4LWDA

Human carma1 card domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
ALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Architecture of the CARMA1/Bcl10/MALT1 Signalosome: Nucleation-Induced Filamentous Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Caspase recruitment domain-containing protein 11
total genus 33
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4lwdA00
2DBGA 2MB9A 2BBRA 1DGNA 2N97A 2YVIA 4F44A 3T6PA 1WXPA 3LQRA 2DBDA 4FH0A 4P4HA 4F42A 2A9IA 1E3YA 3MOPG 4LWDA 2D96A 2KN6A 1ICHA 1NGRA 2YQFA 1D2ZB 2MS7A 2LS7A 4ZBWA 2DBFA 4O7QA 2OF5A 1WMGA 1UCPA 2DO9A 4DWNA 4O9FA 1A1WA 1D2ZA 1N3KA 2LWEA 4M9ZA 2N00A 3CL3A 3EZQB 3YGSC 2O71A 1Z6TA 3LQQA 2YU0A 2VGQA 3KATA 2MN4A 2N7ZA 3EZQA 4D8OA 4QOBA 1YGOA 3MOPK 4RHWA 4A2QA 4P4HI 2P1HA 4JQWA 3YGSP 3J63A 1A1ZA 4N1LA 1PN5A 4O9LA 1CY5A 2N1FA 4EWIA 4M9SA 2N83A 1E41A 1WH4A 4IZ5E 4IZAB 1DDFA 4M9XA 3MOPA 2HM2Q 4JUPA 2L9MA 4RHWE 4N1JA 4IZ7B 2B1WA 2NZ7A 2F1SA 4A2WA 4UZ0A 4N1KA 2L6AA 2N80A 2DBHA 2GF5A 2MS8A 2LWDA 2MPCA 4NQKA 2KM6A 3J6JA 1FADA 2M5VA 4I16A 3QF2A 2BBZA 4O6XA 2YGSA 2IB1A 3CRDA 1C15A 2NAQA 2A5YB 1CWWA 4E9MA 2NSNA 2G7RA 2OF5H
chains in the Genus database with same CATH superfamily
2DBGA 2MB9A 2BBRA 1DGNA 2N97A 2YVIA 4F44A 3T6PA 1WXPA 3LQRA 2DBDA 4FH0A 4P4HA 4F42A 2A9IA 1E3YA 3MOPG 4LWDA 2D96A 2KN6A 1ICHA 1NGRA 2YQFA 1D2ZB 2MS7A 2LS7A 4ZBWA 2DBFA 4O7QA 2OF5A 1WMGA 1UCPA 2DO9A 4DWNA 4O9FA 1A1WA 1D2ZA 1N3KA 2LWEA 4M9ZA 2N00A 3CL3A 3EZQB 3YGSC 2O71A 1Z6TA 3LQQA 2YU0A 2VGQA 3KATA 2MN4A 2N7ZA 3EZQA 4D8OA 4QOBA 1YGOA 3MOPK 4RHWA 4A2QA 4P4HI 2P1HA 4JQWA 3YGSP 3J63A 1A1ZA 4N1LA 1PN5A 4O9LA 1CY5A 2N1FA 4EWIA 4M9SA 2N83A 1E41A 1WH4A 4IZ5E 4IZAB 1DDFA 4M9XA 3MOPA 2HM2Q 4JUPA 2L9MA 4RHWE 4N1JA 4IZ7B 2B1WA 2NZ7A 2F1SA 4A2WA 4UZ0A 4N1KA 2L6AA 2N80A 2MJMA 2DBHA 2GF5A 2MS8A 2LWDA 2MPCA 4NQKA 2KM6A 3J6JA 1FADA 2XV9A 2M5VA 4I16A 3QF2A 2BBZA 4O6XA 2YGSA 2IB1A 3CRDA 1C15A 2NAQA 2A5YB 1CWWA 4E9MA 2NSNA 2G7RA 2OF5H
chains in the Genus database with same CATH topology
2DBGA 2MB9A 2BBRA 1DGNA 2N97A 2YVIA 4F44A 3T6PA 1WXPA 3LQRA 2DBDA 4FH0A 4P4HA 4F42A 2A9IA 1E3YA 3MOPG 4LWDA 2D96A 2KN6A 1ICHA 1NGRA 2YQFA 1D2ZB 2MS7A 2LS7A 4ZBWA 2DBFA 4O7QA 2OF5A 1WMGA 1UCPA 2DO9A 4DWNA 4O9FA 1A1WA 1D2ZA 1N3KA 2LWEA 4M9ZA 2N00A 3CL3A 3EZQB 3YGSC 2O71A 1Z6TA 3LQQA 2YU0A 2VGQA 3KATA 2MN4A 2N7ZA 3EZQA 4D8OA 4QOBA 1YGOA 3MOPK 4RHWA 4A2QA 4P4HI 2P1HA 4JQWA 3YGSP 3J63A 1A1ZA 4N1LA 1PN5A 4O9LA 1CY5A 2N1FA 4EWIA 4M9SA 2N83A 1E41A 1WH4A 4IZ5E 4IZAB 1DDFA 4M9XA 3MOPA 2HM2Q 4JUPA 2L9MA 4RHWE 4N1JA 4IZ7B 2B1WA 2NZ7A 2F1SA 4A2WA 4UZ0A 4N1KA 2L6AA 2N80A 2MJMA 2DBHA 2GF5A 2MS8A 2LWDA 2MPCA 4NQKA 2KM6A 3J6JA 1FADA 2XV9A 2M5VA 4I16A 3QF2A 2BBZA 4O6XA 2YGSA 2IB1A 3CRDA 1C15A 2NAQA 2A5YB 1CWWA 4E9MA 2NSNA 2G7RA 2OF5H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBG A;  2MB9 A;  2BBR A;  1DGN A;  2N97 A;  2YVI A;  4F44 A;  3T6P A;  1WXP A;  3LQR A;  2DBD A;  4FH0 A;  4P4H A;  4F42 A;  2A9I A;  1E3Y A;  3MOP G;  4LWD A;  2D96 A;  2KN6 A;  1ICH A;  1NGR A;  2YQF A;  1D2Z B;  2MS7 A;  2LS7 A;  4ZBW A;  2DBF A;  4O7Q A;  2OF5 A;  1WMG A;  1UCP A;  2DO9 A;  4DWN A;  4O9F A;  1A1W A;  1D2Z A;  1N3K A;  2LWE A;  4M9Z A;  2N00 A;  3CL3 A;  3EZQ B;  3YGS C;  2O71 A;  1Z6T A;  3LQQ A;  2YU0 A;  2VGQ A;  3KAT A;  2MN4 A;  2N7Z A;  3EZQ A;  4D8O A;  4QOB A;  1YGO A;  3MOP K;  4RHW A;  4A2Q A;  4P4H I;  2P1H A;  4JQW A;  3YGS P;  3J63 A;  1A1Z A;  4N1L A;  1PN5 A;  4O9L A;  1CY5 A;  2N1F A;  4EWI A;  4M9S A;  2N83 A;  1E41 A;  1WH4 A;  4IZ5 E;  4IZA B;  1DDF A;  4M9X A;  3MOP A;  2HM2 Q;  4JUP A;  2L9M A;  4RHW E;  4N1J A;  4IZ7 B;  2B1W A;  2NZ7 A;  2F1S A;  4A2W A;  4UZ0 A;  4N1K A;  2L6A A;  2N80 A;  2DBH A;  2GF5 A;  2MS8 A;  2LWD A;  2MPC A;  4NQK A;  2KM6 A;  3J6J A;  1FAD A;  2M5V A;  4I16 A;  3QF2 A;  2BBZ A;  4O6X A;  2YGS A;  2IB1 A;  3CRD A;  1C15 A;  2NAQ A;  2A5Y B;  1CWW A;  4E9M A;  2NSN A;  2G7R A;  2OF5 H; 
#chains in the Genus database with same CATH topology
 2DBG A;  2MB9 A;  2BBR A;  1DGN A;  2N97 A;  2YVI A;  4F44 A;  3T6P A;  1WXP A;  3LQR A;  2DBD A;  4FH0 A;  4P4H A;  4F42 A;  2A9I A;  1E3Y A;  3MOP G;  4LWD A;  2D96 A;  2KN6 A;  1ICH A;  1NGR A;  2YQF A;  1D2Z B;  2MS7 A;  2LS7 A;  4ZBW A;  2DBF A;  4O7Q A;  2OF5 A;  1WMG A;  1UCP A;  2DO9 A;  4DWN A;  4O9F A;  1A1W A;  1D2Z A;  1N3K A;  2LWE A;  4M9Z A;  2N00 A;  3CL3 A;  3EZQ B;  3YGS C;  2O71 A;  1Z6T A;  3LQQ A;  2YU0 A;  2VGQ A;  3KAT A;  2MN4 A;  2N7Z A;  3EZQ A;  4D8O A;  4QOB A;  1YGO A;  3MOP K;  4RHW A;  4A2Q A;  4P4H I;  2P1H A;  4JQW A;  3YGS P;  3J63 A;  1A1Z A;  4N1L A;  1PN5 A;  4O9L A;  1CY5 A;  2N1F A;  4EWI A;  4M9S A;  2N83 A;  1E41 A;  1WH4 A;  4IZ5 E;  4IZA B;  1DDF A;  4M9X A;  3MOP A;  2HM2 Q;  4JUP A;  2L9M A;  4RHW E;  4N1J A;  4IZ7 B;  2B1W A;  2NZ7 A;  2F1S A;  4A2W A;  4UZ0 A;  4N1K A;  2L6A A;  2N80 A;  2MJM A;  2DBH A;  2GF5 A;  2MS8 A;  2LWD A;  2MPC A;  4NQK A;  2KM6 A;  3J6J A;  1FAD A;  2XV9 A;  2M5V A;  4I16 A;  3QF2 A;  2BBZ A;  4O6X A;  2YGS A;  2IB1 A;  3CRD A;  1C15 A;  2NAQ A;  2A5Y B;  1CWW A;  4E9M A;  2NSN A;  2G7R A;  2OF5 H; 
#chains in the Genus database with same CATH homology
 2DBG A;  2MB9 A;  2BBR A;  1DGN A;  2N97 A;  2YVI A;  4F44 A;  3T6P A;  1WXP A;  3LQR A;  2DBD A;  4FH0 A;  4P4H A;  4F42 A;  2A9I A;  1E3Y A;  3MOP G;  4LWD A;  2D96 A;  2KN6 A;  1ICH A;  1NGR A;  2YQF A;  1D2Z B;  2MS7 A;  2LS7 A;  4ZBW A;  2DBF A;  4O7Q A;  2OF5 A;  1WMG A;  1UCP A;  2DO9 A;  4DWN A;  4O9F A;  1A1W A;  1D2Z A;  1N3K A;  2LWE A;  4M9Z A;  2N00 A;  3CL3 A;  3EZQ B;  3YGS C;  2O71 A;  1Z6T A;  3LQQ A;  2YU0 A;  2VGQ A;  3KAT A;  2MN4 A;  2N7Z A;  3EZQ A;  4D8O A;  4QOB A;  1YGO A;  3MOP K;  4RHW A;  4A2Q A;  4P4H I;  2P1H A;  4JQW A;  3YGS P;  3J63 A;  1A1Z A;  4N1L A;  1PN5 A;  4O9L A;  1CY5 A;  2N1F A;  4EWI A;  4M9S A;  2N83 A;  1E41 A;  1WH4 A;  4IZ5 E;  4IZA B;  1DDF A;  4M9X A;  3MOP A;  2HM2 Q;  4JUP A;  2L9M A;  4RHW E;  4N1J A;  4IZ7 B;  2B1W A;  2NZ7 A;  2F1S A;  4A2W A;  4UZ0 A;  4N1K A;  2L6A A;  2N80 A;  2MJM A;  2DBH A;  2GF5 A;  2MS8 A;  2LWD A;  2MPC A;  4NQK A;  2KM6 A;  3J6J A;  1FAD A;  2XV9 A;  2M5V A;  4I16 A;  3QF2 A;  2BBZ A;  4O6X A;  2YGS A;  2IB1 A;  3CRD A;  1C15 A;  2NAQ A;  2A5Y B;  1CWW A;  4E9M A;  2NSN A;  2G7R A;  2OF5 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...