4LW2A

Structural changes during cysteine desulfurase csda and sulfur-acceptor csde interactions provide insight into the trans-persulfuration
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
399
structure length
399
Chain Sequence
NVFNPAQFRAQFPALQDAGVYLDSAATALKPEAVVEATQQFYSLSAGNVHRSQFAEAQRLTARYEAAREKVAQLLNAPDDKTIVWTRGTTESINMVAQCYARPRLQPGDEIIVSVAEHHANLVPWLMVAQQTGAKVVKLPLNAQRLPDVDLLPELITPRSRILALGQMSNVTGGCPDLARAITFAHSAGMVVMVDGAQGAVHFPADVQQLDIDFYAFSGHKLYGPTGIGVLYGKSELLEAMSPWLGGGKMVHEVSFDGFTTQSAPWKLEAGTPNVAGVIGLSAALEWLADYDINQAESWSRSLATLAEDALAKRPGFRSFRCQDSSLLAFDFAGVHHSDMVTLLAEYGIALRAGQHCAQPLLAELGVTGTLRASFAPYNTKSDVDALVNAVDRALELLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine sulfinate desulfinase
publication title Structural changes during cysteine desulfurase CsdA and sulfur-acceptor CsdE interactions provide insight into the trans-persulfuration.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 143
structure length 399
sequence length 399
chains with identical sequence B, C
ec nomenclature ec 2.8.1.7: Cysteine desulfurase.
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4lw2A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4lw2A01
2AY3A 1B9IA 2VMVA 4RJYA 3WX9A 2JGTA 1YAAA 1X29A 3WZFA 4A0FA 3WCOA 1KKPA 2ZUKA 1LKCA 4ISYA 2BYJA 1C9CA 2Z9WA 4MKKA 1SPAA 2AY6A 3DZZA 3F6TA 4R2NA 3I4JA 4AO9A 4CXQA 3F9TA 1PG8A 2EGYA 3MEBA 1ASCA 4F5IA 1H0CA 4KXKA 3VAXA 4B98A 1V72A 2BI2A 4M2KA 4EB7A 3RBFA 2HUUA 2W7JA 3NUIA 3AV7A 3GJUA 3QPGA 5G4JA 5EAVA 2QB3A 4XJOA 1TOKA 1N2TA 3LG0A 2YHKA 1LS3A 4XAUA 3G7QA 4E77A 2AY5A 4MQRA 2BIAA 2VLFA 4PIWA 5G09A 1ARTA 3A8UX 2GQNA 4GEBA 3JZLA 1V2EA 1BT4A 2E7IA 2W7KA 3DODA 4TMRA 4W91A 5JAYA 1S06A 2Z1YA 1I48A 2AY9A 1G7XA 3WKRA 2RFVA 3CQ5A 1EQBA 3NUBA 2VIAA 4O6ZA 3KGXA 1MGVA 1RVYA 5FT5A 1IX7A 1BQAA 3BCAA 4BHDA 1C7GA 2FNUA 3GWPA 3AEJC 4ADEA 4MSOA 1IAXA 3BWOA 4E3QA 5DX5A 1ORDA 1OXPA 1TASA 1GCKA 4PFFA 5M4DA 4JE5A 4XJPA 4A0GA 4L0OA 3K28A 3PPLA 2HZPA 2ZSMA 3NDNA 2AEVA 4E1OA 4AZJA 1G4VA 1BW0A 1WSTA 3JU7A 5D95A 1KKJA 2JJFA 3IF2A 2VMOA 1J32A 1AY4A 2O1BA 3EI7A 2W8VA 3FFRA 4M2MA 3NNKA 3EIBA 3NX3A 2D7YA 2OKKA 4Q76A 1IBJA 1M0NA 2WK7A 4MGRA 4A0RA 1AMRA 3KKIA 3E9KA 2R2NA 2Z1ZA 4GRXA 4RM1A 3AEMC 4IXSA 5EFSA 3M5UA 4P3MA 4IXOA 5E4ZA 2W7HA 1X28A 3NTJA 2C44A 3FQ8A 1CL1A 2VGSA 4MQPA 3QN6A 1C4KA 1QGNA 3FKDA 4OBVA 4W5KA 1ASDA 5G4IA 3N75A 1EJIA 1AKCA 3EI8A 3ISLA 4F5JA 3BN1A 3BB8A 1O4SA 1WYVB 1SVVA 4JEWA 1N31A 1OATA 4OYTA 1GEWA 1KL2A 3B46A 3K7YA 4ZSWA 1OHWA 2GMSA 1GEYA 1WKHA 3MAFB 3E2ZA 3MC6C 1PMMA 3GSBA 2W7FA 4ZASA 4UHOA 5D5SA 1WYVA 5EAAA 4ZM4A 2YOBA 3N0LA 4IW7A 3GETA 4ITXA 4F5KA 1CQ7A 2AEUA 3HT4A 3USFA 1MDZA 3PA9A 3MAFA 4EB5A 5K8BA 3B1DA 2F8JA 3ELPA 3RI6A 1VEFA 2CFBA 4F4EA 3WGCA 4CXRA 2R0TA 3DR7A 3G0TA 1ASMA 5DJ1A 3RBLA 2BI5A 2DKJA 1B9HA 4CBRA 1S09A 3F0HA 4GE7A 1BJWA 1TOGA 5TF5A 5HXXA 3UWCA 1CJ0A 2VGZA 3HLMA 4F5MA 4IYOB 2C81A 1TOEA 4ADBA 2AY8A 1OHYA 4HF8A 4DQ6A 4OCAA 4RLGA 4U1TA 5FT4A 2ZY4A 4ZSYA 4FFCA 1YJYA 1LC5A 2VGWA 2W7LA 4IYOA 1DGEA 4Y0IA 3VK4A 4H51A 4BMKA 2FN6A 2PO3A 3P1TA 2VGTA 4K2BA 1QITA 5EIGB 1YNUA 1FG3A 1LC7A 2E7UA 2VMQA 1TATA 1UU0A 3HQTA 1GC0A 4IXZA 1B5OA 1X2AA 1AAMA 1AY8A 2VMWA 3B1EA 3FQAA 3FDBA 1CQ6A 1ASNA 5EIGA 3LV2A 1O61A 3ACZA 3TFTA 3OKSA 2AY1A 2TPLA 4Q31A 4GE9A 4RAEA 4WYAA 4A0HA 3E6GA 4BA4A 3NYSA 4ADDA 4LNJA 3HMUA 4M2JA 3FSLA 7AATA 3EZSA 3N5MA 4KYOA 4PFNA 3W1IA 4ITGA 1C7NA 4XQ2A 1XI9A 4JEVA 2ZY2A 2AY2A 2W7GA 3PD6B 4W1VA 4W8IA 4AH3A 4JE5D 4Q75A 3ATHA 2HP1A 1MAPA 2ZC0A 3BC8A 1YIYA 5E5IA 1DTYA 4R5FA 5DJ9A 2VMXA 1I41A 5LHAA 1M0OA 2Z9UA 2BI9A 2FQ6A 1GEXA 2VMZA 2CJHA 4QGRA 1TOIA 3DU4A 3AEOA 1BKGA 4JF0A 1LK9A 1ZC9A 1V2DA 2QBTA 1AJSB 3MAUA 3DXWA 1WYUB 1QJ3A 2CH1A 2EH6A 2PB0A 3BCXA 4W1WA 1GBNA 4KAMA 1CS1A 1FG7A 2OATA 3TCMA 3FVUA 2BI3A 3KE3A 3AEMA 2G6WA 3FQ7A 1AJSA 1ASBA 2DR1A 1AHFA 1AICA 3FZ8A 1IVRA 1WKGA 4WD2A 1AHYA 1ASGA 4IY7A 1VJOA 4WYCA 4OMAA 1Z7DA 2VMYA 4MY5A 1RV3A 4F5GA 2WKAA 4TV7A 3VK2A 5C6UA 3FRKA 2YKYA 4WYDA 1GC3A 3IHJA 3MC6A 4ZDPA 5EUNA 1M4NA 3FZ6A 2W8JA 3AATA 3E2YA 3K40A 3VOMA 1PMOA 3ZZJA 4JEZA 2DGKA 1YOOA 1Z3ZA 2BWPA 3DXVA 3LVLB 3GZDC 3EI5A 4NOGA 5HDMA 4WXGA 3WLXA 1M0QA 1DJEA 8AATA 1RV4A 1IUGA 1UKJA 2ZJGA 3CQ6A 3JW9A 1GD9A 3WY7A 1CQ8A 5EUEA 3L8AA 1D7UA 4A6RA 4ADCA 2W8WA 2WK9A 3G8MA 2DGLA 4GDYA 4IX8A 3LWSA 4XJMA 3EZ1A 3EIAA 3LY1A 1BJ4A 1ARSA 3DYDA 3TFUA 5DB5A 1DFOA 1CL2A 4R8DA 4BA5A 1AHEA 1S08A 3JWAA 1AJRA 3GBXA 4XEWA 2YKXA 2CJDA 4W1XA 4EMYA 2HUFA 1MLYA 2EZ1A 2FYFA 3A9ZA 2QB2A 1MDXA 3GR9A 1ARIA 4WYFA 3T32A 3I16A 2ZY3A 1OXOA 1UU1A 1EG5A 2VGUA 1S0AA 3FVSA 2V0YA 4RITA 1BQDA 4WYEA 2R5CB 2YKUA 1BS0A 3HDOA 3BS8A 4WBTA 1MLZA 3DC1A 5BJ3A 3OP7A 4ZWVA 1D7SA 2EZ2A 5F9SA 3LVJA 2Z20A 1MDOA 2D5YA 1LW5A 4ZDOA 4K2MA 2R5CA 2DKBA 2Z61A 1JS3A 4A00A 5M46A 1W3UA 2YKVA 1E5FA 2D65A 1SFFA 1Y4IA 3KGWA 4UHNA 5E3KA 4EFFA 4FL0A 3JWBA 1G7WA 1ASAA 2VMPA 4AO4A 3PAAA 4U2HA 4I8AA 3MADA 2YCPA 2D7ZA 2O7CA 2VMNA 3PGYA 4CBSA 1M7YA 2HOYA 3EI6A 2X8UA 3WGBA 4WLHA 1S07A 3LVMA 1GC2A 1ARGA 1SZKA 2YCTA 3QM2A 1KMJA 3B1CA 4HVKA 2JJHA 3AOVA 3W1JA 4WP0A 5IWQA 3H7FA 2CY8A 4JEXA 5M4BA 2BWNA 3H14A 1AIAA 3D6KA 1YJSA 3FCRA 4WXBA 3QGUA 3QHXA 1O62A 3QI6A 3RCHB 4OT8A 3A2BA 4TN4A 2HP2A 2D64A 4MKJA 2W8TA 3ASAA 2W7MA 3FFHA 4Q6RA 4Y0HA 2OGEA 1D7RA 3DRDA 1OHVA 3RCHA 3ZRRA 2JJEA 1TPLA 2W7IA 5HHYA 4UQVA 2X3LA 2HUIA 1LW4A 5G2QA 3FD0A 1ASEA 4Y0DA 3AEJA 2ORDA 4A72A 1W7NA 2DGMA 2VLHA 4R5ZA 1AMSA 3B8XA 3R4TA 2VI8A 9AATA 2QMAA 1N8PA 3LVKA 5EQCA 2CJGA 1YIZA 4GE4A 2YRIA 2JISA 2ZY5A 4OTLA 1GDEA 2AATA 3PD6A 3WKSA 3NU7A 3PJ0A 2VMSA 4RKCA 3RQ1A 1ELQA 2VMTA 2FNIA 1QIRA 3BWNC 3HL2A 2BIEA 3COGA 4ZDLA 3A9XA 1AHGA 2HOXA 3NU8A 1CZCA 4ZWMA 4ZLVA 2EPJA 3PIUA 1D2FA 1WYTB 1B8GA 1VP4A 4RJ0A 3UAKA 3ZRQA 2HORA 4GSAA 2BYLA 1W7LA 3GZDA 1AX4A 3TATA 5BJ4A 3W1HA 1WYUA 3ELEA 3NRAA 4OC9A 4JF1A 1WYTA 2YCNA 2D63A 4MQQA 3P6KA 1QJ5A 1SF2A 4UHMA 3FVXA 1KL1A 1W7MA 2CH2A 5F8VA 5I92A 4A6UA 2X5FA 1DJUA 2Z67A 2XBNA 2V1PA 3NYTA 2BIGA 3R9AA 1M0PA 2VYCA 3JTXA 4LW2A 4DBCA 4JEYA 5FT8A 3L44A 3BV0A 3EUCA 2CTZA 3VK3A 4E3RA 4WLJA 1U08A 5LH9A 2VIBA 1DKAA 4F5FA 3TQXA 4RIZA 1IX8A 5G0AA 1UU2A 4AZKA 4BQ0A 3AEPA 2OKJA 1ASLA 2CB1A 1BJNA 2CINA 2AY4A 1AHXA 3Q8NA 2DOUA 3PDBB 3AELA 3GZCA 4K2IA 1W23A 5M49A 3EI9A 4CVQA 1AKAA 4XK1A 2WK8A 1IJIA 5AX8A 5EUDA 1MAQA 2E54A 3QBOA 5G2PA 3PDXA 3PDBA 4J5UA 4WYGA 3HVYA 3ASBA 4F5HA 4RKDA 2W8UA 2EO5A 2Z9VA 1C0NA 1AIBA 2OGAA 1LC8A 4AOAA 4DGTA 2C0RA 2BWOA 1V2FA 1IX6A 3CBFA 4ZAHA 2QLRA 5FT6A 4ATPA 1M6SA 4WXFA 4F5LA 3A9YA 3MBBA 1ZODA 3NYUA 1AAWA 3E2ZB 1G4XA 4LNMA 1GC4A 2R5EA 3FTBA 3FZ7A 1ELUA 2ZP7A 4OBUA 1B4XA 1JG8A 1H1CA 1JS6A 3DR4A 3UE8A 2VMUA 4J8LA 4EU1A 2FM1A 3AOWA 1CZEA 3E77A 3MKJA 1SZSA 2W7EA 1AKBA 1ECXA 1I43A 2PB2A 2VI9A 2W7DA 1E5EA 4UOYA 1RVUA 2ZYJA 4ATQA 1AMAA 3HBXA 1IAYA 1YJZA 2BHXA 3CQ4A 2XH1A 2VGVA 2ZSLA 1X0MA 2CSTA 4LNLA 1PFFA 2E7JA 1SZUA 3E2FA 4WB0B 1C7OA 1QZ9A 3BCBA 4B9BA 3ZZKA 4LW4A 4N0WA 3VP6A 3ZRPA 2HOZA 3ECDA 2BKWA 1DJ9A 1ARHA 2BI1A 2OQXA 2Z9XA 1XEYA 4WB0A 2NMPA 5J8QA 1QISA 3BWNA 2CANA 4N0BA 3WCNA 2YRRA 3FDDA 2Q7WA 1BJOB 2X5DA 3AENB 1FC4A 1JF9A 1ASFA 2GSAA 4PVFA 1I29A 2C7TA 2JG2A 1TOJA 2D61A 3I5TA 2GB3A 4LC3A 1AMQA 2D66A 1O69A 3II0A 1AY5A 1TARA 1BJOA 2VMRA 2O0RA 3AENA 1B5PA 4XJLA 3RUYA 4ZM3A 1T3IA 1D7VA 2AY7A 2GMUA 1P3WA 3CAIA 1DGDA 2JJGA 1J04A 1M32A 4A6TA 1ZOBA 2QA3A 4P7YA 1KMKA
chains in the Genus database with same CATH superfamily
2AY3A 1B9IA 2VMVA 4RJYA 3WX9A 2JGTA 1YAAA 1X29A 3WZFA 4A0FA 3WCOA 1KKPA 2ZUKA 1LKCA 4ISYA 2BYJA 1C9CA 2Z9WA 4MKKA 1SPAA 2AY6A 3DZZA 3F6TA 4R2NA 3I4JA 4AO9A 4CXQA 3F9TA 1PG8A 2EGYA 3MEBA 1ASCA 4F5IA 1H0CA 4KXKA 3VAXA 4B98A 1V72A 2BI2A 4M2KA 4EB7A 3RBFA 2HUUA 2W7JA 3NUIA 3AV7A 3GJUA 3QPGA 5G4JA 5EAVA 2QB3A 4XJOA 1TOKA 1N2TA 3LG0A 2YHKA 1LS3A 4XAUA 3G7QA 4E77A 2AY5A 4MQRA 2BIAA 2VLFA 4PIWA 5G09A 1ARTA 3A8UX 2GQNA 4GEBA 3JZLA 1V2EA 1BT4A 2E7IA 2W7KA 3DODA 4TMRA 4W91A 5JAYA 1S06A 2Z1YA 1I48A 2AY9A 1G7XA 3WKRA 2RFVA 3CQ5A 1EQBA 3NUBA 2VIAA 4O6ZA 3KGXA 1MGVA 1RVYA 5FT5A 1IX7A 1BQAA 3BCAA 4BHDA 1C7GA 2FNUA 3GWPA 3AEJC 4ADEA 4MSOA 1IAXA 3BWOA 4E3QA 5DX5A 1ORDA 1OXPA 1TASA 1GCKA 4PFFA 5M4DA 4JE5A 4XJPA 4A0GA 4L0OA 3N4RA 3K28A 3H9XA 3PPLA 2HZPA 2ZSMA 3NDNA 2AEVA 4E1OA 4K05A 4AZJA 1G4VA 1BW0A 1WSTA 3JU7A 5D95A 1KKJA 2JJFA 3IF2A 2VMOA 1J32A 1AY4A 2O1BA 3EI7A 2W8VA 3FFRA 4M2MA 3NNKA 3EIBA 3NX3A 2D7YA 2OKKA 4Q76A 1IBJA 1M0NA 2WK7A 4MGRA 4A0RA 1AMRA 3KKIA 3E9KA 2R2NA 2Z1ZA 4GRXA 4RM1A 3AEMC 4IXSA 5EFSA 3M5UA 4P3MA 4IXOA 5E4ZA 2W7HA 1X28A 3NTJA 2C44A 3FQ8A 1CL1A 2VGSA 4MQPA 3QN6A 1C4KA 1QGNA 3FKDA 4OBVA 4W5KA 1ASDA 5G4IA 3N75A 1EJIA 1AKCA 3EI8A 3ISLA 4F5JA 3BN1A 3BB8A 1O4SA 1WYVB 1SVVA 4JEWA 1N31A 1OATA 4OYTA 1GEWA 1KL2A 3B46A 3K7YA 4ZSWA 1OHWA 2GMSA 1GEYA 1WKHA 3MAFB 3E2ZA 3MC6C 1PMMA 3GSBA 2W7FA 4ZASA 4UHOA 5D5SA 1WYVA 5EAAA 4ZM4A 2YOBA 3N0LA 4IW7A 3GETA 4ITXA 4F5KA 1KAFA 1CQ7A 2AEUA 3HT4A 3USFA 1MDZA 3PA9A 3MAFA 4EB5A 5K8BA 3B1DA 2F8JA 3ELPA 3RI6A 1VEFA 2CFBA 4F4EA 3WGCA 4CXRA 2R0TA 3DR7A 3G0TA 1ASMA 5DJ1A 3RBLA 2BI5A 2DKJA 1B9HA 4CBRA 1S09A 3F0HA 4GE7A 1BJWA 1TOGA 5TF5A 5HXXA 3UWCA 1CJ0A 2VGZA 3HLMA 4F5MA 4IYOB 2C81A 1TOEA 4ADBA 2AY8A 1OHYA 4HF8A 4DQ6A 4OCAA 4RLGA 4U1TA 5FT4A 2ZY4A 4ZSYA 4FFCA 5KTBA 1YJYA 1LC5A 2VGWA 2W7LA 4IYOA 1DGEA 4Y0IA 3VK4A 4H51A 4BMKA 2FN6A 2PO3A 3P1TA 2VGTA 4K2BA 1QITA 5EIGB 1YNUA 1FG3A 1LC7A 2E7UA 2A1VA 3N4SA 2VMQA 1TATA 1UU0A 3HQTA 1GC0A 4IXZA 1B5OA 1X2AA 1AAMA 1AY8A 2VMWA 3B1EA 3FQAA 3FDBA 1CQ6A 2EYQA 1ASNA 5EIGA 3LV2A 1O61A 3ACZA 3TFTA 3OKSA 2AY1A 2TPLA 4Q31A 4GE9A 4RAEA 4WYAA 4A0HA 3E6GA 4BA4A 3NYSA 4ADDA 4LNJA 3HMUA 4M2JA 3FSLA 7AATA 3EZSA 3N5MA 4KYOA 4PFNA 3W1IA 4ITGA 1C7NA 4XQ2A 2FKIA 1XI9A 4JEVA 2ZY2A 2AY2A 2W7GA 3PD6B 4W1VA 4W8IA 4AH3A 4JE5D 4Q75A 3ATHA 2HP1A 1MAPA 2ZC0A 3BC8A 1YIYA 5E5IA 1DTYA 4R5FA 5DJ9A 2VMXA 1I41A 5LHAA 1M0OA 2Z9UA 2BI9A 2FQ6A 1GEXA 2VMZA 2CJHA 4QGRA 1TOIA 3DU4A 3AEOA 1BKGA 4JF0A 1LK9A 1ZC9A 1V2DA 2QBTA 1AJSB 3MAUA 3DXWA 1WYUB 1QJ3A 2CH1A 2EH6A 2PB0A 3BCXA 4W1WA 1GBNA 4KAMA 1CS1A 1FG7A 2OATA 3TCMA 3FVUA 2BI3A 3KE3A 3AEMA 2G6WA 2WB6A 3FQ7A 1AJSA 1ASBA 2DR1A 1AHFA 1AICA 3FZ8A 1IVRA 1WKGA 4WD2A 3N7NA 1AHYA 1ASGA 4IY7A 1VJOA 4WYCA 4OMAA 1Z7DA 2VMYA 4MY5A 1RV3A 4F5GA 2WKAA 4TV7A 3VK2A 5C6UA 3FRKA 2YKYA 4WYDA 1GC3A 3IHJA 3MC6A 4ZDPA 5EUNA 1M4NA 3FZ6A 2W8JA 3AATA 3E2YA 3K40A 3VOMA 1PMOA 3ZZJA 4JEZA 2DGKA 1YOOA 1Z3ZA 2BWPA 3DXVA 3LVLB 3GZDC 3EI5A 4NOGA 5HDMA 4WXGA 3WLXA 1M0QA 1DJEA 8AATA 1RV4A 1IUGA 1UKJA 2ZJGA 3CQ6A 3JW9A 1GD9A 3WY7A 1CQ8A 5EUEA 3L8AA 1D7UA 4A6RA 4ADCA 2W8WA 2WK9A 3G8MA 2DGLA 4GDYA 4IX8A 3LWSA 4XJMA 3EZ1A 3EIAA 3LY1A 1BJ4A 1ARSA 3DYDA 3TFUA 5DB5A 1DFOA 1CL2A 4R8DA 4BA5A 1AHEA 1S08A 3JWAA 4H63Q 1AJRA 3GBXA 4XEWA 2YKXA 2CJDA 4W1XA 4EMYA 2HUFA 1MLYA 2EZ1A 2FYFA 3A9ZA 2QB2A 1MDXA 3GR9A 1ARIA 4WYFA 3T32A 3I16A 2ZY3A 1OXOA 1UU1A 1EG5A 2VGUA 1S0AA 3FVSA 2V0YA 4RITA 1BQDA 4WYEA 2R5CB 2YKUA 1BS0A 3HDOA 3BS8A 4WBTA 1MLZA 3DC1A 5BJ3A 3OP7A 4ZWVA 1D7SA 2EZ2A 5F9SA 3LVJA 2Z20A 1MDOA 2D5YA 1LW5A 4ZDOA 4K2MA 2R5CA 2DKBA 2Z61A 1JS3A 4A00A 5M46A 1W3UA 2YKVA 1E5FA 2D65A 1SFFA 1Y4IA 3KGWA 4UHNA 5E3KA 4EFFA 4FL0A 3JWBA 1G7WA 1ASAA 2VMPA 4AO4A 3PAAA 4U2HA 4I8AA 3MADA 2YCPA 2D7ZA 2O7CA 2VMNA 3PGYA 4CBSA 1M7YA 2HOYA 3EI6A 2X8UA 3WGBA 4WLHA 1S07A 3LVMA 1GC2A 1ARGA 1SZKA 2YCTA 3QM2A 1KMJA 3B1CA 4HVKA 2JJHA 3AOVA 3W1JA 4WP0A 5IWQA 3H7FA 2CY8A 4JEXA 5M4BA 2BWNA 3H14A 1AIAA 3D6KA 1YJSA 3FCRA 4WXBA 3QGUA 3QHXA 1O62A 3QI6A 3RCHB 4OT8A 3A2BA 4TN4A 2HP2A 2D64A 4MKJA 2W8TA 3ASAA 2W7MA 3FFHA 4Q6RA 4Y0HA 2OGEA 1D7RA 3DRDA 1OHVA 3RCHA 3ZRRA 2JJEA 1TPLA 2W7IA 5HHYA 4UQVA 2X3LA 2HUIA 1LW4A 5G2QA 3FD0A 1ASEA 4Y0DA 3AEJA 2ORDA 4A72A 1W7NA 2DGMA 2VLHA 4R5ZA 1AMSA 3B8XA 3R4TA 2VI8A 9AATA 2QMAA 1N8PA 3LVKA 5EQCA 2CJGA 1YIZA 4GE4A 2YRIA 2JISA 2ZY5A 4OTLA 1GDEA 2AATA 3PD6A 3WKSA 3NU7A 3PJ0A 2VMSA 4RKCA 3RQ1A 1ELQA 2VMTA 2FNIA 1QIRA 3BWNC 3HL2A 2BIEA 3COGA 4ZDLA 3A9XA 1AHGA 2HOXA 3NU8A 1CZCA 4ZWMA 4ZLVA 2EPJA 3PIUA 1D2FA 1WYTB 1B8GA 1VP4A 4RJ0A 3UAKA 3ZRQA 2HORA 4GSAA 2BYLA 1W7LA 3GZDA 1AX4A 3TATA 5BJ4A 3W1HA 1WYUA 3ELEA 3NRAA 4OC9A 4JF1A 1WYTA 2YCNA 2D63A 4MQQA 3P6KA 1QJ5A 1SF2A 4UHMA 3FVXA 1KL1A 1W7MA 2CH2A 5F8VA 5I92A 4A6UA 2X5FA 1DJUA 2Z67A 2XBNA 2V1PA 3NYTA 2QSRA 2BIGA 3R9AA 1M0PA 2VYCA 3JTXA 4LW2A 4DBCA 4JEYA 5FT8A 3L44A 3BV0A 3EUCA 2CTZA 3VK3A 4E3RA 4WLJA 1U08A 5LH9A 2VIBA 1DKAA 4F5FA 3TQXA 4RIZA 1IX8A 5G0AA 1UU2A 4AZKA 4BQ0A 3AEPA 2OKJA 1ASLA 2CB1A 1BJNA 2CINA 2AY4A 1AHXA 3Q8NA 2DOUA 3PDBB 3AELA 3GZCA 4K2IA 1W23A 5M49A 3EI9A 4CVQA 1AKAA 4XK1A 2WK8A 1IJIA 5AX8A 5EUDA 1MAQA 2E54A 3QBOA 5G2PA 3PDXA 3PDBA 4J5UA 4WYGA 3HVYA 3ASBA 4F5HA 4RKDA 2W8UA 2EO5A 2Z9VA 1C0NA 1AIBA 2OGAA 1LC8A 4AOAA 4DGTA 2C0RA 2BWOA 1V2FA 1IX6A 3CBFA 4ZAHA 2QLRA 5FT6A 4ATPA 1M6SA 4WXFA 4F5LA 3A9YA 3MBBA 1ZODA 3NYUA 1AAWA 3E2ZB 1G4XA 4LNMA 1GC4A 2R5EA 3FTBA 3FZ7A 1ELUA 2ZP7A 4OBUA 1B4XA 1JG8A 1H1CA 1JS6A 3DR4A 3UE8A 2VMUA 4J8LA 4EU1A 2FM1A 3AOWA 1CZEA 3E77A 2G7JA 3MKJA 1SZSA 2W7EA 1AKBA 1ECXA 1I43A 2PB2A 2VI9A 2W7DA 1E5EA 4UOYA 1RVUA 2ZYJA 4ATQA 1AMAA 3HBXA 1IAYA 1YJZA 2BHXA 3CQ4A 2XH1A 2VGVA 2ZSLA 1X0MA 2CSTA 4LNLA 1PFFA 2E7JA 1SZUA 3E2FA 4WB0B 1C7OA 1QZ9A 3BCBA 4B9BA 3ZZKA 4LW4A 4N0WA 3VP6A 3ZRPA 2HOZA 3ECDA 2BKWA 1DJ9A 1ARHA 2BI1A 2OQXA 2Z9XA 1XEYA 4WB0A 2NMPA 5J8QA 1QISA 2KFPA 3BWNA 2CANA 4N0BA 3WCNA 2YRRA 3FDDA 2Q7WA 1BJOB 2X5DA 3AENB 1FC4A 1JF9A 1ASFA 2GSAA 4PVFA 1I29A 2C7TA 2JG2A 1TOJA 2D61A 3I5TA 2GB3A 4LC3A 1AMQA 2D66A 1O69A 3II0A 1AY5A 1TARA 1BJOA 2VMRA 2O0RA 3AENA 1B5PA 4XJLA 3RUYA 4ZM3A 1T3IA 1D7VA 2AY7A 2GMUA 1P3WA 3CAIA 1DGDA 2JJGA 1J04A 1M32A 4A6TA 1ZOBA 2QA3A 4P7YA 3N4XA 1KMKA
chains in the Genus database with same CATH topology
2AY3A 1B9IA 2VMVA 4RJYA 3WX9A 2JGTA 1YAAA 1X29A 3WZFA 4A0FA 3WCOA 1KKPA 2ZUKA 1LKCA 4ISYA 2BYJA 1C9CA 2Z9WA 4MKKA 1SPAA 2AY6A 3DZZA 3F6TA 4R2NA 3I4JA 4AO9A 4CXQA 3F9TA 1PG8A 2EGYA 3MEBA 1ASCA 4F5IA 1H0CA 4KXKA 3VAXA 4B98A 1V72A 2BI2A 4M2KA 4EB7A 3RBFA 2HUUA 2W7JA 3NUIA 3AV7A 3GJUA 3QPGA 5G4JA 5EAVA 2QB3A 4XJOA 1TOKA 1N2TA 3LG0A 2YHKA 1LS3A 4XAUA 3G7QA 4E77A 2AY5A 4MQRA 2BIAA 2VLFA 4PIWA 5G09A 1ARTA 3A8UX 2GQNA 4GEBA 3JZLA 1V2EA 1BT4A 2E7IA 2W7KA 3DODA 4TMRA 4W91A 5JAYA 1S06A 2Z1YA 1I48A 2AY9A 1G7XA 3WKRA 2RFVA 3CQ5A 1EQBA 3NUBA 2VIAA 4O6ZA 3KGXA 1MGVA 1RVYA 5FT5A 1IX7A 1BQAA 3BCAA 4BHDA 1C7GA 2FNUA 3GWPA 3AEJC 4ADEA 4MSOA 1IAXA 3BWOA 4E3QA 5DX5A 1ORDA 1OXPA 1TASA 1GCKA 4PFFA 5M4DA 4JE5A 4XJPA 4A0GA 4L0OA 3N4RA 3K28A 3H9XA 3PPLA 2HZPA 2ZSMA 3NDNA 2AEVA 4E1OA 4K05A 4AZJA 1G4VA 1BW0A 1WSTA 3JU7A 5D95A 1KKJA 2JJFA 3IF2A 2VMOA 1J32A 1AY4A 2O1BA 3EI7A 2W8VA 3FFRA 4M2MA 3NNKA 3EIBA 3NX3A 2D7YA 2OKKA 4Q76A 1IBJA 1M0NA 2WK7A 4MGRA 4A0RA 1AMRA 3KKIA 3E9KA 2R2NA 2Z1ZA 4GRXA 4RM1A 3AEMC 4IXSA 5EFSA 3M5UA 4P3MA 4IXOA 5E4ZA 2W7HA 1X28A 3NTJA 2C44A 3FQ8A 1CL1A 2VGSA 4MQPA 3QN6A 1C4KA 1QGNA 3FKDA 4OBVA 4W5KA 1ASDA 5G4IA 3N75A 1EJIA 1AKCA 3EI8A 3ISLA 4F5JA 3BN1A 3BB8A 1O4SA 1WYVB 1SVVA 4JEWA 1N31A 1OATA 4OYTA 1GEWA 1KL2A 3B46A 3K7YA 4ZSWA 1OHWA 2GMSA 1GEYA 1WKHA 3MAFB 3E2ZA 3MC6C 1PMMA 3GSBA 2W7FA 4ZASA 4UHOA 5D5SA 1WYVA 5EAAA 4ZM4A 2YOBA 3N0LA 4IW7A 3GETA 4ITXA 4F5KA 1CQ7A 2AEUA 3HT4A 3USFA 1MDZA 3PA9A 3MAFA 4EB5A 5K8BA 3B1DA 2F8JA 3ELPA 3RI6A 1VEFA 2CFBA 4F4EA 3WGCA 4CXRA 2R0TA 3DR7A 3G0TA 1ASMA 5DJ1A 3RBLA 2BI5A 2DKJA 1B9HA 4CBRA 1S09A 3F0HA 4GE7A 1BJWA 1TOGA 5TF5A 5HXXA 3UWCA 1CJ0A 2VGZA 3HLMA 4F5MA 4IYOB 2C81A 1TOEA 4ADBA 2AY8A 1OHYA 4HF8A 4DQ6A 4OCAA 4RLGA 4U1TA 5FT4A 2ZY4A 4ZSYA 4FFCA 5KTBA 1YJYA 1LC5A 2VGWA 2W7LA 4IYOA 1DGEA 4Y0IA 3VK4A 4H51A 4BMKA 2FN6A 2PO3A 3P1TA 2VGTA 4K2BA 1QITA 5EIGB 1YNUA 1FG3A 1LC7A 2E7UA 2A1VA 3N4SA 2VMQA 1TATA 1UU0A 3HQTA 1GC0A 4IXZA 1B5OA 1X2AA 1AAMA 1AY8A 2VMWA 3B1EA 3FQAA 3FDBA 1CQ6A 2EYQA 1ASNA 5EIGA 3LV2A 1O61A 3ACZA 3TFTA 3OKSA 2AY1A 2TPLA 4Q31A 4GE9A 4RAEA 4WYAA 4A0HA 3E6GA 4BA4A 3NYSA 4ADDA 4LNJA 3HMUA 4M2JA 3FSLA 7AATA 3EZSA 3N5MA 4KYOA 4PFNA 3W1IA 4ITGA 1C7NA 4XQ2A 2FKIA 1XI9A 4JEVA 2ZY2A 2AY2A 2W7GA 3PD6B 4W1VA 4W8IA 4AH3A 4JE5D 4Q75A 3ATHA 2HP1A 1MAPA 2ZC0A 3BC8A 1YIYA 5E5IA 1DTYA 4R5FA 5DJ9A 2VMXA 1I41A 5LHAA 1M0OA 2Z9UA 2BI9A 2FQ6A 1GEXA 2VMZA 2CJHA 4QGRA 1TOIA 3DU4A 3AEOA 1BKGA 4JF0A 1LK9A 1ZC9A 1V2DA 2QBTA 1AJSB 3MAUA 3DXWA 1WYUB 1QJ3A 2CH1A 2EH6A 2PB0A 3BCXA 4W1WA 1GBNA 4KAMA 1CS1A 1FG7A 2OATA 3TCMA 3FVUA 2BI3A 3KE3A 3AEMA 2G6WA 2WB6A 3FQ7A 1AJSA 1ASBA 2DR1A 1AHFA 1AICA 3FZ8A 1IVRA 1WKGA 4WD2A 3N7NA 1AHYA 1ASGA 4IY7A 1VJOA 4WYCA 4OMAA 1Z7DA 2VMYA 4MY5A 1RV3A 4F5GA 2WKAA 4TV7A 3VK2A 5C6UA 3FRKA 2YKYA 4WYDA 1GC3A 3IHJA 3MC6A 4ZDPA 5EUNA 1M4NA 3FZ6A 2W8JA 3AATA 3E2YA 3K40A 3VOMA 1PMOA 3ZZJA 4JEZA 2DGKA 1YOOA 1Z3ZA 2BWPA 3DXVA 3LVLB 3GZDC 3EI5A 4NOGA 5HDMA 4WXGA 3WLXA 1M0QA 1DJEA 8AATA 1RV4A 1IUGA 1UKJA 2ZJGA 3CQ6A 3JW9A 1GD9A 3WY7A 1CQ8A 5EUEA 3L8AA 1D7UA 4A6RA 4ADCA 2W8WA 2WK9A 3G8MA 2DGLA 4GDYA 4IX8A 3LWSA 4XJMA 3EZ1A 3EIAA 3LY1A 1BJ4A 1ARSA 3DYDA 3TFUA 5DB5A 1DFOA 1CL2A 4R8DA 4BA5A 1AHEA 1S08A 3JWAA 4H63Q 1AJRA 3GBXA 4XEWA 2YKXA 2CJDA 4W1XA 4EMYA 2HUFA 1MLYA 2EZ1A 2FYFA 3A9ZA 2QB2A 1MDXA 3GR9A 1ARIA 4WYFA 3T32A 3I16A 2ZY3A 1OXOA 1UU1A 1EG5A 2VGUA 1S0AA 3FVSA 2V0YA 4RITA 1BQDA 4WYEA 2R5CB 2YKUA 1BS0A 3HDOA 3BS8A 4WBTA 1MLZA 3DC1A 5BJ3A 3OP7A 4ZWVA 1D7SA 2EZ2A 5F9SA 3LVJA 2Z20A 1MDOA 2D5YA 1LW5A 4ZDOA 4K2MA 2R5CA 2DKBA 2Z61A 1JS3A 4A00A 5M46A 1W3UA 2YKVA 1E5FA 2D65A 1SFFA 1Y4IA 3KGWA 4UHNA 5E3KA 4EFFA 4FL0A 3JWBA 1G7WA 1ASAA 2VMPA 4AO4A 3PAAA 4U2HA 4I8AA 3MADA 2YCPA 2D7ZA 2O7CA 2VMNA 3PGYA 4CBSA 1M7YA 2HOYA 3EI6A 2X8UA 3WGBA 4WLHA 1S07A 3LVMA 1GC2A 1ARGA 1SZKA 2YCTA 3QM2A 1KMJA 3B1CA 4HVKA 2JJHA 3AOVA 3W1JA 4WP0A 5IWQA 3H7FA 2CY8A 4JEXA 5M4BA 2BWNA 3H14A 1AIAA 3D6KA 1YJSA 3FCRA 4WXBA 3QGUA 3QHXA 1O62A 3QI6A 3RCHB 4OT8A 3A2BA 4TN4A 2HP2A 2D64A 4MKJA 2W8TA 3ASAA 2W7MA 3FFHA 4Q6RA 4Y0HA 2OGEA 1D7RA 3DRDA 1OHVA 3RCHA 3ZRRA 2JJEA 1TPLA 2W7IA 5HHYA 4UQVA 2X3LA 2HUIA 1LW4A 5G2QA 3FD0A 1ASEA 4Y0DA 3AEJA 2ORDA 4A72A 1W7NA 2DGMA 2VLHA 4R5ZA 1AMSA 3B8XA 3R4TA 2VI8A 9AATA 2QMAA 1N8PA 3LVKA 5EQCA 2CJGA 1YIZA 4GE4A 2YRIA 2JISA 2ZY5A 4OTLA 1GDEA 2AATA 3PD6A 3WKSA 3NU7A 3PJ0A 2VMSA 4RKCA 3RQ1A 1ELQA 2VMTA 2FNIA 1QIRA 3BWNC 3HL2A 2BIEA 3COGA 4ZDLA 3A9XA 1AHGA 2HOXA 3NU8A 1CZCA 4ZWMA 4ZLVA 2EPJA 3PIUA 1D2FA 1WYTB 1B8GA 1VP4A 4RJ0A 3UAKA 3ZRQA 2HORA 4GSAA 2BYLA 1W7LA 3GZDA 1AX4A 3TATA 5BJ4A 3W1HA 1WYUA 3ELEA 3NRAA 4OC9A 4JF1A 1WYTA 2YCNA 2D63A 4MQQA 3P6KA 1QJ5A 1SF2A 4UHMA 3FVXA 1KL1A 1W7MA 2CH2A 5F8VA 5I92A 4A6UA 2X5FA 1DJUA 2Z67A 2XBNA 2V1PA 3NYTA 2QSRA 2BIGA 3R9AA 1M0PA 2VYCA 3JTXA 4LW2A 4DBCA 4JEYA 5FT8A 3L44A 3BV0A 3EUCA 2CTZA 3VK3A 4E3RA 4WLJA 1U08A 5LH9A 2VIBA 1DKAA 4F5FA 3TQXA 4RIZA 1IX8A 5G0AA 1UU2A 4AZKA 4BQ0A 3AEPA 2OKJA 1ASLA 2CB1A 1BJNA 2CINA 2AY4A 1AHXA 3Q8NA 2DOUA 3PDBB 3AELA 3GZCA 4K2IA 1W23A 5M49A 3EI9A 4CVQA 1AKAA 4XK1A 2WK8A 1IJIA 5AX8A 5EUDA 1MAQA 2E54A 3QBOA 5G2PA 3PDXA 3PDBA 4J5UA 4WYGA 3HVYA 3ASBA 4F5HA 4RKDA 2W8UA 2EO5A 2Z9VA 1C0NA 1AIBA 2OGAA 1LC8A 4AOAA 4DGTA 2C0RA 2BWOA 1V2FA 1IX6A 3CBFA 4ZAHA 2QLRA 5FT6A 4ATPA 1M6SA 4WXFA 4F5LA 3A9YA 3MBBA 1ZODA 3NYUA 1AAWA 3E2ZB 1G4XA 4LNMA 1GC4A 2R5EA 3FTBA 3FZ7A 1ELUA 2ZP7A 4OBUA 1B4XA 1JG8A 1H1CA 1JS6A 3DR4A 3UE8A 2VMUA 4J8LA 4EU1A 2FM1A 3AOWA 1CZEA 3E77A 2G7JA 3MKJA 1SZSA 2W7EA 1AKBA 1ECXA 1I43A 2PB2A 2VI9A 2W7DA 1E5EA 4UOYA 1RVUA 2ZYJA 4ATQA 1AMAA 3HBXA 1IAYA 1YJZA 2BHXA 3CQ4A 2XH1A 2VGVA 2ZSLA 1X0MA 2CSTA 4LNLA 1PFFA 2E7JA 1SZUA 3E2FA 4WB0B 1C7OA 1QZ9A 3BCBA 4B9BA 3ZZKA 4LW4A 4N0WA 3VP6A 3ZRPA 2HOZA 3ECDA 2BKWA 1DJ9A 1ARHA 2BI1A 2OQXA 2Z9XA 1XEYA 4WB0A 2NMPA 5J8QA 1QISA 2KFPA 3BWNA 2CANA 4N0BA 3WCNA 2YRRA 3FDDA 2Q7WA 1BJOB 2X5DA 3AENB 1FC4A 1JF9A 1ASFA 2GSAA 4PVFA 1I29A 2C7TA 2JG2A 1TOJA 2D61A 3I5TA 2GB3A 4LC3A 1AMQA 2D66A 1O69A 3II0A 1AY5A 1TARA 1BJOA 2VMRA 2O0RA 3AENA 1B5PA 4XJLA 3RUYA 4ZM3A 1T3IA 1D7VA 2AY7A 2GMUA 1P3WA 3CAIA 1DGDA 2JJGA 1J04A 1M32A 4A6TA 1ZOBA 2QA3A 4P7YA 3N4XA 1KMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AY3 A;  1B9I A;  2VMV A;  4RJY A;  3WX9 A;  2JGT A;  1YAA A;  1X29 A;  3WZF A;  4A0F A;  3WCO A;  1KKP A;  2ZUK A;  1LKC A;  4ISY A;  2BYJ A;  1C9C A;  2Z9W A;  4MKK A;  1SPA A;  2AY6 A;  3DZZ A;  3F6T A;  4R2N A;  3I4J A;  4AO9 A;  4CXQ A;  3F9T A;  1PG8 A;  2EGY A;  3MEB A;  1ASC A;  4F5I A;  1H0C A;  4KXK A;  3VAX A;  4B98 A;  1V72 A;  2BI2 A;  4M2K A;  4EB7 A;  3RBF A;  2HUU A;  2W7J A;  3NUI A;  3AV7 A;  3GJU A;  3QPG A;  5G4J A;  5EAV A;  2QB3 A;  4XJO A;  1TOK A;  1N2T A;  3LG0 A;  2YHK A;  1LS3 A;  4XAU A;  3G7Q A;  4E77 A;  2AY5 A;  4MQR A;  2BIA A;  2VLF A;  4PIW A;  5G09 A;  1ART A;  3A8U X;  2GQN A;  4GEB A;  3JZL A;  1V2E A;  1BT4 A;  2E7I A;  2W7K A;  3DOD A;  4TMR A;  4W91 A;  5JAY A;  1S06 A;  2Z1Y A;  1I48 A;  2AY9 A;  1G7X A;  3WKR A;  2RFV A;  3CQ5 A;  1EQB A;  3NUB A;  2VIA A;  4O6Z A;  3KGX A;  1MGV A;  1RVY A;  5FT5 A;  1IX7 A;  1BQA A;  3BCA A;  4BHD A;  1C7G A;  2FNU A;  3GWP A;  3AEJ C;  4ADE A;  4MSO A;  1IAX A;  3BWO A;  4E3Q A;  5DX5 A;  1ORD A;  1OXP A;  1TAS A;  1GCK A;  4PFF A;  5M4D A;  4JE5 A;  4XJP A;  4A0G A;  4L0O A;  3K28 A;  3PPL A;  2HZP A;  2ZSM A;  3NDN A;  2AEV A;  4E1O A;  4AZJ A;  1G4V A;  1BW0 A;  1WST A;  3JU7 A;  5D95 A;  1KKJ A;  2JJF A;  3IF2 A;  2VMO A;  1J32 A;  1AY4 A;  2O1B A;  3EI7 A;  2W8V A;  3FFR A;  4M2M A;  3NNK A;  3EIB A;  3NX3 A;  2D7Y A;  2OKK A;  4Q76 A;  1IBJ A;  1M0N A;  2WK7 A;  4MGR A;  4A0R A;  1AMR A;  3KKI A;  3E9K A;  2R2N A;  2Z1Z A;  4GRX A;  4RM1 A;  3AEM C;  4IXS A;  5EFS A;  3M5U A;  4P3M A;  4IXO A;  5E4Z A;  2W7H A;  1X28 A;  3NTJ A;  2C44 A;  3FQ8 A;  1CL1 A;  2VGS A;  4MQP A;  3QN6 A;  1C4K A;  1QGN A;  3FKD A;  4OBV A;  4W5K A;  1ASD A;  5G4I A;  3N75 A;  1EJI A;  1AKC A;  3EI8 A;  3ISL A;  4F5J A;  3BN1 A;  3BB8 A;  1O4S A;  1WYV B;  1SVV A;  4JEW A;  1N31 A;  1OAT A;  4OYT A;  1GEW A;  1KL2 A;  3B46 A;  3K7Y A;  4ZSW A;  1OHW A;  2GMS A;  1GEY A;  1WKH A;  3MAF B;  3E2Z A;  3MC6 C;  1PMM A;  3GSB A;  2W7F A;  4ZAS A;  4UHO A;  5D5S A;  1WYV A;  5EAA A;  4ZM4 A;  2YOB A;  3N0L A;  4IW7 A;  3GET A;  4ITX A;  4F5K A;  1CQ7 A;  2AEU A;  3HT4 A;  3USF A;  1MDZ A;  3PA9 A;  3MAF A;  4EB5 A;  5K8B A;  3B1D A;  2F8J A;  3ELP A;  3RI6 A;  1VEF A;  2CFB A;  4F4E A;  3WGC A;  4CXR A;  2R0T A;  3DR7 A;  3G0T A;  1ASM A;  5DJ1 A;  3RBL A;  2BI5 A;  2DKJ A;  1B9H A;  4CBR A;  1S09 A;  3F0H A;  4GE7 A;  1BJW A;  1TOG A;  5TF5 A;  5HXX A;  3UWC A;  1CJ0 A;  2VGZ A;  3HLM A;  4F5M A;  4IYO B;  2C81 A;  1TOE A;  4ADB A;  2AY8 A;  1OHY A;  4HF8 A;  4DQ6 A;  4OCA A;  4RLG A;  4U1T A;  5FT4 A;  2ZY4 A;  4ZSY A;  4FFC A;  1YJY A;  1LC5 A;  2VGW A;  2W7L A;  4IYO A;  1DGE A;  4Y0I A;  3VK4 A;  4H51 A;  4BMK A;  2FN6 A;  2PO3 A;  3P1T A;  2VGT A;  4K2B A;  1QIT A;  5EIG B;  1YNU A;  1FG3 A;  1LC7 A;  2E7U A;  2VMQ A;  1TAT A;  1UU0 A;  3HQT A;  1GC0 A;  4IXZ A;  1B5O A;  1X2A A;  1AAM A;  1AY8 A;  2VMW A;  3B1E A;  3FQA A;  3FDB A;  1CQ6 A;  1ASN A;  5EIG A;  3LV2 A;  1O61 A;  3ACZ A;  3TFT A;  3OKS A;  2AY1 A;  2TPL A;  4Q31 A;  4GE9 A;  4RAE A;  4WYA A;  4A0H A;  3E6G A;  4BA4 A;  3NYS A;  4ADD A;  4LNJ A;  3HMU A;  4M2J A;  3FSL A;  7AAT A;  3EZS A;  3N5M A;  4KYO A;  4PFN A;  3W1I A;  4ITG A;  1C7N A;  4XQ2 A;  1XI9 A;  4JEV A;  2ZY2 A;  2AY2 A;  2W7G A;  3PD6 B;  4W1V A;  4W8I A;  4AH3 A;  4JE5 D;  4Q75 A;  3ATH A;  2HP1 A;  1MAP A;  2ZC0 A;  3BC8 A;  1YIY A;  5E5I A;  1DTY A;  4R5F A;  5DJ9 A;  2VMX A;  1I41 A;  5LHA A;  1M0O A;  2Z9U A;  2BI9 A;  2FQ6 A;  1GEX A;  2VMZ A;  2CJH A;  4QGR A;  1TOI A;  3DU4 A;  3AEO A;  1BKG A;  4JF0 A;  1LK9 A;  1ZC9 A;  1V2D A;  2QBT A;  1AJS B;  3MAU A;  3DXW A;  1WYU B;  1QJ3 A;  2CH1 A;  2EH6 A;  2PB0 A;  3BCX A;  4W1W A;  1GBN A;  4KAM A;  1CS1 A;  1FG7 A;  2OAT A;  3TCM A;  3FVU A;  2BI3 A;  3KE3 A;  3AEM A;  2G6W A;  3FQ7 A;  1AJS A;  1ASB A;  2DR1 A;  1AHF A;  1AIC A;  3FZ8 A;  1IVR A;  1WKG A;  4WD2 A;  1AHY A;  1ASG A;  4IY7 A;  1VJO A;  4WYC A;  4OMA A;  1Z7D A;  2VMY A;  4MY5 A;  1RV3 A;  4F5G A;  2WKA A;  4TV7 A;  3VK2 A;  5C6U A;  3FRK A;  2YKY A;  4WYD A;  1GC3 A;  3IHJ A;  3MC6 A;  4ZDP A;  5EUN A;  1M4N A;  3FZ6 A;  2W8J A;  3AAT A;  3E2Y A;  3K40 A;  3VOM A;  1PMO A;  3ZZJ A;  4JEZ A;  2DGK A;  1YOO A;  1Z3Z A;  2BWP A;  3DXV A;  3LVL B;  3GZD C;  3EI5 A;  4NOG A;  5HDM A;  4WXG A;  3WLX A;  1M0Q A;  1DJE A;  8AAT A;  1RV4 A;  1IUG A;  1UKJ A;  2ZJG A;  3CQ6 A;  3JW9 A;  1GD9 A;  3WY7 A;  1CQ8 A;  5EUE A;  3L8A A;  1D7U A;  4A6R A;  4ADC A;  2W8W A;  2WK9 A;  3G8M A;  2DGL A;  4GDY A;  4IX8 A;  3LWS A;  4XJM A;  3EZ1 A;  3EIA A;  3LY1 A;  1BJ4 A;  1ARS A;  3DYD A;  3TFU A;  5DB5 A;  1DFO A;  1CL2 A;  4R8D A;  4BA5 A;  1AHE A;  1S08 A;  3JWA A;  1AJR A;  3GBX A;  4XEW A;  2YKX A;  2CJD A;  4W1X A;  4EMY A;  2HUF A;  1MLY A;  2EZ1 A;  2FYF A;  3A9Z A;  2QB2 A;  1MDX A;  3GR9 A;  1ARI A;  4WYF A;  3T32 A;  3I16 A;  2ZY3 A;  1OXO A;  1UU1 A;  1EG5 A;  2VGU A;  1S0A A;  3FVS A;  2V0Y A;  4RIT A;  1BQD A;  4WYE A;  2R5C B;  2YKU A;  1BS0 A;  3HDO A;  3BS8 A;  4WBT A;  1MLZ A;  3DC1 A;  5BJ3 A;  3OP7 A;  4ZWV A;  1D7S A;  2EZ2 A;  5F9S A;  3LVJ A;  2Z20 A;  1MDO A;  2D5Y A;  1LW5 A;  4ZDO A;  4K2M A;  2R5C A;  2DKB A;  2Z61 A;  1JS3 A;  4A00 A;  5M46 A;  1W3U A;  2YKV A;  1E5F A;  2D65 A;  1SFF A;  1Y4I A;  3KGW A;  4UHN A;  5E3K A;  4EFF A;  4FL0 A;  3JWB A;  1G7W A;  1ASA A;  2VMP A;  4AO4 A;  3PAA A;  4U2H A;  4I8A A;  3MAD A;  2YCP A;  2D7Z A;  2O7C A;  2VMN A;  3PGY A;  4CBS A;  1M7Y A;  2HOY A;  3EI6 A;  2X8U A;  3WGB A;  4WLH A;  1S07 A;  3LVM A;  1GC2 A;  1ARG A;  1SZK A;  2YCT A;  3QM2 A;  1KMJ A;  3B1C A;  4HVK A;  2JJH A;  3AOV A;  3W1J A;  4WP0 A;  5IWQ A;  3H7F A;  2CY8 A;  4JEX A;  5M4B A;  2BWN A;  3H14 A;  1AIA A;  3D6K A;  1YJS A;  3FCR A;  4WXB A;  3QGU A;  3QHX A;  1O62 A;  3QI6 A;  3RCH B;  4OT8 A;  3A2B A;  4TN4 A;  2HP2 A;  2D64 A;  4MKJ A;  2W8T A;  3ASA A;  2W7M A;  3FFH A;  4Q6R A;  4Y0H A;  2OGE A;  1D7R A;  3DRD A;  1OHV A;  3RCH A;  3ZRR A;  2JJE A;  1TPL A;  2W7I A;  5HHY A;  4UQV A;  2X3L A;  2HUI A;  1LW4 A;  5G2Q A;  3FD0 A;  1ASE A;  4Y0D A;  3AEJ A;  2ORD A;  4A72 A;  1W7N A;  2DGM A;  2VLH A;  4R5Z A;  1AMS A;  3B8X A;  3R4T A;  2VI8 A;  9AAT A;  2QMA A;  1N8P A;  3LVK A;  5EQC A;  2CJG A;  1YIZ A;  4GE4 A;  2YRI A;  2JIS A;  2ZY5 A;  4OTL A;  1GDE A;  2AAT A;  3PD6 A;  3WKS A;  3NU7 A;  3PJ0 A;  2VMS A;  4RKC A;  3RQ1 A;  1ELQ A;  2VMT A;  2FNI A;  1QIR A;  3BWN C;  3HL2 A;  2BIE A;  3COG A;  4ZDL A;  3A9X A;  1AHG A;  2HOX A;  3NU8 A;  1CZC A;  4ZWM A;  4ZLV A;  2EPJ A;  3PIU A;  1D2F A;  1WYT B;  1B8G A;  1VP4 A;  4RJ0 A;  3UAK A;  3ZRQ A;  2HOR A;  4GSA A;  2BYL A;  1W7L A;  3GZD A;  1AX4 A;  3TAT A;  5BJ4 A;  3W1H A;  1WYU A;  3ELE A;  3NRA A;  4OC9 A;  4JF1 A;  1WYT A;  2YCN A;  2D63 A;  4MQQ A;  3P6K A;  1QJ5 A;  1SF2 A;  4UHM A;  3FVX A;  1KL1 A;  1W7M A;  2CH2 A;  5F8V A;  5I92 A;  4A6U A;  2X5F A;  1DJU A;  2Z67 A;  2XBN A;  2V1P A;  3NYT A;  2BIG A;  3R9A A;  1M0P A;  2VYC A;  3JTX A;  4LW2 A;  4DBC A;  4JEY A;  5FT8 A;  3L44 A;  3BV0 A;  3EUC A;  2CTZ A;  3VK3 A;  4E3R A;  4WLJ A;  1U08 A;  5LH9 A;  2VIB A;  1DKA A;  4F5F A;  3TQX A;  4RIZ A;  1IX8 A;  5G0A A;  1UU2 A;  4AZK A;  4BQ0 A;  3AEP A;  2OKJ A;  1ASL A;  2CB1 A;  1BJN A;  2CIN A;  2AY4 A;  1AHX A;  3Q8N A;  2DOU A;  3PDB B;  3AEL A;  3GZC A;  4K2I A;  1W23 A;  5M49 A;  3EI9 A;  4CVQ A;  1AKA A;  4XK1 A;  2WK8 A;  1IJI A;  5AX8 A;  5EUD A;  1MAQ A;  2E54 A;  3QBO A;  5G2P A;  3PDX A;  3PDB A;  4J5U A;  4WYG A;  3HVY A;  3ASB A;  4F5H A;  4RKD A;  2W8U A;  2EO5 A;  2Z9V A;  1C0N A;  1AIB A;  2OGA A;  1LC8 A;  4AOA A;  4DGT A;  2C0R A;  2BWO A;  1V2F A;  1IX6 A;  3CBF A;  4ZAH A;  2QLR A;  5FT6 A;  4ATP A;  1M6S A;  4WXF A;  4F5L A;  3A9Y A;  3MBB A;  1ZOD A;  3NYU A;  1AAW A;  3E2Z B;  1G4X A;  4LNM A;  1GC4 A;  2R5E A;  3FTB A;  3FZ7 A;  1ELU A;  2ZP7 A;  4OBU A;  1B4X A;  1JG8 A;  1H1C A;  1JS6 A;  3DR4 A;  3UE8 A;  2VMU A;  4J8L A;  4EU1 A;  2FM1 A;  3AOW A;  1CZE A;  3E77 A;  3MKJ A;  1SZS A;  2W7E A;  1AKB A;  1ECX A;  1I43 A;  2PB2 A;  2VI9 A;  2W7D A;  1E5E A;  4UOY A;  1RVU A;  2ZYJ A;  4ATQ A;  1AMA A;  3HBX A;  1IAY A;  1YJZ A;  2BHX A;  3CQ4 A;  2XH1 A;  2VGV A;  2ZSL A;  1X0M A;  2CST A;  4LNL A;  1PFF A;  2E7J A;  1SZU A;  3E2F A;  4WB0 B;  1C7O A;  1QZ9 A;  3BCB A;  4B9B A;  3ZZK A;  4LW4 A;  4N0W A;  3VP6 A;  3ZRP A;  2HOZ A;  3ECD A;  2BKW A;  1DJ9 A;  1ARH A;  2BI1 A;  2OQX A;  2Z9X A;  1XEY A;  4WB0 A;  2NMP A;  5J8Q A;  1QIS A;  3BWN A;  2CAN A;  4N0B A;  3WCN A;  2YRR A;  3FDD A;  2Q7W A;  1BJO B;  2X5D A;  3AEN B;  1FC4 A;  1JF9 A;  1ASF A;  2GSA A;  4PVF A;  1I29 A;  2C7T A;  2JG2 A;  1TOJ A;  2D61 A;  3I5T A;  2GB3 A;  4LC3 A;  1AMQ A;  2D66 A;  1O69 A;  3II0 A;  1AY5 A;  1TAR A;  1BJO A;  2VMR A;  2O0R A;  3AEN A;  1B5P A;  4XJL A;  3RUY A;  4ZM3 A;  1T3I A;  1D7V A;  2AY7 A;  2GMU A;  1P3W A;  3CAI A;  1DGD A;  2JJG A;  1J04 A;  1M32 A;  4A6T A;  1ZOB A;  2QA3 A;  4P7Y A;  1KMK A; 
#chains in the Genus database with same CATH topology
 2AY3 A;  1B9I A;  2VMV A;  4RJY A;  3WX9 A;  2JGT A;  1YAA A;  1X29 A;  3WZF A;  4A0F A;  3WCO A;  1KKP A;  2ZUK A;  1LKC A;  4ISY A;  2BYJ A;  1C9C A;  2Z9W A;  4MKK A;  1SPA A;  2AY6 A;  3DZZ A;  3F6T A;  4R2N A;  3I4J A;  4AO9 A;  4CXQ A;  3F9T A;  1PG8 A;  2EGY A;  3MEB A;  1ASC A;  4F5I A;  1H0C A;  4KXK A;  3VAX A;  4B98 A;  1V72 A;  2BI2 A;  4M2K A;  4EB7 A;  3RBF A;  2HUU A;  2W7J A;  3NUI A;  3AV7 A;  3GJU A;  3QPG A;  5G4J A;  5EAV A;  2QB3 A;  4XJO A;  1TOK A;  1N2T A;  3LG0 A;  2YHK A;  1LS3 A;  4XAU A;  3G7Q A;  4E77 A;  2AY5 A;  4MQR A;  2BIA A;  2VLF A;  4PIW A;  5G09 A;  1ART A;  3A8U X;  2GQN A;  4GEB A;  3JZL A;  1V2E A;  1BT4 A;  2E7I A;  2W7K A;  3DOD A;  4TMR A;  4W91 A;  5JAY A;  1S06 A;  2Z1Y A;  1I48 A;  2AY9 A;  1G7X A;  3WKR A;  2RFV A;  3CQ5 A;  1EQB A;  3NUB A;  2VIA A;  4O6Z A;  3KGX A;  1MGV A;  1RVY A;  5FT5 A;  1IX7 A;  1BQA A;  3BCA A;  4BHD A;  1C7G A;  2FNU A;  3GWP A;  3AEJ C;  4ADE A;  4MSO A;  1IAX A;  3BWO A;  4E3Q A;  5DX5 A;  1ORD A;  1OXP A;  1TAS A;  1GCK A;  4PFF A;  5M4D A;  4JE5 A;  4XJP A;  4A0G A;  4L0O A;  3N4R A;  3K28 A;  3H9X A;  3PPL A;  2HZP A;  2ZSM A;  3NDN A;  2AEV A;  4E1O A;  4K05 A;  4AZJ A;  1G4V A;  1BW0 A;  1WST A;  3JU7 A;  5D95 A;  1KKJ A;  2JJF A;  3IF2 A;  2VMO A;  1J32 A;  1AY4 A;  2O1B A;  3EI7 A;  2W8V A;  3FFR A;  4M2M A;  3NNK A;  3EIB A;  3NX3 A;  2D7Y A;  2OKK A;  4Q76 A;  1IBJ A;  1M0N A;  2WK7 A;  4MGR A;  4A0R A;  1AMR A;  3KKI A;  3E9K A;  2R2N A;  2Z1Z A;  4GRX A;  4RM1 A;  3AEM C;  4IXS A;  5EFS A;  3M5U A;  4P3M A;  4IXO A;  5E4Z A;  2W7H A;  1X28 A;  3NTJ A;  2C44 A;  3FQ8 A;  1CL1 A;  2VGS A;  4MQP A;  3QN6 A;  1C4K A;  1QGN A;  3FKD A;  4OBV A;  4W5K A;  1ASD A;  5G4I A;  3N75 A;  1EJI A;  1AKC A;  3EI8 A;  3ISL A;  4F5J A;  3BN1 A;  3BB8 A;  1O4S A;  1WYV B;  1SVV A;  4JEW A;  1N31 A;  1OAT A;  4OYT A;  1GEW A;  1KL2 A;  3B46 A;  3K7Y A;  4ZSW A;  1OHW A;  2GMS A;  1GEY A;  1WKH A;  3MAF B;  3E2Z A;  3MC6 C;  1PMM A;  3GSB A;  2W7F A;  4ZAS A;  4UHO A;  5D5S A;  1WYV A;  5EAA A;  4ZM4 A;  2YOB A;  3N0L A;  4IW7 A;  3GET A;  4ITX A;  4F5K A;  1KAF A;  1CQ7 A;  2AEU A;  3HT4 A;  3USF A;  1MDZ A;  3PA9 A;  3MAF A;  4EB5 A;  5K8B A;  3B1D A;  2F8J A;  3ELP A;  3RI6 A;  1VEF A;  2CFB A;  4F4E A;  3WGC A;  4CXR A;  2R0T A;  3DR7 A;  3G0T A;  1ASM A;  5DJ1 A;  3RBL A;  2BI5 A;  2DKJ A;  1B9H A;  4CBR A;  1S09 A;  3F0H A;  4GE7 A;  1BJW A;  1TOG A;  5TF5 A;  5HXX A;  3UWC A;  1CJ0 A;  2VGZ A;  3HLM A;  4F5M A;  4IYO B;  2C81 A;  1TOE A;  4ADB A;  2AY8 A;  1OHY A;  4HF8 A;  4DQ6 A;  4OCA A;  4RLG A;  4U1T A;  5FT4 A;  2ZY4 A;  4ZSY A;  4FFC A;  5KTB A;  1YJY A;  1LC5 A;  2VGW A;  2W7L A;  4IYO A;  1DGE A;  4Y0I A;  3VK4 A;  4H51 A;  4BMK A;  2FN6 A;  2PO3 A;  3P1T A;  2VGT A;  4K2B A;  1QIT A;  5EIG B;  1YNU A;  1FG3 A;  1LC7 A;  2E7U A;  2A1V A;  3N4S A;  2VMQ A;  1TAT A;  1UU0 A;  3HQT A;  1GC0 A;  4IXZ A;  1B5O A;  1X2A A;  1AAM A;  1AY8 A;  2VMW A;  3B1E A;  3FQA A;  3FDB A;  1CQ6 A;  2EYQ A;  1ASN A;  5EIG A;  3LV2 A;  1O61 A;  3ACZ A;  3TFT A;  3OKS A;  2AY1 A;  2TPL A;  4Q31 A;  4GE9 A;  4RAE A;  4WYA A;  4A0H A;  3E6G A;  4BA4 A;  3NYS A;  4ADD A;  4LNJ A;  3HMU A;  4M2J A;  3FSL A;  7AAT A;  3EZS A;  3N5M A;  4KYO A;  4PFN A;  3W1I A;  4ITG A;  1C7N A;  4XQ2 A;  2FKI A;  1XI9 A;  4JEV A;  2ZY2 A;  2AY2 A;  2W7G A;  3PD6 B;  4W1V A;  4W8I A;  4AH3 A;  4JE5 D;  4Q75 A;  3ATH A;  2HP1 A;  1MAP A;  2ZC0 A;  3BC8 A;  1YIY A;  5E5I A;  1DTY A;  4R5F A;  5DJ9 A;  2VMX A;  1I41 A;  5LHA A;  1M0O A;  2Z9U A;  2BI9 A;  2FQ6 A;  1GEX A;  2VMZ A;  2CJH A;  4QGR A;  1TOI A;  3DU4 A;  3AEO A;  1BKG A;  4JF0 A;  1LK9 A;  1ZC9 A;  1V2D A;  2QBT A;  1AJS B;  3MAU A;  3DXW A;  1WYU B;  1QJ3 A;  2CH1 A;  2EH6 A;  2PB0 A;  3BCX A;  4W1W A;  1GBN A;  4KAM A;  1CS1 A;  1FG7 A;  2OAT A;  3TCM A;  3FVU A;  2BI3 A;  3KE3 A;  3AEM A;  2G6W A;  2WB6 A;  3FQ7 A;  1AJS A;  1ASB A;  2DR1 A;  1AHF A;  1AIC A;  3FZ8 A;  1IVR A;  1WKG A;  4WD2 A;  3N7N A;  1AHY A;  1ASG A;  4IY7 A;  1VJO A;  4WYC A;  4OMA A;  1Z7D A;  2VMY A;  4MY5 A;  1RV3 A;  4F5G A;  2WKA A;  4TV7 A;  3VK2 A;  5C6U A;  3FRK A;  2YKY A;  4WYD A;  1GC3 A;  3IHJ A;  3MC6 A;  4ZDP A;  5EUN A;  1M4N A;  3FZ6 A;  2W8J A;  3AAT A;  3E2Y A;  3K40 A;  3VOM A;  1PMO A;  3ZZJ A;  4JEZ A;  2DGK A;  1YOO A;  1Z3Z A;  2BWP A;  3DXV A;  3LVL B;  3GZD C;  3EI5 A;  4NOG A;  5HDM A;  4WXG A;  3WLX A;  1M0Q A;  1DJE A;  8AAT A;  1RV4 A;  1IUG A;  1UKJ A;  2ZJG A;  3CQ6 A;  3JW9 A;  1GD9 A;  3WY7 A;  1CQ8 A;  5EUE A;  3L8A A;  1D7U A;  4A6R A;  4ADC A;  2W8W A;  2WK9 A;  3G8M A;  2DGL A;  4GDY A;  4IX8 A;  3LWS A;  4XJM A;  3EZ1 A;  3EIA A;  3LY1 A;  1BJ4 A;  1ARS A;  3DYD A;  3TFU A;  5DB5 A;  1DFO A;  1CL2 A;  4R8D A;  4BA5 A;  1AHE A;  1S08 A;  3JWA A;  4H63 Q;  1AJR A;  3GBX A;  4XEW A;  2YKX A;  2CJD A;  4W1X A;  4EMY A;  2HUF A;  1MLY A;  2EZ1 A;  2FYF A;  3A9Z A;  2QB2 A;  1MDX A;  3GR9 A;  1ARI A;  4WYF A;  3T32 A;  3I16 A;  2ZY3 A;  1OXO A;  1UU1 A;  1EG5 A;  2VGU A;  1S0A A;  3FVS A;  2V0Y A;  4RIT A;  1BQD A;  4WYE A;  2R5C B;  2YKU A;  1BS0 A;  3HDO A;  3BS8 A;  4WBT A;  1MLZ A;  3DC1 A;  5BJ3 A;  3OP7 A;  4ZWV A;  1D7S A;  2EZ2 A;  5F9S A;  3LVJ A;  2Z20 A;  1MDO A;  2D5Y A;  1LW5 A;  4ZDO A;  4K2M A;  2R5C A;  2DKB A;  2Z61 A;  1JS3 A;  4A00 A;  5M46 A;  1W3U A;  2YKV A;  1E5F A;  2D65 A;  1SFF A;  1Y4I A;  3KGW A;  4UHN A;  5E3K A;  4EFF A;  4FL0 A;  3JWB A;  1G7W A;  1ASA A;  2VMP A;  4AO4 A;  3PAA A;  4U2H A;  4I8A A;  3MAD A;  2YCP A;  2D7Z A;  2O7C A;  2VMN A;  3PGY A;  4CBS A;  1M7Y A;  2HOY A;  3EI6 A;  2X8U A;  3WGB A;  4WLH A;  1S07 A;  3LVM A;  1GC2 A;  1ARG A;  1SZK A;  2YCT A;  3QM2 A;  1KMJ A;  3B1C A;  4HVK A;  2JJH A;  3AOV A;  3W1J A;  4WP0 A;  5IWQ A;  3H7F A;  2CY8 A;  4JEX A;  5M4B A;  2BWN A;  3H14 A;  1AIA A;  3D6K A;  1YJS A;  3FCR A;  4WXB A;  3QGU A;  3QHX A;  1O62 A;  3QI6 A;  3RCH B;  4OT8 A;  3A2B A;  4TN4 A;  2HP2 A;  2D64 A;  4MKJ A;  2W8T A;  3ASA A;  2W7M A;  3FFH A;  4Q6R A;  4Y0H A;  2OGE A;  1D7R A;  3DRD A;  1OHV A;  3RCH A;  3ZRR A;  2JJE A;  1TPL A;  2W7I A;  5HHY A;  4UQV A;  2X3L A;  2HUI A;  1LW4 A;  5G2Q A;  3FD0 A;  1ASE A;  4Y0D A;  3AEJ A;  2ORD A;  4A72 A;  1W7N A;  2DGM A;  2VLH A;  4R5Z A;  1AMS A;  3B8X A;  3R4T A;  2VI8 A;  9AAT A;  2QMA A;  1N8P A;  3LVK A;  5EQC A;  2CJG A;  1YIZ A;  4GE4 A;  2YRI A;  2JIS A;  2ZY5 A;  4OTL A;  1GDE A;  2AAT A;  3PD6 A;  3WKS A;  3NU7 A;  3PJ0 A;  2VMS A;  4RKC A;  3RQ1 A;  1ELQ A;  2VMT A;  2FNI A;  1QIR A;  3BWN C;  3HL2 A;  2BIE A;  3COG A;  4ZDL A;  3A9X A;  1AHG A;  2HOX A;  3NU8 A;  1CZC A;  4ZWM A;  4ZLV A;  2EPJ A;  3PIU A;  1D2F A;  1WYT B;  1B8G A;  1VP4 A;  4RJ0 A;  3UAK A;  3ZRQ A;  2HOR A;  4GSA A;  2BYL A;  1W7L A;  3GZD A;  1AX4 A;  3TAT A;  5BJ4 A;  3W1H A;  1WYU A;  3ELE A;  3NRA A;  4OC9 A;  4JF1 A;  1WYT A;  2YCN A;  2D63 A;  4MQQ A;  3P6K A;  1QJ5 A;  1SF2 A;  4UHM A;  3FVX A;  1KL1 A;  1W7M A;  2CH2 A;  5F8V A;  5I92 A;  4A6U A;  2X5F A;  1DJU A;  2Z67 A;  2XBN A;  2V1P A;  3NYT A;  2QSR A;  2BIG A;  3R9A A;  1M0P A;  2VYC A;  3JTX A;  4LW2 A;  4DBC A;  4JEY A;  5FT8 A;  3L44 A;  3BV0 A;  3EUC A;  2CTZ A;  3VK3 A;  4E3R A;  4WLJ A;  1U08 A;  5LH9 A;  2VIB A;  1DKA A;  4F5F A;  3TQX A;  4RIZ A;  1IX8 A;  5G0A A;  1UU2 A;  4AZK A;  4BQ0 A;  3AEP A;  2OKJ A;  1ASL A;  2CB1 A;  1BJN A;  2CIN A;  2AY4 A;  1AHX A;  3Q8N A;  2DOU A;  3PDB B;  3AEL A;  3GZC A;  4K2I A;  1W23 A;  5M49 A;  3EI9 A;  4CVQ A;  1AKA A;  4XK1 A;  2WK8 A;  1IJI A;  5AX8 A;  5EUD A;  1MAQ A;  2E54 A;  3QBO A;  5G2P A;  3PDX A;  3PDB A;  4J5U A;  4WYG A;  3HVY A;  3ASB A;  4F5H A;  4RKD A;  2W8U A;  2EO5 A;  2Z9V A;  1C0N A;  1AIB A;  2OGA A;  1LC8 A;  4AOA A;  4DGT A;  2C0R A;  2BWO A;  1V2F A;  1IX6 A;  3CBF A;  4ZAH A;  2QLR A;  5FT6 A;  4ATP A;  1M6S A;  4WXF A;  4F5L A;  3A9Y A;  3MBB A;  1ZOD A;  3NYU A;  1AAW A;  3E2Z B;  1G4X A;  4LNM A;  1GC4 A;  2R5E A;  3FTB A;  3FZ7 A;  1ELU A;  2ZP7 A;  4OBU A;  1B4X A;  1JG8 A;  1H1C A;  1JS6 A;  3DR4 A;  3UE8 A;  2VMU A;  4J8L A;  4EU1 A;  2FM1 A;  3AOW A;  1CZE A;  3E77 A;  2G7J A;  3MKJ A;  1SZS A;  2W7E A;  1AKB A;  1ECX A;  1I43 A;  2PB2 A;  2VI9 A;  2W7D A;  1E5E A;  4UOY A;  1RVU A;  2ZYJ A;  4ATQ A;  1AMA A;  3HBX A;  1IAY A;  1YJZ A;  2BHX A;  3CQ4 A;  2XH1 A;  2VGV A;  2ZSL A;  1X0M A;  2CST A;  4LNL A;  1PFF A;  2E7J A;  1SZU A;  3E2F A;  4WB0 B;  1C7O A;  1QZ9 A;  3BCB A;  4B9B A;  3ZZK A;  4LW4 A;  4N0W A;  3VP6 A;  3ZRP A;  2HOZ A;  3ECD A;  2BKW A;  1DJ9 A;  1ARH A;  2BI1 A;  2OQX A;  2Z9X A;  1XEY A;  4WB0 A;  2NMP A;  5J8Q A;  1QIS A;  2KFP A;  3BWN A;  2CAN A;  4N0B A;  3WCN A;  2YRR A;  3FDD A;  2Q7W A;  1BJO B;  2X5D A;  3AEN B;  1FC4 A;  1JF9 A;  1ASF A;  2GSA A;  4PVF A;  1I29 A;  2C7T A;  2JG2 A;  1TOJ A;  2D61 A;  3I5T A;  2GB3 A;  4LC3 A;  1AMQ A;  2D66 A;  1O69 A;  3II0 A;  1AY5 A;  1TAR A;  1BJO A;  2VMR A;  2O0R A;  3AEN A;  1B5P A;  4XJL A;  3RUY A;  4ZM3 A;  1T3I A;  1D7V A;  2AY7 A;  2GMU A;  1P3W A;  3CAI A;  1DGD A;  2JJG A;  1J04 A;  1M32 A;  4A6T A;  1ZOB A;  2QA3 A;  4P7Y A;  3N4X A;  1KMK A; 
#chains in the Genus database with same CATH homology
 2AY3 A;  1B9I A;  2VMV A;  4RJY A;  3WX9 A;  2JGT A;  1YAA A;  1X29 A;  3WZF A;  4A0F A;  3WCO A;  1KKP A;  2ZUK A;  1LKC A;  4ISY A;  2BYJ A;  1C9C A;  2Z9W A;  4MKK A;  1SPA A;  2AY6 A;  3DZZ A;  3F6T A;  4R2N A;  3I4J A;  4AO9 A;  4CXQ A;  3F9T A;  1PG8 A;  2EGY A;  3MEB A;  1ASC A;  4F5I A;  1H0C A;  4KXK A;  3VAX A;  4B98 A;  1V72 A;  2BI2 A;  4M2K A;  4EB7 A;  3RBF A;  2HUU A;  2W7J A;  3NUI A;  3AV7 A;  3GJU A;  3QPG A;  5G4J A;  5EAV A;  2QB3 A;  4XJO A;  1TOK A;  1N2T A;  3LG0 A;  2YHK A;  1LS3 A;  4XAU A;  3G7Q A;  4E77 A;  2AY5 A;  4MQR A;  2BIA A;  2VLF A;  4PIW A;  5G09 A;  1ART A;  3A8U X;  2GQN A;  4GEB A;  3JZL A;  1V2E A;  1BT4 A;  2E7I A;  2W7K A;  3DOD A;  4TMR A;  4W91 A;  5JAY A;  1S06 A;  2Z1Y A;  1I48 A;  2AY9 A;  1G7X A;  3WKR A;  2RFV A;  3CQ5 A;  1EQB A;  3NUB A;  2VIA A;  4O6Z A;  3KGX A;  1MGV A;  1RVY A;  5FT5 A;  1IX7 A;  1BQA A;  3BCA A;  4BHD A;  1C7G A;  2FNU A;  3GWP A;  3AEJ C;  4ADE A;  4MSO A;  1IAX A;  3BWO A;  4E3Q A;  5DX5 A;  1ORD A;  1OXP A;  1TAS A;  1GCK A;  4PFF A;  5M4D A;  4JE5 A;  4XJP A;  4A0G A;  4L0O A;  3N4R A;  3K28 A;  3H9X A;  3PPL A;  2HZP A;  2ZSM A;  3NDN A;  2AEV A;  4E1O A;  4K05 A;  4AZJ A;  1G4V A;  1BW0 A;  1WST A;  3JU7 A;  5D95 A;  1KKJ A;  2JJF A;  3IF2 A;  2VMO A;  1J32 A;  1AY4 A;  2O1B A;  3EI7 A;  2W8V A;  3FFR A;  4M2M A;  3NNK A;  3EIB A;  3NX3 A;  2D7Y A;  2OKK A;  4Q76 A;  1IBJ A;  1M0N A;  2WK7 A;  4MGR A;  4A0R A;  1AMR A;  3KKI A;  3E9K A;  2R2N A;  2Z1Z A;  4GRX A;  4RM1 A;  3AEM C;  4IXS A;  5EFS A;  3M5U A;  4P3M A;  4IXO A;  5E4Z A;  2W7H A;  1X28 A;  3NTJ A;  2C44 A;  3FQ8 A;  1CL1 A;  2VGS A;  4MQP A;  3QN6 A;  1C4K A;  1QGN A;  3FKD A;  4OBV A;  4W5K A;  1ASD A;  5G4I A;  3N75 A;  1EJI A;  1AKC A;  3EI8 A;  3ISL A;  4F5J A;  3BN1 A;  3BB8 A;  1O4S A;  1WYV B;  1SVV A;  4JEW A;  1N31 A;  1OAT A;  4OYT A;  1GEW A;  1KL2 A;  3B46 A;  3K7Y A;  4ZSW A;  1OHW A;  2GMS A;  1GEY A;  1WKH A;  3MAF B;  3E2Z A;  3MC6 C;  1PMM A;  3GSB A;  2W7F A;  4ZAS A;  4UHO A;  5D5S A;  1WYV A;  5EAA A;  4ZM4 A;  2YOB A;  3N0L A;  4IW7 A;  3GET A;  4ITX A;  4F5K A;  1CQ7 A;  2AEU A;  3HT4 A;  3USF A;  1MDZ A;  3PA9 A;  3MAF A;  4EB5 A;  5K8B A;  3B1D A;  2F8J A;  3ELP A;  3RI6 A;  1VEF A;  2CFB A;  4F4E A;  3WGC A;  4CXR A;  2R0T A;  3DR7 A;  3G0T A;  1ASM A;  5DJ1 A;  3RBL A;  2BI5 A;  2DKJ A;  1B9H A;  4CBR A;  1S09 A;  3F0H A;  4GE7 A;  1BJW A;  1TOG A;  5TF5 A;  5HXX A;  3UWC A;  1CJ0 A;  2VGZ A;  3HLM A;  4F5M A;  4IYO B;  2C81 A;  1TOE A;  4ADB A;  2AY8 A;  1OHY A;  4HF8 A;  4DQ6 A;  4OCA A;  4RLG A;  4U1T A;  5FT4 A;  2ZY4 A;  4ZSY A;  4FFC A;  5KTB A;  1YJY A;  1LC5 A;  2VGW A;  2W7L A;  4IYO A;  1DGE A;  4Y0I A;  3VK4 A;  4H51 A;  4BMK A;  2FN6 A;  2PO3 A;  3P1T A;  2VGT A;  4K2B A;  1QIT A;  5EIG B;  1YNU A;  1FG3 A;  1LC7 A;  2E7U A;  2A1V A;  3N4S A;  2VMQ A;  1TAT A;  1UU0 A;  3HQT A;  1GC0 A;  4IXZ A;  1B5O A;  1X2A A;  1AAM A;  1AY8 A;  2VMW A;  3B1E A;  3FQA A;  3FDB A;  1CQ6 A;  2EYQ A;  1ASN A;  5EIG A;  3LV2 A;  1O61 A;  3ACZ A;  3TFT A;  3OKS A;  2AY1 A;  2TPL A;  4Q31 A;  4GE9 A;  4RAE A;  4WYA A;  4A0H A;  3E6G A;  4BA4 A;  3NYS A;  4ADD A;  4LNJ A;  3HMU A;  4M2J A;  3FSL A;  7AAT A;  3EZS A;  3N5M A;  4KYO A;  4PFN A;  3W1I A;  4ITG A;  1C7N A;  4XQ2 A;  2FKI A;  1XI9 A;  4JEV A;  2ZY2 A;  2AY2 A;  2W7G A;  3PD6 B;  4W1V A;  4W8I A;  4AH3 A;  4JE5 D;  4Q75 A;  3ATH A;  2HP1 A;  1MAP A;  2ZC0 A;  3BC8 A;  1YIY A;  5E5I A;  1DTY A;  4R5F A;  5DJ9 A;  2VMX A;  1I41 A;  5LHA A;  1M0O A;  2Z9U A;  2BI9 A;  2FQ6 A;  1GEX A;  2VMZ A;  2CJH A;  4QGR A;  1TOI A;  3DU4 A;  3AEO A;  1BKG A;  4JF0 A;  1LK9 A;  1ZC9 A;  1V2D A;  2QBT A;  1AJS B;  3MAU A;  3DXW A;  1WYU B;  1QJ3 A;  2CH1 A;  2EH6 A;  2PB0 A;  3BCX A;  4W1W A;  1GBN A;  4KAM A;  1CS1 A;  1FG7 A;  2OAT A;  3TCM A;  3FVU A;  2BI3 A;  3KE3 A;  3AEM A;  2G6W A;  2WB6 A;  3FQ7 A;  1AJS A;  1ASB A;  2DR1 A;  1AHF A;  1AIC A;  3FZ8 A;  1IVR A;  1WKG A;  4WD2 A;  3N7N A;  1AHY A;  1ASG A;  4IY7 A;  1VJO A;  4WYC A;  4OMA A;  1Z7D A;  2VMY A;  4MY5 A;  1RV3 A;  4F5G A;  2WKA A;  4TV7 A;  3VK2 A;  5C6U A;  3FRK A;  2YKY A;  4WYD A;  1GC3 A;  3IHJ A;  3MC6 A;  4ZDP A;  5EUN A;  1M4N A;  3FZ6 A;  2W8J A;  3AAT A;  3E2Y A;  3K40 A;  3VOM A;  1PMO A;  3ZZJ A;  4JEZ A;  2DGK A;  1YOO A;  1Z3Z A;  2BWP A;  3DXV A;  3LVL B;  3GZD C;  3EI5 A;  4NOG A;  5HDM A;  4WXG A;  3WLX A;  1M0Q A;  1DJE A;  8AAT A;  1RV4 A;  1IUG A;  1UKJ A;  2ZJG A;  3CQ6 A;  3JW9 A;  1GD9 A;  3WY7 A;  1CQ8 A;  5EUE A;  3L8A A;  1D7U A;  4A6R A;  4ADC A;  2W8W A;  2WK9 A;  3G8M A;  2DGL A;  4GDY A;  4IX8 A;  3LWS A;  4XJM A;  3EZ1 A;  3EIA A;  3LY1 A;  1BJ4 A;  1ARS A;  3DYD A;  3TFU A;  5DB5 A;  1DFO A;  1CL2 A;  4R8D A;  4BA5 A;  1AHE A;  1S08 A;  3JWA A;  4H63 Q;  1AJR A;  3GBX A;  4XEW A;  2YKX A;  2CJD A;  4W1X A;  4EMY A;  2HUF A;  1MLY A;  2EZ1 A;  2FYF A;  3A9Z A;  2QB2 A;  1MDX A;  3GR9 A;  1ARI A;  4WYF A;  3T32 A;  3I16 A;  2ZY3 A;  1OXO A;  1UU1 A;  1EG5 A;  2VGU A;  1S0A A;  3FVS A;  2V0Y A;  4RIT A;  1BQD A;  4WYE A;  2R5C B;  2YKU A;  1BS0 A;  3HDO A;  3BS8 A;  4WBT A;  1MLZ A;  3DC1 A;  5BJ3 A;  3OP7 A;  4ZWV A;  1D7S A;  2EZ2 A;  5F9S A;  3LVJ A;  2Z20 A;  1MDO A;  2D5Y A;  1LW5 A;  4ZDO A;  4K2M A;  2R5C A;  2DKB A;  2Z61 A;  1JS3 A;  4A00 A;  5M46 A;  1W3U A;  2YKV A;  1E5F A;  2D65 A;  1SFF A;  1Y4I A;  3KGW A;  4UHN A;  5E3K A;  4EFF A;  4FL0 A;  3JWB A;  1G7W A;  1ASA A;  2VMP A;  4AO4 A;  3PAA A;  4U2H A;  4I8A A;  3MAD A;  2YCP A;  2D7Z A;  2O7C A;  2VMN A;  3PGY A;  4CBS A;  1M7Y A;  2HOY A;  3EI6 A;  2X8U A;  3WGB A;  4WLH A;  1S07 A;  3LVM A;  1GC2 A;  1ARG A;  1SZK A;  2YCT A;  3QM2 A;  1KMJ A;  3B1C A;  4HVK A;  2JJH A;  3AOV A;  3W1J A;  4WP0 A;  5IWQ A;  3H7F A;  2CY8 A;  4JEX A;  5M4B A;  2BWN A;  3H14 A;  1AIA A;  3D6K A;  1YJS A;  3FCR A;  4WXB A;  3QGU A;  3QHX A;  1O62 A;  3QI6 A;  3RCH B;  4OT8 A;  3A2B A;  4TN4 A;  2HP2 A;  2D64 A;  4MKJ A;  2W8T A;  3ASA A;  2W7M A;  3FFH A;  4Q6R A;  4Y0H A;  2OGE A;  1D7R A;  3DRD A;  1OHV A;  3RCH A;  3ZRR A;  2JJE A;  1TPL A;  2W7I A;  5HHY A;  4UQV A;  2X3L A;  2HUI A;  1LW4 A;  5G2Q A;  3FD0 A;  1ASE A;  4Y0D A;  3AEJ A;  2ORD A;  4A72 A;  1W7N A;  2DGM A;  2VLH A;  4R5Z A;  1AMS A;  3B8X A;  3R4T A;  2VI8 A;  9AAT A;  2QMA A;  1N8P A;  3LVK A;  5EQC A;  2CJG A;  1YIZ A;  4GE4 A;  2YRI A;  2JIS A;  2ZY5 A;  4OTL A;  1GDE A;  2AAT A;  3PD6 A;  3WKS A;  3NU7 A;  3PJ0 A;  2VMS A;  4RKC A;  3RQ1 A;  1ELQ A;  2VMT A;  2FNI A;  1QIR A;  3BWN C;  3HL2 A;  2BIE A;  3COG A;  4ZDL A;  3A9X A;  1AHG A;  2HOX A;  3NU8 A;  1CZC A;  4ZWM A;  4ZLV A;  2EPJ A;  3PIU A;  1D2F A;  1WYT B;  1B8G A;  1VP4 A;  4RJ0 A;  3UAK A;  3ZRQ A;  2HOR A;  4GSA A;  2BYL A;  1W7L A;  3GZD A;  1AX4 A;  3TAT A;  5BJ4 A;  3W1H A;  1WYU A;  3ELE A;  3NRA A;  4OC9 A;  4JF1 A;  1WYT A;  2YCN A;  2D63 A;  4MQQ A;  3P6K A;  1QJ5 A;  1SF2 A;  4UHM A;  3FVX A;  1KL1 A;  1W7M A;  2CH2 A;  5F8V A;  5I92 A;  4A6U A;  2X5F A;  1DJU A;  2Z67 A;  2XBN A;  2V1P A;  3NYT A;  2QSR A;  2BIG A;  3R9A A;  1M0P A;  2VYC A;  3JTX A;  4LW2 A;  4DBC A;  4JEY A;  5FT8 A;  3L44 A;  3BV0 A;  3EUC A;  2CTZ A;  3VK3 A;  4E3R A;  4WLJ A;  1U08 A;  5LH9 A;  2VIB A;  1DKA A;  4F5F A;  3TQX A;  4RIZ A;  1IX8 A;  5G0A A;  1UU2 A;  4AZK A;  4BQ0 A;  3AEP A;  2OKJ A;  1ASL A;  2CB1 A;  1BJN A;  2CIN A;  2AY4 A;  1AHX A;  3Q8N A;  2DOU A;  3PDB B;  3AEL A;  3GZC A;  4K2I A;  1W23 A;  5M49 A;  3EI9 A;  4CVQ A;  1AKA A;  4XK1 A;  2WK8 A;  1IJI A;  5AX8 A;  5EUD A;  1MAQ A;  2E54 A;  3QBO A;  5G2P A;  3PDX A;  3PDB A;  4J5U A;  4WYG A;  3HVY A;  3ASB A;  4F5H A;  4RKD A;  2W8U A;  2EO5 A;  2Z9V A;  1C0N A;  1AIB A;  2OGA A;  1LC8 A;  4AOA A;  4DGT A;  2C0R A;  2BWO A;  1V2F A;  1IX6 A;  3CBF A;  4ZAH A;  2QLR A;  5FT6 A;  4ATP A;  1M6S A;  4WXF A;  4F5L A;  3A9Y A;  3MBB A;  1ZOD A;  3NYU A;  1AAW A;  3E2Z B;  1G4X A;  4LNM A;  1GC4 A;  2R5E A;  3FTB A;  3FZ7 A;  1ELU A;  2ZP7 A;  4OBU A;  1B4X A;  1JG8 A;  1H1C A;  1JS6 A;  3DR4 A;  3UE8 A;  2VMU A;  4J8L A;  4EU1 A;  2FM1 A;  3AOW A;  1CZE A;  3E77 A;  2G7J A;  3MKJ A;  1SZS A;  2W7E A;  1AKB A;  1ECX A;  1I43 A;  2PB2 A;  2VI9 A;  2W7D A;  1E5E A;  4UOY A;  1RVU A;  2ZYJ A;  4ATQ A;  1AMA A;  3HBX A;  1IAY A;  1YJZ A;  2BHX A;  3CQ4 A;  2XH1 A;  2VGV A;  2ZSL A;  1X0M A;  2CST A;  4LNL A;  1PFF A;  2E7J A;  1SZU A;  3E2F A;  4WB0 B;  1C7O A;  1QZ9 A;  3BCB A;  4B9B A;  3ZZK A;  4LW4 A;  4N0W A;  3VP6 A;  3ZRP A;  2HOZ A;  3ECD A;  2BKW A;  1DJ9 A;  1ARH A;  2BI1 A;  2OQX A;  2Z9X A;  1XEY A;  4WB0 A;  2NMP A;  5J8Q A;  1QIS A;  2KFP A;  3BWN A;  2CAN A;  4N0B A;  3WCN A;  2YRR A;  3FDD A;  2Q7W A;  1BJO B;  2X5D A;  3AEN B;  1FC4 A;  1JF9 A;  1ASF A;  2GSA A;  4PVF A;  1I29 A;  2C7T A;  2JG2 A;  1TOJ A;  2D61 A;  3I5T A;  2GB3 A;  4LC3 A;  1AMQ A;  2D66 A;  1O69 A;  3II0 A;  1AY5 A;  1TAR A;  1BJO A;  2VMR A;  2O0R A;  3AEN A;  1B5P A;  4XJL A;  3RUY A;  4ZM3 A;  1T3I A;  1D7V A;  2AY7 A;  2GMU A;  1P3W A;  3CAI A;  1DGD A;  2JJG A;  1J04 A;  1M32 A;  4A6T A;  1ZOB A;  2QA3 A;  4P7Y A;  3N4X A;  1KMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...