4LWDA

Human carma1 card domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
ALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Architecture of the CARMA1/Bcl10/MALT1 Signalosome: Nucleation-Induced Filamentous Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Caspase recruitment domain-containing protein 11
total genus 33
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4lwdA00
2LWDA 4M9SA 1A1WA 2D96A 2G7RA 4P4HI 3CRDA 1WXPA 4QOBA 1DGNA 4P4HA 3QF2A 4E9MA 2BBZA 2F1SA 2MN4A 4F42A 1A1ZA 2LS7A 4RHWE 2P1HA 3CL3A 2M5VA 3T6PA 2BBRA 3J6JA 2A5YB 2B1WA 2YGSA 2A9IA 4I16A 4JQWA 4N1KA 2OF5A 2MPCA 4D8OA 1D2ZA 4IZ5E 4N1JA 1WH4A 2IB1A 2VGQA 3YGSP 4O6XA 1Z6TA 2YU0A 1CWWA 3YGSC 4FH0A 1DDFA 1C15A 4ZBWA 2L9MA 2NSNA 2LWEA 3KATA 1UCPA 1D2ZB 2MS7A 2KM6A 2N7ZA 2N83A 4LWDA 4DWNA 2GF5A 4F44A 2N97A 3EZQA 2DBHA 1PN5A 4UZ0A 1WMGA 1ICHA 2MS8A 3LQRA 1FADA 2HM2Q 2DBFA 4IZ7B 4O9FA 4M9XA 3MOPA 4RHWA 4EWIA 4O9LA 2NZ7A 2DBGA 4NQKA 1NGRA 4A2WA 2MB9A 4M9ZA 2DBDA 2DO9A 4A2QA 4IZAB 2N00A 2NAQA 2O71A 2N80A 1N3KA 1CY5A 3EZQB 1YGOA 3MOPK 1E41A 4O7QA 2YQFA 4JUPA 2YVIA 2KN6A 3MOPG 3J63A 2OF5H 2L6AA 3LQQA 2N1FA 1E3YA 4N1LA
chains in the Genus database with same CATH superfamily
2LWDA 4M9SA 1A1WA 2D96A 2G7RA 4P4HI 3CRDA 1WXPA 4QOBA 1DGNA 4P4HA 3QF2A 4E9MA 2BBZA 2F1SA 2MN4A 4F42A 1A1ZA 2LS7A 4RHWE 2P1HA 3CL3A 2M5VA 3T6PA 2BBRA 3J6JA 2A5YB 2B1WA 2YGSA 2A9IA 4I16A 4JQWA 4N1KA 2OF5A 2MPCA 4D8OA 1D2ZA 4IZ5E 4N1JA 1WH4A 2IB1A 2VGQA 3YGSP 4O6XA 1Z6TA 2YU0A 1CWWA 3YGSC 4FH0A 1DDFA 1C15A 4ZBWA 2L9MA 2NSNA 2LWEA 3KATA 1UCPA 1D2ZB 2MS7A 2KM6A 2N7ZA 2N83A 4LWDA 4DWNA 2GF5A 4F44A 2N97A 3EZQA 2DBHA 1PN5A 4UZ0A 1WMGA 1ICHA 2MS8A 3LQRA 1FADA 2HM2Q 2DBFA 4IZ7B 2XV9A 4O9FA 4M9XA 3MOPA 4RHWA 4EWIA 4O9LA 2NZ7A 2DBGA 4NQKA 1NGRA 4A2WA 2MB9A 4M9ZA 2DBDA 2DO9A 4A2QA 4IZAB 2N00A 2NAQA 2O71A 2N80A 1N3KA 1CY5A 3EZQB 1YGOA 3MOPK 1E41A 4O7QA 2YQFA 4JUPA 2YVIA 2KN6A 3MOPG 3J63A 2OF5H 2L6AA 3LQQA 2MJMA 2N1FA 1E3YA 4N1LA
chains in the Genus database with same CATH topology
2LWDA 4M9SA 1A1WA 2D96A 2G7RA 4P4HI 3CRDA 1WXPA 4QOBA 1DGNA 4P4HA 3QF2A 4E9MA 2BBZA 2F1SA 2MN4A 4F42A 1A1ZA 2LS7A 4RHWE 2P1HA 3CL3A 2M5VA 3T6PA 2BBRA 3J6JA 2A5YB 2B1WA 2YGSA 2A9IA 4I16A 4JQWA 4N1KA 2OF5A 2MPCA 4D8OA 1D2ZA 4IZ5E 4N1JA 1WH4A 2IB1A 2VGQA 3YGSP 4O6XA 1Z6TA 2YU0A 1CWWA 3YGSC 4FH0A 1DDFA 1C15A 4ZBWA 2L9MA 2NSNA 2LWEA 3KATA 1UCPA 1D2ZB 2MS7A 2KM6A 2N7ZA 2N83A 4LWDA 4DWNA 2GF5A 4F44A 2N97A 3EZQA 2DBHA 1PN5A 4UZ0A 1WMGA 1ICHA 2MS8A 3LQRA 1FADA 2HM2Q 2DBFA 4IZ7B 2XV9A 4O9FA 4M9XA 3MOPA 4RHWA 4EWIA 4O9LA 2NZ7A 2DBGA 4NQKA 1NGRA 4A2WA 2MB9A 4M9ZA 2DBDA 2DO9A 4A2QA 4IZAB 2N00A 2NAQA 2O71A 2N80A 1N3KA 1CY5A 3EZQB 1YGOA 3MOPK 1E41A 4O7QA 2YQFA 4JUPA 2YVIA 2KN6A 3MOPG 3J63A 2OF5H 2L6AA 3LQQA 2MJMA 2N1FA 1E3YA 4N1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LWD A;  4M9S A;  1A1W A;  2D96 A;  2G7R A;  4P4H I;  3CRD A;  1WXP A;  4QOB A;  1DGN A;  4P4H A;  3QF2 A;  4E9M A;  2BBZ A;  2F1S A;  2MN4 A;  4F42 A;  1A1Z A;  2LS7 A;  4RHW E;  2P1H A;  3CL3 A;  2M5V A;  3T6P A;  2BBR A;  3J6J A;  2A5Y B;  2B1W A;  2YGS A;  2A9I A;  4I16 A;  4JQW A;  4N1K A;  2OF5 A;  2MPC A;  4D8O A;  1D2Z A;  4IZ5 E;  4N1J A;  1WH4 A;  2IB1 A;  2VGQ A;  3YGS P;  4O6X A;  1Z6T A;  2YU0 A;  1CWW A;  3YGS C;  4FH0 A;  1DDF A;  1C15 A;  4ZBW A;  2L9M A;  2NSN A;  2LWE A;  3KAT A;  1UCP A;  1D2Z B;  2MS7 A;  2KM6 A;  2N7Z A;  2N83 A;  4LWD A;  4DWN A;  2GF5 A;  4F44 A;  2N97 A;  3EZQ A;  2DBH A;  1PN5 A;  4UZ0 A;  1WMG A;  1ICH A;  2MS8 A;  3LQR A;  1FAD A;  2HM2 Q;  2DBF A;  4IZ7 B;  4O9F A;  4M9X A;  3MOP A;  4RHW A;  4EWI A;  4O9L A;  2NZ7 A;  2DBG A;  4NQK A;  1NGR A;  4A2W A;  2MB9 A;  4M9Z A;  2DBD A;  2DO9 A;  4A2Q A;  4IZA B;  2N00 A;  2NAQ A;  2O71 A;  2N80 A;  1N3K A;  1CY5 A;  3EZQ B;  1YGO A;  3MOP K;  1E41 A;  4O7Q A;  2YQF A;  4JUP A;  2YVI A;  2KN6 A;  3MOP G;  3J63 A;  2OF5 H;  2L6A A;  3LQQ A;  2N1F A;  1E3Y A;  4N1L A; 
#chains in the Genus database with same CATH topology
 2LWD A;  4M9S A;  1A1W A;  2D96 A;  2G7R A;  4P4H I;  3CRD A;  1WXP A;  4QOB A;  1DGN A;  4P4H A;  3QF2 A;  4E9M A;  2BBZ A;  2F1S A;  2MN4 A;  4F42 A;  1A1Z A;  2LS7 A;  4RHW E;  2P1H A;  3CL3 A;  2M5V A;  3T6P A;  2BBR A;  3J6J A;  2A5Y B;  2B1W A;  2YGS A;  2A9I A;  4I16 A;  4JQW A;  4N1K A;  2OF5 A;  2MPC A;  4D8O A;  1D2Z A;  4IZ5 E;  4N1J A;  1WH4 A;  2IB1 A;  2VGQ A;  3YGS P;  4O6X A;  1Z6T A;  2YU0 A;  1CWW A;  3YGS C;  4FH0 A;  1DDF A;  1C15 A;  4ZBW A;  2L9M A;  2NSN A;  2LWE A;  3KAT A;  1UCP A;  1D2Z B;  2MS7 A;  2KM6 A;  2N7Z A;  2N83 A;  4LWD A;  4DWN A;  2GF5 A;  4F44 A;  2N97 A;  3EZQ A;  2DBH A;  1PN5 A;  4UZ0 A;  1WMG A;  1ICH A;  2MS8 A;  3LQR A;  1FAD A;  2HM2 Q;  2DBF A;  4IZ7 B;  2XV9 A;  4O9F A;  4M9X A;  3MOP A;  4RHW A;  4EWI A;  4O9L A;  2NZ7 A;  2DBG A;  4NQK A;  1NGR A;  4A2W A;  2MB9 A;  4M9Z A;  2DBD A;  2DO9 A;  4A2Q A;  4IZA B;  2N00 A;  2NAQ A;  2O71 A;  2N80 A;  1N3K A;  1CY5 A;  3EZQ B;  1YGO A;  3MOP K;  1E41 A;  4O7Q A;  2YQF A;  4JUP A;  2YVI A;  2KN6 A;  3MOP G;  3J63 A;  2OF5 H;  2L6A A;  3LQQ A;  2MJM A;  2N1F A;  1E3Y A;  4N1L A; 
#chains in the Genus database with same CATH homology
 2LWD A;  4M9S A;  1A1W A;  2D96 A;  2G7R A;  4P4H I;  3CRD A;  1WXP A;  4QOB A;  1DGN A;  4P4H A;  3QF2 A;  4E9M A;  2BBZ A;  2F1S A;  2MN4 A;  4F42 A;  1A1Z A;  2LS7 A;  4RHW E;  2P1H A;  3CL3 A;  2M5V A;  3T6P A;  2BBR A;  3J6J A;  2A5Y B;  2B1W A;  2YGS A;  2A9I A;  4I16 A;  4JQW A;  4N1K A;  2OF5 A;  2MPC A;  4D8O A;  1D2Z A;  4IZ5 E;  4N1J A;  1WH4 A;  2IB1 A;  2VGQ A;  3YGS P;  4O6X A;  1Z6T A;  2YU0 A;  1CWW A;  3YGS C;  4FH0 A;  1DDF A;  1C15 A;  4ZBW A;  2L9M A;  2NSN A;  2LWE A;  3KAT A;  1UCP A;  1D2Z B;  2MS7 A;  2KM6 A;  2N7Z A;  2N83 A;  4LWD A;  4DWN A;  2GF5 A;  4F44 A;  2N97 A;  3EZQ A;  2DBH A;  1PN5 A;  4UZ0 A;  1WMG A;  1ICH A;  2MS8 A;  3LQR A;  1FAD A;  2HM2 Q;  2DBF A;  4IZ7 B;  2XV9 A;  4O9F A;  4M9X A;  3MOP A;  4RHW A;  4EWI A;  4O9L A;  2NZ7 A;  2DBG A;  4NQK A;  1NGR A;  4A2W A;  2MB9 A;  4M9Z A;  2DBD A;  2DO9 A;  4A2Q A;  4IZA B;  2N00 A;  2NAQ A;  2O71 A;  2N80 A;  1N3K A;  1CY5 A;  3EZQ B;  1YGO A;  3MOP K;  1E41 A;  4O7Q A;  2YQF A;  4JUP A;  2YVI A;  2KN6 A;  3MOP G;  3J63 A;  2OF5 H;  2L6A A;  3LQQ A;  2MJM A;  2N1F A;  1E3Y A;  4N1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...