4LXGA

Crystal structure of dxnb2, a carbon - carbon bond hydrolase from sphingomonas wittichii rw1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
276
structure length
274
Chain Sequence
MFEQFESKFIDCDGIRTHYIEMGEGDPLVLVHGGGAGADGRSNFADNFPIFARHMRVIAYDMVGFGQTDAPDPAGFAYTQAARTDHLISFIKALGLSKICLIGNSMGGTTACGAALKAPELIDRLVLMGAAVNISPDDMVADDLAAVMSYDGSEEGMRKIIAALTHSYQPTDDIVHYRHEASLRPTTTAAYKATMGWAKQNGLYYSPEQLASLTMPVLVLGGKNDVMVPVRKVIDQILAIPQAIGHVFPNCGHWVMIEYPEEFCTQTLHFFGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Lid Domain of the MCP Hydrolase DxnB2 Contributes to the Reactivity toward Recalcitrant PCB Metabolites.
pubmed doi rcsb
source organism Sphingomonas wittichii rw1
molecule tags Hydrolase
molecule keywords MCP Hydrolase
total genus 92
structure length 274
sequence length 276
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lxgA00
2JEYA 4HRXA 4BTVA 4LYEA 4UBKA 2WUGA 4LXHA 2PU5A 2YXPX 2Z3ZA 4Y2QA 4P9NA 2XUGA 1XZEA 2PUJA 1XQYA 3MGAA 1RWQA 4FWBA 4X95A 3SX4A 2OLEA 4Y2PA 2UZ0A 5JAHA 3TRDA 3G8YA 4G8BA 2OGTA 3C70A 4KR0A 1PFQA 1LZLA 4J3JA 4Q3LA 1E89A 4EY4A 2HA3A 2V98A 4DTCA 5LIPA 1IMJA 4MYDA 4B0OA 5ALJA 1MU0A 4FNMA 5JIBA 3I2KA 1U8EA 3DS8A 1DINA 3I6YA 2WG1A 5DLPA 3H2GA 5KWJA 2O7VA 1R9NA 3ZPXA 4A5SA 3U1TA 3O4JA 4PSDA 2WFZA 4UBNA 4INZA 3M81A 4ZGBA 2ORYA 3D2CA 3QMVA 4Y2TA 4EY5A 1R4ZA 5CH5A 2VTVA 1CPYA 2WJ6A 2V96A 3D5EA 2ACKA 4B0PA 5KWIA 2WHRA 4JNCA 4QEKA 2ZYSA 3PFBA 1ZGCA 1IUNA 2ZJFA 1CQWA 1WOMA 4X97A 2QJRA 4MQLA 1JMKC 5ALOA 4CCYA 4DNOA 5JYCA 4C4YA 3BXPA 1IVYA 4JUIA 4DNPA 5JALA 3WK9A 5ISMA 3QPAA 3WKBA 2WUDA 3DKKA 5CT9A 1NX9A 1EB9A 5CT8A 2PL5A 2J4FA 4BCCA 3D2BA 5FPPA 5BV7A 4AO8A 1KU0A 4P92A 3I28A 3DKRA 3I2GA 3C8HA 1XRLA 4BCDA 2YH2A 3LIIA 5HQ3A 3I1IA 2Y1KA 5EHXA 4HAIA 3GELA 2E3JA 1R1DA 1CRLA 3ANTA 2PSDA 1Z68A 3LLCA 4PV7A 5ALFA 4X94A 1YS1X 3C6XA 2WHQA 2I3ZA 5SYNA 5T4BA 3HJUA 1AUOA 3LP5A 4S0XA 4MEAA 1W75A 4D9JA 3D0KA 4G5XA 1CUBA 1RYYA 2C0QA 4J0CA 1CUEA 1J07A 4UHHA 1R3DA 2XQGA 4LIPD 2D0DA 3M83A 1VKHA 1F6WA 3G9TA 2I03A 2Y2UA 1L7RA 1UOOA 1DWOA 2ZYRA 2JGFA 1X2BA 3QH4A 3G9UA 4OSEA 4BAUA 5J3JA 2WIFA 3DQZA 3F9CA 2WKWA 5FP0A 2XQFA 4DIUA 1ZGBA 3C45A 5DWDA 2Z3WA 3PI6A 4KEAA 1B41A 1K5PA 5AKLA 4OB8A 1QIGA 3BIXA 1MJ5A 3FNBA 4JYPA 5LYYA 1N5MA 1EH5A 5BWBA 4XJVA 3H18A 5YASA 4KE6A 2WFLA 3STVA 1WB6A 1FFEA 1XZJA 2PM8A 4DGQA 1ZI9A 1LNSA 1Q84A 2HA6A 5JD6A 2Y6UA 4PNZA 4HTAA 1QFSA 1WHSA 1XROA 3U0VA 5HF5A 1EHYA 3ED1A 2XB6A 1XZLA 3VJKA 4LHEA 3R3YA 4E14A 2CB9A 2DHCA 2CZQA 5DTJA 2WU4A 4B80A 2XQKA 3HI4A 4L72A 2WIKA 1UOQA 4UFOA 4UHBA 1FFAA 1TCCA 2QRUA 3C6YA 2IIVA 5AKGA 2OGZA 2XMDA 1GQRA 1ODTC 1YAHA 3V48A 3BL8A 4L0CA 3FOBA 1QIJA 4AX4A 2QJWA 4QWMA 2PBLA 1EDDA 3RLIA 1BS9A 1CV2A 1GZ7A 5AHXA 3STXA 3H2JA 3WZMA 4CI9A 1VE6A 4BZZA 3S2ZA 1UT6A 5AI0A 3NUZA 4ZREA 5AI6A 1SCQA 1JT2A 5ALMA 2VJBA 4LXIA 1VE7A 1VA5A 3EF3A 5AOBA 5D6OA 2JGLA 1MT3A 1LBSA 3AIMA 4E46A 3R41A 1H23A 4FLEA 1BN7A 3DEAA 1CEXA 3DL7A 4CIBA 5AK3A 3KOOA 2VEOA 3NWOA 4DMHA 4RGYA 2BUBA 2O2HA 4BB0A 4W1SA 3O9VA 3WYNA 5F4ZA 4W1PA 3RKSA 4CCWA 3NOXA 4CG3A 4H77A 2CEKA 2JBWA 2BGRA 5K5EA 2XUHA 2JGIA 1BU8A 3HRHA 1YR2A 1K6EA 2JGMA 3QMMA 3G0IA 2HADA 1YA8A 5A62A 3HACA 1TIBA 2IX9A 3LCRA 4C87A 2BKLA 5LZ5A 2JGJA 1USWA 2DHDA 3CN9A 5LZ2A 3L1IA 5ALTA 5CRIA 4OB7A 1QIEA 4PQEA 1WPXA 3P2MA 4KACA 5ALHA 4C88A 2DQZA 1LZKA 3K6KA 1AURA 4U2BA 2Z8ZA 5AI4A 5HCUA 2XMQA 1WB4A 4GXNA 1HL7A 1CUJA 4EY8A 1XRNA 4YX9A 1EDBA 1W76A 3T4UA 3ZLTA 3VVLA 3W2TA 2XMSA 1XZFA 3IIIA 1LPOA 3HLKA 2XUQA 5CBKA 3FWHA 4KAAA 4QE3A 4UHDA 4RPCA 1XLUA 4A16A 4JH0A 5JAPA 4J0IA 2WIGA 4IH4A 4TVKA 5JZBA 3STTA 4BP9A 3DCNA 2G63A 2VAVA 1JJFA 4JEIA 2K2QB 4I3FA 1C4XA 4UBMA 5E2IA 3VISA 4W1QA 1DWPA 5T4HA 5I7UA 1YB6A 4BC0A 4H7FA 5A7HA 5AI9A 1PJAA 5ALIA 2PX6A 3HC7A 1A8QA 4BRSA 1CUYA 3QZUA 4LYDA 2QXTA 1JJBA 1UOPA 3WK4A 1GKLA 1FFCA 2BUCA 1Q0ZA 5AIBA 1BEZA 2BJHA 3C6BA 1CUFA 2CBGA 2G5PA 3WQHA 4Z49A 1JU4A 1J1IA 3BE8A 5AM4A 5AICA 1OCEA 1HLGA 4GWLA 4WJLA 4H7KA 4F21A 1ZD5A 2QKYA 3AZQA 1ZI8A 4OYYA 4BYMA 3AUKA 1N5RA 3VXKA 2QVBA 1LBTA 3V1MA 1UZAA 3ZI7A 1XLWA 3A70A 2WTNA 5ALSA 3QITA 1F0NA 4FMPA 1HDEA 3WIBA 1CLEA 4ZI5A 2ZJ6A 4HXFB 3KXPA 4BVJA 1AKNA 2ES4A 5JASA 1QIHA 5E4YA 2XUAA 4Y2SA 1U4NA 5DJ5A 3H2KA 1A7UA 4ZV9A 1BRTA 2XQJA 2PPLA 4BDTA 2JGEA 4Q3KA 4BTLA 3FSGD 3Q0TA 4H0CA 1LPNA 1SCKA 1XZBA 5ALWA 2AJ8A 2PVSA 4BC1A 5ALVA 4N8DA 1JI3A 1CQZA 4G8DA 4UFPA 5C8ZA 3EIOA 2D5LA 3CXUA 5FUMA 5IVHA 3H2IA 4K5QA 3IUQA 3OURA 2JF0A 1BCSA 1BCRA 1WPRA 2JIDA 3SC2A 1K63A 1MO2A 1AQLA 2YASA 3G9ZA 4Y2UA 1AZWA 4ROTA 1SC9A 5ALQA 3FLBA 4BBZA 4KE7A 4RE6A 2PSHA 1CUZA 3WL5A 1ZD4A 5FLKA 2WG0A 1UKBA 4G9EA 2HHAA 5K3DA 5EIAA 4X6YA 4GEGA 2AJDA 2WJ4A 4V2IA 3O95A 5D3KA 2VJDA 3I6MA 4U2DA 2QZPA 1XZMA 4H7EA 4UPDA 4H35A 2GZRA 4C4ZA 1MTZA 2B9VA 1QIDA 1W1IA 1BE0A 1N8SA 5HKAA 1EDEA 3FVTA 4QNNA 3WWOA 4OYLA 3K2IA 3CCBA 2AJCA 2XMBA 3GBSA 4C01A 2O2IA 5AKZA 3I2JA 1ZJ5A 2B61A 1VOTA 5CH3A 3GZJA 1YASA 4AO6A 3GROA 4UBIA 2C58A 5HFAA 4WY5A 3JW8A 1GPLA 3Q8WA 4YPVA 5HK9A 4OU5A 6YASA 1MNQA 1H2YA 1D07A 5AKXA 2HRRA 2QOEA 3DYVA 3UUEA 2GBGA 1TAHA 4OU4A 4FFVA 1X70A 5ALNA 1LPPA 4WDRA 2H7XA 2BFNA 3YASA 1E8MA 3CN7A 1WHTA 4BRZA 4IQ4A 1A8SA 3SK0A 4K6HA 5ALKA 4OPMA 4P08A 5K3FA 1XZCA 3WL7A 4DLNA 4TGLA 1MX5A 1CUSA 3PUHA 4F60A 5IVDA 1VZ2A 3E4DA 3HZOA 4KJXA 2WSLA 2BUAA 4ZWNA 5CXXA 1C7IA 4FOLA 3C43A 4MQMA 1CFJA 1EX9A 2Y2VA 2PU7A 3WWCA 1J06A 2ZYHA 1DWQA 4B84A 3WK8A 4FKBA 2GBCA 3WJ2A 2RAUA 5ALZA 1QIFA 4AN0A 4QDTA 5C8VA 1QJ4A 4CG2A 3PUIA 2ONCA 5AOCA 1E8NA 4ARAA 4GW3A 4XWGA 2C7BA 4UBLA 4Y2JA 5IVIA 1LPMA 3DNMA 4QLAA 2GBFA 3AZOA 5AKJA 3QBJA 4BATA 2WLSA 1JFRA 1WB5A 3H04A 1A88A 3FYUC 5JD4A 4Q82A 4X90A 3AIKA 3STYA 5BOVA 1EVEA 3K9BA 1MNAA 4WCVA 3L1JA 4TPKA 1OILA 3H1AA 2EDCA 4FNGA 1CIJA 5K3FB 2C0PA 1PV1A 3D59A 2VQ6A 3ESBA 1ACLA 5AKIA 1B6GA 4DMCA 4KAFA 5AIAA 4FDMA 4GBGA 2AXEA 1DT3A 2XMCA 2EDAA 1LPSA 2GZSA 2C4HA 3O4HA 4MXDA 4X3CA 5AM1A 4X00A 2W6CX 1CR6A 5FPQA 3FYUA 4Y9SA 5IKXA 1EI9A 1N1MA 1ACJA 2X8BA 2HA5A 3V1KA 3QM1A 4K2AA 4E11A 2RGUA 2RHTA 5ALDA 1GT6A 2BCEA 5I8PA 4N5HX 4HXEB 2R8BA 1TKRA 3F98A 1RP1A 3R3VA 3R3XA 5EHZA 3VVMA 5ALPA 2OCGA 2HL6A 1K4YA 4MWSA 5LZ8A 5T4FA 2XMZA 5ALGA 3QMWA 3WWEA 1QTIA 5HKBA 1HQDA 2GBIA 1EK2A 3RK4A 4Q3OA 1JJIA 2RI6A 1DQYA 4UUQA 3FAKA 1XQVA 4IHAA 3AIOA 1YSCA 1QFMA 4AO7A 2XUDA 3W05A 1P0IA 3C8DA 1YB7A 5LKRA 2WJ3A 2JGKA 3LIPA 5ESRA 5A6VA 4M0EA 3IA2A 5LZ9A 3FVRA 1YA4A 1O6FA 2XUJA 5JAUA 4H7HA 3R3UA 3WMRA 4W63A 2ACEA 1L7AA 4B9AA 5CH8A 3H0CA 4MWTA 4DM7A 4O08A 3WZLA 2WHPB 4WFKA 1FFDA 3BJRA 4BP8A 1ZD3A 1XRQA 2QT9A 3KDAA 1MAHA 4EY6A 2DCMA 3QPCA 4H7IA 3E1GA 5ALUA 3R40A 1BEEA 2XUFA 4OCZA 3C6ZA 3V1LA 1GKKA 4KYVA 1E3QA 5E4TA 2Z5GA 1HBJA 1AMNA 4J0HA 3VJLA 1H22A 1A8UA 3AILA 1XKTA 2FUKA 2X5XA 2CJPA 3H2HA 4NS4A 1K8QA 5FRDA 4EY7A 3B3QA 5K3CA 2G4LA 3DD5A 4GI1A 5JZSA 5KBYA 3QPDA 4EUSA 1EK1A 1Y37A 3M82A 3H1BA 4EB0A 4AZ3A 2WTMA 2ZSHA 3PF8A 3FLAA 2RHWA 4UBOA 3G0CA 3WLAA 3HSSA 1QTRA 3JYHA 5AKHA 3W04A 1Q0RA 5EFZA 2VF2A 3G0DA 2ZJ7A 4U2GA 3OTQA 1THGA 2W22A 5C7YA 1W52X 2O7RA 4AB1A 4UHCA 3IUMA 4B6GA 2QXUA 4KE8A 1XRRA 4QLOA 2XMRA 3IUNA 4Y2RA 4X7BA 4PO3X 3HEAA 4J0KA 5HF8A 3WI7A 4MYSA 3PICA 4U2FA 3S8YA 4MEBA 1Y7IA 3PE6A 4I4CA 1SFRA 1LPAB 1MX9A 2R11A 4FBMA 5CMLA 4RNCA 3MUOA 2HIHA 2VT7A 3I1YA 3WKDA 4H18A 3A2LA 4AQDA 5AK6A 2J4CA 1OXMA 1TRHA 2WIDA 3BF7A 2Q0XA 5EHQA 1CUDA 3WL8A 1QIMA 4B7ZA 3N0TA 3OG9A 5AO9A 5JAOA 4IO0A 3M3DA 4IH9A 5K3AA 4I19A 1W6RA 4BCBA 1GXSA 2QUAA 2PSFA 2C5GA 4BAZA 1UK6A 4CFSA 3R0VA 2VA9A 4ZRDA 2GYUA 3STUA 5AM2A 3O4GA 1ZI6A 1QO7A 4BE9A 1VLQA 1L7QA 2XT0A 3ESCA 1VZ3A 4AZ0A 5I9IA 5IH7A 5A7FA 1UK8A 4OD0A 3HABA 2XE4A 3R3WA 5HZGA 5DTIA 3KD2A 4X6XA 2NW6A 3FYTA 4J03A 1DX4A 1SOMA 2ZSIA 2GYVA 1CUAA 1VJ5A 2J3QA 5A71A 4PSUA 3AFIA 1CUVA 2P8SA 2WFLB 2XUPA 1AGYA 2DSNA 1MPXA 4ZXFA 1Q83A 3RM3A 5HF9A 1CVLA 3WKAA 2GYWA 3PF9A 3B12A 3OPMA 4N8SA 1R50A 1XZKA 3IULA 4Y7DA 5CXUA 1XZDA 4Q34A 2OPHA 2HDWA 1NU6A 2QS9A 2AJBA 3KWJA 1YAJA 4B85A 4FBLA 2H7YA 4LXGA 2OCIA 2PSJA 2CMFA 1CUCA 3ZWQA 2V9ZA 1ZD2P 2O2GA 4YASA 3E0XA 1H2ZA 3NGMA 4B81A 5DNWA 4FLMA 1XRMA 1CUWA 1GPKA 1ETHA 1Y7HA 3B5EA 3DDUA 4L3WA 4C6HA 1EXWA 4F5ZA 5EIHA 2XLCA 3I2IA 3QVMA 1XQXA 4U2CA 3WA7A 5D3ZA 3G7NA 1AC5A 4AN1A 4GDMA 3PDCA 4EZIA 5EIEA 3W9BA 4FFWA 4NZZA 3ANSA 4G1FA 3VJMA 2H7CA 5FOQA 3D2AA 1LLFA 1O6GA 4N5IX 2VSQA 4XVCA 2ZYIA 5ALLA 2YYSA 4CG1A 1C7JA 5EHNA 2HRQA 4HVTA 1HPLA 4CIAA 4C4XA 3GFFA 2H1IA 3KSRA 4QA9A 3ICVA 1X2EA 1E8DA 4UFNA 1QLWA 3O0DA 5BWCA 1P0MA 4K6GA 2HA2A 2ZVDA 4LKOA 3JWEA 5D7BA 4GECA 1FJ2A 2OAGA 2QUBA 5HK8A 1CUUA 3V9AA 5CT5A 3H17A 3ZLUA 2JEZA 3FCXA 2PUHA 5A7GA 3W06A 1TK3A 4J0GA 3D4LA 5H3HA 1YS2X 1XLVA 4MJ3A 2Z8XA 1IZ7A 3E3AA 3ESAA 3F97A 1CUGA 4WFIA 4X71A 2HU7A 3EBLA 1TQHA 5AI8A 3RARA 1VA4A 2RONA 1S8OA 2HM7A 4BDSA 4ZV7A 3A2NA 5JD5A 3DL4A 4X93A 3IDAA 4EBBA 4FTWA 4X92A 4F0JA 2OQVA 1GGVA 1CUHA 1TCAA 3STWA 1R9MA 3WKEA 4GHWA 2V97A 4YK7A 3TGLA 4QDZA 2VJAA 3G02A 1THTA 3G0GA 1QIKA 1UK9A 1ZICA 4G8CA 4IH1A 5ALRA 4CCYB 1UK7A 1EB8A 4U2EA 4RE5A 2PKYX 1YCDA 2EEPA 2WFMA 5KREA 2AJLI 2VJCA 3DOHA 5K3EA 3O4IA 5AKKA 3FLEA 2XUOA 2ROQA 4G4IA 4G9GA 3HYSA 3OM8A 5AM0A 4B9EA 2J3DA 4DMKA 4W1RA 1XKLA 1ZIXA 3WWDA 1VXOA 4BVKA 1XZHA 3WJ1A 4FHZA 1P0PA 5AI5A 1FFBA 3WK5A 2RIPA 5LKAA 4KRYA 5AOAA 3ESDA 4Q05A 3VKFA 1GQSA 2C5FA 2XUIA 1XZAA 3ILSA 4ARBA 5JARA 2XQIA 3OOSA 5EI5A 1LGYA 3FSGA 1M33A 5DNUA 5FXMA 4AXBA 1JU3A 5FV4A 1UKCA 3T52A 1EA5A 3IB3A 3G9XA 5FDFA 4HS9A 4QZVA 2I3DA 5K3BA 3IUJA 3GUUA 4K6KA 4QWWA 3WKCA 5EGNA 2HA0A 5AM5A 5C81A 1ZIYA 5DYWA 5AH0A 2DHEA 1KEZA 1CUIA 4BAGA 2OCLA 5AK5A 2QM0A 3CCCA 3A2MA 4Y2YA 4EA6A 2WUEA 2OQIA 3DYIA 1XQWA 2HFJA 5FKJA 4DSZA 5DNVA 3I6ZA 5A2GA 3R3ZA 4M0FA 4H7DA 1IUOA 1XZGA 3DOIA 4QDXA 1NU8A 1E66A 2PSEA 4KAJA 5AKEA 1MN6A 3EQ8A 2IITA 3GA7A 1UKAA 1G4HA 3DJYA 4L9AA 1WCYA 1EINA 2WQZA 3WL6A 4NVRA 1XFDA 4X91A 1QZ3A 4Y2XA 2FJ0A 3L1HA 1ZJ4A 4Q1VA 1T4MA 1ODCA 4DMFA 1MX1A 4WY8A 1MAAA 5ALEA 4M0MA 5LLSA 1G42A 4WDQA 5IVKA 3BWXA 7YASA 5C8XA 2WUFA 3W9UA 3WIOA 1LPBB 3FCYA 3V1NA 4G4JA 4DNQA 2DR0A 1U2EA 1EVQA 4X85A 1DT5A 1QE3A 4W9RA 4AMYA 3D7RA 3VDXA 4E15A 4KRXA 3ZV7A 4WFJA 3WYDA 2I78A 2FX5A 4XIIA 4C89A 2B20A 2WHPA 5CT6A 3KWFA 1WM1A 4AMZA 2FJPA 2VAXA 3IVMA 1H2WA 4ITVA 3AINA 4BE4A 3A6ZA 1BROA 4UBJA 4NMWA 3O9MA 2VT6A 4DYHA 3BJMA 2ECFA 2OGSA 1JMYA 5DYTA 2H9YA 1UWCA 1P0QA 3I2HA 4X6UA 3QYJA 5HFNA 3H19A 1E5TA 1QO9A 1TCBA 2WILA 1W4LA 5JZ9A 4UHFA 4UHEA 4OUKX 4J7AA 2CUTA 1F8UA 2X76A 4DNFA 3EQ9A 1G66A 4OB6A 1DTEA 4FLFA 2OCKA 3D3NA 3WA6A 1I6WA 1G5FA 3MUNA 3G0BA 3WK7A 3FYUB 4HZGA 3AJAA 5CT4A 4GLBA 4QDUA 4ETWA 4P93A 2QR5A 3WWPA 2XMGA 1DU4A 2OAEA 1ODSA 1ZOIA 4PSCA 4B83A 2B4KA 3SWWA 3ICWA 3C5WP 2XDWA 2CKMA 1VXRA 2XI4A 1QGED 2G5TA 5AM3A 3IURA 5AP9A 2XLBA 5CURA 2HA4A 1AX9A 5DYYA 1R88A 1UFOA 1CUXA 3UUFA 1UXOA 1SCIA 5T4EA 3BDIA 4DSAA 2LIPA 1DQZA 1HKHA 4G4GA 3TJMA 1QOZA 3F96A 4XX1A 3ZLVA 2BAGA 3AZPA 4HXGA 1BN6A 1ORVA 2VATA 3F67A 4A23A 4BZWA 1KU6A 2OXEA 1IUPA 5CW2A 1DX6A 3BIWA 5LP1A 2QMQA 1H2XA 5HF6A 1JKMA 3WK6A 2WM2A 5HQ3B 2WG2A 5AKYA 3DLTA 5JANA 4Y2VA 2Y6VA 3X3HA 1XRPA 1ISPA 5LZ4A 1U65A 2HFKA 5AK4A 1ORWA 4PW0A 5ALXA 4EHBA 3N2ZB 5SYMA 3F8SA 3MVEA 1T2NA 2QTBA 4HRYA 3LS2A 3BDVA 4JYMA 1QONA 4J0JA 5LZ7A 4N8EA 4BVLA 1QIIA 3EQ7A 4KE9A 2DFPA 3BF8A 3OC0A 1F0PA 3UMJA 1IZ8A 5ALYA 2BGNA 4B82A 3FBWA 2HA7A 2XUKA 5JATA 1J2EA 1XZIA 3C87A 4H7JA 5CTAA 3C5VA 3I2FA 2HU8A 4PF1A 2WIJA 3HXKA 3IBTA 1GPNA 5E4JA 3PFCA 2WU3A 1FSSA 5AJHA 2HU5A 2DQYA 4QDOA 5JADA 4J0DA 3TEJA 2OG1A
chains in the Genus database with same CATH superfamily
4NU5A 1M2VA 2HBYA 2JEYA 3D6MA 1Z4QA 3FIUA 3K3PA 4AS3A 1B26A 3LWNA 3RUEA 1LBIA 4LYEA 3C6MA 4JUBA 4IIJB 3FETA 3M5PA 3LUDA 4I6GA 2PU5A 1X6VA 3UV7A 5HUHA 1SC1A 4P9NA 3QLUC 4TLMB 2W6NA 3LF1A 3GLFA 4GKKB 5GM2A 3GA0A 1RYFA 2WNHA 4HMQA 3MGAA 1QH9A 4M8SA 1FYWA 2DBQA 2EFGA 2F7SA 3HU2A 2OCYC 3JZDA 4I5GA 1RWQA 2IPOA 4JN6B 4D4IA 3N74A 3RS0A 2R6ZA 4LXQA 3F3KA 4D42A 3K09C 5AVSA 5DX1A 2Q6OA 1L7EA 3A0UA 2AFVA 2C78A 3GLIE 3ZZ1A 4Y2PA 4DRZA 4A92A 8AT1A 1S2GA 3AFNA 3TRDA 1XB2A 3G8YA 3L43A 1KGDA 5JAHA 3RAFC 2O6LA 2VT2A 3K8ZA 2CLDX 1NONA 4N6OA 2V7PA 3ZCRA 5DTEA 2H2IA 1D5WA 1XCOA 4KQMA 2OGTA 2NQTA 4R3UC 3ZQUA 4OYHA 2TS1A 5JRDS 1BHQ1 1ZGJA 3HPQA 1U63A 1E89A 1A1VA 3MXOA 3OMWA 3HRIA 3WX0A 3NBZC 2Q9CA 3NGLA 5FPTA 2HA3A 3UY4A 4DANA 2HJWA 1DAPA 4M1MA 3LHDA 2F3SA 4QOJA 1UJBA 1TL7C 2Q4EA 1PVOA 2TMKA 2B2NA 4MJXA 3OD5A 5AVKA 2RH4A 4ZCQA 2VXCA 3VTKA 4BGVA 4OHKA 3VAAA 1NVEA 4IDNA 1IK4A 4K9LA 1GZHB 5E6SB 4RTNA 2SKEA 4LX8A 2CFTA 3DCYA 4MKHA 1YTLA 3DEJA 1U8EA 3WDSA 3T7AA 5MN5A 2FH5B 3IT0A 4GXQA 5IJ9A 1POWA 2KBEA 4RS4A 1FPMA 3ZJYA 4AX8A 2WG1A 1V4NA 3LECA 2PKXA 1O6ZA 5EUQB 3SVLA 3LPCA 4G09A 1R9NA 4XKJA 3WNZA 1T2DA 4H3VA 4JL8A 1K7CA 1GV0A 1TO2E 4KO1S 3ROMA 3U1TA 2WFZA 2G0NA 4O5AA 3O92A 3UM9A 2Z2ZA 5F5NA 1U2SA 4BQFA 1KDPA 2GARA 3HFJA 3KB2A 3ED5A 2E89A 1SBHA 1SHJA 2L0XA 1I3LA 2CL0X 1OH6A 2FFHA 2HO5A 3DBHA 3QMVA 5K51A 1L8LA 1BHO1 2QTCA 3TQCA 4BO7A 4KO3S 4BKOA 3NX4A 1XQ6A 1DOHA 3C4VA 4YRKA 3EF0A 2LDBA 2XCLA 3O26A 5FI3A 4AG3A 4IG9A 2PKQO 5K7SA 2JHAA 3D5EA 4R7TA 4ZRMA 3GMSA 3GVPA 5SZJA 5KWIA 2FTKE 2VAPA 2PZMA 3PQ3A 4QEKA 3DH0A 1DADA 2ZYSA 2NO7A 2W6JA 2PQ6A 4S2EA 4Z1MD 1Z45A 1SKQA 1FTQA 1WZNA 2MSDB 4IDHA 3SAJA 5BSFA 2WU8A 1ZGCA 4ZOCA 1P1HA 5EJ5A 2ZZNA 1YJCA 3AM3A 4IJKA 2I2AA 3BS4A 5C4IA 5IXYA 1BWRA 3DBOB 2FSVC 1G8YA 2OY0A 4JOSA 2Y92A 4RK0A 1B7GO 2QL7A 4CT4B 3FCCA 2HHLA 3I30X 4ZT2A 3U4DA 2I67A 4C3UA 1CDDA 3BSSA 1NW3A 1JMKC 1M2OA 4JBHA 4RAOA 4Y6OA 4O6VA 4NBVA 2P40A 4OQZA 3K0BA 1KRWA 2AOVA 2WF7A 4WKPA 5I9BA 4IV0A 5EWMB 5JYCA 1S3FA 1P5HA 3UHPA 5F73A 4GMKA 4DDTA 3HCRA 1UEJA 2DGDA 4TT3D 3BFPA 1ZONA 4OFZA 5H68A 1IEWA 3N0VA 5ISMA 4WUVA 3DQPA 2RJOA 1PYGA 2WSBA 3AQ4A 4N6GA 1UIMA 1CQPA 2AG6A 1F0KA 2VKTA 2O7QA 3KEGA 3JQFA 4ZVPA 4BKRA 4BEWA 2DBYA 2GKOA 4KQ1A 2CDNA 1NE7A 2YZNA 4TXMA 1HOTA 5FPPA 5HIKA 2BKUA 5E6RA 5I4IA 1G291 1MLDA 1U0TA 2Z43A 1ECFA 1NN0A 4W8HA 2F43A 3MTDA 5BV7A 1V95A 1KJNA 1N0VC 3EIEA 1KQPA 1THMA 1OWPA 2FPIA 3VHXB 5FUWA 1P1FA 4ZVKA 4ENRA 3OF2A 4K28A 4YVFA 4DMRA 3I28A 2R1VB 1E6UA 1ES9A 4LSGA 3UH0A 3PDIA 2GCOA 4IR7A 4HUQB 3PHIA 4AN4A 3BWDD 3U7JA 1CQIA 4BCDA 2X2PA 2OV1A 3KWLA 4ME6A 5KC9A 3I9V1 5FYQA 4G0OA 3FFXA 1V7QA 3Q7QA 4CM9D 1PK8A 3TNYA 2D54A 1RWMA 3FUWA 4MRNA 3KR9A 5EOVA 5SZHB 1K08A 2PZJA 1YB2A 3DZCA 2E3JA 2V9PA 3Q98A 3H1TA 4ZEWA 2ZIVB 1Z68A 2C61A 3GBPA 3KEOA 5IC6A 3UBMA 4B32A 1G6KA 2VDWA 2DOKA 4KQFA 2BEUB 4ZT6A 5JFTA 5KSZA 2FEPA 4X94A 5C1BA 8ABPA 3C1UA 3C6XA 2WHQA 5F1PA 5T4BA 1KHHA 3B52X 3HJUA 4MZXA 3TAXA 4G5FA 1DRUA 4QFDA 3HS3A 2ECPA 3K53A 5I7VA 1BC5A 3G8DA 1Y33E 2FN4A 4FS3A 4D02A 1R0YA 4HNAA 4N76A 2GETA 3LKVA 3M0EA 4G5XA 5LB2A 4ZOBA 1ID1A 1Y6RA 2VN8A 1W5BA 2XX3A 3JPYA 4R83A 3S1SA 4JJ7A 3CVUA 2FEKA 2ZJ2A 3CPHA 1PTJA 1QHYA 1Y3CE 3TD6A 3VKWA 4D98A 5F64A 2UUAB 4CMHA 1R3DA 5HEKA 1MB9A 1GSHA 4K9KA 2KQUA 1CJVC 1H66A 1U8ZA 1EVIA 1OGJA 3P2KA 3MGCA 4JMPA 3KB1A 5CLHA 3WNBA 5MGNA 1VFNA 4KKXB 4QXAA 5EPUA 2KS6A 2D2IA 3NKLA 3W5VA 4O1MA 1G98A 1AS2A 4FB4A 1XJ5A 3CJRA 1UOOA 4HDNA 1KAQA 3FMFA 3TSAA 3VNRA 5B3KA 5TNXA 3FNIA 4RULA 3G7UA 1L9KA 2QD3A 4ZHQA 2OESA 4IIEA 5HZHA 5DU2A 4PCLA 1JLLA 3GP3A 3OIGA 2DFDA 1U28A 3KO8A 2OXTA 2WA2A 3O47A 5J3JA 2WIFA 1OI3A 1N32B 2ZBQA 3IPXA 4HRVA 1TJPB 1SUSA 3HR7A 1N36B 3DXYA 3QGMA 4DIUA 1JR2A 1LDEA 3QXXA 2Q9AA 2IDZA 5H81A 5DWDA 3TMAA 2B21A 1GARA 1T5TA 4J1TC 4NE7A 4ZRNA 4AF7A 1ZOPA 1F5NA 1Z08A 3ZWDA 4KR3A 2BHLA 4XH9B 3I6IA 5JPCA 3HBJA 5FQNA 1QIGA 2Q3BA 3ELUA 4ZAGA 3HE3A 5L9AA 1EUDB 3WRYC 2ZUFA 1O9BA 3ZCPA 2ZR9A 2ZRDA 1Y8RB 3EZNA 3M6UA 1M1XB 3ZU5A 1YZQA 3T95A 2UXBB 4WZAE 3TQOA 3IPYA 1CW2B 1Y1KE 1ZQ9A 3AF0A 4HDKA 4UUMA 1PUXA 1TIPA 1FK8A 3K31A 4HFJA 3EXIB 4CFZA 1K27A 2C95A 3FH0A 3KOWA 5YASA 3C1TA 3GU3A 4ZVUA 4ZPJA 3HWSA 1FTWA 1C3EA 4B75A 1VCOA 2GEFA 1FFEA 1CR0A 4XEHA 5EQTA 1XZJA 3RK1A 4RPLA 1O1YA 2YFHA 2CJWA 2PM8A 3THRA 3B2QA 4JZKA 2B4RO 4DGQA 2AG8A 4BGEA 4LXUA 3M9LA 1Q7TA 4KMMA 4MDHA 1J70A 3RODA 1DV2A 1RT9A 2E4WA 3RLFA 4CZ2A 4GOKA 2HSDA 2ZM6B 5F3DA 4B7CA 1ZBDA 1R0WA 2JNWA 2P90A 5CFPA 1YQUA 1JPVA 1X77A 5JD6A 3ADKA 4A8JB 5EJ6A 5CX1B 3Q1KA 4AUEA 1A5TA 4RJKA 3E05A 1J8MF 1WHSA 4P8RA 4CLDA 1PR1A 1UC8A 3UJ8A 5HKKA 2NU6B 2CYCA 1ZGAA 1NMYA 2QRNA 2O2SA 3DB2A 2KLHA 3TZBA 2E85A 3V42A 1FBTA 1GCGA 5CVCA 4TX1A 1TLLA 1ICEA 1XZLA 1LDBA 2C7GA 4YBRA 1KOJA 1E1RD 2I9PA 1DZIA 4OGLA 3RRMA 3OM9A 4FT2A 4B3CA 2CB9A 4MS3A 3P9PA 5DNAA 4DXHA 3CH7A 1PLLA 1M9NA 1QAOA 3GBVA 3IQXA 4X7RA 3UK0A 1P9RA 3WWZA 3UMSA 4K2HA 3GC6A 3LX8A 2XQKA 1MEOA 3TBHA 1C3LA 2GRUA 2JLUA 1NRJB 1L8XA 3DBLB 2M6KA 4E6EA 3Q11A 1II8A 4LN1A 4N5NA 4M0UA 4FS8A 4KLNA 3OEYA 3TPFA 1I01A 4ER5A 1RNLA 1BKDR 3E9RA 1T3LA 2II6A 2ZUTA 1CWUA 3C39A 3OSZA 1L7BA 2O8CA 2W4IA 3PDIB 3BL8A 1NXTA 4M1EA 3MCAA 4OHOA 4U02A 3ZGZA 1GN9A 5A4DA 5DK6A 3AUSA 3UKOA 1AQIA 1U0SY 4GSKA 4ZANA 3MMZA 2HU2A 1HDXA 2EARA 2UVPA 3DA8A 1FY2A 4PWYA 5F52A 4G1MB 3DCIA 2BMDA 2WUWE 2XA9A 4HAXA 4MJLA 4XVRA 5DB4A 3T9DA 3DLIA 2QJWA 4DCPA 1EUCB 3B2EA 5H16A 5IT0A 4OQEA 4WA8A 5DP1A 1S02A 1G20E 1GZ7A 2D0OB 4O4LA 1X8JA 3GMTA 4L8FA 5AHXA 2PUEA 2R62A 3WZMA 5KPDA 1VE6A 1VP9A 4BZZA 4XOUA 2JBAA 3U3KA 5IUJC 1UT6A 4DREA 2QVXX 4H27A 2H8GA 4Q7EA 3UWSA 3OJWA 3V2UA 2VJQA 3BJZA 1MB2A 3GO4A 5FFNA 4L3OA 4DYVA 4EVRA 1EFLA 2FF5A 5AI6A 3B7PA 4PG6A 2G9ZA 2ODEA 2R7NA 5ALMA 4FMDF 3QQPA 1VE7A 1VA5A 3CW8X 5BUCA 1BD4A 3BRQA 1QJCA 4M1YA 5D6OA 2Y27A 4A6EA 1IH8A 2W42A 1MT3A 3I9JA 5A3SA 4CYMA 3UJBA 4E51A 1QCYA 4YYZA 1I7NA 1LBSA 1EJ2A 2CDRA 3AIMA 3ONDA 4H1TA 3CWZA 4MB0A 4NH0A 5F51A 3UAOA 3OQIA 4IILA 4L7VA 4DLSA 4JT4A 3U09A 2GAIA 3R41A 3AEYA 2GILA 4UCFA 4U4AA 2C5BA 1J23A 1R0ZA 1TM1E 4IKEA 4FLEA 1C8KA 2Z6QA 1NF3A 1CEXA 3DL7A 1UJMA 2FK8A 3HCFA 4OFBA 5CPBA 4BNVA 1OLSB 1BA2A 4LWPA 3RG2A 3R09A 1FW6A 4KR6A 4N3NA 4K6MA 4KOEC 2NN3C 3A37A 1EG2A 2GUGA 1ONNA 5EZQA 2NUBA 1QYIA 3JQ7B 4EF6A 4RGYA 4R2JA 5BT8A 3D3WA 2A0KA 2JAOA 1G5QA 2JFBA 5KYWA 1U8UA 1OZ0A 2P2NA 1P74A 3ADDA 5F4ZA 4P4NA 1EA7A 4HADA 3D1VA 4UCQA 5T5QA 2CMHA 4XD7D 3I61A 3B9BA 3TK1A 4K3VA 2SECE 3NOXA 1V7PC 2MOKA 4LJSA 3RHZA 1G21E 1S3SA 1ZK4A 3D6VA 5ARDA 3U7QA 3N6VA 4QGAA 3SVTA 2AFIB 3IOBA 4P36A 3EAQA 2C31A 4MP6A 1NVWQ 2BGRA 1YZYA 2E6KA 2IC5A 2XUHA 1ZNYA 2ZAOA 1N8TA 2IPAB 4RZSA 5C31A 4AECA 3LKZA 1C7ZA 4MRAA 3AEKA 4J3NA 2ZJBA 3T7KA 1BMFA 1RHQA 2JD0A 4LHVA 1KEEB 2ZATA 1NRXA 1E3LA 1GPH1 2QRGA 5IAKA 1FX0A 1XWFA 2HADA 4HTFA 1YA8A 5A62A 1DEHA 1NRIA 1U0NA 1ZOOA 3KKOA 2FFRA 3BH6A 4LDZA 4R8MA 3P94A 2BKLA 3TFWA 4M7PA 3EVCA 1OW3B 4R7ZA 3ZE8A 4G2TA 1UDCA 3NV9A 3GNLA 1E5VA 5ALTA 4MS4B 4URHA 4HEJA 1NXWA 1WRBA 5IBQA 4RF4A 1W8IA 4M0LA 1F2TB 3P9KA 3VDNB 1BO6A 2H65A 2BM1A 3NETA 2XA2A 3OQIB 3KTDA 4X1OA 5LU8A 4NE2A 2H1HA 3W4IA 3TNLA 5GJBA 2WJJA 4C6TA 3UK7A 1UKVY 4UM7A 3Q6NA 1QOPB 1B15A 2I4IA 1M7HA 2D1SA 5JCJD 3SBOA 5AI4A 2IJGX 3L0DA 1KYTA 2XMQA 3EBPA 3OPXA 1PX2A 3ONWA 2PNFA 3E7WA 1M75A 1PYOA 2NXCA 4K86A 3QUCA 2WT9A 1E5XA 4JB2A 5F1OA 3TE6A 1OYWA 4M54A 2FG7C 1FCJA 1ZFNA 4PFQA 3K8OE 4WAUA 3UMVA 3K2BA 4RU1A 1I7DA 4FGSA 4LRYA 3C5HA 5ILGA 2DWCA 4PPYA 4Q0MA 3PGVA 4PAOA 3PKZA 1P7YA 3HBFA 3TZEA 4V0KA 3WLEA 5FR2A 1PGNA 2CJFA 2ZROA 4O4IA 5CBKA 2JC3A 1MF7A 5REQB 1H93A 3WRXA 3HHEA 4QE3A 4TYNA 1XNQB 4UNNA 1WMSA 4ENTA 4RPCA 5LQUA 4CQMB 1D2AA 5JAPA 3PHLA 4URZR 5HE9A 5A02A 4B3RB 1UANA 4PE5B 4S1WA 1KF0A 2C9DA 5CDGA 2H18A 1AKWA 2ACVA 4TVKA 5TV2A 3W7BA 2WAOA 2PUCA 3MRXA 3HO1A 4OQFA 4LK2A 4TMVA 4YLYA 4AWXA 5DWQA 3FGZA 1T8UA 5K8VA 3CZQA 1FLVA 4CLEA 2N9UA 4EKDA 4TTTS 2VAVA 1KJJA 3GAAA 2BGGA 1DAKA 3WQSB 4YLEA 4IGEA 4QYMA 1JT9A 3GT0A 1FZTA 4KPEC 4XPIB 2BF4A 4P4UA 1NJ8A 2DSTA 2O0KA 1WUJS 3ABSB 4RZXA 5DM1A 3PWTA 5T4HA 3AJEA 2Q7OE 3ZGOA 1YB6A 2ORIA 5F5XA 1KRHA 2JD2A 3COSA 2HREA 3ZV4A 1RXYA 2JFYA 2OD2A 2BC9A 1IOLA 4D0RA 2XTNA 3DB1A 3JZIA 5A7HA 4WBNF 3NHWA 2W2PA 4F9GA 1OR8A 1CD5A 1S2OA 3ENWA 4EYEA 1CDEA 2AQ8A 2QM3A 4MCHA 5CCDA 3VMMA 3EXG1 1GAXA 2NX2A 3A3OA 2Z58A 3HU3A 3IEXA 4HWGA 3CPJB 2XKAA 1E9BA 3QVKA 4BEBA 5LCXA 5TVKA 1JJVA 2J5RA 2GZHA 4BV9A 1HEYA 5FNVA 1HLPA 1YQWA 1U3DA 3QA9A 3L04A 1XX6A 1JJBA 4REMA 2XYVA 1JLMA 3M2TA 3QEKA 5C4MA 2JRCA 3KIPA 4NE9A 4TSFA 5B7QA 4K46A 4KOAA 3X1XA 1MORA 4KFTA 1AXRA 5CHEA 4UDOA 2VC2B 3BH7A 2OUKA 2OVBA 3KALA 1MRNA 1R0SA 3KL4A 2CBGA 2G5PA 2W8BA 1Z36A 2PGIA 3NJRA 1V5WA 1M34A 3QPVA 5FUYA 10MHA 3FDXA 4LZLA 2QGZA 3GGSA 4NDZA 1EFRA 1T9ZA 3HWWA 5EMKA 4AULA 4DXAA 5AM4A 5AICA 1QHEA 4IGFA 2V9CA 3R5HA 1OGYA 1WULS 1B8VA 3CU5A 1FDUA 3LVBA 3PDHA 4LJ5A 4LOHA 3TM4A 2QKYA 2QORA 3LUCA 4PLGA 1YK0A 3O8LA 1ZSNA 2WYIA 3GLGB 1S6YA 3NTLA 4XR9A 3JD0A 3R5JA 2DWPA 1RJWA 3FFTA 4WCDA 2AUMA 3N87A 4WZBA 1QWSA 2JGRA 1X9IA 4RL6A 3V1MA 1H69A 4M9CA 2Q7XA 1JIVA 4FYMA 5I5EA 3A70A 5DGCA 1BDHA 1KO5A 2WTNA 4WHMA 5JBQA 4JUAA 3SYNA 4JP1A 2XF2A 4MR9B 4PS0A 4LWZA 1Z7WA 3KV1A 4OHYA 3TX2A 1U5BB 1X9HA 1P1IA 1GITA 1MABB 2ZEJA 5MGBA 2R7LA 4TL6A 1CZUA 1Y8RA 5FL7A 3FCAA 4UZEA 3JQ7A 1E2GA 2ZRGA 3LGSA 3MB5A 1ZAKA 4HWKA 3U2QA 1AKNA 1O95C 1VKNA 2ZUWA 3FVVA 2OR3A 4EZBA 5HJ5A 3UJHA 4YWJA 4O2BA 1DKUA 1MVOA 2MR5A 4BFUA 1S0UA 1U4NA 2X0KA 4DDVA 1Y5IA 3H7AA 5CBPB 2WWHA 2QG4A 3GRCA 1H0SA 2E5FA 2HEIA 1UF9A 3BMQB 4R5MA 1VHJA 2AOTB 3X2SA 1GUYA 1PDOA 1W4CA 2CMGA 4KJZA 4G0NA 4R3NA 3WLHA 1N3YA 1IBSA 5ULLA 4RIFA 5AVQA 1AKRA 1ZJZA 2BFFB 4EAAA 5IARA 4A2PA 4DKXA 4LOIA 4KREA 1FDRA 2J0VA 3EQZA 1FBNA 1LTHR 1S3GA 4D8TA 1ZR2A 1PZXA 4I50B 1IWBB 4QATA 4UULA 3REOA 4FYHA 3RFFA 1CYEA 1AS3A 1CLUA 1VJRA 1WHSB 1JRLA 3ORFA 1VIMA 3TTVA 5BOSB 2F3UA 5ALWA 1SK9A 1MTOA 3ZH2A 1KI7A 3TD9A 4DLWA 2PVSA 5EJ7A 3TZHA 5KNBA 1KIAA 1NLFA 3QVWA 1II0A 1OSNA 1TM5E 4M3NA 4P4SB 1UMKA 1CQZA 4WTOA 1PAUA 3A7DA 4G1BA 2R8OA 4EFNA 1Z33A 3C0KA 4FYPA 4JROA 3IO5A 5K6AC 1AF7A 3U6BA 1OIXA 1PR9A 2OM2A 4JLKA 4NFLA 3ZD9A 1Z4KA 1M6EX 3EIOA 2YJ4A 3IT1A 3K0HA 2AI3A 1YZKA 3L8GA 1IHPA 3FROA 4ZYXA 5E6UB 2FPIB 4AK9A 1GDHA 1N4DA 5FTJA 5IVHA 2X86A 1Y4SA 3H2IA 3IRVA 3EOAI 4ALKA 3QX3A 4K5QA 1TT5B 3LW7A 2Q3CA 3T7EA 2IDJA 2ECQA 1N6LA 2JA1A 2O0MA 3MTJA 4YJKA 3FYDA 5EJFA 2IV7A 4C04A 1KP9A 5AHRA 3FHLA 2JIDA 3HUTA 4AU1A 4D6XA 2ZU0C 2RH5A 1MO2A 3SC3A 1Z47A 1GNPA 1Z83A 5GP1A 1FVFA 3P9CA 3P9RA 2M32A 2H85A 3WLQA 4E7PA 3FOEC 4BP1A 2XV1A 4O5OA 2JJ1D 1YOVA 4HX2A 3KQQA 1YRLA 3B3AA 1U3CA 3QPUA 1MGOA 2FEAA 1SC9A 3CR7A 4XFJA 3FLBA 5LXTA 2MINA 3ET5A 2ONYA 3OZ7A 4X1IA 1USUA 3UCXA 2E4YA 4KE7A 4IBOA 4RE6A 3KKEA 2Q3JA 3E35A 3P19A 2F9FA 4EVIA 1T0UA 1B43A 1FVXA 3X44A 4QHYA 1QZXA 1K8XB 4YRZA 1ORRA 2D0IA 1P7VA 4KGZA 4HBZA 1XMPA 3JQ9A 1IHDA 3ZZNA 5ICMA 4R5HA 4RCZA 4B7XA 3JWGA 3FTFA 1P4SA 2VPIA 2G7MC 4XX0A 1N2HA 3WC4A 1IN4A 4XUEA 3E3NA 4RGVA 3T9AA 1UBJS 3KU1A 3S55A 2WUVA 2V0CA 1JKXA 4MMZB 5CNKA 2YV5A 1JPJA 4XIJA 1FYDA 3C3XA 3BXZA 1T8WA 4JVNA 4KGDA 3RRXA 2A1UA 4GP9A 3PTAA 5JNUA 2AJDA 2WJ4A 3GIDA 2RGBA 3E5MA 5B5SA 3PHHA 1SZDA 2A14A 4MVJH 2ORVA 5AW0A 1XZMA 3OF5A 4DPMA 4B5KA 4BWVA 2C94A 2NOAA 1GA1A 5LC1A 3GI1A 3A9WA 2GH1A 3R0XA 4KAXA 2C97A 3QOXA 3NHYA 1B6SA 4LVNA 4BNFA 4FC7A 5GZ3A 2EBFX 3AR3A 2OORC 2GZRA 3NO4A 2FQYA 4FJ1A 3WYCA 4D81A 1PS8A 2W0MA 1LW7A 4C4ZA 3L6RA 1OJLA 2OZPA 3Q7EA 1ABEA 4JMLA 1YDMA 2R60A 1QBKC 2B9VA 5HUQA 1U02A 2Y1LA 3AUTA 5FA8A 3T3MB 2XCUA 4TKUA 1E58A 1VPEA 1QVWA 3WGIA 1VIVA 4YO7A 3TFQA 4YDRA 1N8SA 6REQA 3BSWA 3CX3A 4JLBA 1N7IA 4QNNA 4N7JA 2ZULA 4ZAYA 5BSWA 5BV0A 3RADC 4MQ5A 1JKFA 2XCSB 3CCBA 3B36A 1MQSA 2O07A 2DBVO 2JGDB 4A2CA 2AJCA 3BRWD 4OOFA 1WXQA 3SMVA 4RYLA 1UQUA 4HEHA 1TU4A 2VVTA 2H92A 2QTRA 3EGDB 3FUCA 2VIIA 4JGIA 4OKNA 3RROA 2JG3A 2DFKB 2NLOA 1DAMA 5ER9A 4DDKA 4O3MA 5G02A 1OAOC 3O82A 3DMTC 2C2BA 4RWZA 1VOTA 4RVFA 1NOIA 1YASA 1BMTA 3QF4B 4AO6A 5EXSA 1TVMA 1PD1A 3GROA 4UBIA 1JHYA 2R47A 5BQOA 3T4XA 5IN5A 2PZFA 4DVJA 1H05A 2NV2B 5ERXA 2NAFA 3BTOA 1IZ9A 2ILTA 5HK9A 1W87A 4INAA 3BA1A 4RKRA 1AHNA 1XBTA 4ISBA 5EINA 4DV1B 1PL7A 1ZIOA 4HSEA 5FB3A 4M1QA 4CM6A 6YASA 5EUMA 5I7WA 4JP5A 1IRXA 1D07A 3AF3A 4RVUA 5AKXA 2NUTA 3DEFA 4C22A 2HRRA 4PZEA 5C5CA 5TQ2A 3UYLA 1TC2A 3ITKA 3O8NA 4N9QA 2V7GA 2W6QA 4XYLA 1EZZA 1W9HA 3OX4A 5JAMA 4OU4A 3FPLA 1W0KD 2ZT6A 1IM8A 2YL2A 3D54D 3MEQA 1X70A 3CEHA 4FFVA 3ACDA 4OO3A 4S0ZA 1LPPA 4WDRA 1MAUA 3EFOB 2BFNA 2OB1A 3T1VA 1P2FA 1XVUA 1ZA1A 2J9ZB 3OVMA 4U8HA 2X9QA 3G7SA 3GPIA 3BN3A 2PZGA 4HJXA 3U9SA 3ULKA 4ZMSA 3OE7D 3U1BA 2E5LB 2H31A 4U7PB 4BZXA 4EW1A 2FSFA 2VHZA 4F2WA 4JS0A 1TFRA 3MGBA 3SZMA 4NHEA 1XTZA 1FMTA 1Z3CA 3U7RA 3WGNA 2OK7A 1CRQA 1EE9A 1T1GA 3VVCA 4DLKA 4OPMA 1KWGA 2ZAYA 4P7FA 3LYHA 1B8NA 1GUDA 3O91A 1WLYA 1M5RA 5DISB 1YBVA 1BVYF 4D92A 2PTGA 4WLVA 3PUHA 3Q0EA 1UC9A 2JGDA 3DE4X 4AQ7A 4LF7B 1ZGGA 1KWKA 1EFVA 4ER6A 3FY4A 3R1IA 4KX3A 3ZY5A 2QD4A 1VZ2A 3E4DA 2ADMA 3PC4A 2UV8A 1JF8A 2OOKA 4TTQA 2NSHA 3RC3A 1FTNA 2IUSA 3R74A 2HAEA 4HDMB 4CKEA 2EBHX 3VC7A 2YMQA 3KLOA 4CIWA 2B4AA 5ES4B 3V4FA 4BGIA 1VECA 1MENA 4Q4JA 2FMXA 4HWPA 4NZOA 1DCKA 3C43A 3DAFA 4KIJA 3BYZA 3DP9A 2CHVA 3PUWA 3QXHA 2MINB 2PU7A 4X1IB 4CQMD 1DKLA 1J06A 2ZYHA 4FNOA 4XPIA 2O54A 2NZXA 1DWQA 3RFXA 1EWVA 1CZNA 1SVOA 4NNOA 2DERA 2QSYA 5DI9A 1J49A 1A96A 2QRMA 1JFFA 1E99A 1ZHHA 3NPMA 3B89A 2IXEA 1LFAA 4XOIA 4KFUA 3WJ2A 1B6RA 3SE0A 2GHRA 4HL6A 1RE1A 1V7ZA 4BO9A 4DMUB 5ALZA 1L5ZA 1QIFA 4HQKA 4QDTA 3E3LA 1GSOA 1Q11A 4AN0A 5IJXA 1XFAA 1Q1AA 2JLAA 4RTKA 3THWB 1HURA 3RSCA 3QPBA 3L77A 4IM7A 4IJUA 1TPYA 2QRQA 2V4UA 3S27A 3UT6A 1HT0A 3H7IA 2B5VA 1BDJA 2HJHA 4G25A 3PCRB 5D3MA 4ZO6A 2H3EA 3RS8A 4FHEA 4QYWA 1I5EA 1GSIA 2GJ8A 5AJZA 1AHHA 1ZJWA 1Z88A 4V0LA 3RS2A 1T9GR 2KSQA 2PWPA 1KE1A 5B64A 3FYCA 4HQ0A 3H2ZA 4X24A 5CXSA 2MSNA 1TK9A 4EEZA 3DNMA 5GOTA 4QLAA 1YF3A 1G7TA 3PHCA 4AJ4A 3AZOA 1NQOA 3QBJA 2ZS8A 4JWTA 3SP1A 3GCXA 3KYCB 1EAYA 3IOEA 3EZ2A 5CP8A 3QVSA 4G63A 5DGHA 1H2BA 1E18A 3RVMA 2BFWA 4RHUA 2GSDA 1BYUA 3OA0A 1KFEB 2CBZA 5JPIA 4AMGA 1A88A 5CPFA 4DRXA 4X90A 1LDMA 2P9BA 3LX6A 4ENVA 5LYJF 3PEYA 3AIKA 3OLWA 4AJKA 1MA0A 1G6HA 1HE2A 2GRAA 4JIMA 3TOXA 3M4YA 5BN3A 3PPYA 3IVGA 2B6NA 1BZYA 1D7OA 1RCFA 2OSBA 1R8QA 1UZLA 3OT5A 3CQ9A 4L85A 4PNPA 4WCVA 1PEKE 3PJRA 1KZYC 2H06A 2G7ZA 3F5MA 5LB4A 4TPKA 1DZ3A 2WF9A 3EULA 3CLHA 4YUVA 3UK6A 1DP4A 1GNTA 1YMVA 2VCYA 3G79A 3H1AA 4URVR 4G5YA 1WU8A 1IIRA 1Y6FA 2YS7A 1PV1A 5K3FB 1QP4A 3D59A 2VQ6A 1GTL1 2GM9A 3M33A 3DLCA 3HYNA 4WL0A 1BTOA 2YVKA 4B3MB 1B6GA 1M10A 2IPXA 1WY7A 2N42A 3I73A 4KAFA 1Z56C 4PTLA 4FDMA 4GBGA 2XCQA 1W5EA 4PRKA 4FX2A 1ID8A 3GJYA 2ZIAA 3LY5A 1VHLA 2FSIA 4C7KA 3RS9A 3ZW7A 4X61A 1W0JD 4UXIA 1P29A 4POOA 1TZCA 4LFAB 3QEBZ 5DM60 2QZSA 2Y71A 2EDAA 3Q8LA 1I4WA 4WI1A 5DE3A 3T9CA 3O4HA 2BTOA 3TSWA 5J47A 4RMGA 2QUJA 1Z2DA 2OV2A 3WY9A 1NYRA 1RIFA 1NZDA 2RBKA 2JIZA 2FW9A 3FSEA 4GE3A 1M54A 4TL8A 2D13A 5B37A 5LQSA 4YRCA 1DLIA 4K3UA 1I14A 5IJZA 1TUEA 1Z2NX 5EMMA 1BWSA 1AGNA 3QYFA 5JS7A 4YV2A 3BAFA 2OL4A 4Z2YA 2JEOA 1T8YA 2BFFA 4X8HA 2VDUE 3EGDA 4I1RA 4L2IA 1NKTA 3O1JC 4RGQA 5IKXA 4TQ9A 3FPEA 3GXBA 3LFTA 2RKBA 3MFYA 3TQHA 3WBBA 1J7JA 1NNSA 1N2EA 1XD2A 3HFSA 5GV7A 4K2AA 3V1KA 4E11A 2PR7A 5TEVA 2WE7A 3GDOA 1LDGA 2IHTA 2RHTA 5IHPA 1TO1E 4G07A 3KTOA 4UD2A 1GGMA 3DW1X 4MDFA 3KZCA 3UWDA 3USZA 3CFYA 2WWGA 3BJIC 2XE6A 5EG5A 3KVRA 1LV8A 3ZTTA 2R8BA 1Q21A 1ESCA 2CJWB 1PK7A 2DPLA 4QYSA 3IQFA 1FTGA 4RM3A 2I1QA 4DWJA 5JNSA 5DM4A 4TUYF 4UATA 1RP1A 5FCDA 2A7XA 4BIIA 3GEHA 3VPFA 3R3XA 5EHZA 4AG6A 4TKVA 2PH5A 4WZ6A 2ZTSA 3REFA 1T4CA 2HIMA 2QZJA 1JLSA 5ALPA 3H6KA 4ZI7F 1ZNQO 2HL6A 3OUUA 4ZQEA 2DWOA 2E82A 5BPHA 2VH1A 1I1HA 1F38A 1NMXA 4YHBA 3E3OA 1W30A 2CF6A 4ZAZA 5KAPA 5BQFA 3SEZA 5EAIA 4MH0R 2XQVA 4I5IA 4K9OA 4Q24A 4KIGA 4WLFA 1NBIA 5T67A 3RAGA 3HZZA 2BH2A 4KK4A 2XXAB 1EP3B 1O6CA 3ORHA 1S2IA 1GO2A 1BJTA 1EIZA 2R4UA 1O94A 1YRHA 1N9GB 2ZE7A 4S2UA 1FFXA 3SF8B 1OLOA 4KQGA 1HQDA 1NVDA 2FGKA 1ONSA 4L5BA 1K7FB 3I1JA 3PNMA 5B7PA 1EK2A 1KYWA 4DMMA 1E2PA 2C8VA 5LQRA 2CNLA 2DMRA 1OC4A 5EP3A 5C1OA 5DNYB 4C5AA 5EMHA 4RKWA 4IJWA 1KVUA 4LWQA 2CXNA 2ZJAA 4G0QA 4ZKDA 3GEGA 1Y3DE 5JAQA 1XQVA 2BFEA 3ZKAA 2EFJA 1QFMA 3TRKA 3AB3A 1KEUA 4CDRA 1QDLB 2YJNA 3O1LA 4NONA 4BGUA 4E12A 5JJBA 3C74A 2XUDA 5JO0A 3HFRA 1VBKA 3SPXA 3V8EA 1Z8HA 3FWKA 3ZDRA 1I3OA 2JGNA 3UUWA 2Q2QA 1V3QE 1KMHB 2WJ3A 3U16A 2V59A 1JW9B 2GHQA 3D4BA 3UN1A 5ESRA 1MZPA 2YR0A 4B73A 3LPDA 5AVZA 4LOKA 2SCUB 3M6VA 4BEVA 3IA2A 4B3GA 3G49A 1GPUA 3B6JA 3DZHA 3PZRA 1YR3A 1Z2CA 3I23A 4HZUA 3KDSE 3FVRA 3QY9A 1MV8A 5JDCC 3T1QA 1X1RA 3W0LB 1AQJA 1SXJE 1O6FA 1RWNA 2XUJA 3LFHA 3WMRA 2YFKA 3MMNA 3M6WA 2EEZA 4HLUA 4TYMA 1W85A 2K87A 3K73O 4FQ5A 5LQDA 3IQHX 3N2GB 5CDFE 1OZGA 2O14A 5HBGA 4B9AA 1FRVA 3R0ZA 5GGXA 2HJVA 5CH3A 5I9SA 3K7EA 2AHOA 2KB0A 3LXRA 1JIKA 1AHPA 2X15A 2JK1A 5KTSA 2AZMA 3EYAA 3DDCA 2ZJ8A 2Q5HA 4N03A 2NTYC 4OFWA 3WZLA 3UPDA 1N2CA 3WB9A 1FMFA 2IUEA 2P9CA 2X8LA 2CLHB 4LSZA 2ZDQA 1J99A 1DKQA 4HAOA 3Q3EA 4PR3A 3DBRB 3G3EA 1ZLYA 3BJRA 3TSOA 4F04A 1RXVA 3AVVA 3OJXA 4J2OA 1L5MA 1L2TA 5G0WA 3VR0A 2ZUDA 3P27A 4B48A 5CAEB 4EQZA 2R5NA 1BOOA 2E87A 4AY5A 1EE1A 2W6OA 3KAPA 3KDPA 4AMBA 1A7JA 4DEXA 2ID4A 1YC2A 3IUSA 3KQSA 3NFYA 4OCZA 4DJFC 3CZMA 3NKVA 4CEJB 5BSVA 2ZRMA 3ANNA 3C6ZA 3H9EO 4NBRA 2ZWOA 4KQIA 4MV3A 1MIOB 1NUPA 1SD1A 1GKKA 4OI1A 3VPDA 3OJFA 1RACA 1U6IA 3HBNA 4NK4A 2DAPA 4NCIA 4CETA 4W8GA 4JOQA 3UZUA 5G2OA 3NT2A 2CXSA 4U8GA 4X1YB 2FZGA 2OXCA 1N6NA 3B1WA 4J0HA 3UMGA 3HCCA 1XP5A 1KKLA 3VJLA 1UBRS 2AG5A 4IOLA 3DKPA 3TLAA 3R4CA 2QTMA 3I4LA 4I4NA 1Q92A 4UUAA 4R2HA 2X5XA 2G1PA 4EPWA 3L84A 2NZJA 1J0AA 2OMKA 5G3ZA 4EA7A 4Z4QA 1CF9A 2XYRA 2HIGA 3B3QA 3PDWA 3PWKA 5K3CA 4N0QA 3RQSA 2W2VA 3P0FA 3QKSB 3WYGA 4CKEB 3Q7SA 1OV6A 3DD5A 4LC9A 2BEKA 5DGTA 3ILVA 3SFZA 3W4KA 2HF9A 1M1NB 4E3ZA 4F9FA 4PC2A 4UCXA 3ZQ4A 5KBYA 3TW6A 4ZI3A 2Q4OA 1F2DA 1M34E 1EK1A 1UEXC 2ODPA 1Q0HA 1XN4A 4UD6A 3H1BA 2F4VB 3PUJA 3JAWA 2FPSA 2FR1A 5TDHA 4AZ3A 4D4HA 1M8PA 1NMSA 3HK2A 1QE5A 3S28A 2ARKA 1D2MA 2YHUA 3PF8A 4KCGA 2EZ8A 3FLAA 3AIIA 3INGA 1NM5C 3MTIA 5CB0A 2KJQA 1LBQA 1MH1A 2E55A 2FXVA 3EVAA 3ZV6A 5ADHA 5IXSA 4LJLA 1T5BA 2Y9MB 3IOMA 4GQIA 5AKHA 3W04A 1Q0RA 4BRWA 2R6HA 2YXLA 3MWLA 2QLMA 1U1DA 4JLJA 3K9LA 4PLVA 3G0DA 4U2GA 4UEJA 1WUTA 1C3JA 4W6QA 3FCOA 5JTTA 4GXTA 1Q16A 1Q0PA 4GX1A 2O23A 4Q9NA 5JVDA 2BTEA 5HM8A 2YHIA 1PWYE 2P35A 4QXRA 3UTDA 1JLKA 5I7SA 4C7XA 5FNVB 2P9TA 2VK8A 3GFVA 4B8ZA 1VTKA 3U4MA 3A28A 3DR3A 5C7YA 1C4KA 4Q4CA 1GGEA 3LSTA 5DYIA 2XXAA 4GT1A 5DN6A 3I8SA 4RA6A 3VHRA 1PV4A 4NV3A 4AB1A 3BWEA 1ADYA 3LP8A 3O8RA 4YUWA 4OSOA 3F4LA 1AE1A 2CBXA 2CFCA 1P31A 3WP1B 3IUMA 2QXUA 3UA3A 3FSRA 1E4EA 1RKVA 1G63A 1M2KA 4AJHA 3AUYA 5HJEA 1KORA 1XRRA 3K0KA 3ROTA 3T7TA 4M60A 4QLOA 3ZJ5A 4EJSC 1AA9A 3LT0A 4Z1OA 5DBEX 2Z6UA 3NM4A 5F7JA 1Z2EA 1EGAA 4YJHA 5J2UB 3FWZA 4PLTA 2FZCA 5KDDA 1C7RA 4X65B 3GRRA 4X7BA 3FNEA 4PO3X 4OVKA 4QYIB 4Y2RA 1DC8A 2C03A 3B9RA 3R6TA 5HF8A 5A06A 1GTSA 1BGVA 4JFRA 4TWJA 3UIEA 5THQA 4U2FA 3NIBA 4BVEA 2YMMA 3S8YA 2D2VA 1TTQB 3D6NB 2G28A 2FKNA 3PHJA 3Q3IA 1YHZA 3BXFA 1JR6A 1JQ5A 3U62A 1LX6A 1SFRA 2N75A 1MX9A 4IXWA 2Q1XA 3GYGA 4YV7A 5A5DA 2POQX 3I8XA 3NBMA 4YRJA 2QYHA 4N65A 3SZGA 4BNDA 4MRPA 4AZ3B 4JI5B 4ARVA 1J2RA 4LNHA 3NNDA 2K6GA 2XPCA 3OPQA 1TRHA 2FHSA 3X43A 2Q0XA 3VFDA 1I24A 2MYUA 1XHLA 2LRHA 3ID6C 4X8OA 2OZLA 1W85B 2GAFA 4M0CA 3TI7A 5EHQA 5L40A 3CR3C 4ZPXA 2OM6A 4OMDA 1O8CA 3EAFA 4ZAFA 5BV1A 1Z0AA 3BGIA 1GXSB 5FFMA 1MHTA 1ULHA 4UVIA 4B7ZA 4RVDA 3EHDA 4DV4B 1Z9BA 4BZQA 3GEPA 5GGYA 3N0TA 2HMSA 5SV2A 2M6RA 1RPZA 1Z0IA 2IU6A 1ENPA 5B12A 2YV2A 1JDTA 3W8FA 5K3AA 1C81A 5BYKA 5J1SB 4KQ6A 4WNAA 3AOEC 1NBME 1RIIA 2AN1A 3J80A 2X19A 4QYXA 4DCUA 2P5SA 2QUAA 3N8NA 4NHOA 3RDPA 3BIJA 1DCTA 1TOAA 3VR5A 4BAZA 4P7JA 2V6IA 4OAPA 2AZXA 1T3SA 4RX1A 3OCWA 4MYRA 3NW9A 3WHLA 1IY1A 3UUGA 3QFHA 1ZW6A 1G5TA 4RGBA 1YZNA 2BKEA 2YNMA 3BBLA 3HH8A 4UE3S 4Y3UA 1VP3A 4QEDA 2OUIA 1NOJA 1NQWA 3C14C 1QYXA 1FLNA 2JH9A 3AYZB 2X3UA 3UAWA 2DXIA 4D25A 1QO7A 1RE0A 1VLQA 2XE8A 2VHEA 5GWXA 4LECA 4L76A 4FGLA 1QG4A 3U3DA 1VZ3A 3FHCB 4AZ0A 2OILA 2H1OA 3T3GA 2DLCX 2ZR0A 1PZNA 4XQ0A 4QSHA 3N2IA 1KJ8A 5FFFA 4DNOA 1NHGA 3R3WA 1RYHA 1XR3A 1PWXA 1RBQA 1VHTA 3O0TA 4QLBA 1K0UA 1SJ9A 4LRWA 3ZDCA 5DTIA 1RHUA 3KD2A 4ER3A 4RV5A 1K0FA 2A59A 1Y7LA 3FYTA 1W93A 1SOMA 5D86A 5DCUA 4P6VF 1WW8A 2VDVE 3KBBA 1CUAA 2O8FA 1EX1A 2DG2A 4RV9A 5A3RA 1K8RA 1PK9A 2VHQA 2WTAA 3A31A 2PUVA 3DWEX 1SXJB 4MULA 5TRTA 3T3IA 3BT7A 5CYPA 2B69A 4XIYA 4B4DA 3BZUA 4FOPA 3IT2A 1M8FA 1DQNA 1FSZA 3V8MA 3RT9A 1CUVA 3BOSA 5KWEA 3MQFA 2WFLB 2JAWA 3UMMA 2QRPA 2WVAA 3PGMA 5HQJA 2VS1A 4OK3A 5LQAA 3AMVA 1NG9A 3K0CA 4IFBA 4KP7A 4MIKA 4GPAA 2R97A 3O03A 2V55B 3GLSA 1OA0A 1CVLA 3DZDA 3F0TA 3PF9A 1X1TA 3B12A 4A8JC 5AVRA 4QUIA 5ITZB 3IEMA 1UXHA 5DX0A 3IULA 2EKBA 2F62A 1ISFA 3CRVA 2VFAA 4Q1BA 4TV9A 1KARA 3G2PA 3VGJA 4CMIA 5KCZA 2VPZA 1XZDA 1NOKA 2WPNA 1JECA 3DE1X 2H08A 3OUTA 2W5UA 2CMKA 2SHKA 4Q34A 1AK1A 1GZ5A 4C9BA 1NATA 2FN3A 3DFKA 1HZJA 2AKEA 2GCPA 2HDWA 5EY5B 1LTQA 4S05A 2WM9B 2D6FA 4I4LA 2GM3A 2QS9A 4I46A 1GUBA 3HB5X 4K40A 1JV2B 4WMLA 4WWHA 4DM3A 4F46A 4OP3A 4YA6A 1TADA 1ZIDA 2OKCA 2H7YA 5U4QA 1O97C 3PENA 1TZJA 2BCGY 1E5LA 1NSYA 1X9GA 3BEOA 1TE2A 3D3EA 4TRRA 1L5SA 3OQVA 2H9AA 3G2KA 2RAPA 1GRRA 4G0XA 3HR4A 2O2GA 1QHHB 5ETJA 2DFTA 3ZS8A 2I5PO 4YASA 3HKDA 3W3AA 4RZHA 3RYTC 3ZCVA 5KC8A 2PGDA 5ICGA 1SKYE 1VM6A 3AR6A 3G5AA 2O2JA 4B81A 1DXOA 4FLMA 2DLNA 5CEJA 1C29B 2ZITA 3QI7A 3B5EA 1GZ4A 4IW3B 2NSJA 1U99A 1RLIA 3N2LA 2AEMA 3OQHA 5TLSA 3PFWO 4MUKA 4C1NA 4F5ZA 1EGMB 5EIHA 3QLVA 2VPTA 1PFYA 2KBFA 3ZE6A 1T3ZA 4CM4A 2HQBA 4ESEA 2JJ2D 3H1GA 1E4YA 3WA7A 1DSSG 1KY3A 1D6MA 1FRFS 2JZNA 3NHBA 5IFLA 4UAUA 3GCZA 4KBFA 4URWR 3TAUA 1IXKA 1EVLA 3PS9A 3F74A 1KZ6A 3BQMB 4MUAA 1RI4A 3N2KA 1G9XA 4DPKA 3R6LA 3TZKA 1Q0UA 3TLZA 4RTLA 5EIEA 1JG3A 1Q91A 1HG1A 1VB5A 3NRJA 4AIIA 4BJ5A 4KMSA 5K6TA 5KKAA 2O8EA 1QFXA 2ZYVX 2H7CA 4JOBA 4LJ6A 4CV2A 3IUYA 3IILA 3TQRA 3GJ5A 3VO2A 4C3VA 5HKOA 1CQJA 2JI9A 5ALLA 1ZHFA 4QU8A 2YYSA 4JI0B 3LQ1A 3TLCA 3NHKA 4QBTA 4MYCA 1XPOA 1MOZA 3RYCB 1RM4A 4CODB 5EHNA 2QMOA 5KTOA 2ZU6A 3KKQA 3R77A 4HVTA 3A6FA 3D1LA 3PRKE 4XJXA 3S1LA 4CIAA 3N5CA 4C4XA 4L0QA 3GFFA 2VQFB 3KSRA 3TW8B 1SZCA 3FKSA 4JBNA 4DA0A 5HW0A 3L02A 3KTAB 1G18A 4W7HA 3NTXA 5LA6A 2IRWA 3CNOA 1X2EA 1E8DA 2XZOA 2G08A 3DZIA 4FIZA 2H4XA 4R9NA 1ZDMA 1LJLA 2P68A 5IT4A 3HY6A 3LKBA 3O0DA 1HMPA 1ODLA 1P0MA 3AONB 2XEDA 2NU8A 3N2GA 3WGLA 3O1HB 3AL0C 1X1SA 1IN1A 3JWEA 3IIKA 5KSWB 3TLJA 1VCMA 5IULC 3T3OA 1RZRA 3V7UA 1PNVA 3D31A 2WOOA 1FJ2A 1FW8A 4ZTBA 3OFNA 4YDSA 2OAGA 1SUFA 2AOWA 2Z56A 2LGJA 5M5BA 1TUGA 4YPOA 4P81A 1NVMB 2HSJA 3CHYA 4L78A 1XXHE 3AEZA 3NTOA 3LBHA 4I2VA 4KSCA 5EWLB 1OY1A 5DRYA 3SIPA 2VUSA 4M7WA 4ETIA 1TYCA 3EISA 3I9LA 4R1SA 2FOLA 3SEFA 3PKJA 3PC6A 4GX2A 5FI5A 1JE0A 2WYHA 5F77A 4RENA 2OKGA 3TVTA 2QL9A 1PO7A 1HRKA 2Q45A 4MV5A 1QRTA 1NXPA 1YS2X 3DTVB 3HCWA 4B8YA 3Q8MA 3M4JA 5IEBA 1YL6A 4F71A 2UUOA 9LDBA 3P2OA 4BFXA 1ENOA 1IZ7A 2HCRA 3F97A 1XIVA 1IBCA 1NJ6A 1NXVA 3OY2A 4HB4A 4X71A 4BNJA 4CEJA 3MGKA 1TQHA 2RHDA 3WB0A 4PG4A 4P3OA 3NPAA 1O08A 2CE2X 1A95A 3KVVA 4PXAA 4DLTA 1H1LB 3QE4A 4I1YA 1HDCA 1CJTC 1JQLB 5JD5A 1L4UA 3C16C 4X93A 1BG6A 2G9RA 2H29A 1PJTA 3TLYA 3VR2A 4OXNA 2O8DB 1IN5A 2QX4A 3RYCA 1J25A 2UXDB 5JSZA 5KYKA 1SKMA 1ZVJA 3B1YA 4IHKA 3CLRD 5L3QB 4PLPA 4HWOA 4JITA 3FPJA 3A2KA 2P1ZA 1JE1A 1U3GA 2OQVA 4RSRA 1VKRA 4UM9B 2YBEA 2ZTMA 3RVLA 5K09A 1J8QA 4DV3B 4HN9A 2KW5A 1JDSA 3E0QA 2DY0A 5J4HA 3T0IA 4FW9A 2HK8A 4AFNA 3AY3A 1TQDA 3MHTA 3H4VA 2QT0A 1X7HA 4CV3A 2C2KA 4GHWA 1U3WA 2VP6A 1WCXA 1DGQA 2MCFA 2V97A 2C82A 2AR7A 4FR5A 1BGXT 1T6BY 1P44A 3PQ8A 4ZVOA 2J6CA 4F3NA 3P9QA 3UKJA 3B78A 3FGNA 8ATCA 1OV4A 3MT9A 3MPOA 2VUTA 3EFEA 4WOJA 5A0VA 1UDXA 1YQXA 3H9GA 4BU1A 1OI7A 4LZWA 1A3CA 4DCTA 1ZICA 2JIOA 3AW9A 4F12A 3ZZTA 4EL0A 4ZVSA 2H00A 1E62A 2XGOA 4CCYB 2YN0A 5LP6F 3THWA 5A2QA 4RE5A 3REGA 2FEXA 3KSBC 3N8KA 4JB0A 4OBBA 4L0DA 3M9WA 4MW7A 1EIWA 3RFUA 4ZK2A 2ODWA 3MCUA 2WFMA 3H5OA 3IJEB 3UXYA 2R9VA 3CSUA 5K3EA 1OH5A 5AKKA 4QNMA 1XVAA 2Y93A 3ITNA 1ULBA 3LL7A 3NBUA 2XADA 4N7MA 4RELA 5B1SA 3K6RA 1ZN7A 1L5YA 2RHMA 1Y9JA 4ND8B 1OROA 3H8WA 4E6PA 5DLYA 2W4MA 3D5QA 5GPBA 4X63A 4B9EA 4OHMA 1XKLA 2I6SA 4RTJA 1T9BA 4JJ6A 1H5QA 4TV9B 3WWDA 3UMRA 1BGWA 1ZCFA 2BTQB 3L0SA 4JEMA 3LGXA 3V8PA 3WJ1A 3ZHYA 1XTKA 3PQ7A 1XDBA 2EJWA 1RAEA 4FHZA 4MUIA 5BQPA 4YAJA 5PNTA 3RIEA 5EQJB 4EB6B 1D4OA 3ILXA 4EUFA 1EUYA 1FFBA 1U2GC 3EQ2A 1R15A 3WSWA 3EIHA 2PRYA 3PYLA 4D9NA 1HTBA 3IRUA 3KYIB 3QA3E 2GQ0A 4ITUA 4KRYA 1F1BA 3RFVA 4LVOA 3WDLA 4HNAB 3E5HA 1VI5A 4WIAA 2RHBA 2QA5A 5I7HA 5CFMA 2ATCA 3S2IA 2G04A 3CRNA 1EVZA 1SOUA 1TZBA 1EDOA 3HVUA 4F11A 3IOCA 4JVOA 3WZ2A 1M2OB 1CJCA 2PYDA 3GUHA 3NWBA 3KR2A 1Q0SA 2VAMA 2Q2VA 3NC4A 4JP3A 4ND2A 4RJLA 5FTWA 1GKIA 4OHCA 5B2FA 4D9FA 4LDPA 4MA5A 3D6FA 4Q1FA 4HDMA 2F1RA 5JFGA 1VQ1A 2WZDA 4MQEB 4ALIA 3VKGA 3QU2A 4LFBB 5FXMA 2X8JA 1C9EA 1JU3A 5BV2P 2FZLA 3B51X 3GMIA 2GK3A 1ONBA 4CM4B 3T52A 4D7AA 4PZUA 3EVNA 3KOYA 3Q2IA 1Z82A 4GL4A 4A2WA 4J4TA 2IHNA 1SCAA 2XNSA 1EHIA 1BH6A 1D7AA 2XDAA 2VP4A 3G9XA 2O2EA 3CX7A 3L46A 2XJ9A 4HS9A 2WP8J 2G70A 2RHJA 1I1OA 4AMVA 4QZVA 5K3BA 2GLTA 3K5PA 1YQTA 4F8JA 5IWCA 2C9CA 4IMJB 3GUUA 1FB5A 3AM4A 1PEDA 2HA0A 4YV1A 2CNOA 3ZWVA 3O3MB 4Q00A 1TAQA 1VGQA 4XGKA 3ZCTA 2WJHA 3VAZA 4DJTA 1XPJA 2JFFA 5AVVA 1WSWA 5C81A 1ZIYA 2HK9A 4GS5A 1U80A 2JFXA 4I5DA 5K0FA 4JJZA 4EFMA 2WSSA 2ZBUA 3EVZA 4NG5A 5M3BA 3S81A 4BAGA 1WSAA 3L0BA 4I9GA 4BWGA 2YOGA 5AK5A 4B8WA 3ZYZA 2NVUB 2BE9A 4CNQA 2C3YA 1QRRA 3D8HA 3HV2A 4NI5A 5G0TA 4AS2A 2EW1A 2BHNA 2C00A 3GN2A 3INRA 1P8JA 3CF2A 3P45A 4Y2YA 5L95A 5COBA 3ZQJA 3SS9X 2SICE 3SKVA 3ZHSA 3SNHA 3NBFA 1H2HA 2PBZA 3DYIA 5BR7A 4PX5A 2HFJA 4WINA 2CL6X 2GVDC 3JPWA 1Q95A 1DUVG 2I7CA 5E38A 3I6ZA 2J45A 4PPFA 2W6IA 2CFRA 3R7WA 3HJAA 3RSGA 3RSOA 4LRUA 4YALA 4MPPA 5IX8A 3IP5A 5LWQA 3KQNA 4Q9AA 1N5IA 3EZXA 1R9JA 4PFSA 4TT8A 4MKZA 4YRGA 3CISA 2FPGA 4DVGA 3MS2A 4YACA 4RJTA 4LEIA 5CB4F 2PKCA 3BMCA 4KX5A 4NU8X 4HYTA 4B17A 4FT4A 3P8ZA 5TR9A 3K8QA 1RCUA 3USCS 2WFAA 2OWEA 3LZ6A 4BYGA 4KAJA 2W2LD 5L3QA 3P2IA 2RJ3A 3FM9A 1N2BA 3MWDA 3SXPA 5AKEA 4BO5A 3F73A 1K3UB 3LW8A 4PONA 1SXJA 1V4BA 1H8ED 5DGIA 4JYCA 4K03A 4YN3A 3JQAA 1FTYA 5HCNA 1Y6JA 2IITA 2HEGA 3DNPA 3OA2A 4YJ3B 3ZBQA 4DHWA 1V5EA 3FPFA 3SBDA 1X8XA 4V02A 4ESVA 1CEEA 3CE6A 1ZEJA 1RPJA 2FCRA 2G1KA 3SXUB 5LQCA 1SZPA 1SB8A 4KLAA 2IZ7A 2P5TB 2H2DA 4MLPA 1Q3KA 2Q99A 2WHEA 4L15A 4Q9HA 2ZS7A 3C3BA 5T57A 3OHMA 1XFDA 2FAXA 4JFAA 5EA2A 3TINA 5DYNA 3OT1A 4I8XA 4X91A 1QZ3A 4RSGA 4Y2XA 4DYDA 3Q6MA 2FJ0A 4XWWA 3QF4A 4FR0A 4EYQA 4MVJA 2HDOA 2QW0X 3JAKB 5D84A 3KUDA 1AQUA 4HGZA 1VI6A 1MJHA 1SKAA 4JBLA 1ODCA 4DMFA 1SOVA 2JJMA 3BB4A 3E03A 3UICA 4HH0A 3B5IA 2WIBA 4IIYA 1CIPA 4I9NA 3PD1A 1HE3A 2WE8A 5ITWA 3SFVA 4E5KA 3URMA 1OC2A 1I51A 1SBIA 2GEKA 5C8XA 2YV1A 2VJKA 3WIOA 3JYLA 1LPBB 4DADA 2O8CB 1UBLS 4CUKA 1FFWA 3MWYW 1X1EA 1G8AA 2YHIB 2ZUCA 3FCYA 3OESA 4RPIA 2O59A 4DNQA 1FMCA 1U2EA 4LS3A 3TZ6A 2H2AA 1PHPA 3G2NA 1SG6A 1IN8A 1GLGA 1Z6AA 3OZSA 1DLJA 1PDVA 2ZUSA 3D7RA 4W9RA 5J5CA 5AUPB 4KRXA 5T6BA 5BPFA 1OTXA 2I78A 4XIIA 4C89A 2QM7A 5IDWA 2WHPA 4R1QA 5CT6A 2P2DA 2HMYB 1D6JA 1G7CA 2AI1A 2B3TA 5JXJA 4P54A 4JI4B 3K2EA 5TGDA 2PVPA 3K4HA 5JVDF 4YP1A 3NONA 4OBWA 4RESA 2HBZA 1XEWY 1SH7A 3DUWA 3IVMA 3MSCA 4MMXB 5ANRB 4U5QA 5AFSA 4FVTA 5E0KB 1LH0A 4E7OA 3IGFA 5ITSA 2C92A 1KDZA 4LW8A 1V39A 3CF6R 4EWLA 2OXIA 1E6WA 4PLZA 4C78A 2ET6A 4AS1A 3GH3A 4BE4A 3I0NA 3W8DA 3O9MA 3LBNA 1AHIA 4W9MC 1EAMA 2XNDD 4DYHA 1OBHA 1U11A 2P5YA 4BWYA 5KNBD 2JHCA 2GVZC 3DFIA 3V1UA 1K86A 3JQBA 1UWCA 4RLQA 1PL6A 3I2HA 3DEHA 3NNSA 3AJRA 2DULA 2EZ4A 3TE7A 4GPIB 3BKXA 3CUUA 3ACBA 2CLFB 4U7HA 2AV6A 4LY6A 2X8JB 5JWHA 4CBVA 1M2NA 2OC9A 2R4QA 3H19A 3VKUA 2VHTA 3SOPA 1JSZA 1TCBA 5GQSA 5AUQA 2WILA 2OHIA 3BD6A 2FDRA 1U3FA 3I5MA 4X6LA 4BFTA 3G5TA 3MWFA 3IYLW 5B3LA 1E7RA 3M34A 2EX4A 2X1MA 1YQ9A 2QIOA 3H2BA 4H4CA 1PLKA 4LQCA 4OXRA 4RQBA 2C2XA 1I6KA 1WWKA 4OUKX 1TEVA 4J7AA 2GCNA 2BI8A 2GKSA 4YP6A 5LYJB 3VC1A 3B6KA 1OLXB 3JVDA 3N7TA 5J1TB 3I05A 2GJKA 2PGAA 1UBEA 3KYJB 1NLYA 2BLNA 1WAMA 3QVUA 3BE6A 4G24A 4J7CA 3TD2A 4BLTA 1MO6A 4BQNA 6ABPA 2OHJA 1WU7A 3EQ9A 2G76A 2PGJA 3DBLA 4OB6A 1KIFA 1UJCA 4WCFC 3SZLA 1PT9A 4V3CA 1RQRA 2XOKA 3KXDA 3RAPR 5LMNB 4RZ2A 4TMZA 3O7WA 2NU7A 4MR8B 1VG8A 1KP3A 1GTMA 4X1KA 1Z0JA 4ACBA 2EP7A 2HQSA 2IEIA 4FEGA 2XIJA 4L8WB 1I6WA 3NP9A 1DKNA 4YJDA 5GM1A 3MUNA 1D1SA 1U81A 3IPRA 4N5DA 2SCUA 3W9SA 3WK7A 4ZHQF 5CDHA 5LJIA 4RTOA 1NTOA 1LD3A 1MKYA 4LE0A 5DFAA 1SIOA 5TF0A 1NQXA 4ETWA 3MWGA 4HQNA 2FRXA 5ENZA 3HJNA 3WLPA 4N4AA 1NN3A 3VX3A 1TQ2A 1TZ2A 1ZOIA 1WSBA 3GUZA 5DGDA 5HUJA 3W7VA 4QX6A 1N6KA 2F6RA 4MSUA 2YJTD 3ICWA 3SYKA 2XDWA 3DF9A 2FE1A 2LW7A 4ZICA 1UBMS 3SEAA 2Z08A 3WSVA 4TYYA 3L1VA 2R6AA 4I5EA 4O63O 2EOAA 4RK1A 5G1OA 1WS6A 3H9CA 1I6MA 1QGED 2BJVA 3RVDA 5IM4A 1H4VB 2JD1A 2PVCA 5JH7B 4QUHA 3QV1A 1D0IA 1GLNA 1T1EA 1L9XA 5AP9A 5LBTA 4EJ2A 3AW8A 3A6EA 1CNFA 2OPBA 4U7WA 3UUFA 1JB9A 4IL5A 4P33A 4YUXA 1BCSB 4OAQA 1UXOA 1ADCA 1C3VA 1GFWA 3VPCA 4M55A 4WLEA 4PQFA 2IXBA 1AUXA 1DIRA 2IZ6A 2QTHA 3BDIA 3LDFA 4F1WA 5I9NA 5M7EA 3HA2A 3TGPA 3MOSA 3TJMA 3F96A 3PUVA 2W0SA 4XX1A 4WESA 4PX2A 3WIBA 1VPWA 1JDUA 2JKYA 3EEQA 5CCBA 1JAIA 2ZB2A 1NFFA 4FFRA 1XWIA 1O87A 1GAEO 1ZITA 3F67A 4A23A 3KQLA 4RFSB 5L4NA 2C0CA 2V74B 4EF5A 1YR7A 1PJQA 2CXOA 4D74A 4GQBA 2OZEA 4RCVA 1DX6A 3OCUA 4JASB 4LWOA 2QMQA 2UVDA 2CHUA 3DUFA 5CGQB 1T13A 1J09A 3DV0A 3HCBA 5AXDA 5HF6A 2DF8A 3T0FA 3WK6A 4YIHA 4AKIA 3IAAA 2BEVA 4TWZA 5IUKC 4WOKA 2WG2A 4X20B 2PA0A 3UJ9A 1YKGA 4QOEA 4Y2VA 3EVGA 3IVAA 1MJGM 1GJRA 4BQPA 4MP8A 2AVNA 3EC7A 4OHPA 4M0D