4LXGA

Crystal structure of dxnb2, a carbon - carbon bond hydrolase from sphingomonas wittichii rw1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
276
structure length
274
Chain Sequence
MFEQFESKFIDCDGIRTHYIEMGEGDPLVLVHGGGAGADGRSNFADNFPIFARHMRVIAYDMVGFGQTDAPDPAGFAYTQAARTDHLISFIKALGLSKICLIGNSMGGTTACGAALKAPELIDRLVLMGAAVNISPDDMVADDLAAVMSYDGSEEGMRKIIAALTHSYQPTDDIVHYRHEASLRPTTTAAYKATMGWAKQNGLYYSPEQLASLTMPVLVLGGKNDVMVPVRKVIDQILAIPQAIGHVFPNCGHWVMIEYPEEFCTQTLHFFGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MCP Hydrolase
publication title The Lid Domain of the MCP Hydrolase DxnB2 Contributes to the Reactivity toward Recalcitrant PCB Metabolites.
pubmed doi rcsb
source organism Sphingomonas wittichii rw1
molecule tags Hydrolase
total genus 92
structure length 274
sequence length 276
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lxgA00
2WFLB 3ANSA 2CUTA 2Y6VA 1K4YA 3QVMA 3KD2A 4QDOA 1LBTA 4UBLA 1XZLA 4HTAA 1QO9A 2J4CA 3PF9A 4HRYA 3WL8A 3CCBA 3JW8A 4A5SA 3AJAA 5JARA 4CG3A 2XQFA 3IBTA 1QOZA 1TAHA 3ZLTA 3A2LA 2RAUA 5T4BA 3WWDA 3ESCA 5JAOA 4P08A 1GQRA 2IX9A 3CCCA 2OAGA 3M83A 4KRXA 2VF2A 2HA5A 4DMFA 1XZMA 4U2DA 1W1IA 2WHPA 5ALTA 3K2IA 1XQWA 4H18A 1YR2A 1SCIA 3C6ZA 3V1NA 4IH9A 3TEJA 3YASA 1A8QA 5ISMA 5CMLA 1F6WA 1HDEA 3QYJA 4AO6A 1TKRA 5AM3A 2RONA 4MYDA 4MEAA 5JALA 2WFZA 5AM0A 4UFOA 3OG9A 2HA7A 1EK1A 3ZV7A 3OPMA 3TGLA 4KAFA 4DGQA 2G4LA 1J06A 2OPHA 2WUEA 1H2YA 3RK4A 1PFQA 1LBSA 3FLEA 5ALDA 2Y2VA 4MJ3A 3RARA 2PSJA 1CUDA 3I2HA 4EHBA 4Q05A 1IVYA 2OAEA 3WIOA 1YSCA 2V9ZA 1JU4A 1DINA 3DDUA 3L1JA 1JJBA 4DMCA 1YCDA 2GYUA 1CUWA 2PUHA 2X8BA 4QWMA 2CJPA 4BRSA 3VXKA 1XZGA 3WK9A 3HJUA 2E3JA 4GBGA 4Y2JA 1ZI9A 2XI4A 4BCBA 1R50A 4CIBA 1UOPA 3O0DA 3I2FA 3I6ZA 4X71A 5AM4A 2BUCA 1XKLA 1FFCA 4PQEA 3QH4A 1RP1A 2HIHA 1YB7A 1CUVA 2OGZA 1YA8A 5AKLA 1AURA 3NWOA 2FJ0A 1W6RA 2BGRA 1X2BA 3BXPA 5ALUA 1QIEA 5FUMA 1AKNA 2AJDA 2AXEA 2HFKA 3H04A 2WTNA 3DCNA 1AZWA 1ZD3A 1F8UA 2XUIA 3WWPA 1H2ZA 1K8QA 4G9GA 5AKKA 4X94A 4X6XA 2XUGA 3RLIA 4KR0A 4BE9A 5CT9A 2VJDA 3DKRA 3UUEA 1ODTC 3QM1A 1UOQA 1E3QA 4YX9A 1CRLA 5AKJA 1OCEA 2PVSA 5LYYA 4F60A 3E0XA 3B3QA 1R4ZA 1WCYA 5IKXA 3UUFA 4F5ZA 1BCRA 2XUAA 4HZGA 2HA0A 1CUSA 1VZ3A 1EDEA 5K3CA 5DYWA 4F0JA 5FV4A 5LZ4A 5K3FB 3WKCA 2G5TA 2JIDA 1BCSA 2CKMA 3KWFA 5JAUA 1K6EA 3F97A 5HKAA 1ZD4A 3EBLA 1F0PA 5AK3A 1P0PA 4F21A 5AI0A 4KRYA 4BAUA 2I3DA 1O6GA 1VJ5A 4DLNA 3ILSA 4TPKA 3H1BA 1DWPA 2O2IA 3ED1A 5HFAA 4AMZA 4UBIA 1FFDA 5D7BA 3AZPA 3FOBA 5ALZA 2JEYA 4RGYA 3WA6A 1MJ5A 1N8SA 4KAAA 2EDCA 1JI3A 2ZSHA 5CURA 3R41A 5EFZA 2XQJA 2WHQA 4X90A 1LPAB 4CG2A 5A62A 4BZZA 1MPXA 5HF8A 2JGEA 1LZLA 1ZD5A 4Y2PA 4B7ZA 4AMYA 1QTRA 3G8YA 3C6XA 1THTA 1CUUA 5SYNA 1CIJA 3MGAA 1GZ7A 2D0DA 2WIGA 2GBFA 3WA7A 5AI8A 4IO0A 4FWBA 1QZ3A 1XRNA 2QUAA 1EDBA 3DYVA 4Q3KA 2FX5A 4U2BA 2WU4A 1XRLA 2VAVA 1S8OA 4BTLA 1CUJA 1CLEA 4PW0A 4WY5A 2H9YA 3LIPA 5A71A 5C7YA 5F4ZA 3BDIA 4FTWA 4GECA 4OU4A 2Z3WA 3PUHA 3STTA 3QPAA 1ZIYA 5CXUA 4H35A 3WZLA 5KWIA 4NZZA 2HU5A 4W1PA 1R88A 2BUAA 4LKOA 1GPNA 3IIIA 2XQGA 2G63A 4K2AA 5AI6A 1HBJA 4BVLA 3QPDA 3VVLA 5DNUA 2XUJA 1WB6A 3O9VA 3E3AA 2RI6A 2BKLA 3QMVA 4ROTA 4ZGBA 3WYDA 3ZLUA 5HF5A 2O7VA 2EEPA 1XRRA 4U2GA 4ZV9A 1QONA 4BAGA 1WB4A 2XUPA 3PFBA 2JGLA 4EY7A 3WKBA 5AOAA 1A7UA 1JJFA 4MWSA 3DQZA 3D59A 3AFIA 3WK7A 5AKHA 5HK9A 5IVHA 4X3CA 5HF9A 4INZA 3VJMA 2XMSA 4C88A 5AI9A 1XRMA 2O7RA 1MX9A 4AZ0A 4WDQA 2JEZA 5D3ZA 1UK9A 3BWXA 5T4HA 1EVEA 4DMKA 3ZI7A 4EB0A 2B61A 4C4YA 5LZ8A 3H2HA 2P8SA 1LZKA 1GPLA 5DNWA 4M0EA 4FFWA 1CQZA 2PUJA 1U4NA 3D0KA 1QIKA 3H18A 3L1HA 2HU7A 4A16A 5HZGA 4UBMA 4DYHA 2OCIA 4C89A 3WKDA 2H7YA 3KWJA 3D7RA 1YB6A 4LHEA 1VXRA 4UHEA 1DWOA 2VAXA 1VXOA 2QOEA 1H22A 3B12A 3QBJA 4AX4A 1GT6A 3D3NA 1EVQA 4DNOA 4L9AA 3O4HA 4AB1A 2PM8A 1UK6A 4GDMA 4E14A 4FLMA 3H2GA 3DOIA 1E89A 4J0CA 4BC1A 4KYVA 3IULA 4N5HX 3N2ZB 4HXGA 1H2XA 1UOOA 2ZYSA 3G0GA 5HF6A 4C4ZA 4H7DA 4BDTA 7YASA 4DIUA 2AJLI 4QWWA 4W1QA 1CUHA 1SCKA 4JNCA 1MAHA 5ALWA 1N5MA 3BIWA 3PE6A 5FXMA 2VT6A 2OLEA 4JYMA 5JIBA 2JGJA 3SK0A 1TCAA 2ZYIA 3DD5A 1FSSA 4QLAA 5DYTA 5FPPA 4QDUA 4YASA 5SYMA 1E66A 5IH7A 1AQLA 1UK8A 2HDWA 1P0QA 3C43A 4QLOA 2YXPX 2NW6A 5AP9A 3VJKA 2YH2A 2D5LA 1UT6A 2WIKA 5E2IA 4QNNA 3OTQA 3LS2A 2IITA 5JATA 1DX4A 5CTAA 4EY5A 2RIPA 2WG2A 1R9MA 4JEIA 1J07A 5FPQA 4MWTA 4EY6A 1D07A 2O2GA 4ZXFA 3FAKA 4MEBA 5CH5A 5KBYA 1VKHA 1MX5A 4PV7A 4UBKA 2ZYHA 5ALSA 4X6YA 4C4XA 2WHPB 2CB9A 1EB8A 5ALIA 2OQVA 4NVRA 4QDTA 4BC0A 4E15A 2J3QA 4GWLA 2BGNA 4HVTA 2W6CX 2QS9A 4PSDA 2WFLA 3DEAA 2ZJ7A 2XMCA 3AIKA 4L72A 5HCUA 3ICWA 4MQMA 4J0KA 1OXMA 1H23A 2HA4A 3PICA 3AIMA 2VA9A 2PU5A 1C7JA 4A23A 4C01A 2I78A 3W04A 2R8BA 3G9XA 3H19A 4RPCA 4FBLA 2VJCA 2XQIA 3PFCA 2OQIA 5K5EA 2IIVA 4V2IA 2XMRA 1P0IA 1XZKA 3H0CA 1USWA 4IH1A 1IZ7A 1QIIA 4KE8A 1TK3A 1MU0A 4LYDA 5EHNA 1ZJ4A 4FBMA 4B0PA 4GEGA 4G8BA 1JT2A 2I03A 4ARBA 3PUIA 4OSEA 5HKBA 2GBCA 1M33A 1ZD2P 5AI5A 3ZLVA 1ZOIA 4CCYA 5HK8A 2RGUA 4N8SA 4X91A 1PV1A 1HPLA 1DT5A 1R3DA 2GYWA 5CT8A 3WJ2A 3WKEA 1UKCA 5K3DA 3I28A 2YYSA 3WKAA 1LPBB 4N5IX 3F8SA 3BIXA 5JADA 5BOVA 5C8VA 2JF0A 3SX4A 3IURA 3M3DA 3G0DA 4EY8A 4AN1A 3D5EA 4PF1A 4QE3A 3QMWA 1E8MA 5EGNA 1T2NA 1Q0ZA 1ZI8A 3SC2A 4B6GA 2DFPA 1W52X 3F96A 2HA2A 4XWGA 3WL7A 5CH8A 5ALYA 5JD5A 4RNCA 3D2AA 3PDCA 1K5PA 5ALFA 5HFNA 5AOCA 1K63A 1NU6A 5EIEA 2HHAA 5EI5A 5HQ3B 1VOTA 5LP1A 2WUDA 5AI4A 3WLAA 1Y7IA 1YS1X 2Q0XA 4FFVA 3X3HA 3R3YA 5DYYA 3STXA 5CT6A 3R0VA 5AHXA 3ESBA 4WCVA 3DYIA 5AK6A 2JBWA 3W06A 1LPOA 2QKYA 1ACLA 1XLVA 5EHZA 5JD6A 2WLSA 1YAJA 1LPNA 4LXIA 4Y2TA 3DJYA 5DJ5A 2C58A 2XQKA 4ETWA 3QZUA 4CG1A 2H7CA 4EA6A 4CFSA 3I2JA 2C5GA 1QLWA 4K6KA 5EHXA 3PI6A 3HABA 4GXNA 3HEAA 2WM2A 5C81A 4Q3OA 1CUGA 3HXKA 2RHTA 2QXUA 2XLBA 3A70A 2WJ3A 1JU3A 1YAHA 3CN9A 4N8EA 5K3FA 4OPMA 4LYEA 5ALEA 1ODCA 3M81A 5ALVA 3KSRA 2QJRA 1MNAA 3G9TA 4HRXA 4G1FA 4J0DA 4XX1A 3FLBA 1W4LA 3ESDA 4P9NA 3WWCA 3FYUB 1MTZA 4Y2YA 4FNGA 5JZBA 1RYYA 4M0FA 1JMYA 5FKJA 4X93A 3O4IA 4OU5A 4X7BA 2HRRA 4WFJA 1GKLA 1ZJ5A 1VA5A 3G0IA 2PX6A 5JANA 4OCZA 4FOLA 2DR0A 2Z8XA 3IUQA 1THGA 4B9AA 1GQSA 1X70A 2H7XA 2V97A 4W1SA 4BCDA 2XUOA 4FDMA 5CT4A 1FFBA 1GKKA 4YK7A 1XZFA 1QFSA 4E46A 3A2MA 2PU7A 1JJIA 5JAPA 1UK7A 4H7IA 1ZGCA 2JGIA 3STUA 1QIHA 4B82A 4HAIA 4HXFB 2C0QA 1A8UA 3I2GA 2Z5GA 1BU8A 2UZ0A 2G5PA 5AKXA 2XB6A 1LPMA 2ACKA 2WFMA 3D4LA 3GZJA 3ZPXA 5DWDA 5JZ9A 5ESRA 1NX9A 3MVEA 4J03A 4PSUA 1FFAA 2WIJA 4U2EA 3HLKA 1AC5A 3ZWQA 4B84A 1A88A 1UWCA 1ACJA 2QMQA 1EI9A 1GGVA 3C5WP 3WL6A 1AGYA 1QE3A 3BF7A 1G66A 4EBBA 3V48A 3A2NA 3AUKA 3GA7A 3HC7A 1HLGA 1G4HA 3BL8A 3EQ9A 4P92A 4H77A 4OYLA 3Q8WA 3GROA 4MYSA 1IUNA 2RHWA 4MQLA 3IA2A 5JAHA 1ISPA 3TJMA 2QT9A 3R3UA 4K5QA 4UHBA 5I9IA 4Y2XA 2R11A 2VTVA 4ZI5A 4Y2UA 3F9CA 3BF8A 2PSHA 4FLEA 2HL6A 1BEZA 1JKMA 2WTMA 4OUKX 2HA6A 4OYYA 5ALHA 3IVMA 3C8HA 1CUFA 1CUCA 2FUKA 3EQ8A 2Y1KA 2AJCA 2ZYRA 1HKHA 1SOMA 4O08A 4X92A 3WMRA 2WJ6A 2Z8ZA 2VEOA 3GBSA 4GI1A 1Q0RA 4PNZA 4BDSA 2QR5A 4EUSA 4DNFA 1UKAA 2DHEA 3A6ZA 4MXDA 1LNSA 4J0JA 3STVA 3FCXA 3LP5A 4WY8A 3O4JA 5AIAA 3JWEA 3U0VA 1J2EA 3R3WA 2WUFA 4B0OA 3AINA 1KU0A 5IVKA 1IUPA 2WIFA 2C0PA 1QGED 4Q34A 2EDAA 3MUNA 3I6MA 1CUIA 1NU8A 2HFJA 1JFRA 4Q3LA 4IHAA 2DQYA 4LXHA 4BVJA 4PSCA 5E4JA 5LZ2A 4WFKA 4QZVA 4FHZA 1GPKA 1XZBA 2XUHA 3B5EA 2XMQA 3WIBA 4JUIA 4AQDA 3H1AA 4HS9A 5AICA 1TQHA 1UFOA 5AKEA 3WK5A 1MO2A 3WL5A 1QIMA 1LLFA 1EHYA 4BZWA 2JGKA 3V1LA 2DHDA 4ZWNA 2PBLA 3BJRA 5EIHA 1E8DA 2J4FA 5CXXA 5CRIA 3WK8A 4FMPA 2XMGA 2QJWA 2ROQA 1BE0A 3D2BA 1LGYA 4FKBA 3G7NA 5ALNA 1ZICA 4M0MA 4W1RA 5DLPA 5AKYA 1DWQA 2HA3A 4PO3X 1IZ8A 1CUXA 4UBOA 5LKAA 2XMZA 1QFMA 2J3DA 3QPCA 5AM5A 5AJHA 3WZMA 3C87A 5ALKA 2VJAA 4X97A 3TRDA 4Y2SA 1F0NA 2WHRA 3PF8A 2VT7A 4KAJA 4QDXA 4H7EA 3I1YA 1AX9A 3NGMA 1XZCA 1VE6A 2OXEA 3QMMA 4E11A 3MUOA 3G9ZA 4H0CA 1ETHA 5EHQA 4GHWA 2WUGA 4KE6A 5ALOA 5K3AA 4B83A 2WJ4A 4BP8A 1XZEA 5D3KA 1L7QA 3V1KA 1KU6A 2WQZA 4AN0A 4G4IA 2JGFA 4BATA 3FSGA 5LZ7A 1XLUA 1XLWA 4HXEB 5ALGA 3FCYA 2DHCA 1VLQA 1JMKC 4J7AA 5ALPA 2BCEA 1TIBA 4X85A 3I1IA 1ZIXA 1WPRA 1QIGA 4C87A 3W9BA 3HZOA 2XUFA 3IB3A 1L7AA 1BS9A 4J0IA 4H7HA 2WG0A 3C45A 1XQYA 4P93A 2VATA 2CEKA 3FNBA 6YASA 2ACEA 2VQ6A 2ZJ6A 3S2ZA 4JYPA 3C5VA 5E4TA 1B41A 4BTVA 3CXUA 4DTCA 2Y6UA 1WPXA 3F67A 1BROA 4L3WA 1BN6A 3C6YA 1ORVA 3I2KA 3HSSA 1IMJA 4G5XA 4WJLA 1GXSA 2ORYA 4GLBA 1DTEA 4Y2QA 2V98A 2WIDA 4DNQA 1QIJA 5KWJA 4OB7A 1U2EA 3R3ZA 3W05A 1EK2A 4DM7A 2PSDA 3DL4A 3ICVA 5D6OA 1SCQA 1YS2X 3O4GA 4J0HA 5ALQA 4CCYB 4BRZA 2HM7A 2QM0A 4OB6A 3N0TA 2CBGA 2DCMA 3AILA 5C8XA 1BN7A 4TVKA 3VKFA 4BCCA 3M82A 1G42A 1CR6A 1EINA 4UHFA 3FVRA 4UBJA 5EIAA 3FBWA 3GELA 1U65A 4GW3A 5E4YA 1X2EA 1ZI6A 1ZGBA 2OGTA 2ZSIA 2HRQA 2Y2UA 4FNMA 4N8DA 1WM1A 4WDRA 1XZDA 4JH0A 2OG1A 1R1DA 5YASA 4Z49A 4QA9A 4B81A 1B6GA 1XZHA 4Y2RA 2H1IA 4ARAA 3EIOA 3IDAA 5AM2A 5IVDA 2QTBA 1W75A 2I3ZA 1XQXA 1XRPA 1N1MA 5BWCA 4OD0A 4UBNA 1WHSA 1MNQA 3R3VA 5I8PA 1EX9A 3K9BA 3I6YA 2OCKA 1VE7A 5FRDA 1HL7A 3H17A 3FYTA 2PSFA 3WWEA 1QO7A 1Z68A 1ORWA 3DL7A 4Q1VA 3HACA 2WU3A 3P2MA 4Y7DA 2B9VA 2ZJFA 1T4MA 4QDZA 5ALLA 1XZIA 2C7BA 5A7HA 2GZSA 1N5RA 1W76A 2VSQA 2PPLA 4OB8A 3QITA 2QUBA 4XIIA 2OCLA 3OM8A 4Q82A 5JD4A 1C7IA 1HQDA 1OILA 3DKKA 1U8EA 1EB9A 4L0CA 1Y7HA 2DQZA 3AZQA 3W9UA 3FVTA 2BFNA 1CV2A 3E1GA 1EH5A 4DSAA 5HQ3A 1DQYA 3LCRA 5CH3A 5H3HA 5A7GA 5LLSA 1H2WA 3NUZA 4UFPA 3WQHA 4KE7A 4UHDA 3IUMA 2W22A 2WKWA 1E5TA 3DOHA 1YASA 5LIPA 3H2JA 5A7FA 4ITVA 4Y2VA 1XFDA 1CPYA 4K6HA 3STWA 4KACA 3D2CA 2ZVDA 3FYUC 2XUQA 2B20A 1AMNA 5KREA 3G0CA 5J3JA 4UHHA 2V96A 5AKIA 5CW2A 2XE4A 5BV7A 1DU4A 5ALRA 1CUAA 4K6GA 1ODSA 3G02A 4TGLA 2B4KA 1CUBA 3CN7A 1QTIA 3GUUA 4ZV7A 2QRUA 2XMBA 4DMHA 1C4XA 1XQVA 1FFEA 2VJBA 1CQWA 2BAGA 4B80A 4S0XA 2O2HA 2CMFA 4BP9A 4IH4A 4BB0A 5FOQA 1CVLA 3FYUA 4KEAA 4Y9SA 3HI4A 3LLCA 4AXBA 5AKGA 4I19A 3ESAA 4RE5A 1VZ2A 1EXWA 3E4DA 1IUOA 3S8YA 4AZ3A 4W9RA 1MN6A 4YPVA 3WK4A 3V1MA 1A8SA 3F98A 1QIDA 4CI9A 4H7FA 2C5FA 4XVCA 3ANTA 1MX1A 5LZ5A 1UKBA 4KJXA 2WG1A 2GZRA 2ONCA 2XT0A 3WI7A 2PKYX 1LPSA 3VDXA 3WWOA 4QEKA 3KDAA 2QZPA 4J0GA 1L7RA 3R40A 1TCBA 5K3EA 2YASA 4ZRDA 4G4JA 1LPPA 2QXTA 4U2CA 5AK4A 4LIPD 4X95A 2XUDA 5I7UA 2AJ8A 2BUBA 4UPDA 1XRQA 3IUJA 3UMJA 3V9AA 1MT3A 3FLAA 3C8DA 1TRHA 3AZOA 2PSEA 4I3FA 3O9MA 1AUOA 1CUEA 2FJPA 3L1IA 1R9NA 4C6HA 3KOOA 3EQ7A 1QJ4A 2QVBA 2XUKA 4UHCA 3FWHA 5C8ZA 3IUNA 4J3JA 1BEEA 4BE4A 3K6KA 2LIPA 5AKZA 3VJLA 4W63A 2XMDA 1Q84A 1DQZA 3BE8A 1XROA 4CCWA 2GBIA 4WFIA 5JYCA 5AM1A 1DX6A 1CUYA 5T4EA 5CBKA 3O95A 3R3XA 1E8NA 3T52A 1SFRA 4UUQA 3NOXA 4H7KA 4I4CA 3SWWA 5AH0A 5ALMA 1XZJA 1YA4A 5A2GA 5CT5A 3C70A 3Q0TA 2GBGA 1CFJA 3DLTA 4BBZA 3OOSA 3EF3A 5BWBA 3C6BA 2OCGA 1PJAA 4NMWA 3BJMA 3AIOA 2WSLA 4XJVA 1CEXA 5T4FA 1Y37A 2HU8A 3HYSA 5LKRA 1WOMA 3BDVA 4G8CA 4D9JA 1XKTA 2C4HA 2JGMA 3U1TA 1QIFA 1CUZA 2X5XA 3I2IA 4U2FA 3HRHA 2K2QB 1G5FA 3JYHA 3WJ1A 5K3BA 3H2KA 4IQ4A 5DNVA 2BJHA 4KE9A 2OGSA 3KXPA 3STYA 4H7JA 2ECFA 2PL5A 2ES4A 2GYVA 5AK5A 4NS4A 5ALXA 1UXOA 3DS8A 4X6UA 5AO9A 5IVIA 3WK6A 1O6FA 1DT3A 5AIBA 3OC0A 1WB5A 5A6VA 2AJBA 4ZREA 5JZSA 4AO8A 4BYMA 5ALJA 3GFFA 3G0BA 1VA4A 3FSGD 5LZ9A 4CIAA 4B85A 1XZAA 4AO7A 1Q83A 3OURA 1FJ2A 1I6WA 2X76A 4G8DA 1MAAA 1WHTA 3LIIA 4FLFA 3DNMA 4X00A 4EY4A 4RE6A 4LXGA 5DTIA 1UZAA 4DNPA 5FLKA 3VISA 2WILA 1J1IA 1TCCA 2DSNA 4G4GA 3H2IA 3WYNA 5DTJA 1EDDA 3VVMA 2Z3ZA 5FP0A 4BVKA 4B9EA 1SC9A 3W2TA 4DSZA 1EA5A 3T4UA 4EZIA 3RM3A 5AOBA 4BAZA 4UFNA 3G9UA 4G9EA 2HADA 1RWQA 1P0MA 1BRTA 2XLCA 2XDWA 1KEZA 3RKSA 2CZQA 5JASA 5FDFA
chains in the Genus database with same CATH superfamily
2WFLB 2HBYA 2GCOB 2Y6VA 2AJTA 2C29D 5ETJA 3KYDB 3B1XA 3UTCA 2I7XA 2E21A 3GPDG 5FJJA 4QDOA 1BQ3A 2P0YA 4CEJB 1X87A 1J0CA 2NPFA 4HJRA 2XX3A 3KKMA 2BELA 1XZLA 3KQOA 4HTAA 4MV8A 1A9TA 2DM6A 2PZLA 2VJOA 1ZSNA 4LOKA 1X8KA 3FSEA 4Q9KA 4BLOA 4PCVA 2JKYA 3T5PA 2FLWA 2JFXA 4D0GA 3MBIA 4P3NA 2G0TA 4KXVA 4EHHA 1W87A 2O6LA 3FNFA 3GGOA 3TDNA 4ALMA 4DW8A 1YI1A 1C4KA 2XQFA 2HBRA 3BREA 1TAHA 3QUAA 4D99A 4FT2A 4P3OA 2XRMA 2DKNA 3GYGA 4GR5A 4J3FA 1MO6A 3RWMB 5EYPA 5EZSA 2BEWB 4TM7A 1GL9B 1DSSG 1RBZA 3WWDA 5KOJB 4IUDS 3P0IA 1XDBA 2C03A 2P1DA 1V9LA 3B5JA 1YT5A 3KQUA 4ZYZA 4YEDA 1QVWA 2IX9A 2DX7A 1Y98A 2OSVA 3AHEA 4L02A 2BR3A 1D2RA 3GN2A 3AF1A 4ENRA 4AJKA 1SHLA 4OHZA 2Q3HA 3WTCA 2K7FA 1MB2A 4TZ6A 4BMCA 1K6MA 1TO1E 3B6EA 4FZJA 4KRXA 1RIFA 5JEDA 3WXMA 4MR9B 1PHPA 2XSZA 3LLSA 1J5EB 1Y1QA 2HA5A 4WI1A 1PL6A 1ZMOA 1Z6PA 3L0OA 4H27A 4U2DA 2CVPA 1K5HA 5C80A 1AZSC 3GW8A 5EKXA 1XNRB 4R83A 1ZAYA 1DUVG 3FTFA 3OF3A 1VMEA 2X42A 4BKMA 1YR2A 1SCIA 3C6ZA 3D8UA 3PLAE 4ALIA 4IIJA 4TKLA 3F74A 3ACDA 1M2JA 2D54A 2X1MA 2EP8A 4G1CA 1C29B 1FYDA 3GRCA 1ULBA 4G0OA 2DLDA 4V2UA 1QF6A 5CMLA 1JTVA 1F6WA 1HDEA 1YRQA 3QYJA 4YJGB 3RG8A 4B8WA 1MQAA 4YMTA 3KX2A 4GPD1 2Q1WA 1H05A 2I2XB 1X1BA 4FDUA 3UH1A 1DQSA 2WFZA 4YVFA 1JXMA 4CTJA 1IZZA 4X7PA 3NAQA 2LCFA 2OP0A 1UJ5A 2DP4E 2AB0A 1PK9A 4WN3A 1WS6A 3OY2A 1U0LA 3TYXA 2QM7A 1RYBA 4UJ3A 4CM1A 3U80A 1IPHA 3ZTTA 3N8IA 4X1IA 4LN1A 1GCGA 1XZPA 5CW1A 1T36B 2BFMA 2G4LA 1J06A 1MC4A 3SLRA 5HJ7A 2OPHA 5AHRA 5CG1A 2XGOA 4JT9A 3CW8X 5J5CA 1EUCB 1LBSA 3K2QA 5FWXB 1ZONA 4G86A 3TLAA 4A26A 4UNQA 4DLSA 4CM6A 2Y2VA 4MJ3A 3AF2A 1G2IA 4EKDA 3NEYA 1E7RA 4L3OA 4B32A 2HJHA 3ZIAA 3NHWA 8AT1A 1RYNA 1L5LA 3CF0A 3FMPB 5H80A 2R96A 4DXHA 2RK6A 2G25A 3X1YA 1FXUA 4B3TB 1BRMA 1YSCA 1YB5A 1ZP6A 2V9ZA 4EB6B 3OM1A 4NSNA 4EL0A 1YACA 4Q12A 4DUGA 4R1UA 1IBKB 5A4AA 4A2PA 3TLXA 1JJBA 1YR1A 4MUKA 1LFDB 1SA0B 1Y5IA 3K9NA 1YONA 1YCDA 2ATCA 3SMVA 5B3JC 1DKMA 4PTYA 3GDFA 2PUHA 3O3CA 1Q1BA 1PF7E 1UBMS 2JI8A 3RS2A 1VCIA 2JG3A 2QNRA 4IKPA 4P3XA 2MCFA 2NV0A 1XZGA 1NWCA 1BH6A 4LJ6A 2OV6A 2NVWA 3M6AA 1POXA 1KEWA 2IEIA 4FMCB 4MRAA 2PMEA 3PXGA 4E7PA 2E3JA 5C7IO 1F2VA 1HLDA 1UT8A 2NT4A 3KVNA 1W5AA 3O2SB 4KR9A 1ZI9A 2WD8A 1N5KA 2WHXA 4HPJB 2MYPA 1WUTA 3U17A 1VKZA 3DHVA 2X15A 2BMJA 1W6UA 4CIBA 1L5OA 1YR3A 2C4UA 4NYIR 3TZHA 4DJ5X 2WF6A 1DJMA 3NQ41 1UODA 1XSEA 3NRJA 1QQ7A 3RK1A 1TJYA 3ZZNA 3M3HA 3CEJA 3G79A 1F8XA 1PR2A 3U4MA 4DC0A 5IX8A 2OCYC 3UQYS 3ZQ6A 5EL0A 3HKEA 1FFCA 2QQFA 4E7OA 4PQEA 1P81A 1QE0A 1WXDA 2I2DA 2R8OA 2MSWA 3BMOB 4RORA 3F6CA 1Y5MA 4KAXA 3RUCA 3UAYA 5BSFA 1XMQB 2BEUA 3ZHZA 2BF7A 5H82A 5MFPA 1EVKA 4S1WA 4B17A 1N0HA 1TKCA 4OXRA 4A82A 2ZB8A 5AW4A 4UE6A 1GL7A 1BX1A 1WX1A 2H00A 1XD9A 2DTDA 1P9RA 3HFRA 3NGXA 3PFGA 4GQAA 4DG5A 1OYVA 2E6KA 2C5LA 3BXPA 4IUCS 5B3JA 1X8XA 4NABA 4PG5A 3WQQA 4AY5A 1P2SA 1DO8A 2JJMA 3TGPA 3PFWO 4DADA 2HFKA 1OROA 2WTNA 3C5HA 3SXUA 5CDTA 2IY8A 2O8FB 2WUVA 3K0EA 2Z2YA 5DGCA 3UBMA 4EMUA 5TJHA 4U1RA 1MHPA 4KGZA 4AM8A 1K8QA 4LOHA 3NVMB 2NO0A 4BV2A 2WM8A 4X6XA 1VFPA 2DKOA 2QRMA 4RC9A 1Q2XA 3A0UA 2VSFA 3CM0A 3TD2A 2SECE 4BFZA 4AAYA 3KQVA 2EWMA 2CXHA 4OJKA 4QOGA 1TC1A 3BRCA 2O7NA 3E22A 4NDNE 1Z5PA 2NOAA 4PBTA 2BF4A 1DLIA 2GN4A 5COAA 4UPVA 1CRPA 4QHYA 4AKHA 1I2ZA 5FUQA 3JSAA 1H5UA 3EXIB 3GNSA 3FSRA 4ZTBA 1XTJA 4C4RA 3UNXA 3N0VA 2CFIA 1NBOA 2CDAA 3F5DA 2D2EA 2C88A 3I39X 4C6TB 2I1QA 2WM3A 4KITB 5JVDA 1HFKA 1OCEA 3M6IA 2PGIA 2NAPA 3LUJA 1ZA2A 2BHRA 2Z9BA 3AHIA 1BC5A 5LXTB 1P9OA 3B6KA 3O3OB 5CGQB 2MINB 3CLUC 1TEHA 3PVSA 4LYAA 3UUFA 2Y93A 5FA6A 1A7AA 4X9XA 2GM9A 4KN8A 4EUEA 3BFKA 4ZT4A 1TUEA 2A5FA 2B3DA 3AFMA 3DE7X 1OWPA 4Y6OA 4XM1A 2OCAA 1MTOA 3MAAC 1WO8A 3KWFA 4N48A 3DMYA 3FUUA 4XJSA 1RXSA 3ENQA 3HFSA 4W8HA 5HKAA 1ZD4A 2I76A 2FMIA 3HLTA 3OEWA 4PYNA 3B1KA 4G1BA 2QORA 1M2KA 4QBIA 2G06A 1HFWA 2QX9A 4JOQA 4F21A 2VWHA 1LLUA 1Z2DA 2FP4A 2ZBUA 3IKJA 4BAUA 1W36D 2BKVA 4TS4A 1CQPA 4YRCA 1JDPA 3TKAA 3GUVA 4NCHA 5HGXA 1MGPA 4XX0B 2MSKA 4B3RB 2FV8A 3U40A 1X13A 3OQBA 4WESA 5TQ2A 4DWVA 2VZ0A 4DLNA 1E2JA 2CHFA 3SYRA 3KFLA 3VKHA 2XIJA 4BO2A 3RTBA 2NTEA 1YCGA 3DBIA 3OD5A 3VC2A 3BMQB 4Z1OA 1PEDA 1S2LA 2L42A 4RABA 4B4KA 4YRKA 3MB5A 1DWPA 2PQMA 1E2DA 3GH1A 3JQRA 3DXXA 3LFHA 3L4JA 3CG4A 4NF2A 4O0LA 4IGAA 1P4JA 4UBIA 1IBMB 3RBAA 3WV5A 3RVMA 3HP7A 2NXNA 3N6XA 2JD1A 3BM5A 4GGOA 4H1TA 3UAXA 1MJHA 3ZXUB 2YYAA 2EQAA 4X8HA 1TE2A 4PX2A 5F9HA 1KNXA 4ZQHA 2XB9A 5ALZA 2JEYA 4QXOA 3WGOA 4RGYA 3WVNA 1XYVA 4DRYA 1UFKA 3FG9A 3N8KA 2IV2X 1L7DA 3F8WA 3NNNA 3ZJVA 1BFUA 3KJNA 1MJ5A 2AMVA 2FEWB 3E3OA 4O2BF 4DA0A 1GL6A 1N8SA 4KAAA 1FFHA 4FEGA 4BFCA 1P9WA 1OLUB 1I94B 1Y6JA 4JLVA 5F76A 3QOFA 3PNPA 1FNDA 5CURA 3Q3IA 3U6KA 3RU9A 1M2VA 3R41A 4MULA 1IG3A 3NATA 2WHQA 1LI5A 3DSRA 3ZCPA 4JIMA 4D6YA 3AKZA 4LY9A 3EVTA 4RJJA 1NKSA 2ZIUB 3WWYA 4J1TC 3Q40A 1TECE 4Z1MA 2BJVA 3HI6A 1PLJA 1AKRA 2GZMA 4RZ2A 2E5FA 2AQKA 3CGWA 4MVWA 1R0YA 1HEUA 3D1LA 3R7WA 1YZNA 4XSGA 2FZ4A 3HB0A 2XBUA 4KUHA 1JKJB 4R9VA 1VIYA 4ZO6A 1MB9A 3O93A 2PL9A 4CM5A 3RQSA 2G3YA 3GLUA 1YDGA 2H8GA 2QPOA 1M2HA 1O8CA 2HF8A 2VLBA 3WMWA 1ZH8A 2RCNA 4MUAA 1R5NA 3RROA 4AMYA 5JY6A 4MHTA 1T2CA 1XTZA 2D7JA 4ZI3A 1TKBA 2NXCA 4HUTA 3G8YA 3V7UA 4FE4A 2ZYUX 1P2DA 1THTA 3EEFA 2IU0A 2JHGA 1CUUA 2WSMA 2QMOA 4HEA1 3ST7A 4BLWA 2RHJA 4NBNA 3AR8A 5LOVA 1TU3A 3KHSA 2H2FA 4AJLA 3PHHA 4LXXA 2VQEB 4Z0NA 4LOAA 1IIRA 3KL2A 4PG7A 3QNMA 5AI8A 3TRHA 1M8GA 4G97A 1JF8A 1LJ8A 1QZ3A 5AXCA 1NN1A 3B60A 3EWSA 2C0CA 3A14A 4V03A 4TYWA 2AC4A 2O2EA 1XRNA 2QUAA 3GLHA 4QTZA 1GZ6A 1TEXA 4FN5A 2NXJA 1A96A 1EDBA 3DYVA 2VYFA 4NPCA 4LCJA 3K1JA 2QZJA 3UMSA 4DZRA 4Q21A 1XRLA 2VHXA 1YNOA 4J1TA 3ZD8A 1CUJA 4HVAA 4PW0A 5BSKA 5TGDA 1N77A 2YRFA 3QU2A 2IEYA 1MB4A 3IPYA 4I6EA 1X7XA 3LIPA 1FQWA 3TTWA 1P2UA 5A71A 2OV3A 1XDDA 3WO0A 3K5WA 1CY7A 3L4EA 4J1SA 5BRNA 5C7YA 5A3VA 5L3SA 4QREA 3FPSA 5JE8A 3VR3D 3BDIA 3CZMA 1QOPB 4KIJA 1S1CA 2RGBA 4GECA 4WGGA 4X1YB 3ZD7A 1K7YA 3S6JA 2BI4A 1KJ9A 4QDJA 2JHFA 4IYRA 2OFOA 3N8HA 4Q18A 5CLFA 4PRZA 3EVDA 1C30B 5IRCD 4OLAA 3MBKA 3EDQA 2V6MA 2CNOA 5DDIP 5CYOA 2J31A 4R01A 1NMQA 1QVZA 3R0ZA 4E2XA 1H0KA 5KSWB 1UBHS 2HMUA 2C78A 4IZHA 2R8RA 3NC1C 4LGYA 5E7QA 3UMGA 5KWIA 2D13A 3S68A 5LUBA 3W9SA 3KU1A 3AM5A 3S29A 4CM4B 3P2YA 3G68A 4QUHA 3ORQA 1KI6B 4IP0A 3MK31 1X7WB 4QNMA 3MLEA 4UEWA 3LQ2A 9ATCA 4M22A 5K0TA 1RCUA 1RJWA 2W8BA 4Y6QA 1ZHFA 2FR1A 4B40A 4QBGB 1D9ZA 5IK2D 1W8DA 1JIXA 5IT4A 3FHOA 3P9XA 2ID9A 1H1LA 1NXTA 4E5VA 3KKPA 2Z2ZA 3G5AA 2OK8A 2G63A 5AI6A 5EJ9A 3L0BA 1HBJA 2KHZA 5F3WB 3LO8A 3QLUC 4Q4CA 1A1VA 2MSDB 4D4IA 4E31A 5TQ0B 3S2SA 1XKQA 5KSOA 1L4BA 4ZGBA 1FK8A 1H0RA 3VDRA 3ZLUA 4XIJA 1FB5A 3IP7A 1QC5B 1TM7E 2QRQA 4PX9A 5KWEA 1GHTA 3UWMA 2EEPA 3HKCA 5F12A 4HGNA 1PZNA 2AD5A 2NUPB 3TKLA 4BV9A 4D4KA 4BAGA 1OYWA 4KWIA 4P7KA 1OHHD 2GAFA 5AOAA 2VCHA 1A7UA 2Z98A 4IDBA 1A95A 2RI1A 4MWSA 4Q1BA 3DQZA 3T7AA 5M04A 1FRQA 4MR7B 4B34A 1GV1A 1PW5A 2HAEA 2YWRA 3EBOA 6REQA 2X19A 5AVVA 1NRJB 4GI2A 1HDOA 5IVHA 3ZCSA 1JFFA 1KVTA 5CAEB 3TW8A 1I0ZA 5CLQA 3ESZA 4RJKA 1QFXA 4X3CA 1ZOLA 1IEWA 4GMKA 5HF9A 2I3GA 5BW8A 4C9BA 1SUAA 4DIEA 4INZA 1GUBA 2CVZA 2W6JD 2QTFA 4C88A 4JC0A 3KK0A 3CPJB 4BZPA 1KI9A 2QRJA 1GL3A 2Z3VA 2ZU0C 3M6WA 1N1EA 2PEYA 1ZL2A 4LC9A 2WTUA 3MGBA 3BX1A 3I1FA 3EC2A 4UD6A 1M66A 5TEWA 4GLFA 5IJ0B 1TYDE 4JJ6A 1JDSA 3QLVC 1ABBA 4N39A 1BHQ1 1UM8A 4PFJA 1DV2A 4B4WA 1X19A 2JEZA 2B36A 3MPOA 1RABA 3R76A 1T2VA 5C5IA 2MSNA 3QLUA 3W1WA 1EVEA 3BTOA 4UUMA 5IC4A 4YRMA 2NG1A 3MMZA 3TSOA 3C4QA 2OC9A 4PWZA 4ARAA 1SU7A 3C39A 1SC4A 2JEOA 4ZVUA 3S8MA 5BSGA 2ONKA 1GRQA 1HI9A 5GONB 1T4GA 3AKCA 3LX5A 2Y1XA 4PCAA 1KYZA 4W82A 4JLUA 4C0LA 4IAOA 2RJOA 2A9KA 4M37A 4YAWA 2M2IA 1NSFA 1DIAA 2FG5A 4CTNA 4MPPA 3TOCA 1MMFB 1YQWA 1I1NA 2KPOA 2PRSA 2VUSA 4HQRA 4FFWA 2FJUA 5FT9A 3V32A 2PUJA 1U4NA 1G21B 1PEKE 1QIKA 3H18A 4NCXA 4NE7A 2UYOA 3PPIA 4TV8A 2OGWA 3RJTA 2INGX 4PAQA 4UBMA 2NVUB 4C89A 4COOA 5HIAA 4N6OA 2X40A 3TRKA 5EJMA 1F6DA 3I4LA 4W5JA 4CLEA 3SQLA 2R1UA 1XPOA 3ZGZA 1S3IA 4K6OA 1UQTA 5T7BA 1YB6A 4C05A 2W2VA 2X7JA 3TINA 1N3LA 4Y6RA 3L0SA 1YR8A 2IYAA 2ZRFA 1U2QA 2I3BA 3BXHA 2ORIA 3HCOA 3IQFA 3ILHA 4KWEA 4IM7A 1ULSA 3K8YA 4X8LA 1H22A 1WL8A 1ISMA 4O2RA 4XUCA 1N8TA 3THXA 3CX8A 5K2OA 5J59A 3GHHA 2OO5C 3L49A 3IHWA 4N03A 4XRGA 3LQ1A 2A0YA 3B12A 3M1AA 3SSOA 2D7DA 3FETA 3AVWA 2AOXA 3LFTA 1I3MA 3UVEA 3MB8A 1ZRNA 5I47A 1N6NA 5LU8A 1VP9A 4DNOA 3OCUA 4ZMRA 4U7WA 3RSGA 3H3XA 5AWFC 1K66A 2P6RA 1NUHA 4Z7JA 4GDMA 4KQHA 4ILEA 3WNBA 1KVRA 2OPBA 2VJMA 1NV8A 1E89A 3GCDA 3IPLA 4TL8A 4BC1A 2W6PA 4AULA 3CZQA 3Q3JB 4KYVA 1UMDA 4N5HX 4WBNF 1NGSA 2YNMC 3N2ZB 5K20A 1VSBA 2HOQA 2IJGX 1A9PA 4R2XA 5FULA 1FTSA 3EVZA 1D4FA 1Q0SA 3KZNA 3L6RA 3NKVA 4RPLA 3T1OA 2BC9A 5HMMA 5KTOA 1Y9ZA 4QATA 1RTTA 4P0QB 1ZRHA 2P4HX 4JGGA 4DJAA 3OU7A 3SVTA 2RI0A 3RS3A 1G6Q1 1OU0A 4EMBA 5BR8B 1JRLA 1QR2A 4Q1CA 1MAHA 3TEFA 4OLBA 1NFFA 4IIHA 2G9NA 2WQ7A 3BIWA 3L18A 1Z3IX 1UKVY 1NM5C 3DM9B 2IYSA 4FT4A 4RETA 4DVJA 2GJKA 1ZQ9A 2VZ9A 2EKBA 2OLEA 3HJCA 1WY5A 5H68A 4BKOA 3LPNA 4G84A 3AQIA 5KQLA 4MAAA 1OBOA 3AJ8A 4R8RA 2ZDQA 1UL1X 3ADKA 3B9RA 2VJQA 3U4CA 1PJ8A 1TCAA 3C1AA 3ELBA 1AHHA 2OO5A 5BV2P 1FSSA 4D79A 5K05A 5HTKA 5DYTA 1I9GA 4WN9A 1DBPA 2W2XA 4IVNA 4JJAA 5TLSA 2H2AA 3MZ0A 3IAUA 4YASA 3TAUA 5D3QA 1CERA 2ZBVA 4G5HA 1FS6A 4NATA 4PZDA 4TKUA 3RHSA 3SZOA 1P1CA 4RA6B 1E6EA 1E66A 1JJVA 1F8GA 1GLVA 2X0RA 4BQNA 1AQLA 1UK8A 4I0WB 4GPIB 4WK2B 5A4IS 2IIBA 2OMEA 4FDTA 2YNMA 4X20A 1MPTA 4CGYA 4YRRA 4WZBA 2GS9A 2QENA 1P0QA 1KY3A 2H8KA 2TRSB 2ZBRA 4HUQB 4JITA 2WWIA 4LCBA 4J9VA 4MVJF 4QLOA 4ZARA 3KP1A 2ZT5A 4M1TA 4CFYA 1VHQA 4J49A 4ND8B 3OOJA 2L69A 3T7IA 4RPJA 2HJVA 1U8CB 3RAEC 5BMVF 2GCNA 1TVMA 4IWYA 1VPTA 1JYFA 4X5OA 4OJMX 1PGQA 2C9MA 4BO8A 1UT6A 2IH5A 1LVGA 2QR3A 2WIKA 1Y1RA 5JTTA 5K09A 5E2IA 4AY6A 1GU1A 2J41A 1NM5A 3IIKA 3BL5A 4MV5A 2OXCA 3LS2A 1RQPA 1KKMA 2REQA 3DPUA 2RHOA 1G64A 3C5EA 4F3KA 5JATA 2D1SA 2J7PA 3NTOA 4H3HB 1R7RA 2HWUA 5CTAA 4MW7A 1A2BA 1HMPA 4KUGA 1KJ8A 1KYXA 4S1VA 4EY5A 1S3FA 1ZNXA 3B82A 4JEIA 3LVRE 3V2IA 4MWTA 1NBMD 1N2CB 3QVXA 4Q03A 4ZXFA 3KJZA 4YQYA 4IRUB 4JDPA 4JI6B 4DLBA 5KBYA 3R9WA 2Z2JA 1AS3A 3E9DA 3QXHA 4WOCA 5E2AA 1X7YA 4YMGA 1TRKA 4Z5XA 4PV7A 4YLYA 3NTXA 3PFKA 1K08A 1K92A 2A1UA 1EVIA 2FWAA 2EAUA 2G80A 4UBKA 5F51A 3SR0A 3ZGVA 1TZCA 2AS0A 1JDUA 3GMIA 4HG2A 4OH1A 2WHPB 3AEUB 4YJ2B 3RVSA 1THMA 5CLGA 1O0CA 3TLGA 4BQQA 1E69A 2G1AA 1KZ6A 2X5JO 3EUAA 3TQOA 1G2PA 3AUFA 4QDTA 4BC0A 4FK8A 1WMAA 1B6SA 3WL3A 2R48A 3KT0A 4EJMA 4HT3B 5AW8A 2IA5A 2BGNA 4BNJA 2CDRA 2WTAA 3ETJA 1TM2A 1NTOA 4FZRA 3VPSA 4BBJA 2PPVA 2BFCA 1V6CA 4HI0E 1CF9A 3L46A 5IABA 3F73A 3W5DA 2IP2A 4Z4GA 3C1TA 3LCMA 1G16A 5A5FA 4DV6B 3DEAA 1P5JA 1YO6A 3WHIA 2AD1A 3AIKA 5HCUA 3ICWA 3W4JA 3S1AA 3IYLW 1KPHA 1KYYA 4TWRA 2QIPA 4DAEA 5JCZA 2WYWA 4WZAB 1DEOA 4KQMA 1R66A 3PICA 1IY0A 1JHDA 4JP3A 3UHPA 4S1NA 4YFYA 3RSHA 5CFQA 3N70A 1GQOA 1O6CA 1ATZA 4PE5B 4L2IA 4Y8VA 4C7KA 5IWAB 4A15A 2FA9A 4EELA 1H8HA 1C7JA 3AG6A 1W34A 1KH3A 3GEHA 3OI7A 4RDHA 4RY9A 5B4UA 4N0MA 3VYUB 1X7ZA 3UHOA 3IEMA 3CB2A 3TN7A 3UKJA 2HIMA 3IS3A 2WWRA 1F3OA 2ANCA 2H4ZA 2FQ1A 1E0DA 2O8CA 3DNFA 4IDGA 1K97A 4UCXA 1WDMA 2B98A 1CJBA 2W2PA 2IWHA 2XQIA 4DDHA 4JU9A 1G8FA 5BYKA 5D5PA 4DGSA 4UHJA 3WXBA 2CNDA 5I7OA 3LOUA 1GR1A 4KXWA 2Z1DA 2IIVA 4G07A 4V2IA 4TUYA 3H87A 3ZS9A 1SU4A 1RJGA 4RHUA 4KIFA 4X6LA 3AR7A 1PU2A 3DL0A 4AKEA 3QBDA 3A0RB 1ODIA 4LHWA 3OZFA 3RPEA 4YCMA 3MMPA 4P7BA 4ZQIA 3L77A 5IUJC 1W5FA 2ZS8A 4IRMA 2YVUA 1HE3A 3D4NA 4M87A 3ZI4A 3O75A 1GGHA 5EHNA 4FI3C 4OX9B 4B0PA 2F62A 1YK0A 5IAOA 3F7OA 3S8EA 3Q3EA 4ENQA 5A06A 2VTKA 4AU1A 4HDKB 3T7KA 2ZVQX 4WEQA 3HDVA 3AQ4A 1JT2A 2I03A 4OHPA 4QEZA 2PS1A 5T67A 1WDKA 2HD4A 3OP4A 4QRIA 4ARBA 1P3DA 1GQYA 5HJEA 1EXDA 4WXYB 3MD9A 2P62A 1PFVA 5FWDA 4C06A 2JFUA 5HKBA 3P9RA 3SBOA 4HWTA 2GBCA 1ZD2P 4HDAA 3QTLA 1WUIS 3PUXA 2PH1A 4JELA 2H57A 1B4DA 4UW9A 4NCJA 2ZXUA 1OFUA 2OWDA 2YMMA 2X8JA 2W93A 4JI5B 1XZ8A 1WHSB 4ND7A 1E1QA 5HK8A 3NYRA 3TTYA 4BKUA 4C5AA 1XTBA 3SNHA 5JWRA 4HAUA 1SG0A 1BXGB 1T1RA 3M1IA 3AESB 5IWCA 2C2GA 2ZRIA 3E15A 2GGSA 2G36A 3SHQA 2IUEA 1OX4A 1PR9A 3CRNA 3TJRA 4Q15A 3LY7A 2FEPA 3M89A 4NPHA 1ZGZA 1UPAA 2ZAOA 5JYBA 5CT8A 4YRAA 1KJYA 2ZLBA 1OUMA 1UAAA 3IE1A 3H5WA 4O1IA 4DLYA 5HEKA 4IDQA 1WCIA 5L3QB 3WYAA 4O4LF 1KI2A 3KPVA 1AHPA 3F8SA 1BSVA 1I10A 1EJ2A 3S1SA 3UMVA 5JADA 2FEOA 4BZXA 1N25A 5BV8A 1Z4LA 2QZZA 4GYWA 4FOSA 1VBMA 5CGZA 1RSZA 1Z6QA 2Y3IA 3K70B 3QJ5A 2Q6TA 5FOUA 5BNWA 2Z5LA 3IURA 3QFSA 4MVJP 2IVZA 2A1IA 1YQUA 4IINA 5K51A 4JL5A 1AKEA 1BA3A 1CDZA 1DEHA 1SUIA 3AUUA 4DRXB 3D5EA 3K0FB 3DAOA 2P3LA 2OLJA 4JHXA 4KUEA 2ZSKA 3FRIA 1GUFA 5FUYA 1NQXA 5IULC 1W94A 1T2NA 4D4MA 4FGKA 1UBTS 4JMPA 1OYYA 2GK4A 1KS9A 4K3UA 4AJNA 1F5SA 4NZMA 4KQCA 4KW7A 2XZDA 1JNXX 3AONB 4HO1X 5A0VA 4IIVA 3IMGA 1RPAA 1WSDA 2HK6A 2XVZA 3DXZA 3HB1A 3P71T 2HA2A 5J2UA 2VAPA 2WTXA 3EBPA 5ARBA 2NSYA 4KRFA 1JPUA 5JD5A 4BWVA 3IA7A 2B25A 4NXNB 3QVVA 4LE0A 2P4UA 3U7EB 1CJSA 3GX1A 5HBGA 1DAKA 2HLDA 4YRLA 4DMUB 5IXYA 5EWMB 5HFNA 3TF5A 3QE9Y 1PNTA 1JV2B 4IJ5A 4A7PA 1J6UA 1NU6A 2IDKA 5TE9A 3T7RA 1T0IA 2ODAA 1JVBA 2PBFA 1RMTA 1ZJZA 2GEUA 4U9UA 5F52A 3KYCB 2WUDA 3ICCA 4H7PA 4W7IA 5EJGA 3UC5A 2ZSJA 4DMRA 5AJVB 2IUUA 3LDUA 5A03A 3OEHD 1JDTA 3SMQA 4UXIA 4E08A 3NTVA 5FPYA 1BDHA 4FDVA 4NBLA 1ZVQA 1ARZA 1ORDA 3FA2A 2VP6A 3G9QA 4OATA 1E9FA 2FPGA 5IBRA 1I2DA 4ROSA 4JLMA 1XE3A 3X3HA 3MINA 5CA1F 4NEHB 3ZUGA 1TJ3A 4CPDA 1MP0A 3ZHSA 3EIWA 3Q8XB 4WCVA 2VDQB 1IONA 3F46A 3SF0A 3DYIA 3CUTA 4G1UC 2VZ8A 2W6MA 4IFBA 5JXHA 2X86A 4NENB 1SK9A 4QELA 3ZDYB 2P9ZA 3H9JA 3PNQA 1ACLA 1XLVA 1C4WA 1NP7A 1Z5ZA 3W5AA 4LYJA 3PR2B 4BO5A 3KSMA 5ER6A 3SQOA 1E64A 1NMSA 3QFRA 4NC9A 1Z8FA 3ZCRA 1P1HA 3IO3A 3IRUA 1D1PA 4CQMB 1T9ZA 3BEDA 2C58A 2DULA 3F1KA 5DOZA 3GEGA 1YQQA 3C8MA 3QZUA 3A26A 4YRQA 1ZJYA 2H7CA 2RGXA 4A5OA 4ATNA 1SXQA 5BUQA 4EA6A 2BKUA 3IIMA 4L3VA 4CFSA 5F3RA 2Z5VA 3P0JA 1GADO 2EZTA 4FR5A 1LW6E 2C5GA 3MWEB 1VJ1A 2PK3A 3SKYA 3F3KA 1U04A 1Q50A 4OG2A 2P90A 2OA0A 4IHJA 4B3BA 5E1DA 5CA0F 2CV1A 4R1TA 1ISJA 1CUGA 4WA7A 5H4GA 1S2GA 3H4MA 2NN3C 3QENA 1SUWA 3R7BA 2RHTA 2RJNA 4GZLA 1T2DA 4UOQA 3Q8MA 4PO8A 1BQEA 721PA 4N8EA 4QVGA 3PGKA 4OPMA 4CR7A 4TRRA 1ETUA 3Q9SA 4HX2A 2ZAIA 3E5HA 1ECBA 3KTFA 3OO0A 1TJ5A 4DSTA 2P68A 3IJRA 2PJDA 3QWHA 3KSRA 3KWMA 1VLVA 3W8EA 3RUDA 3Q6NA 1MNAA 1U80A 3D81A 3GT3A 3NIFB 1O4WA 3MAGA 4UNRA 2PKQP 3ZQKA 4KOAA 3FLBA 1XTSA 1E96A 5I6DA 2NVOA 4X45A 4P9NA 3K0SA 2ERXA 2CLLB 3H6HA 5CJPA 3A6LA 1D4ZA 5GM2A 5JBIA 3G13A 2CV0A 1ISSA 1T6YA 3CR7A 4PEVA 2A0KA 3DMTC 3PUYA 4FNGA 1D0IA 4RMIA 4Y2YA 2VYNA 4F97A 3EX7C 2C7VA 2HHHB 2POQX 2ZTUA 2GHTA 1JMYA 4GOLD 1ZAKA 1JMVA 1NASA 3Q9UA 4HNHA 4KH0A 4R8LA 4QEDA 5IH3A 1GDDA 1LSOA 3V9PA 3E2MA 4OU5A 1UJ2A 2BFFB 2CMHA 3EVBA 4JN6B 3II6X 1C4OA 2HRRA 4X7BA 4YIKA 1B0UA 1MA3A 1EX7A 4K05A 4EG5A 4KO2S 4M0LA 5EXEA 4YRIA 1ZJ5A 1LTKA 4XWWA 1XXHA 3K53A 4W9NC 3SBEA 4ASUA 4BNHA 3TUZC 4RK1A 4PANA 2PT6A 2OG2A 4N7BA 2DR0A 1UBCA 3JWPA 3IUQA 3EHEA 4OCZA 3O7MA 3TCNA 3NHZA 3OQMA 1W5TA 5D1NA 2XCIA 1W5SA 3N0XA 1UEIA 2ZIZA 1G6KA 1SU6A 2OYRA 1OU4A 1L4FA 3LP8A 3FTCA 3NHAA 4MAFA 4Q47A 1YWGO 2WTBA 2XOKA 2H7XA 2WSYB 5LYJA 2FW9A 3LCJA 3LPLA 1LTQA 1SB9A 4BO9A 2XUOA 4FDMA 3BHNA 4TTJA 1JA1A 2OFPA 5CT4A 1H5QA 2YWEA 1FFBA 3ODGA 2H4JA 1GITA 1P5RA 3NTRA 2WT9A 4RTPA 1CDEA 1TTHA 3OE7D 3DDCA 1ZCFA 4QQFA 1XZFA 4WNAA 4JSRA 5CDSA 4E46A 3A2MA 1FXSA 2EX1A 2VNSA 4BY9E 1JJIA 1P62B 2QRNA 2J07A 1AKMA 1B16A 1IQPA 1UK7A 1YIOA 3B6JA 1WXIA 3DE6X 3JQQA 5ARCA 4AWXA 5LLTA 4DSNA 2DVMA 3RU7A 4UM9B 4ND3A 4CL2A 2DEUA 1N2OA 3ZWPA 1PYGA 4DLXA 4Q93A 3UMBA 4E51A 1F06A 3DMTA 2IYTA 1WIWA 1DKLA 4D74A 4HXFB 1Z7YA 2NZ8A 4PFQA 1SHZA 2D8AA 1A2QA 4EO7A 3IXMA 4JUAA 3BG5A 2CXPA 1FU7A 4HEHA 4LF8B 1BMFD 1H6CA 3BQ9A 4RPHA 1QSGA 4WKOA 5AKXA 2BD0A 1W581 3T1VA 2A92A 2JIZA 3FWPA 2HUPA 4ZVKA 3ME5A 2FZKA 1DL5A 3D4LA 5KSZA 3TAXA 1F5NA 1JHUA 3ZPXA 2VHUA 3CNEA 1KXZA 4AXXA 4BJ3A 2Q3BA 4W9NA 3IMFA 5AVSA 2FSUA 4QNRA 1YGYA 3HXTA 1RQ7A 1Z73A 3ILVA 3UICA 1ZR4A 3VO9A 4C0KA 3QE4A 4V0KA 1QBGA 2UV8A 1EUQA 3HCDA 2GHIA 5G1NA 4EKGA 3NYQA 1UWCA 4XCQA 1ACJA 4FHEA 2I2WA 3SE0A 2FDCA 2NO4A 3VGJA 1A4RA 1IPEA 1FXWF 1YZFA 4DA4A 4BGDA 1KSFX 1CY4A 1SBIA 2G8NA 2RD2A 1GGVA 4MSUA 3C5WP 4INAA 3MGCA 3L2OB 4RO0A 2JAUA 1QQ6A 4MCJA 1SUBA 5KYYB 4QODA 3IX7A 3AB8A 4NV0A 3IQZA 3S7ZA 1VI5A 2JATA 3WGNA 3WLOA 2FOLA 4R9SA 1G4HA 3AHGA 3DT9A 3EQ9A 2FB9A 2XTMA 3Q5GA 4P92A 5IDVA 3W78A 4NYJR 3KKZA 621PA 1NF9A 1PR3A 1JA9A 2JFBA 4H77A 1U0JA 2P4EA 3N76A 5JH7F 1OB2A 3JS5A 4PZCA 4B33A 1WABA 3GROA 1OJLA 1E2GA 2IYWA 5EHIA 5HIJA 4C0WA 4QUAA 1RRGA 5MDHA 1P5FA 1PUIA 2HRBA 1QU2A 2RHWA 1WULS 3IA2A 3KQWA 3GG9A 2PL3A 1CZUA 1UBKS 4NYMR 1BDBA 3RVJA 3A6KA 4JT2A 2WKQA 4F96A 5CDHA 4P33A 4MW4A 5F9FA 2RAVA 4UZFA 2F48A 2YV1A 2QAGC 4RD6A 1G5HA 4UNIA 3DZHA 1KI3A 2PTHA 3D8TA 1KOFA 1B26A 4NL4H 3C98A 5ES3A 1GUYA 5I9IA 1B3RA 5A6SA 2XNJA 3OPXA 1J20A 3DCJA 1XHFA 4M7PA 2C8VA 2WYIA 1KZ7B 2ZANA 1C7EA 3N0WA 4KCGA 4ZAVA 3UJAA 4BWYA 5IUNC 5E8JA 5I4IA 3VX3A 3BF8A 2PSHA 3AKYA 1QWOA 1KZGB 3K5IA 4Q02A 1QRSA 2HL6A 1L5YA 2OL4A 3GDGA 4HGYA 2F43A 4KQFA 1BEZA 1MD9A 2FX3A 3U9TA 2HA6A 2OY0A 2WICA 3SQDA 2VAMA 1JDJA 1QQBA 3RYCA 1PR5A 2P6NA 3U3MA 4F6CA 4HDNB 3O5AA 5IJ9B 4J16C 3G6KA 5FUWA 3U6BA 3E9CA 3QUCA 5DNDA 1D4OA 1TMKA 1F60A 1GSHA 1SQ5A 1TMOA 2AJCA 4CW7A 1JEQB 4KQXA 3GFQA 1T0UA 2ZJ5A 2J6CA 1SWVA 5JO0A 1L5HB 2WINI 3UYLA 2VJPA 1T3HA 4S2UA 2JGDA 5LA6B 1TQ8A 3BRSA 4HF7A 2GMWA 1AGNA 2JCSA 2H5EA 2Y1FA 3MEQA 3P19A 4F8EA 2VYCA 4U8GA 3PJFA 1Q20A 2R2AA 2WJ6A 1Y6QA 2XITA 2WE8A 1S9DA 1Y63A 1YZUA 2P3SA 3B78A 3Q11A 5FPKA 3E2IA 2NAFA 3FJYA 1CJTC 1GFSA 3RJ9A 4Z53A 4RENA 4HDCA 3PRYA 1WLYA 2HXYA 2QAGA 1SVMA 4HMOA 1L4KA 3FCUB 4BDSA 4EUSA 2D0PB 2DTEA 4WZ6A 3RC3A 3HWSA 2DHEA 3GOHA 2IELA 4ISBA 1FFSA 4IGFA 4OAPA 1MABB 1LNSA 4HH3C 1QYXA 4LTNA 3IE0A 1NI4A 3DVAA 2I9KA 3ZZ0A 1HQKA 2WNHA 3FIUA 1K1EA 3MD0A 3U0VA 5KJ1A 2GEBA 1J2EA 1W1WA 3BXXA 1W0KA 2WUFA 3ICOA 3WGKA 1SR8A 2R8ZA 5CLJA 4RTOA 4R5MA 4PU0A 5B1HA 1UMKA 3TOVA 3SIWA 1IUPA 2REOA 4J16A 2WIFA 3VAAA 2WYVA 1V8DA 2C0PA 2FFRA 2WYHA 3VKWA 4CF4A 4YAEA 2IHBA 1UWKA 3KLBA 4ZQEA 4BFXA 1K7CA 4BO0A 3EGCA 3OKAA 1OJ7A 3PITA 5KX5B 1A9RA 2XMPA 2JFFA 2EHJA 4M9XA 3U3ZA 1ZW6A 4D3ZA 1GPBA 1Y8RA 1FJHA 1CUIA 1NU8A 1V3UA 4A2CA 5C5DA 1UBNA 1GTJ1 3NH9A 2CZCA 4XDYA 3VPGA 3ZWWA 4IHAA 4OQ4A 4DDKA 2PUFA 3AVUA 2OO3A 1UQUA 4E5NA 2UUPA 1Z0IA 4PM4A 2QDXA 4G5YA 5E4JA 1B0AA 3UFXB 4A6DA 4WFKA 3ONNA 1X80A 4IIFA 4RDCA 5LZ2A 4FHZA 2AEEA 3AUAA 1MC5A 1UKYA 2G0NA 3EGXA 1L4UA 1K7EB 4XGQA 3VO8A 5JECA 3N7AA 2XMQA 5EE9A 1G5QA 3ZDFA 3ZCVA 2CF6A 5KHLB 2QIOA 3H1AA 4F9EA 1OIWA 4DQLA 2PKCA 4CMGA 2R65A 4B3IA 4HS9A 7REQB 1GPDG 2W00A 1P2FA 1XQ6A 2P3OA 5AKEA 2X1LA 4PG6A 1XP8A 3WGUA 3X1XA 1L4HA 2VEDA 2ZSEA 4JXJA 3R7DA 4BZWA 1W88B 2JGKA 1QG4A 3C48A 3PEVA 4QD3A 5HE9A 1U1IA 1GTRA 1H3EA 2HQOA 3NBUA 5EIHA 1E8DA 2J4FA 3A05A 3MS4A 3WRWA 2ZE5A 1HDGO 2IHJA 3QHQA 4CIWA 1TVCA 4TQAA 3LWNA 2ZJ8A 4BFYA 4DQ0A 5DHTA 3ZX4A 3WLHA 2YZ7A 4QGGA 2K2WA 1J0DA 2XMGA 2ROQA 2F90A 1PR0A 1DKRA 1NW5A 2GA8A 2FETA 3D2BA 4FKBA 1QNLA 2UZ3A 3LZCA 1ZKDA 4ARZA 1F3LA 2LXNA 4Q4JA 5CFPA 2B1GA 3IB6A 1NATA 2P78A 2R66A 2C9DA 3FZYA 1VB5A 3QEOA 3HBMA 4GSYA 1JG6A 2ZUVA 1DWQA 2GAAA 2HA3A 5LB2A 4YHHB 3O90A 1IZ8A 5LKAA 3A9WA 3QMPA 1OT3A 4Y0VA 3UH0A 4M4SA 4GMFA 1JIVA 3OA2A 2Z5FA 3PGVA 5AM5A 3WZMA 4Z4IA 1WD5A 1WETA 4G5QA 3CZCA 4J0EA 4BECA 3VYSB 3TRDA 4FILA 4JLAA 3DBHA 5E3JA 1SVLA 2KM1A 1EM8A 2VHYA 3CVJA 4MV7A 4MRRA 5ITZA 4RA9B 1U63A 3QJYA 2DBYA 2HV8A 2VYQA 2YN2A 1UXIA 4FE7A 3HCAA 3I1YA 3FY4A 5DEIA 3K6SA 3NGMA 2DJIA 1XZCA 1KI4A 1ZUWA 1VE6A 2R4TA 4IIDA 4NOJA 4YECA 4BGEA 2N47A 3IP8A 3MUOA 2J5QA 4KHPB 2HPAA 2IKSA 3RIGA 2PYIA 3G9ZA 4HK4A 5BWOA 3KC2A 2C83A 3E9ZA 2J0SA 1ZMRA 1ETHA 5EHQA 4UU0A 3AW8A 1Z39A 3E27A 4BUCA 3MM4A 2FPPA 2WUGA 1E3TA 1WVIA 4KE6A 1J5PA 3H2YA 1WZEA 3U4HA 4PLWA 4BP8A 4ZANA 4CODB 3HY4A 2QZ9A 3T38A 2QMYA 1WDLA 4AF6A 4AYWA 4J2OA 5C4MA 2WQZA 4AN0A 3VVCA 2GKOA 1Q0HA 2Q5FA 3L1VA 2A7XA 3L7CA 3OQIB 1JTEA 4H6XA 1M75A 2Z6VA 4M1QA 2JGFA 2HSZA 4BATA 1C3VA 4DZTA 2ZTLA 1X77A 5BORA 4QDKA 5MN6A 2WWYA 4KQEA 1S8AA 3KYIB 2ZSAA 4QBFA 5CNKA 1NT4A 1XLUA 3F49S 3NALA 3FOFC 2O7SA 1ZWLA 5BYBA 1QAQA 3NRCA 4ZVPA 4BQFA 1Z47A 2DHCA 2O2DA 1XU4A 3FNRA 1JMKC 1Z0DA 2CYBA 3KUDA 3LA8A 3JAWB 4J7AA 3CX6A 3HU3A 1IM2A 4X85A 4RF2A 5DBFA 2GETA 1U7PA 1SZDA 1TZJA 3AVTA 2ZPTX 3FHCB 3L0ZA 4EW2A 1A9QA 2JH9A 3PQ6A 4N9QA 4MS1B 3NHKA 2HNAA 2OGUA 1J5XA 2A5YB 2XCUA 1JZSA 4A9AA 1O77A 5JC1A 4II3A 4GS5A 4KQ2A 3H97A 1HLPA 1T8SA 4H4DA 2GCOA 3WGZA 4C7VA 3RF6A 2R68A 4XEHA 2JFHA 4YR9A 3PE3A 1RYEA 3OOWA 5C51B 1ZFNA 4J0IA 1A9OA 1KGDA 4P93A 1PKXA 2X23A 1XDUA 2C9YA 2OFWA 2CEKA 1LXCA 2I6GA 6YASA 2PJRA 4V0RA 1E6UA 5JISA 4DV4B 1RAGA 1VMDA 1A7JA 3PWTA 4M86A 3G1WA 3KVOA 1EWYA 2GXUA 3A1EA 4B6QA 1QF9A 2AGVA 4TSFA 4OKNA 5L95A 2CWDA 4UAUA 1TFUA 3EZLA 4QYMA 3A4YA 2H92A 1CT9A 3H16A 4X65B 4BTVA 1ZJWA 1VG0B 4OP1A 2I99A 2OESA 1C0LA 1VSQA 2ODTX 2XA9A 1MOZA 3G2LA 5FWAA 4DTCA 4GU5A 3A36A 2BGIA 1OR8A 3N28A 2JJ1A 4BNYA 5D2CA 5FLXA 2OBBA 2Y1GA 2BEWA 3C6YA 1ORVA 4A0FA 3FTPA 4D41A 1LK5A 1M6VB 1SUCA 3I2KA 3NJRA 4LGMA 4MA4A 3SQWA 2PKEA 3FUXA 4EYKA 3UWDA 2ZTMA 2ORYA 4OBWA 1DTEA 1LFAA 3QKSB 5KYXB 3P26A 4JUCA 5TPZA 3FM9A 4C3VA 4ZAWA 2WIDA 3HL0A 4ZCTA 4NX2A 5KWJA 4OB7A 1U2EA 3O8CA 4H16A 5EIWA 4F7DA 2QUJA 3JTMA 2PSDA 4TVBA 4ETMA 3DL4A 3E23A 4P84A 4PO1A 3MJFA 2HEIA 1B8VA 1YS2X 2R84A 3IP9A 5ALQA 1VCOA 1OBFO 3VR5D 1QK4A 2REBA 1XN4A 1PJLA 3L7MA 4LA4A 3CE6A 1H9AA 4PZEA 4KP7A 4XB2A 4GI5A 1S8NA 2HM7A 1QH8B 3ZK9A 1U8ZA 3HO8A 3MUEA 5D1HA 3GARA 1II0A 5G3ZA 3ZZTA 3QBEA 4W5QA 1GRVA 1H65A 3ND8A 3VKFA 2C7QA 4RV9A 4M83A 3RTDA 3I5MA 1BXRB 3DZFA 4CU2A 2ZUWA 2ILVA 4BASA 3PR1A 3SJZA 3DAPA 1LF5A 2A9RA 1IXKA 3L41A 4K2HA 3UCEA 2C3UA 3T3MB 3VR6D 4FUTA 4POAA 3ZGYA 5TY0A 1IZYA 1PW7A 1C1DA 5HW0A 3FVRA 4L07A 3HP4A 3OKCA 4HSEA 4TWAA 2GN0A 4UBJA 4UUAA 5IYZB 2C2ZA 1WU7A 2HWXA 2BTEA 3GELA 2CVOA 4GW3A 3WMEA 4D8YA 4QFCA 4DV1B 1X2EA 2XAAA 4KPGA 4ZV4A 5DLYA 4YRBA 3T94A 2NMVA 1PQYA 1SQSA 4A8TA 1FQKA 1ZGBA 2GO7A 3Q87B 2B2CA 4KMMA 2GPSA 3WIUA 1RIIA 2CZGA 3NBZC 4JB2A 4RTJA 3ZD6A 4J6EA 4JCOA 3FFWA 4WDRA 5CDFA 2C1XA 3W2HA 2OOSA 1I51A 2OAP1 2UYYA 4KLNA 3BKWA 4Z0TA 1D2GA 3CNNA 3DWGA 2R9VA 3NPAA 2UUOA 4PAOA 1QH0A 4FONA 3Q1LA 4M1OA 5EP4A 4Z49A 3S1LA 2G70A 3DFUA 2J1LA 4MLDA 4OHRA 3FDJA 4WLVA 3WLIA 4CKBB 1F7VA 1VKNA 4A2QA 4EKNB 2RKWA 3ABOB 1XZHA 4Y2RA 1SA0A 1E0SA 1QHNA 2FNAA 1QHSA 2H1IA 3GMTA 4R1MA 3TFWA 1Z7GA 1NQWA 1K8RA 1PLLA 2NUAA 1EBFA 3I23A 2O1WA 1R0SA 4DQUA 3WIDA 1UCFA 3ENWA 2VCEA 2BONA 2ZB4A 4O8CA 1XQXA 3LYUA 5CVVA 3KR1A 1N1MA 3QUSA 5DLEA 5J9FA 3ZZ1A 3G6WA 4ERXA 4UBNA 1U3CA 1SCNE 4WKCA 4X66B 2QQ5A 5JAIA 3VKUA 3AY6A 3KPJA 2Q9CA 5CVUA 5I8PA 2OCKA 3U7RA 3K5PA 3HM9A 1R74A 1VHDA 3EIUA 3ZCQA 2PLAA 1NJ1A 5FRDA 5H0IA 3H17A 1SC3A 4FOPA 4NE9A 4I4TF 3S44A 1VJDA 2QA5A 2OENG 5BOSB 1GPAA 1RWNA 3AEQA 3T7EA 4BJ5A 1E3WB 1TTTA 2ZIXA 4X63A 1DAEA 4BJ1A 1PWXA 3HPQA 3SQXA 1L5ZA 3IILA 5DLDA 1ILWA 1M6HA 2NADA 1UXJA 4LRWA 1SC1A 1ZM2A 1EJ0A 2HY7A 3DKPA 1ZA1A 4L15A 1BCRB 2WU3A 4RD3A 4ESOA 2B9VA 5BVHB 4WERA 5IF9A 5KINB 5E6UA 3BMOA 3FJ1A 3HN2A 4A92A 2ZJFA 3L7IA 3STHA 4E88A 5HM8A 1T4MA 4D44A 2ZI9A 1MXHA 5D6NA 5ALLA 2QUZA 4GE0A 2GF9A 1E7WA 3QEMB 1T3LA 1D2NA 1Y0BA 4WCFB 2I7TA 3CB4A 1E1CA 3FTEA 1GYPA 3GJ7A 1UP6A 4ODIA 2GZSA 4Z8YA 3TKYA 3ZGLA 1J23A 2OZPA 4EIWA 3FF4A 1AN9A 4JCCA 4WVFA 4R8VA 4UDNA 5L3VA 1Z88A 3GF4A 1B6TA 5K99A 1ONNA 3F6EX 4XIIA 1WR8A 3SJAA 2NPOA 3VU3A 4PAMA 1RAHA 3QPVA 4JR0A 2OCLA 5KQRA 4AUKA 3DBOB 3K1AB 3GCXA 2C54A 1GNTA 1TOAA 3QPBA 4A3SA 4Q82A 4ZC1A 5JD4A 4CXMA 4PYOA 2QDKA 1EK0A 3HU2A 3NIGB 1OBVA 4JVSB 1V3VA 3HJHA 5F73A 3PCRB 1U9JA 4A8HA 5BYAA 1B74A 1M8PA 3DV2A 4JBIA 4F45A 3C15C 5DISB 2IYZA 1ITZA 1GPMA 1U8FO 2IU3A 1VP3A 2V5VA 3KCNA 5CEEA 2H4FA 3HXQA 2I7CA 4AT1A 1OFIA 1VTKA 4L16A 4CNBA 1JX6A 1Y7HA 5IEJA 2XY4A 3HVKA 1Z5GA 3IUBA 2XV1A 4EX7A 1H42A 1KO7A 3E1GA 4YAIA 3LXUX 1O5OA 1U1GA 1EK6A 1CDDA 1H69A 1EH5A 3A58B 1T3ZA 4QU5A 3SFTA 3EYWA 4AUEA 1PT8A 3PL1A 1QDUA 3LCRA 1QCDA 3HA2A 2Q1UA 3PA6A 5CH3A 4EUHA 4TROA 5F23A 1ES9A 3HA5A 5LLSA 3WLKX 5IT5A 1TIPA 2D3TA 1CETA 1OWNA 1RRPA 3G17A 3NUZA 4RKYA 3RS8A 3I8XA 3UXMA 3WQHA 4JJZA 1DJNA 1QGYA 1N2GA 1R8XA 2O5RA 2RGCA 4D57A 2WIBA 3IAS1 3IUMA 3RHTA 2OCPA 4O4HF 3AL2A 1W59A 4FWIB 1ZHHA 2PRZA 1G0OA 3AY3A 3U1VA 4LQDA 1I5RA 2BVNA 3B1ZA 2BMVA 1E5TA 3MHPA 4XFJA 3FDIA 4FZ3A 5KKNB 3ZBUA 2PMFA 3RSZA 1A3CA 3A9SA 3BD9A 3OVMA 2GERA 2YKGA 4ZI7A 1YL5A 2GZ1A 3RHZA 2IUSA 3GAAA 2FE4A 3E1SA 1EGHA 4TLBA 5A1TA 5ECWA 1PX2A 1OWOA 2KS6A 3ZGOA 2Q4RA 1UUFA 4Y1RB 1CY8A 4AW9A 3RGWS 1W36C 1HEIA 4JOBA 4LRXA 1M1YE 3QVOA 4KMOA 4JI7B 4F3YA 1ML4A 2B20A 2PMWB 5IAJA 4BS9A 1QHGA 4RM3A 2R8YA 5K0LA 3R9KA 3EMBA 5JQGF 1QXSA 2B94A 1YZQA 2ZJ3A 3PQ8A 4CL3A 3KB8A 2JCYA 2N9UA 1KYIA 4RVSA 4MS3A 3UOAB 1IDN1 2FVYA 1C8LA 2I2FA 4LX0A 5BQ3A 4UHHA 4G09A 5CDYA 4LY0A 5DZSA 2GAIA 5CW2A 1TMGE 4AZWA 2XE4A 4OUDB 3GIWA 4QJIA 1DU4A 2HSJA 2ODBA 4AICA 1Y3HA 5AUOB 5BV7A 4K6GA 4DWOA 2HYIC 3BMCB 3VTAA 4CMIA 1G20E 1C1XA 2L19A 1CY2A 1KFCB 4OLHA 3I61A 3JQAB 5I45A 2GZ2A 3LKDA 4IIJF 4PGGA 2ISQA 3PPVA 4WXEA 3JALA 3CN7A 1BYUA 3DVSX 4WVLA 1XK7A 4JJ7A 3K7EA 2HUNA 1E32A 3KLMX 4OHKA 3WTBA 4EGJA 4F84A 1O97D 4LDJA 5FBZA 4OQZA 4RTRA 2H08A 3H9UA 2HRCA 3DKIA 1L8AA 1IN5A 1R16A 3C6MA 3UGQA 4DMHA 4DXAA 3BJIC 3MOSA 3P9SA 2F3TA 1XQVA 3W5CA 3S2IA 2GD1O 4IKEA 3LH5A 2X9QA 4B3CA 1KI1A 1WF3A 2CMFA 4BP9A 3PFIA 1IBRA 3UK7A 3G2MA 1OLUA 1VHLA 1SXIA 1XCPA 2A5LA 2RHRA 1X3SA 5DASA 3L3BA 5CHEA 2PMCA 1FDTA 3AC0A 3F2IA 5KWVA 2C1ZA 2C4TA 1VRVA 1M74A 5EEGA 5AJXA 3HI4A 3BXGA 3OQHA 1SBTA 3BQMB 4JR2A 1QVAA 3PEEA 3IPRA 3R7SA 4EB3A 4PNEA 3TD6A 1E4YA 2D5CA 3CO0S 4C0BA 3R5FA 4Q7MB 5EE5B 1LX7A 2ORVA 2NSHA 2R97A 5GV7A 2OFFA 1ZXXA 2P2SA 4HNGA 3RT7A 5KQMA 4LMPA 1PWYE 1AD2A 4LECA 4WAUA 3CRMA 521PA 3RC7A 3KJEA 4AZ3A 2AFIB 1FFWA 3S8YA 3OFSA 3ITKA 1RM5A 4FVTA 4ZPXA 4EJ2A 3TNYA 5IZ4A 3FPCA 3MT9A 4DSUA 9LDTA 1ZKMA 3COSA 3V1MA 5AHKA 3VOBA 3B9BA 2IPLA 1V9SA 1AKQA 2DY1A 5C7OO 3KIPA 4NONA 5EMNA 3ROQA 4MO9A 2JJ2A 4U6SA 1EG7A 1QH1B 1EZ4A 1T6ZA 3WMGA 4BEBA 1NNUA 1F14A 4F8YA 1TLTA 5LZ5A 1O95D 4GAEA 1NLFA 2O3UA 1UKBA 2C2KA 3H84A 3KAPA 4LC1A 2ZAGA 1GSAA 1R5JA 1ZM4A 2IQ5A 1ZXBA 2XT0A 4F5EA 4EPXA 3T0GA 4WOJA 2CL6X 3WI7A 5KQPA 3SGLA 1PT9A 2PWBA 1E6MA 3A6FA 2CXXA 1XMXA 4URZR 1XVUA 3MPUA 3FUCA 3VDXA 1DJOA 5CEFA 3FDZB 1VDZA 1D1SA 1OPRA 3GQBB 4L6AA 4DLTA 1OWMA 3CSDA 3FRJA 5K0SA 1TFRA 4I1YA 4IDFA 4DUZB 4C3OB 2QD5A 2QLTA 4QEKA 4UMDA 5KYWA 4FGSA 4MDYA 4J0GA 2QZPA 5FLYA 2V7VA 2J48A 4LSMA 3NEJA 8ABPA 4NQZA 4RSGA 1LQUA 4KRGA 4MNTA 4RF3A 4CLXA 3LPCA 4YV2A 4FD3A 2N0SA 4ZRMA 4FZ5A 3D8SA 3P52A 4KXXA 3WE7A 4A0SA 5LMNB 2FI1A 5J5AA 1QZUA 4TL7A 4YXFA 3OKPA 2XTZA 2XVMA 3KOZA 4FNOA 4P2GA 1FW8A 1E6CA 1Q1ZA 3AGPA 4OGLA 2V0CA 3E4CA 3FLAA 3PUKA 2XYGA 1L4MA 3LX4A 3VNRA 2JFGA 3GT7A 3NWPA 2PSEA 4ZODA 4MR8B 1YV9A 4KOEC 3ZXIA 1E3DA 5FBRB 4HRAA 4I3FA 2AG8A 5HIKA 3L1IA 3PR3A 3HE3A 2DFNA 1TF2A 3QYFA 5AXDA 1R9NA 2GD6A 4KI0A 2HK8A 3HBLA 3HVIA 3FYSA 4C3ZA 4IGEA 1SKYE 4A10A 2VH1A 2DH6A 4FYVA 2EU8A 3D4BA 4X41A 3ZDBA 1QGUA 4J3JA 4AZ0B 2XPCA 2OMKA 1BEEA 1IQRA 2RG1A 4CM4A 1KI6A 2FE1A 1KRXA 2LIPA 4BX3A 4E70A 3WP0A 4KDFA 2AFRA 3UHAA 1DQZA 4EMSA 4I55A 4CEHA 2BI8A 1IUKA 3LQFA 3M4NA 3GRAA 4CCWA 2V4MA 1FDWA 3NDRA 3C7AA 2B0JA 4IZIA 4BB5A 2IHYA 4NZPA 5FOSA 1R0BA 1U4OA 5DCWA 4DTIA 1CUYA 5JFGA 4UDOA 5TQ0A 1FQOA 1XMJA 3EQ6A 1C9JA 1UZLA 4BFLA 4IWXA 4KPEC 3E03A 2PLNA 2DR2A 1KAQA 2QE7D 4U7JA 5A0TA 5JVDF 3V97A 1PD1A 2I1LA 1JQAA 2R6DA 2RH5A 4XSHA 3VR3A 1SFRA 5HBRA 3IV6A 3NOXA 3D9QX 3EOAI 1P44A 3CT4A 1OTXA 3HFGA 1MDBA 4WOPA 3ZHOA 1HX7A 4GMGA 3G0HA 5KJEA 4CM8A 1SVUA 3KPWA 3MTIA 2GRUA 2W4QA 2PO7A 5DW3A 3DO8A 3RYHB 3THSA 3TNJA 3VOSA 4IYJA 4RAOA 3TCXB 3U3XA 2YHBA 1T1IA 4NCIA 4RQAA 4RTLA 1GTZA 3DHYA 5E2BA 4JBWA 1U99A 3Q3VA 4E5MA 4J43A 1R8YA 2GWHA 4TWBA 2NZWA 3IQXA 4IV5A 4P5PA 1CP3A 3JQ8A 3DYBA 3R4VA 4K81B 1UZNA 2PXAA 1QK3A 4XA8A 2QXYA 3V7YA 1G38A 4JBYA 5DHPA 3H5VA 3OF5A 1KQ3A 1Y8AA 4IGKA 2MYNA 3OO1A 3OZWA 3CJQA 2CLSA 5IJ0A 3GEDA 3C6BA 4NNOA 3F71A 3EFOB 3NYIA 1KYTA 4I4NA 1PJAA 4NMWA 1IBSA 3RODA 3W5BA 1Y3DE 2J33A 4XJVA 3TQTA 4C07A 3C1UA 4P32A 5T4FA 5HX7A 3L8DA 1PQWA 5D00A 3HYSA 1M1YB 5LKRA 1WOMA 5TARA 1WAMA 3HJNA 5EPEA 2X0KA 4EQZA 4LY6A 5H70A 3MRXA 1CTQA 2QV7A 1Z4JA 1XXLA 1OHHA 4LJYA 3TM4A 3U1TA 5LD2B 2X5XA 1C0EA 3I2IA 1DJPA 2C1EA 3HRHA 1OI3A 1Q0TA 4LGVA 4RDIA 2BBOA 1DFIA 1ZJJA 1G5FA 3H5LA 5HQTA 3UV6A 1OIVA 1WWKA 1G20B 3ICEA 4OREX 1RKVA 1HRKA 1UFRA 1G21A 2FQXA 2WA2A 2LDBA 4INJA 4LNUA 3EXFA 2FWMX 4P53A 1ESDA 3C5CA 2OGSA 2WLTA 2W6JA 1QMGA 3THOA 3STYA 3ZX5A 1OXKB 2IYEA 1EDZA 1U7ZA 1N6KA 3DMNA 2NU8A 2ES4A 1D6MA 1ZS9A 1G2OA 2FMHA 1BMDA 2JIBA 4MKZA 1M7HA 1YZ3A 4UM8B 4KFTA 4AJPA 4I5DA 3O1HB 4TYQA 4RAQA 2DUJA 5AO9A 2AOUA 1O6FA 5FPTA 1NW8A 1P4RA 3EA0A 4MVJI 1F4LA 3UEOA 5I8WA 1Y8QA 3QVSA 2AJBA 4EDFA 2GB4A 3VYRB 4AO8A 1J99A 2YOFA 5ALJA 4ITRC 2I55A 3GFFA 1II9A 4CGZA 2JCXA 4M7RA 1L5GB 4FGJA 4OHXA 4D4GA 5EIBD 2Q7DA 3NBKA 4Z7QB 1AV7A 3MIIA 1OXXK 3E5NA 4UVIA 4NH0A 4RVOA 5B1DA 3Q8KA 1F4VA 4DJEC 1SBCA 2X76A 4N40A 4G8DA 1M7BA 1J9ZA 1WHTA 3SVLA 5L4SA 1Z16A 5G53C 3TTVA 4FLFA 4Y3UA 4RMJA 2R6FA 2P27A 2MSCB 1Z36A 3EXG1 4W99A 3UC9A 4EFDA 2UUAB 1KMQA 4RE6A 3GAFA 3WLFA 4KQWA 4BX9A 4LJAA 4TV9A 3MMSA 5C4IA 4CEIB 2G1KA 4BNZA 3PHBE 1J1IA 1YS6A 3F6SA 3IEVA 3DHNA 4KN9S 1J90A 2VNKA 3G2OA 5L7TA 4C4XA 3ZWNA 1SXJB 3ZE8A 5FYQA 4GKBA 2RK3A 1CRQA 1X6VA 3WYNA 3PHJA 4CMCA 2QTWB 3GMDA 1EDDA 1KFBB 2NPIA 4C14A 5KTYA 3L8YA 3W5IA 4I8DA 2Z3ZA 4GD3Q 3KQKA 3DC7A 3QELB 4DM4A 1AY0A 1TJNA 5FL3A 2FUEA 1NPDA 2Z4SA 2JKZA 1KY2A 1DIHA 2GH1A 2H1FA 2WRZA 3GEPA 3PG5A 1SC9A 3EXG2 3PDIB 4IDDA 2CFOA 3W2TA 1L1RA 2WWVD 1E7MA 1E62A 3PJDA 1EFCA 2ZYTX 4QPPA 4DSZA 7GPBA 4XRRA 3ANNA 4N7MA 4AYXA 2FZCA