 5IJVB 4ODBD 1T2QH 1NCCH 3TBYA 2XN9D 5L2KE 4P3DB 4QRPA 5IM7A 1DQQB 3SPVA 1Y18A 3CNKA 5I1DA 2WBJD 1AXTL 2NY3B 4YIQB 3BEWB 1O5DT 2NW3B 3VG9C 1EHLL 1LK3H 1INQB 3ZKMC 3PV7A 3VFNB 2FZ3B 2Q6WB 5DMJB 3FFCE 2VXSH 1OAZL 3VXQA 1Q72L 1MEXH 3RNKB 4P0DA 1WFUA 2CLVA 5KVGL 4UTAH 2DWDB 4P9HH 1N6QH 1BD2B 4XPHH 3N85L 3ZE0E 5CEXB 4NN7B 2DF3A 2HT2D 4FS0A 5IB3B 1WAAA 1MF2H 4X9FA 4POUB 5IHZA 3QDMA 4Z7WB 1OD9A 5CCKH 1P84K 2FLBT 2ITDA 4JFPB 4CADA 3HAEA 4G43B 2BSED 4MXWL 3UTZA 4OZFH 2G75A 3FB6B 4WHYG 2FR4B 4Z0XA 1DQTA 1BEYH 1GGBL 3ULSB 1A7NL 1SY6A 1ZANL 4WO4D 5DA4A 1NGWB 5C86A 2VIRB 5I8EA 1N26A 4P46D 1MJJB 3ARZA 4NO3B 5T3ZE 1V3MA 4CMMB 4HWBA 2H8PB 3V5HB 3GRWH 3QR2A 3IDXL 5KVDH 3V7AG 5IIEA 1DUYB 2X5PA 3DTXB 3IDUA 4DKEL 4OAWB 1Q9LA 4XPGH 5BRZA 4Y5YC 3SDYL 1KTLB 2YMXL 1BQLL 1NBYB 2OXGA 2RFXB 3QUXC 3T0AA 1R24A 3QXWA 4X7SL 1XR8B 3PP3H 3FO9B 3WLWD 3WO4C 2B7DT 5IQ7H 1BZ9A 2OCFD 4PV8B 4NO5A 4DK6A 4TNWK 4QRTA 4MD5A 4ODTH 2Z8WC 3WFDL 5ID0B 5MEND 3WDIA 5IB2A 1ZLUK 4OIIL 5C0AB 3QI9D 3HRZA 4Y2OA 1YEDB 2CIIA 3ZE2E 3PDOA 2VL5B 1XF5A 2Q7NA 4YHKL 3S9DB 4UNUA 3IJSA 3QUZD 2FGWH 3LZFL 4PG9B 4M3KB 5CGTA 5LGJA 5EA0L 2VR5A 1C08B 1OOAA 4S1DC 1S7QB 4EIZC 1FNHA 3E3QC 2XNAB 5DHVH 3O2DH 1PAMA 3E2HB 5E08L 2DI7A 3ZL4L 3JVGC 4KJQD 3AB0B 1RU9L 1I7RA 1LD9A 1VERA 4XCEA 1OT1A 3C87A 1CXLA 4QTHA 3KYKL 1MVFA 4CN1A 1UFUA 4HXBH 4HFWB 4ZUTA 2C7UA 4GUPB 5T1LA 4QRSB 5SWQA 1P2CB 1WWBX 1C5BH 5C09A 5C0JA 1K4CB 3NIGF 2W0KA 4L3EB 3Q6FA 4QOKA 1HCVA 5FOBB 1GCFA 1F8TL 5CJQH 1T20B 3EJYC 4ZFOL 4NO0B 3ULVE 2LVCA 4K3EL 5IMMA 3HC0B 4XNXH 1QVOA 2ARWA 1MCWM 4OLWH 1BOYA 5CJOL 4JM4L 5JXAH 3BSZH 3OTTA 5GRJL 2LU3A 5JHLH 5C0EA 5K59E 1G9NL 1NMAL 1EFXD 2YPLB 2X9XA 4GAJL 2CDEB 3GB7B 3WNLA 3HG1A 2D7TL 3CSPA 2IMMA 3SQBA 1KG0A 1NLBL 1EAPB 4YHZL 1MHHA 4KK5D 3QUMB 5TE7L 2MJWA 4NBYB 5E56A 4YHPB 3PHSA 2VDLH 3PJSB 5JW3L 5CSZB 5DJCA 3AU1B 3DX8B 3P4OA 4XP1L 2BFVL 3U4BH 4GKSA 4PRHA 4YK4B 3ARBA 2VDNL 2X1PA 4KZDH 3P4NB 5HHQB 1PZ5B 4XBEL 4U1GB 3MYJB 3UX9B 2VQ1B 4H5SB 4YXKL 3STLB 3RDTD 1JMXA 3U82B 3TJEH 3WNNA 3VD5A 3CX5J 5D1ZA 4NNPL 3ZLQC 5T1MA 1T6WA 4LCCA 2SEBA 4U1MA 2CKBL 4RGND 1MHEB 4MVBD 1BBDH 5C07D 3B5HA 4JRXA 1UVQB 4Z7UB 5T3ZH 1AXSA 3VE0B 3TNMB 5EU7C 5DK2A 1KIPB 2P5ED 4R0LC 5BW7C 3ZKXB 3O3EB 3WS6A 3QIUD 2BNQB 3TBWB 4OZIE 4YGAB 2E3VA 1A6ZA 3KPRA 1X5HA 3VA6A 3EGSA 5JMRA 1BX2B 1GZQA 1NAML 4H1LA 5CSGA 1KACB 1JWMA 2VH5L 4LKXB 1FFOB 4MCYA 5T5FL 1QRNB 4PIRF 2YSSB 4KUCD 1FLTX 3QIBC 1CD8A 1MCJA 3EYOB 5HHPB 1QPXA 5I1IL 1ED3A 5B39G 4FQIL 2BSRA 2J3SA 1N59B 4LPXA 2HKFL 1NC2A 2Z31D 3BHBB 3MLTB 1K2DA 1YEHL 2BCKB 3PV6A 4F9PA 4O9HH 4DN3L 4ZAKD 4GMSH 3TPKA 1DLFH 1CD0A 1LEGB 1W0WA 1TPXB 5E2VL 3DIFB 1MPAH 2VJXA 5L8JB 1AR2A 4KTYA 3TIEB 1YEJL 4D8PB 4G7YL 5KJRH 1BD2E 4U6VL 2F54B 5ESVB 1P53A 4IRSD 3KHQA 3KYAA 1GRWA 5JW5A 1J5OL 5D7IB 2PW2B 5C0BB 2ZUWA 2FNBA 3PXJA 5TPWL 1A1MB 1OD7A 3IDGB 2ESVA 4XNYH 4PJIA 5DSCB 4KJYB 3FB8B 3W9DB 1MFNA 3X13A 1JWSA 3E3QE 3BI9X 3L95A 1U9KA 2HH0L 1UM6H 1TJIH 3IFPB 1MCEA 1YMMA 2GAZA 3HMXH 5GISL 5LKNA 5C0RH 2YS4A 5DXWA 2WP3T 2XQYG 4ZO6A 3W0WA 5GHWL 1R3LA 3MOAH 2ADFL 4LSPL 4WHDA 3ULVH 2DJSA 1F3JA 4PRNB 5GGQL 1VGEH 5J11B 1MLCB 1OSPH 3EYSL 1F42A 2BJMH 4KTDH 3RVXC 2AXHA 3X14B 4JN1L 1HHJB 3Q1SL 1EO8L 1IKNC 4R2GB 3VGBA 2OSLA 3GJFB 1P5VA 1KNOB 1CXKA 3AMLA 1RUAH 1U2HA 3JWDH 3LRSB 4ZTPH 5ITFA 2YRPA 1T5WA 1IBGL 2A83B 4YEEA 5EU6A 3REWA 4TPRL 4ZNEE 4XVJH 1AGDB 2FO1A 5IW3A 3V5KA 1A22B 3VWKD 2OJZL 5C6TL 1J8HD 1FYTE 2AEPL 1YQVL 3N9GL 4X8JB 5AAMA 2GTZB 1UCTA 4PR5A 1EJOH 4OQ1A 3INUH 2OR7A 3QDJB 3BD4A 3U7YH 4PJAB 5IOPB 2UY6A 1FVDA 5TDOA 5KSVB 2AEQL 3H8NA 1SJEB 4FP8L 2XPGB 3KJ6H 3JV6B 4P3CL 4U7SA 2WUBL 3WUWA 1TPXC 1LDPL 3MRGA 4K3HA 2JJVA 3S4SG 2FJFA 1ZTXL 4Z7VB 5MERA 1C5CL 2KUTA 4NRYB 3VW3L 5GXBB 4X6DF 5EU3B 4ONHB 5SV4A 2VOTA 3RL1B 3MRDA 1DBKL 2XXMB 3BH8B 2EDXA 5J12C 1YUHB 5SWSD 5GS0C 1TVDA 4S1SH 2D03H 3T1FA 4I0PA 2I5YH 4XB7A 3VXSA 4IDJH 1KJ3H 2PTUA 2J12B 2P47B 1OP3H 3BE1H 1RZFH 4K94H 2Z0BA 1IL1A 4WW1B 1YNLL 1QHPA 3GHEL 3BO8A 5IB5B 2F53B 3GK8L 5J11C 4ZUWA 1RZ8B 1ODAA 2ICWJ 4DZBB 7CGTA 4P57A 3KJ4C 3FQUB 1AFVH 4Y0GA 4HX1A 1PDKA 2I27N 4MJ5B 5EU7E 5C08B 4Z77B 5IBUG 4G8EA 3U7AA 4K8RC 4PGCB 4HJ0D 3QUXD 4OCSL 5KN5B 3WFBL 1R3IL 1I85C 2ZWLT 3JSSA 2XZQH 5IM7B 1M7DA 5D2LF 2DIBA 4OCRH 1Y18B 3SKUD 4I48B 3DVNB 3OJVC 5I30H 1TLKA 2FX9L 1U3HD 3IJYA 1MIML 4G6FB 1JNLH 2YOCA 3GMLA 4OJFH 3KR3L 3VXRE 4AH2B 5ALCL 5J57B 4UILH 3IF1A 2ZNWA 3VXQB 4HS8L 3LIZH 1B2WH 5FYJU 3MACL 4LIQH 1KPVA 4S1DD 4M62L 1M05B 4G8GB 2VABA 4HZLA 4U49A 5IVNA 3ARRA 4EOWH 1BQSA 4BSVA 3QHFL 4NRXA 1EUUA 1XCQA 3SDXF 3V6OC 1VGKA 3JXAA 3C08H 1JCKA 3QDMB 4YGVA 1CICD 1EGJH 4CADB 3HAEB 3VXNB 4YNYA 4JANA 5I1HH 1VA9A 3UTZB 3MRBA 3ESUF 3KS0H 2J8HA 1QBML 3TN0C 5ACMA 1DN0B 1KN4L 4HGKC 5GSRA 3TT1L 4EXPX 1CLYL 4HAGA 3UTTA 2HMIC 4F8TA 4H88L 2DQHL 2J8UB 2XG4A 3I50L 3DX6A 4NN5C 3T2PA 2LU7A 4ONGL 4JQVC 2XQYK 4JFDA 2FSEA 2WIIA 3PXHA 4MAUL 2BNQE 1SM3L 5FA3A 4HK3J 3UJJL 5EULV 3SJVE 1WIPA 1M1SA 5BRZB 1L7TL 5T1KB 3MGTB 4FQLL 4PJ5A 1QRNE 1QRKA 1IC7H 1R24B 4HBCL 4YBLC 5KVFL 2YPKA 1YY8A 3QEUA 4NO5B 4QXUH 3C60D 5C0GA 3M17B 4RWHA 1MFCH 4YX2L 5IB2B 5F7YC 3P0VH 2Y25A 2MWCA 4DZ8B 5TE6H 4G3YH 3CFEA 2VISA 3H9SA 3IDYC 1HYRC 2R1XA 1MRFL 1MCHA 3PDOB 1XF5B 2IG2L 2MKWA 2C1OB 4Y4KA 3IJSB 3L5WA 5E9DE 4Z0BH 4KKBC 3U4EB 2RB8A 4XPFL 2OMNA 5D7IE 4F37K 4QXGL 3GBNH 2ICWB 4E42A 1JZ7A 1LD9B 3B83A 1OQOA 2PETA 5TE4L 4QTHB 3RUGF 1J05A 1CVRA 2C7UB 2EO9A 3ZE1F 3RX5A 3R06B 5HYJD 4P2QD 3CVHB 4UQ3B 1LO0L 1BVZA 4QOKB 1N3NA 4Y4FB 2P4AB 1WTLA 4XXDA 5I1GH 5GGVL 3ILQD 3V6FA 1QVOB 3FONB 2HKHL 3VXRD 3WXWH 1MWAB 4PGDA 1FNSL 1RZJL 4DAGL 3QQ4A 2VLJD 4XBPA 1NDMA 3HE6A 2B5IB 4AEHL 4RBPK 4QF1B 3S3JA 3LQAH 5I1JL 1BFSA 4U33A 5C0EB 4OBSA 4LARL 1OY3B 3KHOA 5D96B 1FL6A 2Q8BL 4LSRH 2IFGA 4WU5A 2EDTA 1NFDA 3HG1B 3TT3H 1GHFL 1Q9WA 1XF3A 3QUMH 5DJZB 5F1NA 5LWYH 5MHSD 1KG0B 2NTFA 4R9HA 4PB0L 1LVEA 4F7EB 3N1GC 1MHHB 4LPWA 3QDJE 2JB6A 3A6CL 2X4PA 5IHLB 1EZVX 3EYQD 4JR9H 1QSFA 1NSNL 1N7ML 3FOMB 3W9EA 3LMJH 4PRHB 1OP5K 3V0VA 1R3HA 1JGUL 3LH2H 3HZVA 1U8KA 4WFGE 4Z7VE 4F58L 1WFNA 4DGIH 4XAWH 1JNHA 2XYCA 4EQ2A 2KPNA 4PJ8A 1DQJA 1UQSA 3D9AH 3NABH 4G6JH 4BZ1H 3I75B 3HMWL 4HUMB 3MV9D 4AIOA 4WFHE 3V6OE 4G80A 2VDQL 4FHBD 3PWJB 1ZHNB 5D1ZB 1KC5L 3GIZL 4WEUD 3RVXD 3MPCA 5T1MB 1G0YR 4M1DH 4U1MB 2SEBB 3FQRA 5DC4B 1CFVH 2IPUK 2W1NA 1P9MA 3GSWA 3D87B 1AO7A 1HKLH 1KJ2B 2IANB 3RX7A 2P5WA 4HJJL 1EV2E 3PDGA 5INDB 4FXKA 5D1QA 4JHBA 2F53E 2A0LD 3REVA 4CMHB 3L1OH 4WFFE 4YZFE 3GZKA 3NIGE 1AJ7H 1QYGL 2C9AA 5AG8A 1YNKL 1U93A 3E6FA 5C08E 1A6ZB 3K7UA 2BC4A 3KPRB 4URTB 1F90H 3EGSB 1GZQB 2VE6A 3ES6A 1BLNA 5ABDE 5CEZE 4KTEL 3RTQA 3MV8B 2IALB 4QRPE 1GOFA 3QRGL 4ZQKA 3WS3A 4XRCB 4KKCD 4F57L 2YD9A 4P99A 2EYRA 5H2BA 2P8PA 5B38B 5BVPH 5E9DD 2D9QB 2XZCH 1FC1A 4HG4J 1J1XL 3FB7A 4KXZH 3PDDA 1HZHL 5E8NA 3TPUA 4IBLT 4LLVB 3PV6B 1BQUA 5DC9B 3QCTH 4PLJC 1JVKA 4U3HA 3FQXB 3SKOA 4R90H 2V7HB 4Y7MA 3NTCL 1JF5A 3ZKND 3ARBC 2R69H 5HDBF 1NEZG 3UROR 5ADOL 1T0PB 4CJ1A 4OD3L 3TZVA 3BWUC 1HHKA 3O3BA 3ZTJH 4WY7H 5DZLA 4LEXH 5B21A 2DTMH 3W81A 1LO5A 5DJ2A 5HGAA 2DWEB 3KLHD 2VB5A 3N50A 3DX7A 4N5UA 1R5IB 2ESVB 4PJIB 5IEHA 1WAAE 3DUUB 2GT9A 3IYLW 1JWSB 3MRNA 3QDME 5F9WB 4QHLA 3MJ8A 4D94A 3MLWH 5K93A 1A6VL 1S8DB 1S7UA 4LCCC 2GAZB 4M6MH 1MY7A 5AUMA 3W5MA 1JGEA 4NFCA 1PBYA 5I74C 1R3LB 4JZJB 4D0DB 2OM5A 3GJFH 4HT1H 3MRFA 2UVEA 2VUYA 5GGUA 3WS6C 4JQXA 4CMHC 1KEGH 3QG6A 4M6NL 2RBLA 2OSLB 4WUUD 2DQIL 1P4LA 2DKMA 3MLRH 3O0RH 4K8RH 3C5JB 4XP9L 2PTVA 4CVXA 1IGTA 3OJDB 4YR6A 4ZOAA 2EE9A 3ARYA 1KLUA 1A7QL 2HWZH 1T5WB 1JGLL 3D1MC 5EU6B 5CGYC 4PLKC 3V5KB 1VFBA 2AK1H 4K23H 3H7BA 5DS8A 3SE4A 5IMOA 1L7IL 4JDVA 3V9FA 3GHBL 1E4XI 4WI5A 4KMTL 3MODH 5BRZE 3MLXL 4ZODA 5CD5C 4JDTL 3TM6A 2BOCA 1GGCH 1FVDB 3RHWK 4OLYL 4GOSA 4PUBH 2DTSA 2NY4B 3CSGA 1RJYB 5F71A 3BUTA 4F9PC 2EYSA 3QUYD 2M8XA 5IGXL 3CK0L 3VXUA 3V95A 1CBVH 2J7LA 4TN9A 1I7TB 2VN4A 2FJFB 4ENED 5MERB 5T3XE 1Z9LA 1IQDA 4GKZA 3KXFB 1DFBH 2LV4A 2CGRH 2MFNA 5E24E 4P2RA 2DBJA 4H8WC 5I73B 3H3KA 3EDFA 3LKPA 2VSDA 3MRDB 4MNGB 5MEOA 1M71A 4JKPL 4OCXL 5DHXB 4ORGA 1CFNA 4HJGA 5ELIA 3T1FB 2B2XH 4I0PB 4DFIA 4OCYL 3VXSB 4GG6B 3N0PB 2HMID 5K9KA 3BPLB 3IVKA 3WXVL 1RY7B 1IILE 3QO0A 1IL1B 1D6VL 2Q76B 5DUPH 2NY6C 4NC1C 4X6EA 5ESQB 2EH7L 4QRPD 5C09E 3WE6A 3KWWA 4P57B 4ZDHB 2XIDA 4MSWB 4N8VG 4QOKE 4JHWH 4HX1B 4UIMA 1XGPA 5CEZH 4AQOA 4EDWH 1ZAGA 1NCDL 1UACH 2P24A 4EVNA 4JHZA 1CFQA 4TULL 1M7DB 5D7LD 2ICWI 3U0WL 4OKVB 4LCUB 3SN6N 3M8OL 3LV3A 5DFWH 4QGTA 3STZA 1MHPL 4RWYH 1IM3B 3B9KD 3D85A 2RIKA 3IJYB 1I8LA 1FFNB 4X0KA 5EG6C 3GMLB 3HG1E 3CDFA 1BAFL 4QEGA 4OI9A 3JWOC 4EI6A 3B5TA 2BOBA 3IF1B 3I9GH 2AGJL 1HH6B 1P4IH 2CK2A 1KPVB 3DBXA 2VABB 5I6XB 1B6UA 2IBZX 4LASL 4DW2H 1OVZA 4HZLB 1G7JA 2IPKA 4HUXA 4PRHE 3KGRA 3TYGH 3MA7A 5DT1H 1JHKH 2D7QA 5KZCD 4BSVB 4UNTA 4NRXB 4V1DD 4I0CC 3S6CA 2WUCL 4FABH 1VGKB 3E0GA 4FFVC 4G5ZL 15C8L 4I0PC 4NQXA 5GGTH 3HAEH 3TBTA 3ARGA 5FYJD 4YGVB 2BVYA 1TNMA 1E4XH 4ZMAT 1CXHA 1KTDB 2DM3A 3WEXA 3M45A 1FV1A 1SY6H 2D7OA 3RPIA 3IS1X 4K2UH 4LLYA 3CX2A 5J1TC 2F8XC 3HZYA 5IVZA 1CD1A 1EPFA 2MCPH 5DVLA 8CGTA 4OV6F 2DRUA 3BH9A 5TDNB 3CDGA 4RMTA 2KL6A 4JRXE 4HWBH 5DRXA 1B6DA 2P8MA 4LMQE 2YEZA 1Q38A 2W9EL 5F9DC 2FSEB 2VLRD 4LCWD 1G84A 2WIIB 3DVGA 1BFOA 2IEPA 1GC1C 1LWRA 4R3SA 4X7TA 3KPRE 4AG4H 4C57C 3P2TA 4ERSL 2EXWD 4PJ7A 1IC5H 4AEFA 3ARQA 3TF7C 3GI9H 4TVPE 1CLOH 5IKCB 1YN6B 4OTXL 4OGZA 4P23A 1H5BC 1OARH 2YUWA 1CLZL 2YPKB 1YY8B 4POYA 1FGNL 4NKOB 5C0GB 1U6AH 3BGFC 4S1RL 4K9EC 3O3DA 1FDLL 1NCBH 4JFYA 2WLYA 1PEZA 5HVHC 3WIFA 4E5XB 1NCUA 3GBML 5C70A 2PCPB 3T1WA 4BQCA 5I8CB 1EBAA 4H0GA 2WP3O 4LSQH 4MMXC 4PPTA 2ED9A 3O6FB 3SE9H 4P5KB 4AEEA 2ARJQ 2CDGB 5E8EA 4LSSL 4OF8A 5ERWB 4HUVB 2ESVE 1CE1H 4PJIE 1F4XL 2W38A 4JKKA 2Y4SA 5FYKE 2X89A 3F5WA 2WWKT 1NCAL 2I26N 1I9JL 1WIOA 3CVHH 1EH9A 4I13B 5I75B 1YMME 4G42A 3NIDF 2BVTA 3DRQA 4QTIL 1ADQL 4NWTH 3W0WE 3HI1A 3BW9A 3DROA 4KROC 1N3NB 4QO1A 4NC1E 1RSFA 4XXDB 5HXMA 2Z8RA 5IMLA 4W6WB 1MWAH 3F7PC 1TFHA 3ZT7A 7FABL 3LY6A 1WWWX 3STBA 1HN1A 1IM9A 3S5LG 4P48A 4PGDB 1WZKA 3QQ9D 5ANMA 5HYSG 4XHJC 1NDMB 3DETD 4FFYH 1ZK9A 4CJ0A 3U0TB 5EBGA 5EU6E 3MX0A 1IGYB 4MS8D 5I19H 3CVIL 1X4YA 1FL6B 1S7RB 1Q9WB 5F1NB 4M9OA 3VFVA 2NTFB 4YWGH 2Y72A 1QO3B 3FQWA 5KSUA 4GRLA 5B4MC 4QYOA 4APQB 2JJUA 1TZGH 2QQKH 4HIHA 4YQXL 3ELAT 2I24N 4XP6L 5MP6H 1G7IB 2I9LB 2R0WL 1R3HB 3V0VB 3LB6C 4OT1L 2GYSA 1QKZH 4Y4KC 4Z95H 1YYLH 3NA4A 2IH3A 1F3RB 1DQJB 3B8YA 3TCLA 5I1CL 4YHNB 4KKLC 2IMNA 1ORSB 3AREB 4JRXD 4XVUC 5CP3A 1WBYA 2VDML 3GIVA 4NWUL 4UUJB 1BF8A 5F6IB 2EDDA 3SGDH 4OF3A 5CHNA 3L7FA 3RA7L 4BQBA 3VXSE 4J1UA 4GG6E 4I2XA 4CDHA 4M5ZH 1HINH 4NN6C 4YPJA 1KJ2H 3FQRB 3FTGB 1AO7B 3H3PL 3K4ZA 4W4OA 2P5WB 2BVOB 3RWHB 4GBXA 1TVHB 4TSCL 4OLXH 4PLKD 3HS0A 4K3JH 2ICES 4YHOL 5DURB 1WZ1L 4AL8L 2IFFH 4A6YL 2EIBA 3O6LL 2P48B 4JCMA 1DUZB 1Z0NA 2BC4B 1S7SA 3D3VD 3PWUA 3QISA 4LCIL 5CD5D 3HE6C 3HUJB 2UVFA 1NC2D 3VFSA 4TVPH 4WHTA 5AG9A 1BLNB 3AC0A 2M1KA 4UOW1 3OX8B 4WV1B 3UAJD 3SGJA 4XCYA 3S4SA 3WS3B 4NKIH 4Y8AA 4NQED 1DE4A 1R3KB 4PJDB 3S3PA 1ZT4A 5GGRA 3PE9A 3TVMC 5H2BB 3WFEL 2CKNA 3WIIL 4LVNB 3FB7B 2O5XH 3TPUB 1FNGA 2MSPA 1V3JA 4JZOA 5FV2A 5AYUL 1SEQL 2ICEB 2YD6A 2VXVL 1F4YL 1MVUA 1RIUL 2F74B 1UB6B 3K46A 2QKIA 4P59L 4Q6IA 1IAOB 3O3BB 1DZBA 1FORL 3WNMA 1WJ3A 4PJ8C 5DJ2B 1YMMD 4HF5L 3QCUH 1V7ML 3DX7B 3W0WD 5DD5L 4L8SA 5FYKH 3VRLE 5FAAA 2X4OB 5IEHB 1CE6A 2NY6D 2GT9B 3BRGC 2QQQA 3RNQA 3MRNB 5BV7C 3A67H 2VRAA 3MJ8B 1JPSH 4ZFOA 1S7UB 3RRQA 4MD0B 4HUUB 1KJMA 1P9MC 5DQDH 3K0WA 1LNUA 2NR6D 4XMPH 5AWNH 4JFQB 4GSDH 1GZPA 3KLAA 5D1QC 4HV8A 5TDPA 3QYCA 4PS4H 5GGUB 3GFUA 4KRPC 3UTTE 3QG6B 1P4LB 4YEFA 1IGCL 1X5FA 4OSUL 2ZCLL 5CZXC 4CVXB 5C6WH 4MB3A 4IOIB 4JFDE 2G5BB 3GM8A 1KYOJ 4PJXB 3T2QA 3U9PH 4AEIH 3RTQC 5DS8B 3BKCH 5IWLA 2NZIA 1HDMA 5CP7A 4QRRB 3OHXB 4JDVB 4R96A 1UA6L 5EUOF 4YHYC 5A2KH 3LQMA 4FFWC 1YEGL 2X40A 3CH1A 3O9WD 4XC3H 5KSAB 1D7FA 3HFML 4PJ5E 2BOCB 4AMKL 3CFDA 1A6TA 5IEKB 3BDBA 5E6IC 3ARSA 2Y06H 4HZAA 5I1KH 4QWWC 5I71C 4PJCF 2O5YL 2EYSB 5GSVA 3EDEA 1X5ZA 3FN3A 3RVVC 5DMKA 4YHMH 3PGCA 1T2JA 1EVTC 3CMOL 4N68A 3LS5L 3RKDD 5FUCC 1IQDB 4GKZB 3TZVC 1FNEA 4HPOH 3OAUH 1K4DA 3TEUA 1A4JA 1U8JB 3H9SE 5HDBE 2CKBA 3LKPB 4YUEL 3V6BR 3JUZA 4ORGB 1FVCA 1E6OL 4G6AD 2FD6H 1ZOXA 3ZSSA 3KPNB 4KDWA 3DX9B 3DXAB 4U4BA 2IADA 2WIMA 5CZVL 4OCWL 1Q1JL 1UG9A 3RWJA 2H32B 5DDHA 2B1AH 3RVWD 2FIRT 3OKYA 1EO7A 4X6EB 5ALBH 4JQXC 3WE6B 4FXGA 1ZHKB 4W6XB 3TIDA 3BKML 5ENWA 1R5VA 3RGVC 4UIMB 1XGPB 2XTLA 4MHHG 4UV7H 1WBXA 3OAZK 4EVNB 3UPCA 1LO2L 3CIQA 1GGUA 3QXDA 3VJ6A 5IFAH 4P5TB 5LBSL 4YDIH 2AV1B 1WVZA 1DQML 4JAMA 1RK0B 4NQDA 3DJ9A 3SE4C 3I84A 4JFZH 3QPXH 5JZ7C 3NBNA 4ONFH 4BUHA 1UKQA 3S88H 4HHAA 3MOBH 3STZB 2QJDA 1FIGH 1JUFA 2YA2A 2DLHA 3D85B 3HNTH 3VXPA 3LEYH 1IT9H 1JPTH 3L3OA 1EK3A 1NFDE 2R8SL 5IFJB 4L5FH 4NM4L 5B3JF 4EI6B 2ADJB 2GSGA 2BOBB 1X7QA 4PGBA 3NPSC 1FN4A 3O6KH 3ULUF 4ZO9A 3P4LA 2E6JA 3DBXB 1I1AA 4AM0B 4S10A 4HUNB 5D8JL 1QSFE 4ZFGH 2GITA 4HUXB 5J6HA 4YXLH 4ZS7H 1FZOA 5I1EH 5JOEA 2IPTH 4X80H 4KGJA 5HI3C 1FLRH 3MLUL 2Y36H 4CKVX 5D5MB 3JZ7A 4RGMB 1GGIH 4NQXB 1NMBL 5GJSL 3ARGB 2XKUA 4WI6A 2AXFA 3UTTD 5IVXA 3T77B 2AJUL 4LU5H 4QNPF 4GKNA 4KROD 2PN5A 2NY1D 3WEXB 1AGEB 4F7CA 3NIFF 3RPIB 3ZDXE 3W82A 3AMKA 5FO7B 3HZYB 1CD1B 1N4XL 3K8LA 5KAQF 5LCVL 2R4SL 3UP1A 1AO7E 4UQ2A 4HIXL 2P5WE 1BFTA 3FAXA 4GT7A 1A6WH 2P8MB 3QBTB 2E8ZA 2YEZB 5JNYA 3O4LA 3G04B 4N9OB 4ZD3H 4ZXBD 5SWZB 1OAKL 2B0SL 3P4MA 3GMMA 4MJIA 2YHGA 5TFSL 2CRMA 2XY1A 1KYOK 4R3SB 1AKJA 4PP2A 4JFHD 3QEGL 4LHJB 43CAB 5D1XA 2EIZA 1NGYA 4PJ7B 5E5RB 4YXHL 1I8LC 5CBAA 4L8BA 4KJWC 4MJ4A 2NYYC 3PNWB 3K2MC 1YJDC 2A6IA 5IB4A 3S7GA 4BQ9A 5LVEA 1IC4H 3O3DB 1DTUA 1A1OB 5H8DA 4FOMA 4NQUA 3A6BH 3LOWA 5DWUH 5MI0B 3F12A 43C9B 3VWJD 4GAGL 1KIRB 5F7EH 4H25A 5FUOH 2ATPA 2R56L 3K1DA 2JLLA 5FO9A 2D31A 5D7SH 4K3GA 5DEFA 4U1IA 1UCBH 1NDGB 3ARGC 1CXFA 4KUZL 1IQWH 3H0TA 3PF2A 1F6LL 3SBWA 3AS0A 2AK4B 1EMTH 4G42B 1EX0A 2Y07L 2NMSA 3DVFA 4L4TA 1X5XA 4D3CH 1KB5A 2D4FA 2H41A 2A1WL 2FEDC 1E4WH 3BW9B 5FCUL 5TGBA 3DROB 5DD0L 2OR9H 4M6OH 4X7CC 1KCSL 1L0XA 3RWCB 4HIIB 2CRZA 5B39B 4EUPG 1WK0A 1MFDL 2J5LC 1S9YB 1NKRA 1TCRA 1FNAA 3GSQB 4M7ZC 3TVMD 1IM9B 2ADIA 3D2UD 1QFUH 2AP2A 2ZKHH 5F9AC 2DM2A 2R9HC 3G5YA 4Y16A 1Z5LB 4K7PL 1EDQA 1QSFD 4R4BA 2DKUA 1ZWIB 1UB5B 2DQJH 4P23C 3QFJB 1JV5A 5IFHH 4DFHA 3CUPA 1RJLB 4RISH 1OAUH 4C56A 3S96A 4GRLB 3ARPA 3FCTB 4PJ8D 3UBXG 3WKMH 4AT6A 2Q87A 4HIHB 4GW1A 12E8L 3VXUE 5ADPL 1OT2A 4JFED 2KZ1B 4PJEF 2IQAA 4XCFL 1KCVH 1NQBA 2DQGH 4JN2A 1A2YB 2IH3B 4KK6C 3L5IA 3QDGB 4M6AA 4P2RE 4JGJA 3L3JB 4Z18A 1MCIA 5DD6A 4E0RA 3BP6A 3L3KB 4IDLA 1P7QB 4LSVH 1XF2A 2ICCA 3RWDA 2FRGP 3GIVB 5D1QD 1OTSD 2O61B 5CHNB 3L7FB 4YLQT 4CVWA 4J1UB 1AGFB 2OZ4L 4KRPD 4ZUSA 4JB9L 1ZHBB 1PEWA 4YBQC 3NFNB 4YDKH 5CZXD 2WLZA 1J0ZA 2CMRH 4GBXB 1H8NA 1IKFH 1ZLUH 3MLSL 4MQ7A 3ZMRA 1D5XA 1K8DA 4N0FA 1J11A 3EO9L 4G6KL 1S9XA 1KEMH 3LHPL 5C0AD 3IXTA 3UZQA 2E7CA 2KZWA 4FFWD 1RIHL 1MELA 1OAYH 4EIGB 4UT7H 4I3RH 3BPNC 1U91A 1S7XB 3VFSB 2EEAA 1A7OL 4ZFFB 5E6ID 1KFAL 4DKDC 1MUJA 1G7HA 4X9GA 2OXHA 4QWWD 2DQDL 4XCYB 5ISZA 3S4SB 3IETA 4J6RL 3ZKQD 3T8XA 5B22A 3RVVD 1NGXB 1ZT4B 4JPWH 5GGRB 3DUSA 1KBGL 3MR9B 2NPLX 4X5WA 3KPMB 4NZTH 1YZZA 2ADGA 3OAYK 4GRLC 4UV4H 3AFLA 1FNGB 3PL6A 4FG6D 4B5EA 2VYRE 4JZOB 4Q2ZB 1NAKL 4UOW0 1EXUA 5FYLE 1OPGH 4LLUA 4NIKB 3FB5A 1IMHC 4H20L 3D0VB 4KPHH 4L3ED 2QKIB 3F58H 2C5DC 4LP5A 4G6ML 2FLRT 4Q6IB 4XC1H 2CRYA 1FJ1A 2CLRA 2X4UA 2Z35A 1I3GL 1CTNA 4ZOBA 4WW2A 1CE6B 2LAAA 5C0CA 5DQ9A 3LEVL 2A9ML 3RNQB 4RFEA 2MTPA 3FFDA 4IOFC 1W8OA 2V9RA 5IBUB 4ZFOB 3LN9A 4Y1AA 1G6RB 4NQVB 4Y5VB 2YPLD 4I9WE 5B3NA 4BFIA 2HLFC 1JI2A 4I4WA 3RGVD 1LNUB 3OKLA 4XNZC 2R2EB 4K3DL 1NBZB 2F5AH 3B43A 4W4OC 1A21A 4C59B 1OSZB 2APWA 1GZPB 3KLAB 1BJMA 1Z3GH 4HV8B 5TDPB 3SDAA 5HI4C 2GJ6D 4KZEL 4R4FL 1CR9H 3M07A 1AI1L 1S78D 1ZHLA 5J06A 3UPAA 2DAVA 5A16A 2FO4B 3BKJL 5FYJL 4L8DA 3LKOA 4X5LA 1IFHL 35C8H 2G2RA 3FO0H 4ALAL 3BZEB 4ZTOH 4HGWA 3ARXA 4AENA 5JW4N 4HQQL 3SGJC 2GY7B 4XZUA 3QWOA 3L6FA 1VENA 1HDMB 4XP4H 1ES0A 4R96B 3PABA 3VXUD 2QR0A 3IB4A 4RCAA 4WEBL 2ITCB 4PJ7E 1T0NA 4MZ2A 3LS4H 4UDTA 3UJTL 3VFMA 5I8OH 1A6TB 3R0NA 5DMKB 3PGCB 5BZWA 4N90E 4V2CB 1B0RA 2FEEI 3ULUC 5KVMC 1K6QL 1T1WA 4HLZG 5CJ8A 2VLKA 4WHYH 3C09B 2WWKO 1FNEB 4ETQA 5HDLA 1KIUA 1K4DB 1U3JA 5I66B 1A4JB 1QBAA 1RVFL 2W0FA 4YAQB 4XMKH 2O5ZL 4Q9QL 1OAQL 4LLWB 3O2WL 1BIIB 2EDFA 4L8SC 1NFIB 3MLVH 1FVCB 1INEH 4IIQA 5J56B 5CUSH 5HTSA 1OM3H 3G9VA 1F00I 3QEQB 3HTLX 5K9OA 2ZCKL 4WVRA 2A6KB 2H32H 5E2UH 3EUUA 2Z8SA 4G8IA 3RWJB 3GKWL 3QNZB 4NJAL 1RUQH 4HC1H 2BVPA 1IAIH 1QNZH 5DDHB 3PWPA 1H3TA 2WWMD 1NAMB 1MAJA 1CT8B 3BDYL 4RZCA 1PSKL 3I02A 4IMLA 3SQOH 2V7NA 3D39D 1I3RA 1N64H 1E0OB 5J3HC 1T1ZB 3MNVA 3TIDB 4RMRA 3TYFA 4JJ5B 4F2MA 1IGFH 4LPUA 2PNDA 5ETUA 4EI5C 3MRKA 1OCWL 3OMZA 3QJHB 3QXDB 2DQFA 4KJWD 5FGRA 1LGVA 2NYYD 3VJ6B 2QADD 2F54D 3QAZB 5IWLC 1BREA 4NQDB 2XQBL 5F7WC 5ANME 3CGTA 5DGQA 3GMOB 3EZJB 5C0BD 3IDJB 1R0AL 2MHAA 3QNYA 1P7HL 2XN9A 4NZDA 2C4FT 3VXPB 2R2HA 4Q9BA 3RWFA 1LK3L 5FYLH 3L3OB 1YJDH 2WBJA 2F58H 1UYWH 2GSGB 2VWEC 4PGBB 3OKEA 2VXSL 2CUMA 3I3BA 1KENL 1C16B 1W72B 4S1QL 5E8DH 4YDJB 1I1AB 4MD4A 5E94B 1IGIH 4P9HL 2NY2D 2OTWA 3X3GL 1N6QL 1TJGL 2GITB 5J6HB 3C8DA 4POZC 4L3CA 4UTBH 4NQCB 3F62A 1A6UL 1SBBA 4R2GD 3QQ3A 4WW2F 3NCFB 4X4ZA 3GMPA 3Q6GH 1CZ8H 3VXOB 4Y4HB 2BDNH 1PKQA 1UJ3A 3RY6C 1CU4H 3QULB 1ZLSH 5IVXB 3QHZH 1ERNA 4LHUD 1F13A 4ZFZA 3EO0B 4V2BA 4F7CB 5LGHL 4BSJA 2VDOH 4I2XE 4GQ9H 5JOPD 1BGXH 1QBLL 4R7DA 3CU1A 5E7BA 5I15H 5D93B 4RQQA 5KSBA 4UQ2B 3SE8L 3NPZB 4BQ6A 2EEBA 1LK2B 4FQJL 3G08A 1ZLWH 1HHGA 5JNYB 4PJFF 4WI2A 5DRZA 1AQKL 4WO4A 3VFTA 3GMMB 5T5NF 4LVHC 4MJIB 4WU7A 4CVZA 4U6HB 2YPVL 3QAZC 1AKJB 1PKOA 4TTDD 4CW1B 3MMEB 1C1EH 4PGEB 5D1XB 2EIZB 1NGYB 4OFYD 4XPGL 2YXFA 3RQ3A 4KH2A 2IH1B 1VADB 2ZUXA 5DFVD 5CBAB 3NACH 2FECL 1INDL 3OL2A 1W8NA 2Q86A 2HT3D 2A6IB 2ZOLB 5IB4B 5C9JB 4KK6D 1S5IL 4ODTL 1HHIA 4FQ1L 5JQ6H 1I8MA 4GAYA 5HDQH 4JLRB 5T1DH 5FK9B 4TUKL 1A47A 2C4XA 2Y6SD 4K55A 5MENA 2EZ0C 2VLME 2ATPB 3OBAA 1MSPA 5FO9B 2D31B 2V5YA 3V5DB 4L9LB 3EOTL 2FGWL 4X7EC 1MCOL 3C2SA 5F93C 4HLJA 4PBXA 2DI8A 4FZEH 3OKNA 2V5RA 4RFOH 1MH5B 3QUZA 3DUHA 4H8WL 2ARJA 3H0TB 5DTFB 3LN4A 1HE7A 4Z7OE 4G7VL 5JW4R 1S7VA 3MRHA 3OR6A 3DURB 1JFQH 3EOAA 3VFGH 3B6SA 3Q48A 4G6FD 4JFXB 4KY1H 4OZGB 4Y2DB 2Y5TA 2HG5A 2FHCA 4M1CC 1EHLH 3QIWB 4PJDF 5AZ2L 1IGML 1QSZA 2X4QA 1GH7A 3BWAA 5HHVL 5HGDA 1WSST 1TCRB 5DC0A 1I7ZA 1KB9K 4ZUUB 1OAZH 1Q72H 2ADIB 5EC2A 2EDOA 1DQLH 5A1AA 1I9IL 4Y16B 4QXWA 5KVGH 5AZEL 1X4ZA 4M5YH 4PRDB 1S5HA 1H3PL 5JHLL 3MUZ1 4HFUH 1FZKA 2E9BA 5DYOA 4R4BB 1X5AA 1P1ZA 1UT9A 2VDPL 2OX5A 4C56B 3QXAA 4DGVL 3TBVA 2FL5A 1EFXA 3S96B 4AT6B 4OFKA 2DLFH 4GW1B 5CIPA 3C6LA 1A8JH 3CDYA 4MXWH 3LRHA 2VWEE 4L1HA 4OD2A 1GGBH 3RZCD 2EYTA 4JN2B 1ZANH 1FO0L 5JIPA 1T4KB 4IJ3B 4GW5A 2AXGA 2RAMA 3BP6B 1RUPL 1UZ8A 4M93C 1XF2B 2QQLL 5HGHA 4U1JB 4ODSL 4F3FA 3VGEA 5T1KD 1BJ8A 3SBWC 1PX3A 3IDXH 3A6OA 3RDTA 4ZUSB 2PYEA 1C8PA 2FH6A 4MGXA 5DMGC 4M02A 4DKEH 5KSBF 3NFPB 3FT3A 3TGXA 1AGBB 4OGYL 3VI4F 1T1XB 3SDYH 1BJ1J 3RVUC 2ORBL 2YMXH 1UH3A 2VUOA 1BQLH 1JI1A 1Q94A 1D5XB 4X7SH 1K8DB 1FIEA 4HKBA 3QH3B 4MA3A 5C07A 1NL0L 3TFKD 1S9XB 2F5BL 1NBQA 2E5EA 4JM2A 3IXTB 2UUDK 4ELKB 2EDQA 4JPIA 3WFDH 2P5EA 5J89A 5DRNB 4Y16C 3VFWB 4P2OC 1U58A 3QIUA 1U8LA 3OXSB 4OIIH 4HH8A 5ISZB 4FZ8H 2XACC 3IETB 2R15A 4MXQC 4NQDE 3T8XB 4XH2A 5EIQA 1RZ7H 3FOLA 3KVQA 1QFOA 3DUSB 5E00A 3ULUD 3LZFH 4EN3B 3GMNA 1GC1L 2ADGB 1DL7H 4WTZA 3O45B 3O6MH 3PL6B 5E08H 4S0TD 4WRLA 1EXUB 1VKXA 4O9HL 1RU9H 4LLUB 1FE8L 2QSTA 3FB5B 4CL7A 3S98A 5HD8C 2Z31A 3KYKH 1FZJA 2UWEA 3MJGX 1MPAL 3QJFA 1ZA3A 3RAJL 3W39A 3WFHA 1T0MA 2CLRB 2X4UB 3QNXA 4L4VD 4FTVD 4ZAKA 4NQCE 3MV7A 1V7NH 2YD2A 2Z93B 3EDKA 4RDQG 2QSQA 5DUML 4XNYL 4X6CA 5C0CB 1J8KA 3OB0K 1T7ZA 4OI8A 1G6RH 2HVKA 2ZUYA 2A6DA 2YZ1A 3FFDB 4IRSA 4K3EH 4RFEB 5IVXE 4LGPB 1A7BA 2CK0H 1UM6L 2DLTA 4BFIB 4I4WB 3L3HA 4U1NB 5C0RL 2VAAA 5CJOH 4JM4H 1FH5L 3VDCA 2UZXB 5GRJH 1YEKL 4N0UA 4EI5D 1RZKC 1G9NH 3IFOA 4ELMF 1Q0YH 3V8OA 4GAJH 3SDAB 2BVEA 2EDJA 1VGEL 1OP5H 2FGZA 2D7TH 3EFFB 4TSBL 4OB5H 1BWMA 1NLBH 4YHZH 1F11B 3BAEL 3C5ZD 1UZ6F 4BSWA 3JWDL 3O4LE 4MA1C 4ZTPL 5I76B 1HQ4B 3MFGB 1NMCB 4HGWB 3CD4A 1RAMA 4MJIE 2X4TA 2HFGL 4XP1H 3TO4B 1VCAA 2BFVH 2DMCA 3G5ZA 1ES0B 2X05A 1SJXA 3WL9A 1CGVA 1T0NB 3MNWA 4XBEH 5E03A 4UDTB 4CVUA 3SKMA 3VFMB 3VWKA 1XAUA 4YXKH 1A14L 1J8HA 3DRTA 3LQZA 4H1LG 4POZD 4ZOEA 4J3SA 4KKNA 2VZOA 2DL9A 5KTEL 4KI5F 5BMFH 4MDJA 1T1WB 2IAND 1QLEL 1XGRB 4WGWB 2JKXA 1C7TA 5HYQB 1U8OA 4WCYH 2EE2A 3NH7L 5F9JA 3MJ9L 3ROOA 4K7FA 4WW2C 3SDCB 2HFTA 1TQCB 5JDSA 2ZUTA 3VMNA 2QQNL 4HH9A 2D03L 2I5YL 5E8PA 2NX5B 3MV8D 4J3UA 4OF0A 5SWSA 5DVMA 5EU5B 4G8IB 3DGCR 3ECBB 1F2XK 1T6VN 2BVPB 5J13B 1NAMH 1U8IA 4K94L 1RZJC 3GSRA 4LP4A 1GL4B 1TXKA 5T5FH 4NNXA 1ZLVK 1I1YB 4U1LB 3GSNB 3SDAC 4L4TE 1NC4D 4RZCB 3GKZA 3GSOA 3I02B 4IMLB 2V7NB 2BNRB 2OTPA 3MNVB 5L7XL 4XI5C 3DARA 3HPJB 4JM2F 3TYFB 1AFVL 2P45B 4F2MB 4IRJB 4QHKJ 1ZKAA 2MPAL 3MRKB 1YEHH 1NMCC 1BBJA 2DQFB 4DN3H 1I4FA 1VFMA 5EORL 4U6TA 3I6GA 1ZE3C 4Y5YA 2PW1B 4OCRL 5E2VH 2HTKD 1YEJH 3QNYB 2XN9B 4G7YH 4J3XA 1JTTA 2Y9RT 1OWRM 3ARDD 2R2HB 5E5UB 1H15B 5IMKA 1J5OH 4XTRC 1WV7T 1JNLL 1IE5A 2AJSL 1A4KA 4RMVA 4S11A 1W72H 4HBQA 3FQNA 4UILL 4C56E 3OKEB 5SX4I 1U3HA 1PQZB 4MA7H 2ZZUT 4OZHA 4LIQL 4EJ1C 4MD4B 1MI5A 2R29H 3MRJB 2NY0C 3SOBH 2OTWB 1MFEL 3V7MA 3MREA 4L3CB 2DQTH 4JKLA 1J1PH 4LSPH 4DQOL 4JRYD 1TVBB 1TQCC 1XF4A 5D6CA 4IIQC 3P9LB 5GGQH 3QA3B 3ALWA 3WUWG 2UYLA 4JN1H 3TLRA 3Q1SH 1EO8H 2B1HL 3SKNA 1UJ3B 2BRQA 4K7PX 5JPNA 2H2SC 4M7LL 4OF7A 4M1CD 5JIKA 3EHBC 1IBGH 5K9JL 5DI8A 4TPRH 3S5LB 3WD5L 4XPBL 3JTSA 1S9WA 5HYSB 1CICA 1YDPA 2OJZH 4LF3A 3QEHA 4R7DB 3CPLA 1BECA 1FAIL 2AEPH 2B4CL 4EZMA 4LFHG 4RQQB 2NY4D 1YQVH 3N9GH 5BV7L 5F70A 5E2WL 5FFLA 3G08B 2A74B 1XT5A 1HHGB 4N0YH 1YEIL 3OXRA 4PJBF 2R39A 5HHXL 5DRZB 1I8IA 2VLLA 4WO4B 4YDLB 4FP8H 3QO1A 3KXFD 2Y5EA 2JJTC 4CVZB 4P46B 3RWGA 1VDGA 3P40A 3UBXA 3WDJA 4P3CH 3FT2B 2ILLA 1LDPH 2HN7A 1ZTXH 2NCMA 3NVQA 1C5CH 3VW3H 5ISZE 4DWHA 1GPOL 1QFWI 4P2CG 1I8KA 4HWUA 5DJYA 1L0QA 1DBKH 2WBJC 3SGKA 1CDGA 2JCCA 2Q86B 2Y7QA 1EZVY 2PO6D 4QXUL 3MXVH 1HHIB 4WTXA 4BFBD 1CGTA 5E99H 3U6RA 2D4DA 5C3TA 4OV5A 2XKSA 3C60A 4XCCL 4ZPTB 5TE6L 5IG7B 3VFOA 3BZ4B 3DI2B 5F72S 4N9GB 2FWOB 1YNLH 3GHEH 3QZWA 4PRPD 1BVKB 4PTUA 1ZXQA 3GNML 3V8CA 1GSMA 3L3GA 3O8XB 1G7QA 4Z0BL 3QI9B 5DJ0B 5DJAB 2E8YA 5DHVB 5FOJA 1UJ3C 4HIEB 1QFWM 4QY8A 4Y88A 4KHTL 5C0CE 4OCSH 1I1FB 5IQ9A 5K33A 1QACA 3WFBH 1R3IH 1LP9B 1QOKA 3DOSA 3UPRB 1JRHI 4Y1AE 3MRHB 4MDIA 3OR6B 5AYQA 3EOAB 3B6SB 3ZYIA 2DB8A 5EUKA 1AHWB 2EDBA 5GS1B 2WINA 1M4KA 5SX4H 2Y5TB 2FX9H 4P2OD 1RFDH 3VCLA 5JQHC 2DQUL 1MIMH 5HYJA 5HGDB 4P2QA 1A7RL 1AE6L 3TH3T 3VXMD 3D0LB 4WFED 3WHXA 5MEPA 4O02L 5EC2B 2QLVB 4HS8H 3WXWL 3ZHLA 3MACH 2RGSA 2ED8A 5D9SB 2K7QA 4M62H 3DO3A 5IBTL 3UJIH 1FZKB 5DYOB 2JIXA 4R26H 5CLWA 1P1ZB 4P4KA 3V4PL 2VLJA 4LSRL 3IFLL 4KFZC 4NHCH 3GSVA 1N5AB 3TT3L 5LWYL 2EKJA 4LAQL 3QXAB 5C0DA 3TBVB 2FL5B 1EFXB 4JFFA 4FQQA 4NKMA 2NXZC 4NYLA 4J3OC 3UO1L 4Z76A 5CIPB 2DS4A 1CDHA 4RFNC 5D2NA 1B0GB 4BELD 4OD2B 6FABL 5BXFB 2VLKE 4J3TA 1QBMH 3IT8D 1KN4H 3TT1H 1CLYH 4XAWL 1HXYB 4GW5B 2AXGB 3G6JA 4H88H 2DQHH 1JPGA 3I50H 1PY4A 4OKDA 1AD0B 4P5MA 4KRMB 4ONGH 4PJHA 1UZ8B 3QUZC 1ONQA 5HGHB 4AIZB 4MAUH 1R3JA 5HHNB 4F3FB 1SM3H 1QFWH 3H7LA 3CZJA 1KLGB 5LAXA 1LEIA 1BFVL 4KJQC 4NGHH 3MV9A 4PRID 4FRWA 3EJZD 1HKLL 2XRAH 3Q5OA 3L3DA 1CD9B 1HIML 1QZ1A 1BQHA 5DD1L 1J0JA 1RJZA 3PWPE 2J6EH 1KELL 4HBCH 4RGNB 2VNCA 2VL4A 4M43L 4PBVC 4D9QE 5KVFH 4O5LL 2CIKA 3L1OL 4TUOB 1D6EA 2A9NH 1X6NA 3O6FD 1U8LB 5I9QC 3CFKB 3C9NB 3KNBB 3OGOE 5FM5O 1MRFH 3NGBB 4LNRA 1U8HA 3FOLB 3LD8C 4AQ1B 4LAJH 2IG2H 3SO5A 5E00B 3H42L 3DV6A 4GRWF 2XN9E 3TH4T 1DR9A 1N8ZA 3C6SB 2W0PA 5F9OL 4XXCA 3C5SA 5ACLA 4XPFH 3HHRB 3TA3C 1I75A 1TENA 3GEWB 2FDBP 2BMKA 4QXGH 4X5XB 3C6LC 4KI5C 4PJ9B 5DMIL 2HFFA 5EZJB 4YHLH 3EOBB 3OR7A 2Z31B 5I8KL 1FZJB 2UWEB 4QRQA 3T65A 2AQ1A 3QJFB 1ZA3B 4ODVL 3MA9L 4KRNA 2DMBA 3W39B 1BWWA 3WFHB 3SDDC 1T0MB 5DJ8A 4Y1AD 5IBLC 4ZAKB 3GJEB 1LO0H 4O58L 1F3DH 2W60A 4ZS6D 5GGVH 4KKAD 2HVKB 2A6DB 4Z9KB 1PKQE 2I9TA 3RDTC 2HKHH 1T5XA 2ENYA 3VFPA 4U1HA 5DZOA 2DMKA 5FECA 1EBPA 3OGCB 1RZJH 5A2JH 1JTOA 3L3HB 2ERJB 3BPCA 5KVEL 4AEHH 3MRIB 4KI1A 2HJLA 4MNHB 4N0UB 4X99A 3T08A 4HUKB 3EYFA 1HKFA 3E1F1 4LARH 3IGAA 2Q8BH 4RGNC 5H37G 2IF7A 4JFOB 5KSBE 5GGRY 1GHFH 3KS0J 5CMAA 4M7KL 1GIGL 4JM2C 4PB0H 3MCLL 1WFTA 2Q8AL 3A6CH 4BSWB 1I85A 2YR3A 4IM8A 1JGVL 2HT4D 3QIUC 2CR6A 4NC2B 4NBZB 1NSNH 2X4TB 4JKMA 4DVBA 4WUUA 5CJ5A 5F8QC 1VPOH 1JGUH 4GMTL 2AK1L 3AS3A 3ZDZE 3NGBC 2L0DA 5C0IB 3VG9B 3ARED 3WL9B 4L8CA 3V6ZB 2V17L 4JDZA 3MNWB 1KTRL 2VLKD 4MJ6A 2C3VB 3SKMB 2CRIA 3VWKB 2BX5A 3MRPB 3DRTB 1EEUA 1GGCL 32C2A 3LQZB 5F3BA 1PY9A 4PUBL 3H9YA 4Z7NF 4M61A 3NZ8A 5FHAL 3KPLB 4JO4L 4WENB 1FQ9C 2VDQH 5FKPB 1Q9OA 3HNSH 2XFXA 1KC5H 3GIZH 5HPMA 5CKAA 2AJ3A 5DJDA 5IF0B 1H3VA 4RMWA 1U8OB 3QUYA 1F4AA 2OZ4A 3BYYA 1KOAA 3ZHKA 5MENE 3ROOB 5F9JB 4U2YA 4PJHF 3EHBD 1SBSL 1MCBA 5E2TH 1BJ1H 5F8RC 1NGQL 3HCVA 4HH9B 4IRSC 1YYML 4D9QD 3DO7A 1YNKH 3MBXL 5SWSB 4FQHA 2VMFA 5KBNC 4A6YB 5EIIB 4X4YA 5EN2A 2X42A 2APFA 2JK5A 3LPWA 3GSNH 2O26U 1UM4L 1FRGL 4M4RA 4NUJA 3QRGH 4NNXB 2NLJB 2XZZA 3E8UL 4I5BA 3IFNL 3MGOB 4JPVL 4DN4L 4RNRA 1J1OL 1XFPA 3M1BB 4F7MB 1OP3K 5DRWA 5IVOA 3O11B 3P77A 2R2BA 1J1XH 1O0VA 4B41A 2Z92B 2R1YB 1PYWA 2FJGB 3OKDA 3U2SB 4GG8B 4XT1C 1OTTC 3S36L 4CU7A 5DUBA 1J10A 1REIA 3VXTB 4NP4L 1RULH 1MJUH 3NTCH 4Y5YB 3I6GB 4QCIA 5EFIB 1UZ6E 2BRRL 5LQBH 5C2UB 1ULVA 5TQ0L 1WC7B 3G9AB 5ADOH 3QUXB 1QHOA 5DZNA 2YKLL 3BQUD 3LEXA 3VRJB 3T4YB 4RWYL 1CL7I 4JVWA 3CFBB 4UT9L 3T3PF 3WO4B 4QHKI 3VWKC 1S9VA 5IMKB 5D7LA 1KCUH 4HK0A 4XWGL 1A4KB 4Z7QF 1H3XA 3B9KA 1G1YA 3WFZA 3BDXA 3GO1L 4OZHB 3NOIA 4PGZA 1E6JH 1QSVA 3FRUA 2FX8L 4ISVA 3WNKA 3VCLB 3MREB 8FABA 1JHKL 4KC3B 3OG6B 4LQFH 4D0CA 2J88L 3RJQB 1T04B 1XF4B 5EBMA 1N6UA 2CO7B 4G8FA 3F65A 4FABL 3QCVL 3KYNA 1NUGA 4M6NH 3FAWA 3SKNB 2Z91B 1MCSA 5JPNB 4XP9H 4EUPB 4G9DA 4V1DA 3RWIB 1E4XL 2IBGA 1I9RH 5I16B 4CGTA 1FGVL 2OQJA 1JGLH 1JZ2A 3BVNB 5DI8B 2C26A 4I18C 1IVLA 2OL3L 5KSAD 4K2UL 3CCHB 2PYEE 5GPRA 4LF3B 1Y6MR 1CK0L 1ZMYA 3QEHB 1L7IH 1U8MA 3I6KB 3T3ME 4P49A 3MLXH 4N8PA 4JDTH 2MOVA 3PWVA 4RGNE 1QLFA 5C07E 1UWGH 1FYTB 1SEBB 4XNQA 3RWGB 1RHHB 5IGXH 3UBXB 3CK0H 5F88A 1X9QA 3C8HA 5TH2A 2P5EE 5C0FA 2DQEH 1OWWA 2HN7B 4HJ0C 2VLRA 4LCWA 1MREH 2DD8H 1XH3A 2NXZD 2VZTA 1FG2A 5GRWA 1P7KB 4UB0L 5EBLB 5DJYB 5BQ7A 4JKPH 4OCXH 1OARL 3DXAD 1NUFA 3MROA 1VEPA 1U3HC 2WQRA 5BJTA 2MMXA 3DV4A 2WBKA 3TNNA 1S3KL 4XPTH 1M7IA 1D6VH 5DO2C 5SX5K 2APXA 2UWEE 2W9LA 5CJBA 3QZWB 4UZGA 2GSIA 4PTUB 3L3GB 1HQRA 2EH7H 2EE6A 5IB1B 3MV7E 3ULUL 3ME0A 4E41D 4NQTA 3U30C 3DECA 4X6CE 1K5NB 5IQ9B 1CL7H 2B8OT 4ODHL 5C8JA 1OB1B 1CICC 3CVHL 4MDIB 1ZT1A 3U0WH 4U6XA 1I9EA 1PZUB 3HR5A 3JBG7 1X4XA 5EO1A 3M8OH 4DVRL 3FHAA 4R0LB 2N56A 1ZGLA 4N0UE 3RIFF 5EBWA 3LKNA 3BKYL 3MLZH 1G9MC 1XIWA 4HPYH 5HYJB 3WN5C 3NCMA 1BAFH 1MWAL 3VRIA 4ZYKB 5MEPB 3VD7A 1E27B 3MTRA 4LCYA 4LHUG 3U9UA 3KPPA 4NJ9L 4H26A 3TA3D 5C7XL 4MHHI 4DKFL 3QIBB 4W70A 4NQSB 3VXRB 1QSEA 4UBDD 5J6GA 3C6LD 4KI5D 3PGDB 3GBLA 4HWEL 2VLJB 2I07B 3SGKC 1G9EA 2HP4A 4PV9A 4Z5RA 2XWBA 2WUCH 1B4JL 1RIVL 5INCA 2FIKA 15C8H 2H1PL 5CIPH 1TNNA 3UTSD 3SDDD 3NAAL 4FQQB 4NYLB 1J8HE 5IBLD 1HOCA 4Z76B 1E28B 2ZJSL 1OAXL 4BH8A 1EAJA 3EFDL 3C60C 1OGAA 5D2NB 5J7CC 2RCSL 3ILPB 2ZUSA 4ODUA 4X6DA 3MRQA 3MFFA 1QKZL 1BOGB 1QA9A 2PYED 1Q0XH 5SWZD 1JPGB 3T2NH 3O3UN 3BT2H 4U7MA 1DCLA 1ONQB 2W9EH 4L29A 2FH8A 1KCKA 3F6LA 2LE9A 1WWAX 3L7EA 1R3JB 2MNUA 3FO2B 3VH8A 4JJHA 1A3LL 4M8QA 4M5ZL 5SWSE 1FL3A 1TTGA 4JM2D 2X44D 1HSBA 2HFEA 3MV9B 2AW2A 4WJ5B 1UC6A 4X6BB 1HYSC 2NY5H 4ERSH 1P6FA 1RJZB 4J4PC 2P7TB 2DKSA 4OLXL 4OTXH 3UTOA 2WW8A 5J1AA 1CLZH 3P0GB 4K3JL 5HHMD 1FGNH 1DLHA 1FL5B 3SJVB 1KUMA 2RJMA 4S1RH 2R4RH 1TZHB 4RAVA 1CG9A 2CXKA 1JHLL 1FDLH 2P1YA 3ILQC 5D2LA 2G9HA 4DOHE 3GBMH 5IW6B 1FFRA 5L8KB 1GJIA 5AD0A 4NKIL 4LNRB 4P4KC 1K3ZA 1U8HB 3D3VA 1FFPA 3UTPD 3BMVA 3EYUH 2R23B 3B5GA 3CZFA 3DV6B 1N8ZB 1MJ8H 2XTJC 3L5XL 3C5SB 2MQCA 2VXTH 1DDHA 4LSSH 4NQEA 2JELL 2VITB 4QHUA 2O5XL 3MV7D 2BMKB 2VC2H 2XI9A 5B8CC 2AEIT 1F4XH 1ROWA 2AK4D 4ZG1A 2QEJA 3CLEL 5D2NC 3FZUC 4D0BB 5E9DB 3OR7B 1D5BB 4JHAH 4OZHE 4QRQB 3MSPA 1WBZB 1NCAH 1I9JH 1FSKC 4OF6A 3EYQC 1MI5E 3AGVA 5DHYB 3O41A 1TZIA 5J12B 4OZ4B 2BHUA 4QTIH 4QGYA 1ADQH 4YBHA 3SDXA 1LILA 2P43B 4ODWA 4XVTH 5FCSH 1AQDB 1GGTA 1YN7A 1CFBA 4S2SA 1HI6A 4YFLI 4FA8A 1MY5A 2W07A 1MOEA 2I9TB 1OL0A 4LLQB 1JPSL 3VFPB 4U1HB 2AJZA 3K3QA 5FECB 4UAOC 3QFJD 2HJLB 4OQTL 2J4WH 4JZNA 2ZUUA 4RGOL 1OTTD 3EYFB 4XMPL 3O81A 3IU3A 3KJ4B 1NLDH 1FNLA 3MUGA 1IEBA 2O93L 4BH7A 4KU1A 2A0LC 4D9LL 2GTWB 3BZFA 4PREA 4DEPC 1KPRA 4YQXH 5FUZL 1U3YA 3PQYA 4WUUB 4XP6H 1LE5A 1AD9A 4K71C 3QDGD 2R0WH 4XP5H 4OT1H 1HSAA 1UH4A 3DMMC 2H6PA 5EWIH 2GCYB 4B50A 4OGXH 1P7QD 4M1GH 2H26B 1A7PL 4XXCC 2CPCA 5I1CH 1FO0A 3R1GL 1A9EB 5JHDD 5A43C 4KKCC 4NZRL 5F3BB 1DBMH 4M61B 3NZ8B 1WICA 2JCCE 3O9WA 5L2JB 2VDMH 4AZ8A 4NWUH 2I60H 1Q9OB 2LFGA 4LKCA 2XFXB 4MAYC 3RA7H 2AJ3B 2D7NA 4KDTA 4XMLH 1RZGA 5GGVY 1K85A 2F19L 5ICXA 4X8XA 5BS0A 3H3PH 3NCBB 3ZKNC 3DSNA 3PWLB 5ACZA 4MB5A 4M7JH 4TSCH 4HWZA 4LVOB 1YPZF 3LCYA 3LKQA 1ZGLP 3CDCA 1ZVSA 1DSFL 2XY2A 3PIQA 3KPQA 3KLHC 1CN4A 1WZ1H 3CX5K 4X6FA 4AL8H 1I7UA 5CILH 3MRMA 5DLMH 4A6YH 3RU8L 4G9FD 3BISA 5C6PB 1A1NB 3O6LH 4FQHB 5BOPA 4LCIH 3RUGA 3D18A 2HLAA 1MJ7L 5EN2B 3TN0B 3OAYH 2JK5B 1PX4A 2FJHB 3JV4B 3ZZ1A 2B1AL 4NUJB 5HY9B 3AVEA 1YEEL 4I5BB 4NN5B 5MEQA 2VDRL 1FZMA 4RNRB 5DRWB 3WIIH 3TBYB 2R2BB 5A3IC 4GLRH 2PTTA 4QRPB 3OKDB 4UV7L 5HYJE 4B0MM 4P2QE 1KB5L 3SPVB 4Y19A 5M94B 5AYUH 5I1DB 5KS9A 5KAQG 4QXTA 4HGMA 4JREC 2VXVH 3T4AA 4QCIB 1F4YH 2R0LL 1DVFC 5I1AA 4JFZL 4HS3A 5DVNA 4YBLB 1FIGL 1FORH 5F89A 1MI5D 1H5BA 4I77L 4GS7B 5D7LB 1V7MH 4NO2A 2VLJE 1DBAL 5DD5H 1JPTL 5DO2D 1ZA6A 2CLVB 9CGTA 4TSAL 1U41A 3CC5A 2NXYC 2XTJE 1H8OA 1AY1H 1QBBA 2LVEA 4JFFE 4RIRA 3O6KL 2CXGA 3G6AA 1FC2D 3IDYB 4ISVB 1T7WA 3QUYC 4LOUC 5MHSE 4ZFGL 5D2NE 4PB9H 3U36A 1U92A 4ENEC 1OF2A 2IPUG 4LVOC 5IHZB 1ETZA 3P30H 5EBMB 4G8FB 2ITDB 1J12A 3KYNB 3G6JE 3MUJA 3BRDA 1H3UA 4EUPH 1GGIL 3WCYA 4JO1L 5KZCB 2G75B 2ZCLH 4PJHE 1CGYA 4G9DB 1L6XA 4Z0XB 3ARFD 2OQJB 4XNMA 5ID1A 4XCNA 3KLSA 1RURL 4BJLA 4BFGA 5I8EB 4MCZA 4GJTB 2DLIA 5EZIL 1U8MB 3MV9E 3MXWL 4TUJA 3T0EC 1YEGH 3D69A 1NCTA 2DJ4A 3HFMH 1A6WL 4AMKH 3PWVB 4CNIA 1TETH 5GZOD 1QLFB 3IRPX 2YUZA 5IIEB 4F9LC 3VI3E 2O5YH 5GGSA 4XNQB 2ZG3A 1RZKL 1Q9LB 1N0LA 1Y0LA 5F88B 2EDEA 5TH2B 4MLSA 5C0FB 4NC0B 3LS5H 4MA8L 1X3DA 4LCWB 5GRZA 4ZXBA 3VGDA 5LJYH 1MIEL 3V2AR 5ITBL 3FJTA 1FG2B 4HCRL 4TRPH 5DR5L 1BZ9B 4QHMA 4GS7C 1P4BL 4YUEH 4OF5A 3QEQD 4KAQL 4QRTB 4MD5B 4OCLC 1VEMA 1FFQA 3MJ9A 3IAQA 1E4JA 3B9KC 5GZND 3MROB 3UZEA 5BJTB 3UMTA 3B9EA 3HRZB 4PJGA 5D72L 2X7LA 4FQ2H 2A73A 5CZVH 2CIIB 3TNNB 4UIKL 1MHCA 1I3VA 3X11A 2L7UA 1JN6A 5LGJB 1KGCE 1J18A 2V6HA 1HQRB 5D7SL 4YPGA 5D6DA 1IEAA 3VWJA 3MRCA 4C4KO 2BVUA 1I7RB 4XCEB 3SO3C 1HYSD 1BPVA 1LEKA 4OZIA 4NDMA 5FGBA 3NA9L 4J4PD 1KULA 4ZUTB 2RHEA 1TTFA 4KXZI 2AJVL 5IJVA 5T1LB 1LO2H 3MO1A 5SWQB 2OBGA 5C09B 4P3DA 5C0JB 5LBSH 3ZT5A 1DQMH 5HYEA 4U6XB 1A5FL 3Q6FB 3HR5B 3OKMA 5J4MA 5EO1B 3HC4L 3JUYA 5EPMA 4D3CL 4NSKA 1DBBH 1FNFA 1E4WL 3QWRD 4YIQA 5EBWB 5HHOD 3LKNB 3BEWA 2NW3A 5IMMB 3UC0H 1INQA 2JIXD 3VFNA 2R8SH 3T0VA 1T7XA 4NM4H 4P4KD 5KS9F 4LCYB 3PGFL 2XTJD 1VEOA 2OS7A 2ZKHL 3ZE2F 3U9UB 4JFFD 5F7LB 4WUUE 1J88A 3TVMA 3D2UA 1H3GA 1WTGT 3FZUD 1SJHA 4Y4HD 1BZ7A 2QTEA 4PV9B 3KDMA 1XGYL 4R6UA 5CINL 2EXWC 3MLUH 5IB3A 5INCB 2FB4L 3MCKA 5DJCB 5GJSH 3GM0A 5LG1A 3P4OB 4GKSB 4M03A 4Z7WA 4C55A 3WKML 2AJUH 3ARBB 3SE3A 3IDIA 4BH8B 4HAFA 4JFPA 4G43A 4R7NA 2YD3A 1DANT 3VD4A 4ODUB 4X6DB 3MRQB 1N4XH 4KVCH 3ULSA 4GW4A 5LCVH 2R4SH 2BHZA <