4LXGA

Crystal structure of dxnb2, a carbon - carbon bond hydrolase from sphingomonas wittichii rw1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
276
structure length
274
Chain Sequence
MFEQFESKFIDCDGIRTHYIEMGEGDPLVLVHGGGAGADGRSNFADNFPIFARHMRVIAYDMVGFGQTDAPDPAGFAYTQAARTDHLISFIKALGLSKICLIGNSMGGTTACGAALKAPELIDRLVLMGAAVNISPDDMVADDLAAVMSYDGSEEGMRKIIAALTHSYQPTDDIVHYRHEASLRPTTTAAYKATMGWAKQNGLYYSPEQLASLTMPVLVLGGKNDVMVPVRKVIDQILAIPQAIGHVFPNCGHWVMIEYPEEFCTQTLHFFGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Lid Domain of the MCP Hydrolase DxnB2 Contributes to the Reactivity toward Recalcitrant PCB Metabolites.
pubmed doi rcsb
source organism Sphingomonas wittichii rw1
molecule tags Hydrolase
molecule keywords MCP Hydrolase
total genus 92
structure length 274
sequence length 276
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lxgA00
3F96A 4AMZA 4XIIA 5HFAA 5C8ZA 1BE0A 5CH5A 5K3DA 2WG0A 3QMVA 3BXPA 3WMRA 1XRNA 1XKLA 3U1TA 1CUHA 4Z49A 4W1RA 5A7HA 3WQHA 4KYVA 1O6FA 1MTZA 4Y2QA 4DSAA 4G4GA 4UFPA 3VVLA 2I3ZA 1DT5A 2YXPX 4BRZA 1RYYA 4BP9A 2VJDA 3T4UA 4BE4A 3I6YA 2QT9A 4Y2VA 3U0VA 2J4FA 2GZRA 3IVMA 4AO8A 1E8NA 1J2EA 1W52X 1P0PA 4BCBA 2QMQA 5LYYA 3F98A 4Y2XA 4IH9A 1E89A 1K63A 4C88A 2XE4A 5A62A 2XUGA 4S0XA 1ISPA 2G63A 3H2KA 3WWPA 2FX5A 2QXTA 4FBLA 4K6KA 1QLWA 4Y2TA 2AJCA 2XMGA 1R9NA 1YA8A 2FJ0A 2JEYA 2ZYHA 2IIVA 1A8UA 4Q1VA 3SX4A 1MAHA 2HA0A 3R3YA 3MVEA 2C7BA 4X90A 3CN7A 2GBGA 4X94A 4Y2JA 2Z5GA 1WB4A 3PE6A 1K6EA 2JGFA 3LCRA 1CUUA 4J0JA 4J0GA 4PO3X 4FLMA 1AURA 4UBMA 5ALUA 5A71A 1ODTC 1R3DA 4BVLA 1GPNA 3BDVA 4B9EA 2C4HA 3AZOA 1XZMA 5FPPA 3I2HA 1K4YA 5AOBA 4EY6A 2QRUA 2HA2A 1MU0A 5ALSA 2NW6A 1QIEA 5FV4A 3SWWA 1VLQA 2YASA 1AMNA 4EY5A 3W9BA 5C7YA 2Y6VA 5AKYA 4EA6A 4B0PA 1WB5A 1E66A 1X70A 2HA5A 4X6XA 5E2IA 5T4EA 4CG2A 3I1YA 2ACKA 2DQYA 2PX6A 3OOSA 5DYTA 1GGVA 1JJFA 1Z68A 2Z8ZA 1T2NA 3KWFA 5ALXA 5HK8A 5ALYA 4MEBA 2G5PA 3DOIA 3KSRA 4KE6A 4CIAA 1SOMA 4X6YA 3L1IA 2WQZA 3FLEA 5F4ZA 5LZ7A 5LZ9A 1YA4A 3JYHA 5T4FA 4JYMA 4WJLA 1F6WA 1JMYA 3QM1A 1AZWA 3FSGD 2WTMA 4EUSA 5CT9A 5C8XA 2CB9A 2QTBA 5HF8A 1P0MA 1QIDA 2WHRA 5JALA 1YB6A 2X76A 5IH7A 4L9AA 1GZ7A 3STUA 2XLCA 4V2IA 2WUEA 5AP9A 1BN6A 3WL8A 5CH8A 3O4IA 3QYJA 3TJMA 4F21A 4UFNA 1JJIA 4UBKA 1MNQA 2ACEA 1Y7HA 3WKAA 1H2WA 3HXKA 3R3UA 3WL6A 4EZIA 4ZGBA 5AM3A 4OSEA 4ZV7A 4BCDA 4G8DA 5AKLA 5AKZA 4DMKA 5SYNA 4FKBA 1NU6A 4Y2UA 1LZKA 5ALJA 2GYVA 1WPXA 3D4LA 2XUFA 3E0XA 5HQ3B 1ZD5A 2H7CA 3C6BA 1UKCA 4K6HA 3IIIA 3D5EA 4J0DA 1U8EA 2WG2A 5AKJA 2VAVA 1VXOA 2B9VA 2VSQA 4ZV9A 4X92A 2PU5A 2ONCA 2PSHA 4FOLA 2WFZA 3T52A 4INZA 2LIPA 4RE5A 1CUAA 3A2LA 4E11A 5FPQA 3FWHA 3C6XA 5ISMA 1LNSA 2XLBA 1K5PA 4QDUA 3HZOA 5HF5A 4U2BA 3STTA 4MQLA 4QWWA 5FLKA 4C6HA 5AM5A 1L7AA 3Q8WA 2WHPB 1ZI9A 2WILA 1CV2A 1MX5A 3C8DA 3WWOA 2QJWA 1H22A 3VXKA 4C87A 2OAGA 3Q0TA 4G1FA 2WSLA 7YASA 4KRXA 1UK7A 1IZ8A 3L1JA 5LZ8A 3IUNA 4QLOA 4G8CA 4YX9A 3BIWA 4GBGA 4JEIA 2J3DA 3EBLA 4U2GA 3STYA 1CPYA 2PBLA 1EDEA 1A8QA 1QTIA 2YH2A 5BV7A 5AKEA 1M33A 3G02A 5CRIA 2VF2A 4K6GA 1A88A 4OCZA 4PNZA 4MJ3A 4JNCA 4MEAA 3WZMA 1XZCA 1BEEA 4K5QA 3PFBA 4CCYA 2OQIA 2OCKA 1MO2A 3OG9A 2Z3WA 4UPDA 3GBSA 2WHPA 4TGLA 3K9BA 1W75A 4C4YA 3ZWQA 1VA5A 2WKWA 3I2GA 2GYUA 2WJ3A 3V1NA 5AI6A 4AN0A 3HLKA 1G42A 2O2GA 4GHWA 1ZICA 3C6ZA 4N5HX 4JH0A 3R3XA 2XQKA 5ALEA 1X2BA 1XZEA 3KD2A 1EDBA 3IURA 2WFLB 4J7AA 3WJ1A 4E15A 1JU4A 4DMCA 5AI0A 3C70A 1LGYA 1LLFA 1UFOA 3STVA 2JGEA 4FMPA 2HRRA 5ALGA 3R0VA 1WHTA 3FAKA 3AFIA 5ALVA 4QE3A 3QH4A 4Q3KA 4C01A 2GBCA 2ZJ6A 4D9JA 3PF8A 1EI9A 3OPMA 4C89A 1IUOA 4UHHA 4FLFA 2XQGA 3DYIA 3A70A 3FLAA 1HKHA 2ES4A 3WZLA 1E3QA 3JWEA 3H17A 5EI5A 3ZV7A 3V1MA 4OB6A 1H2YA 1WCYA 1XLWA 1CVLA 5A7FA 2B20A 1W1IA 3D0KA 4LKOA 3A6ZA 4P92A 2HFKA 5ALQA 4H7HA 1F0NA 1PFQA 1XZGA 4ZWNA 3AIMA 3OURA 2H7YA 2XUKA 3BJRA 3LP5A 1DQZA 5AKKA 5JZ9A 1G5FA 3IUJA 3D7RA 1D07A 2ROQA 4A23A 4B84A 3G8YA 4M0EA 3HSSA 4EBBA 3I2IA 5LLSA 3VJKA 5FOQA 4ITVA 1CFJA 4DNQA 3I1IA 4ZXFA 5JYCA 2V9ZA 4IQ4A 3I28A 5ALPA 4P93A 3C5VA 3WKCA 2UZ0A 4ROTA 1MJ5A 5AM4A 3ESBA 3UUEA 2WJ4A 5JD4A 1TAHA 1J07A 2PSEA 1CUEA 3HEAA 3D2BA 4O08A 1Y7IA 5EIEA 5JIBA 3IUQA 2O7VA 2JF0A 4FNMA 2WIKA 2XUPA 2WIFA 4B0OA 4B80A 4I3FA 1AKNA 3WI7A 1YAJA 3MUNA 1LBSA 4JYPA 2BGNA 5AO9A 2XMRA 3C45A 4U2FA 4Y2PA 4I19A 5T4HA 5EIAA 4Q34A 3UMJA 5ALRA 3H2JA 1YS1X 2VT6A 4B82A 5AOCA 3FYTA 5HKBA 3I2FA 4DNOA 2ZJFA 4N8DA 1U4NA 3LS2A 4UUQA 3WJ2A 4X95A 5KWIA 4PQEA 4BC0A 1TCAA 3O95A 5AICA 1BROA 1HQDA 1JFRA 1TRHA 5ALDA 3G7NA 4HZGA 5H3HA 1UKAA 4A16A 4BDSA 1XRLA 1XZKA 2RGUA 2JEZA 2WLSA 3KDAA 4FDMA 1J06A 4ZREA 1PV1A 4IH4A 4L72A 1QIKA 3WK8A 3TGLA 4AMYA 2GBIA 3RKSA 1QIHA 4LYEA 5C81A 4BAGA 1USWA 2PKYX 5DYWA 5K3FB 1U2EA 4B6GA 5ALOA 1DWQA 3ED1A 1C7JA 1IZ7A 2DHDA 4MQMA 2XQJA 4DMHA 2OGZA 2WUFA 1XRMA 2ZSHA 5AJHA 2XQIA 1MAAA 2HU5A 1XQXA 5ALFA 1VA4A 2Z8XA 5ALZA 1L7QA 4DGQA 1CQZA 3QMWA 1P0IA 2ZYSA 5FDFA 1WPRA 5JADA 3A2MA 1RWQA 2FUKA 1GPLA 4GEGA 4M0FA 4UHCA 4FLEA 1N1MA 2G4LA 4BVKA 3V1LA 5HQ3A 1FSSA 2B61A 4Y2YA 4AZ3A 4ZI5A 5JASA 4HRXA 2WJ6A 3JW8A 4B9AA 2CKMA 2WTNA 2PU7A 3IBTA 3SK0A 5FXMA 2QS9A 1XZHA 5LKRA 4UHEA 3FVRA 2BJHA 3GELA 4U2CA 1QFSA 3G0BA 4GWLA 1W6RA 3WLAA 4OPMA 3DKKA 3MUOA 1XQYA 4UBLA 3W06A 1LPPA 5LKAA 3DNMA 5EHQA 2WUDA 3WL7A 3WKBA 4QDTA 3GUUA 3G9XA 4LXIA 4H77A 2WM2A 1A8SA 1X2EA 2PSDA 5JAPA 3G0IA 3D59A 2CEKA 1YASA 1UOQA 3FOBA 4DSZA 3FBWA 2QUBA 4LHEA 3HACA 4MYSA 2AJLI 1W76A 1EB8A 5AIBA 4DIUA 3WK4A 1XRPA 1JI3A 4AO6A 2GBFA 1EX9A 1FJ2A 3I2KA 3HYSA 4H0CA 3LIPA 5FP0A 4L3WA 2Y6UA 5D3ZA 3CCCA 2VA9A 2V98A 3WYDA 4EY7A 4X3CA 3O9VA 1UK9A 3VDXA 4DYHA 2BKLA 4FWBA 5LZ5A 2DHEA 1TCBA 5JD6A 1WOMA 4FHZA 2XUJA 3EF3A 4B81A 5JARA 1QIGA 3O4HA 2O2IA 4XX1A 4H35A 4OU4A 4C4XA 4BTLA 3IUMA 1QIFA 5ALIA 2J3QA 1DU4A 3F97A 4EHBA 3OM8A 2HRQA 2XMSA 4AZ0A 5HF6A 4Q82A 5EFZA 5AI8A 3SC2A 2RHWA 5AK4A 4UHFA 3NUZA 1SCIA 3ANSA 4H7JA 3KXPA 1BRTA 3ESAA 4ARBA 4LXGA 3RLIA 5HKAA 5DTIA 1VE7A 1TQHA 1UWCA 3DJYA 2JGLA 4W1QA 5DNVA 2XUDA 5AM1A 2AJBA 4H7IA 5E4TA 4X97A 4G9EA 3F8SA 3W9UA 3WK7A 3VJLA 1KU0A 3C87A 1YB7A 4IHAA 4X7BA 5CTAA 2PUJA 5AK3A 4OD0A 5IVKA 1AX9A 2HA6A 2CZQA 1N8SA 2DQZA 5DYYA 3N0TA 3R3WA 4C4ZA 4QLAA 3G0CA 1ZJ5A 1XQVA 3KWJA 4CCYB 1CQWA 5CT8A 4QDZA 5SYMA 1EHYA 4GW3A 5ALLA 5ESRA 1DTEA 5HZGA 4N5IX 1QIMA 1ACJA 2O7RA 3DCNA 3PI6A 5JAHA 2RI6A 3DLTA 4WY8A 2RONA 5AOAA 5AHXA 3HABA 3PFCA 1EA5A 1THTA 2EDAA 1R50A 3DL7A 5AKXA 1UT6A 2PM8A 3W2TA 4GXNA 3STWA 3H04A 4Q05A 2B4KA 4NMWA 4WY5A 1IUPA 1UZAA 2PSJA 3DQZA 3K6KA 3QITA 4YPVA 4KACA 2DCMA 3PICA 3QPCA 4X6UA 4W1SA 3O4JA 1XZLA 2R8BA 3A2NA 4PSDA 5CXXA 3AZPA 4E14A 2D0DA 3I6ZA 5CT6A 1LPBB 1BN7A 2XMDA 3PUHA 3EIOA 2WG1A 3WIOA 5ALKA 1B41A 3H2HA 5CURA 2XMQA 5A2GA 4W63A 5FRDA 3B3QA 5AKGA 3C6YA 2H9YA 2HHAA 5IKXA 4OUKX 2RHTA 3W04A 1ORVA 3G9UA 3K2IA 4XJVA 1BU8A 1HBJA 1CUZA 2VTVA 3O0DA 4DNFA 6YASA 1MX9A 4WFJA 3FCYA 3DKRA 1ZI6A 4CIBA 5ALHA 4UFOA 1XRQA 1XZAA 1XRRA 4L0CA 1PJAA 3DYVA 4BE9A 1P0QA 3ZLVA 2CBGA 3H1BA 2HA4A 3X3HA 1LPAB 3E1GA 1XZIA 1TK3A 2XUQA 4FBMA 1C7IA 2X8BA 2JGKA 3WKDA 4CG1A 1LBTA 2WFMA 3HRHA 2W22A 5AI9A 3W05A 3AIOA 4QDOA 4Y2RA 4QWMA 4PV7A 3KOOA 1QGED 5A7GA 4UBIA 3DEAA 4GLBA 4LIPD 1QTRA 4F5ZA 4Q3OA 4X00A 5HK9A 3LLCA 3VKFA 3GFFA 4ETWA 1VZ2A 1EVEA 2QOEA 3S2ZA 2DR0A 4BRSA 4DMFA 2OXEA 2QKYA 4ARAA 1G4HA 1DT3A 3EQ8A 3M3DA 5AI4A 4RNCA 5KREA 2RAUA 3STXA 3WKEA 2WUGA 1U65A 3GROA 4CG3A 5EGNA 1ZIYA 1B6GA 1JU3A 1C4XA 1XZBA 3FCXA 2BAGA 2HFJA 3IB3A 3WIBA 4HAIA 3R40A 3B5EA 1F0PA 3H0CA 2OG1A 5DTJA 4J0IA 2HM7A 1QIIA 2XI4A 5BWCA 5KWJA 4KAAA 5D7BA 4MWSA 1FFCA 5AH0A 4BZZA 4MXDA 5A6VA 1MNAA 3H1AA 3IA2A 3DDUA 3EQ9A 4NS4A 3WA6A 4M0MA 4X71A 2CJPA 3ILSA 3L1HA 4OYLA 3O4GA 2GZSA 4GDMA 5AKIA 5YASA 2IX9A 2OPHA 3B12A 2FJPA 1CEXA 1VOTA 1UKBA 5HFNA 1EB9A 2BUCA 2BUAA 3RK4A 5K3FA 1CUCA 1YS2X 3VJMA 2ORYA 4G9GA 4J0HA 3GA7A 4N8SA 1IVYA 4UHDA 5I9IA 3H2IA 1JKMA 3FYUB 1Y37A 1JT2A 3ZLUA 1ZD3A 3C8HA 3M83A 3HC7A 1G66A 5AM2A 1CLEA 2GYWA 3CCBA 1N5RA 2I78A 1LZLA 2CUTA 1ORWA 4BP8A 2JGMA 1EXWA 1YSCA 1KU6A 2I3DA 3TEJA 4KE7A 4LYDA 3GZJA 3G9ZA 2ECFA 1XROA 4BC1A 1E8DA 1EINA 4E46A 1UK6A 1QE3A 1S8OA 2VJAA 4JUIA 2HU7A 5I8PA 4BCCA 2WU3A 2R11A 3WWDA 4EY4A 5BOVA 1QZ3A 5JZBA 5DLPA 3DD5A 5IVIA 1Q84A 3AZQA 4W9RA 4RE6A 2P8SA 4BAZA 2X5XA 3S8YA 3ZLTA 2WIDA 2PPLA 1DWPA 2XT0A 3QBJA 4U2DA 2WIJA 4H7DA 2D5LA 3V1KA 3WL5A 1EVQA 2AXEA 4P08A 3WYNA 1VJ5A 4U2EA 1GKLA 3ICVA 4UBNA 2OAEA 5DNUA 1WHSA 2JGJA 5I7UA 3D3NA 2BCEA 2AJDA 4N8EA 3OTQA 1ZI8A 1R88A 4FTWA 2ZJ7A 5CBKA 3NGMA 2V96A 1ZOIA 1R1DA 1QFMA 1GXSA 4OU5A 1FFEA 4DM7A 3UUFA 3C5WP 1QONA 3HI4A 2V97A 1CUWA 1AC5A 2C0PA 1EH5A 1FFDA 2Y1KA 4H18A 2H7XA 3NWOA 4HRYA 4HTAA 4HXEB 3ESCA 4FFVA 2HDWA 1LPMA 3WWEA 2VT7A 4I4CA 5CW2A 2JBWA 4CCWA 5AK6A 5CT5A 4UHBA 2XB6A 4HXFB 3G0DA 1NU8A 1E5TA 1VZ3A 5D6OA 5DWDA 4BB0A 1MN6A 4RGYA 2BUBA 4BATA 2VQ6A 2AJ8A 1HL7A 4HS9A 1CRLA 1R4ZA 4OB8A 1MX1A 2BGRA 4B7ZA 5K3EA 2Q0XA 1CUDA 1IMJA 1KEZA 1A7UA 2C5FA 5AKHA 1THGA 2O2HA 5AI5A 5FUMA 2HA3A 1XLUA 1XZFA 4WDQA 2QUAA 1LPNA 4NZZA 3PF9A 4X91A 4QEKA 1J1IA 2K2QB 3WA7A 4EB0A 4WCVA 4J0KA 3RARA 1OILA 1MT3A 4BYMA 3FLBA 4KRYA 1EK1A 4UBOA 3FSGA 2E3JA 1XQWA 3G0GA 2W6CX 2G5TA 4A5SA 1CR6A 3BWXA 2HU8A 3QZUA 1ZJ4A 2VATA 3QVMA 3AILA 4BDTA 5E4YA 4AX4A 3R3VA 3BIXA 1YAHA 3FYUC 4YK7A 4WDRA 2WFLA 1E8MA 5JATA 1ZD4A 3DL4A 2QM0A 4KAFA 4G4JA 5ALTA 4J0CA 3HJUA 2XUAA 1QO7A 4QDXA 2VJCA 2OQVA 5T4BA 2XMZA 1MPXA 5HCUA 5LP1A 4AB1A 1O6GA 4F0JA 1ODCA 4TPKA 1ETHA 1TIBA 3AINA 2EEPA 2HADA 1I6WA 1QJ4A 3WK9A 5K3CA 5AIAA 1BEZA 2PVSA 3WK6A 4RPCA 1UXOA 3BF7A 1CUGA 4WFKA 3TRDA 3M82A 3QMMA 4OB7A 1BCSA 1H2ZA 4BTVA 4WFIA 3H18A 1SCKA 4G5XA 1YR2A 1SFRA 4PSUA 1EDDA 1Q0RA 4G4IA 1BS9A 4AQDA 3IDAA 5EHXA 4YASA 2XUOA 1ZGCA 4MWTA 4QZVA 5EHZA 4KE8A 4W1PA 1CUJA 5LZ2A 1R9MA 5IVHA 5KBYA 3RM3A 1WM1A 2DSNA 4BAUA 3PDCA 3R3ZA 5HF9A 1Q0ZA 2OGTA 3MGAA 4H7EA 2WIGA 1T4MA 1QO9A 3BL8A 3BE8A 3E3AA 1CIJA 3V9AA 1AGYA 4TVKA 2XMCA 5JD5A 3I2JA 5ALNA 3CXUA 2RIPA 1H2XA 4B83A 4H7KA 3V48A 2PUHA 4FFWA 2XUIA 4ZRDA 4NVRA 1DINA 3ZI7A 5DJ5A 1CUXA 3CN9A 4GECA 4IH1A 4KR0A 4J3JA 3BJMA 1GQSA 2VAXA 4Q3LA 4XVCA 3ESDA 2XMBA 1CUIA 3AIKA 2DFPA 3C43A 3PUIA 4K2AA 3F67A 5K3BA 5CH3A 5IVDA 4EY8A 3I6MA 3BDIA 4DNPA 5E4JA 3N2ZB 1VKHA 1NX9A 5K5EA 5JAUA 5AM0A 1OXMA 2ZYRA 1Q83A 2Y2UA 2ZYIA 3EQ7A 4KAJA 4XWGA 3FVTA 4BZWA 1SCQA 3QPAA 4H7FA 4BBZA 3DOHA 1GQRA 5LZ4A 1K8QA 1TCCA 1DQYA 5LIPA 1LPSA 3WK5A 1HDEA 1DX6A 1ZIXA 2PSFA 5ALMA 3R41A 4PSCA 4QNNA 2XUHA 3AUKA 3M81A 2HIHA 3H2GA 2OLEA 1CUYA 1AUOA 2HL6A 1LPOA 4DTCA 1RP1A 4DLNA 2WHQA 3WWCA 1F8UA 3LIIA 1GKKA 4AXBA 5BWBA 4P9NA 4OYYA 4KJXA 4GI1A 4AN1A 2OCGA 3YASA 2WU4A 4HXGA 1CUVA 5JANA 3ZPXA 5FKJA 4HVTA 3ICWA 2BFNA 3OC0A 3FYUA 1L7RA 4PW0A 4PF1A 2JGIA 5J3JA 5EHNA 1FFAA 2ZVDA 4AO7A 1XZDA 1H23A 4MYDA 3VISA 3DS8A 2OCIA 1HPLA 4X85A 1HLGA 2CMFA 3D2CA 2QVBA 1XZJA 2XDWA 3AJAA 4B85A 1N5MA 4Y7DA 3O9MA 2Y2VA 2QJRA 5JZSA 2ZSIA 5DNWA 5ALWA 2XQFA 2C58A 1DWOA 1UOOA 3H19A 1UOPA 3FNBA 5JAOA 2I03A 1CUFA 1AQLA 1FFBA 2YYSA 2PL5A 1WB6A 5EIHA 4Y9SA 4Y2SA 2EDCA 1ACLA 2OCLA 1XFDA 3F9CA 1W4LA 2VJBA 1BCRA 1YCDA 2VEOA 3D2AA 2J4CA 4KE9A 1ZD2P 4KEAA 2C5GA 4FNGA 1SC9A 1IUNA 5CMLA 5C8VA 2C0QA 1GPKA 1OCEA 1GT6A 3QPDA 3IULA 2QXUA 2IITA 3VVMA 4LXHA 1XKTA 1DX4A 1VE6A 3NOXA 1TKRA 2QZPA 2JIDA 1UK8A 3G9TA 4G8BA 1QOZA 4CI9A 5AK5A 4IO0A 1CUSA 3ANTA 3P2MA 2DHCA 4CFSA 1ODSA 1EK2A 1XLVA 1JJBA 1ZGBA 4X93A 5K3AA 2QR5A 3E4DA 4QA9A 4BVJA 5CT4A 1JMKC 2OGSA 4J03A 2Z3ZA 3BF8A 5D3KA 1CUBA 2HA7A 4F60A 1VXRA 4UBJA 2H1IA 5CXUA 1QIJA
chains in the Genus database with same CATH superfamily
1RAFA 2JC3A 1FRNA 2ID8A 3H65A 3CF0A 3OEHA 3P5SA 4PINA 3LHKA 3EXIA 4TKUB 2ZWVA 3ZCRA 4AMZA 4LZWA 1BE0A 2FCAA 3EQ2A 2P9BA 4HH3C 5CH5A 5TT1A 4NJMB 3ZHYA 1J09A 2R60A 2VAPA 2VP6A 4FYMA 1W93A 4Q12A 5LJIA 3ETDA 4JJIA 3SNKA 4B4UA 2QNRA 3BXPA 4AURA 3Q40A 4JWKA 1XKLA 2WHYA 4HFRA 4M22A 4AWXA 4RULA 5HBGA 1BA3A 1JIUA 5B53A 3F9IA 4O2AF 5JSZA 1U2DC 4L4ZA 1GXSB 3WQHA 2V03A 3VVCA 4A0QA 4FMCF 3KKOA 3QWIA 4PLGA 2Y68A 1KNQA 3ZHOA 1T5OA 4AIIA 5CCDA 3VC7A 1LDYA 2EP8A 1P3Y1 4UFPA 3QKUA 4Q9HA 3E9CA 2CV1A 1ZX1A 3BXOA 3M6WA 4DCCA 3HVIA 3W5HA 1NDHA 2TMDA 3GA5A 1RYYA 3PUYA 4RW0A 2RGWA 5IYZF 5KHAA 2I7XA 3AWDA 1Z33A 4UPVA 5J43A 2MSWA 3PDIA 4IOJA 2FPKA 1ESEA 2XJ4A 1YK1A 3D3JA 3L5OA 4TL6A 5EJ2A 1PWXA 1WOYA 3I34X 1Y34E 3U0VA 1VG8A 2P2DA 4D56A 4HEQA 4KB5A 1M5UA 1W1UA 2C7OA 1QG2A 1QQ7A 2I71A 2XWPA 1FOEB 1CETA 3TSWA 4IGEA 5FLYA 1TM1E 5T41A 1ISSA 3O1LA 5CDYA 2I1VB 4EJMA 3T7JA 5KQSA 3GLGA 3OEYA 1NN1A 1P0PA 5E8RA 4BCBA 3A26A 1XU9A 3BBLA 3MPUA 5LYYA 3TVTA 3F98A 4G0NA 3DWFA 3F6RA 4RCVA 4JYCA 3VZBA 5BVHA 10MHA 4DJJA 5A6SA 2JD0A 2OT3B 4WN9B 2XE4A 4TV8F 1VLLA 2MYTA 3BEDA 1IVNA 5DHSA 3UNXA 3DDHA 2PS3A 3PD0A 4EKYA 4ZN6A 1EFAA 2G63A 3ZR4B 3BDAA 4NOKA 4P4UA 4M86A 4RZXA 4K87A 1ZK1A 4ZVQA 2QXTA 4K6KA 2PGJA 1WY7A 2EFJA 4UU0A 2VP0A 4QJ3A 2ZRMA 1QLWA 4NBLA 3S2IA 1MB0A 2BL4A 2JJ1A 2PR2A 4QODA 4MRPA 3SS8A 4FW8A 4GDFA 3OFSA 2JEYA 5AVXA 3IEUA 4NMHA 1PZMA 3ZDYB 2ZB8A 1L7VC 2X58A 3VU3A 2JBHA 1TC1A 2Q3DA 2XCQA 1X7HA 1H2EA 2CDNA 2HQBA 3F8TA 3JCZA 4ZICA 4O4IA 4JHXA 5AVTA 1MZPA 2NMVA 4O1IA 1KRWA 4KN6A 2HA0A 5IP5A 3QG1A 1J8FA 4LXUA 5JXIA 3GP3A 2BPOA 4TQUS 1XVAA 2YDYA 4EECA 2DT8A 3JR3A 2PH1A 1K06A 3WYCA 2HRDA 1YZ3A 2YQ4A 1SUEA 2C7BA 3GFTA 2LP4Y 2M6SA 3MS4A 1I2BA 1PYOA 2Z2JA 4HPXB 4KO1S 4UD6A 2JFQA 4YBRA 4RA9A 4AUNA 2GCOB 4FDLA 3VR6D 2EW2A 3KTAB 4DNXA 2RE8A 4D4JA 2C2GA 1K0FA 3OX3A 3T3DA 1JBEA 1EXNA 3UKDA 3KUCA 5ER9A 4ER5A 1YVDA 3HKCB 2P4SA 1JG7A 1A5ZA 3HKCA 4S0ZA 3THYB 1W0KA 1JLMA 1NJGA 1VQ1A 4DZRA 3LUCA 3R4VA 4KPYA 1K6EA 4ND6A 1SG6A 1ECPA 4IY1A 3LCRA 3SGLA 4JLVA 2WF6A 1C8LA 3UVEA 2P6OA 3R7FA 3WO1A 3H3FA 4MWCA 3MWLA 3PQ2A 2CHUA 4BYGA 2H92A 4HB0A 2N0SA 4HG2A 2IXBA 5A3SA 2D1FA 4L5YA 4HN9A 3QEMA 2KM1A 5A1JA 4FLMA 2X0NA 5IMSA 3QVVA 2CD7A 2ZJ8A 3ZDRA 3UGKA 4BVLA 4DLSA 4XUDA 4F9TA 4P8RA 1NYQA 5FQOA 3O9ZA 3A1VA 1XZMA 2WMYA 5KC9A 4I5EA 3KQHA 3FW1A 2GHTA 3JD1A 4OO3A 4R5MA 1UPUA 4NJOA 4PBRA 2Z08A 4GWKA 1K3TA 1AGPA 1P60A 3VTZA 3I2HA 5DM0A 5GQSA 2NXEA 1O58A 1K4YA 1ML4A 1Q21A 4RY0A 4PRLA 4EHDA 4BO3A 5A1TA 1E1YA 1QYIA 2QRUA 1T9BA 4KQMA 2ZE7A 4ND1A 2BM0A 4X62B 3KQVA 1ZUIA 3SWWA 2FQYA 4RKYA 1E3TA 2YASA 5DI3A 3TGPA 5BO5A 2OXIA 1FX0A 2OBFA 3GB9A 3KQPA 2RB5A 2IY8A 5M29A 1YXMA 3ZWXA 4WSOA 3RJZA 4XD7A 1XDSA 5CK4A 3Q9LA 3GHYA 1QCCA 5C7YA 3ZWMA 3V7NA 4GPEA 3BMCB 3LBFA 4W7SA 3P9IA 4R84A 4TQGA 5DISB 1OZAA 1M0SA 1LEHA 1WB5A 4NY1A 4AZ0B 1E66A 4B7CA 5I7SA 1X70A 5T4EA 4PAOA 1NMSA 3PGJA 1W73A 3UJBA 4NC9A 5CIQA 1P2FA 2I2CA 1M34B 3KZCA 3VR6A 4C7BA 2WPDA 2PX6A 5KTOA 2YDXA 4KTTE 1NRIA 1JHVA 3D7LA 5JMPA 1G2QA 2XZPA 3E9RA 1UPAA 2NP7A 2FMKA 1HT0A 1XVLA 5CM8B 4FZRA 5BQXA 2GJSA 1G20B 2CLSA 2Z95A 4L16A 2FFHA 4CTJA 1VRVA 2P90A 4OJMX 4G09A 1Z68A 3W3ZB 2BBWA 1A82A 2VT2A 4P81A 1T2NA 5GZ3A 5ITZB 5B6JA 1Z74A 3JWJA 2IHBA 1LTQA 1ZVQA 4P2GA 4Z0HO 1E5VA 4AROA 3MOIA 1WA5A 4R7TA 3ZS8A 3P9SA 5HK8A 4RK7A 1KQPA 1H69A 1SXJA 4I0WB 2P0YA 3Q2OA 4IQGA 1FDVA 4TV9A 2P4EA 4MEBA 1Z5NA 4NATA 2FCRA 3DM5A 1L9XA 4NDZA 1UMDA 3OHSX 1G16A 1GAEO 2FR8C 1D7OA 2GQ0A 2ZRGA 3OPYA 2PZKA 1SOMA 4RC9A 4ZYXA 2NADA 4LJLA 4YMUA 3C3DA 4RY9A 1XJWA 1FLDA 1FFWA 5COQA 4CTMA 1W5AA 1Q1QA 2Z83A 4MWDA 2WQZA 5KU7A 1J4AA 3FLEA 1V5WA 2QLNA 3T1QA 4DLLA 4N9WA 4MVJH 4FFLA 3THWA 3LTEA 3JD0A 1LRJA 5LZ7A 1T0HB 1ZOOA 1NRWA 2GM9A 4FFRA 4UNNA 5FD8A 3BTOA 1PKXA 4JYMA 1AH2A 3P2YA 1XTIA 1B8NA 1F6WA 2YW2A 4GX5A 1N3LA 4Q4LA 4K6CA 3L7MA 3DEIA 4TT8A 3QM1A 4MCHA 3TTXA 3WB0A 4AG5A 5BPFA 1DG9A 3BTVA 2P5SA 3D8HA 2XE7A 4RIHA 4XWTA 4RVNA 2FSUA 1E6LA 1F8GA 1NQ5A 3B51X 4IWNA 3RQIA 4EUSA 4EUFA 1WVIA 1G3UA 2PD6A 2GF9A 2V7UA 2YN0A 3KD3A 4DDVA 5C8XA 5JNWA 2QTBA 3LW7A 4BUZA 3BCSA 1QIDA 3L0BA 1UPTA 4LJYA 1U11A 2QR3A 1TO6A 4IOMA 1E7MA 2R6JA 3ADKA 3RV3A 1O89A 1XF9A 1BTOA 3VO8A 1UODA 3KR9A 2Y3IA 3ZXXA 5JALA 1V5FA 2B1QA 4DCGA 1XX6A 2ZAIA 5BN3B 1OQAA 1Q2XA 5TSDA 4KGDA 1TZ2A 4ATNA 4I1RA 3STUA 3TLCA 2FKNA 1SG9A 4AYXA 4CMIB 3NHLA 2PR7A 4KN5A 2D1QA 3ODPA 4MV0A 3NZEA 3OSUA 4DDKA 5K2OA 5DP2A 5LN1A 4JT4A 3IV6A 3RDPA 3QYJA 4RHTA 4Z3KA 5CLJA 4TMVA 1XPRA 3C41J 1HLDA 4FKZA 1HFWA 4GSLA 4S12A 2J3LA 5CDFA 4AVYA 3SVLA 1XTRA 3Q8LA 3HRIA 4UATA 5GZ6A 1UWKA 3CH7A 3QVTA 1N2IA 3AFHA 5E0OA 3W1WA 3OLQA 4AP9A 5HYVA 1RRVA 1TD1A 1SPXA 1OI3A 3IH5A 4GOJA 5ARDA 2BF4A 1DGQA 1ZM3A 1ZLYA 2D2XA 1IM2A 3C8ZA 1LX6A 1Q15A 1V8DA 2PXXA 4CKYA 3HXKA 3GEEA 3R3UA 3L8YA 1Y48E 2P2LA 3QVGA 5J5AA 3EGXB 5ICSA 4GE0A 1Q19A 4MV9A 4B3JA 4EZIA 5LFAA 4BXOA 1WBJB 4UAGA 1S3GA 2JFUA 5M3BA 4M9CA 4P0TA 1NWHA 5CAEA 4AMUA 5AKZA 5AKLA 5M5BA 4MR7B 2JJYA 1QQ6A 4RD6A 4C0SA 4IGKA 2QLFA 3OZAA 2ONJA 1AMUA 3D4LA 4MTCA 2YXDA 5BMOA 1QSGA 3S81A 1KI8A 3PGKA 5AHRA 3KVYA 1HYEA 2GJ8A 2YC4C 3P8ZA 3AUUA 3FMPB 3T5TA 3MTQA 1WXWA 1UKCA 2GF0A 1LBIA 4J0DA 1PCXA 4DJDC 2WG2A 3HPQA 2HK8A 4BB5A 3EXFA 4FYYA 4Y9TA 5ERYA 1G6Q1 1ZJJA 2QM3A 1XT6A 2CVOA 4M0FA 2ZI6A 2UZ4A 1L0BA 3S99A 3TKYA 2PUEA 3F5DA 2PUGA 3F46A 3CUVA 2CYCA 3U4QB 3KELA 3ELDA 4R9RA 2FRVA 3SHWA 5TEVA 2C95A 3E84A 4DCNA 3MLEA 2C97A 2LDBA 3M9WA 3PDIB 5BRAA 4JKYA 2DKNA 3A2LA 3B48A 1NBME 2YRXA 2D8AA 2MSNA 3ORHA 4IZ6A 3SSNA 4E11A 2ZI9A 3DW1X 3UBMA 2HQ1A 1D9XA 2NSHA 1U4SA 1BSVA 2YWJA 3BD8A 3CZCA 2YV2A 1X74A 5ENVA 3RU3A 3SHTA 4DMUB 1VHWA 1GUZA 3UW1A 1VKRA 4WN9A 3FVVA 1LNSA 4QELA 5TT0A 2XLBA 2DM6A 1E1QD 1K5PA 2WM3A 4JI2B 1CVIA 1GQQA 4PXYA 3PL1A 3L79A 1E2NA 1N0WA 2UYHA 1PEKE 1V5GA 2VZLA 5HGJA 2CHFA 3W8NA 1E58A 3UWDA 3BB4A 4QSMA 2G17A 4FWTA 5CCEA 1QHHA 5DSXA 2GUWA 4G4SO 2JANA 4YC7A 1U0SY 3FPJA 2HWXA 4G0VA 3CUUA 4B3BA 2EG9A 5CLHA 4ZI7A 1OWPA 3OY7A 1L7AA 5HRUA 1KSJA 4OQQA 4J0EA 2WHPB 4JP3A 1NXXA 7MDHA 1ZI9A 1JIIA 3AB7A 3DKPA 4DRXA 2PT9A 3BBPA 3DCIA 1CV2A 2I34A 4OP3A 3TTUA 1I7QB 1MX5A 4IGFA 4G07A 1C3OA 3UAWA 3A11A 3JQ8B 2EZ9A 2F8MA 2H08A 1ETUA 4NWIA 1JR3E 1XI2A 1NOKA 4OHXA 1IBCA 2XITA 4R9UC 4EQ6B 2WYWA 4EHIA 3AHHA 2G1UA 2Z57A 1PGQA 1CYDA 3A1UA 3E2MA 4IYRA 2EWMA 3T1OA 1VI5A 4KRXA 1QCZA 3TO5A 3S1SA 1NBEA 1W87A 1O57A 2JK0A 2PQ0A 1IZZA 1JFFB 1YRQA 4UDYX 4DQKA 1GPDG 3IUNA 1V1JA 2R86A 5BUSA 4EI2A 1YIDA 2JFYA 5K1ZA 5JH7A 2NXJA 4BVEA 3IIJA 4EUHA 1KI3A 1PG0A 2QRPA 1EWYA 5KVCA 1I0IA 1E1LA 3SZUA 1XHEA 2V7EA 1WUHS 4EARA 2J3DA 3W90A 4PS1A 1UADA 4MX8A 4S1TA 5DNCA 3TLEA 4CPDA 4YJFA 4YJFB 3P0JA 1K5GA 3IEVA 3OQNA 5LM3A 2G9NA 1INLA 3GR6A 4UMFA 2R79A 3TLBA 4BMZA 4I8XA 3UT5A 1QVWA 2GARA 3I62A 5HKOA 5L7WA 2ZS7A 3EIQA 1WQ1R 2Z56A 5CRIA 1Y6JA 4Z86A 3T5CA 1P77A 4L57A 2D59A 4I1PA 5LLDA 4MJ3A 3VU9A 4OHKA 2NNLD 3OZCA 2FEXA 3R6TA 5BR4A 3WZMA 1XZCA 4HN2A 4DILA 1XD2A 1XP5A 4IFTA 5C5EA 2ZAYA 4ICIA 5CFRA 3LWBA 4UUPA 3VBEA 4L50A 4QC2A 4TVSA 4FGKA 4MPJA 1VSUA 4RU1A 1F7UA 1NFQA 1Y82A 3P94A 3GBSA 2E82A 2WVAA 3KJEA 1M8PA 3K9BA 3VAZA 4P0QB 2GFQA 1VG9B 3MA0A 3QW2A 4N65A 1P81A 2HSJA 4EENA 1KZHA 1X8KA 2AKAB 3R6GA 3MRTA 1MC1A 4MTLA 3AXSA 2GYUA 2WB4A 2RB4A 1BAPA 4TXMA 2P65A 5JEEA 2B5VA 3ILYA 2BF7A 1A2OA 4B46A 3PTAA 3A3KA 4P3PA 2AB0A 4REQB 3MELA 1KPGA 2XQVA 1DIOB 3DFUA 3HLKA 3HV0A 5AOVA 1RC0A 3NRCA 4D3SA 2RARA 4XDZA 1PS8A 1QYWA 1NPDA 1ORRA 1SQ6A 5D85A 8ABPA 4QBKA 1XCLA 1ZICA 4IXWA 3C6ZA 3TQTA 3V2HA 2DC1A 3ROXA 3QE0A 1PQPA 1WDTA 2A3RA 2YIDA 2WZBA 2QD4A 3R3XA 4D0LB 1WW8A 3ZOKA 1TU0A 5HXAA 3VHRA 5I51A 2HB6A 3OMWA 3EW7A 1LJLA 1DJLA 1JDJA 3F7MA 4XCQA 3CW9A 1SAYA 3EXG2 3HY6A 1H42A 3PC4A 1NF2A 2PKXA 3H97A 5JQGB 4QPZA 1QS0A 4EYEA 2O54A 1X7XB 1WXEA 3AG6A 9ATCA 1Q6ZA 4QUKA 1KMHB 2GH1A 3GVCA 1OB5A 3KD2A 1FYXA 1EM8A 2YMMA 5D86A 4P34A 1SBIA 2AOXA 1U02A 2A1UA 2YV3A 5LQSA 4IIJB 2WWYA 2CV0A 5FI3A 3A1WA 3GFRA 4Y1FA 3IURA 2OM6A 2WFLB 3ISVA 4IM7A 4YMSA 3TGWA 3CTMA 5B64A 2XWJI 1DL5A 4GXRA 4FEYA 2W2KB 3EIWA 2XTNA 5FFFA 1Q7BA 1X7WB 3QU5A 3SF0A 1HH4A 3BERA 2GO7A 1GKYA 2BZGA 1FTQA 1L5NA 1LGYA 1T5LA 2HDNB 4JT8A 4BO1A 4K28A 4D8TA 1UFOA 4MCAA 1GGEA 4FMPA 2OO7A 4KXVA 1D2GA 2HRRA 5ALGA 2VH2A 2XE6A 4PYJA 3HJFA 1K2WA 4U4AA 5ED4A 1G60A 1BU5A 1V0JA 3FAKA 4LZLA 4BNVA 3KLOA 2XB8A 1YZHA 4YXWA 3KJZA 5B2FA 4TUYF 1G8JA 3Q6IA 4Z7OB 3AFIA 4QE3A 5JT1A 1M2NA 1P4HA 1X39A 2UYGA 3IT3A 5DHAA 4QBIA 1CU1A 2J09A 1WQ3A 3G23A 1P73A 3EGOA 2MSDB 3HWWA 2QJTA 3ND7A 4D9JA 3QPBA 1JPNA 2IPLA 4BP3A 3ZS9A 2QI9F 3A9TA 5F7ZA 3TTTA 2IPNA 3ZE9A 6REQB 2ZR7A 3NI2A 3ROPA 1W4RA 2XMPA 3DMDA 3WGKA 4F9GA 3QVGB 4IJQA 3T41A 4BX2A 1BXZA 2PNFA 2TYSB 1AS0A 1MPTA 1YDGA 3PGMA 3HU2A 4K8RB 3FLAA 3OWHA 2X5NA 4IDBA 1WCWA 4PRZA 3TB4A 1UP7A 2A30A 3PLAE 2K4MA 2NPFA 2MSLA 4JP2A 1FZTA 2W11A 4R3WA 2JHPA 3WL4A 1NR5A 2B2CA 3SDSA 2GLUA 3AR5A 2DKOA 1B0ZA 3S2YA 1NVWQ 2FP4B 3P32A 3K70B 3V1MA 1EP1B 2QX6A 4OB6A 4Q48A 5EMLA 2QP9X 1AUPA 1WLYA 1O4WA 3ONNA 4MLPA 4Q00A 1T8UA 3UT0A 1GJRA 4EHNA 3D02A 2Q8PA 3O8QA 2B20A 2Q4OA 4KVGA 4LGMA 1HG0A 4ZJYA 4LNHA 2E85A 2GBLC 4FEGA 2Q07A 2JH8A 2QMZA 1IY0A 5DSZA 1F7VA 2FRDA 2B25A 2YOFA 3ADCA 4TYYA 4HDKA 2WOOA 4LRUA 5ADUS 1XZGA 2AFHE 1GFZA 4ZVKA 3BGVA 3UK2A 1WVGA 3AIMA 4QVIA 1H1LB 5JS6A 5K09A 1MCZA 4PAWA 2QMOA 2Q49A 1D6NA 2EAUA 4OHVA 2GTIA 3NXSA 1TEHA 1V3VA 3LP5A 4HAOA 4RKRA 3U60B 5AKKA 4A1FA 4B34A 4Q66C 1MV8A 5CFZA 4QUBA 2OZVA 3OM9A 4TLLB 5TEWA 3D7SA 2F43A 2ODTX 5IVPA 3FSRA 2ZIEA 1NSYA 2RCNA 3PKZA 4B7AA 3EQ6A 1O94D 2ZLBA 4NABA 1WSAA 3KLPX 5T7BA 3DTYA 4EBBA 3C4JA 3KKMA 3L7YA 4YR9A 2NT3A 2QJFA 2C42A 5IJ9B 3QEBZ 1ZO8A 2ZYGA 2DWQA 3IP1A 1KJJA 1HE3A 1J42A 1CFJA 4C05A 5FOQA 4ZHQB 4ZXFA 1UKVY 1NGSA 2VWQA 1OLUB 2V9ZA 1X1RA 1ZHFA 4IQ4A 4PXSA 2G1JA 4K9PA 2ORWA 4MW0A 4DL9A 1A9SA 4YCLA 2QAGB 4TLCA 2VDWB 3C5VA 1JP7A 1G5HA 2UZ0A 3JZAA 5AJVB 5L3ZA 2NG1A 2VOEA 4A73A 5IT4A 1L4LA 1ZN8A 1DXHA 2W71A 3HNPA 3AY0A 2NUPB 4N41A 3VR2A 3M34A 4JXZA 3GG9A 3N28A 3K0BA 3E18A 1ULUA 2YHIB 4MR9B 4O4JB 4Z2AA 4MV4A 1TAHA 2ZOSA 3MWYW 1T9KA 3I4CA 1NT2A 2NO6A 3HEAA 4B6PA 2GN8A 4IICA 4KO2S 3UW3A 3PX2A 1ST2A 1KI2A 3C8UA 1MIOB 3CRW1 3ETGA 4H9GA 1GLGA 1JQKA 1YMVA 3DAHA 2CLEB 3IMFA 4I08A 3FPEA 1Y6RA 2EGHA 4IVQA 1W2GA 4KIWA 2JDID 3I9V1 4LQ4A 4P4TA 3SU8A 2VUUA 1OXBB 2FDCA 1OXKB 4KWCA 2JF0A 2QQ0A 4FNMA 1YQXA 4E3ZA 2WWWA 5JO9A 3COSA 3LAWA 1IATA 3UAOA 4I8DA 3LYAA 2F1JA 2XUPA 4L5BA 5DWVA 5KNDH 2C92A 1L4FA 1JDBC 2G4VA 3LPCA 3N3BC 4B0OA 4K46A 3AYXB 2O20A 1YAJA 1N0VC 1CR2A 3QENA 4KWEA 1DIHA 4Q15A 2XOEA 4N01A 5AO9A 2WHEA 1M67A 1WIWA 3HO8A 3NEJA 4HWOA 4RVOA 3FWPA 5DRYA 3LD9A 2XMRA 4U2FA 4Y2PA 1T2CA 1YT5A 2GAOA 2C9ZA 2CYBA 5B1HA 1LFDB 3C1TA 4ZKEA 1T2DA 2H11A 1CY8A 5HUHA 4PZPA 1A50B 2MIIA 3PUXA 4BNKA 3UMJA 4IF4A 4LSZA 3RVJA 4C7JA 3H2JA 1Y8QB 1YS1X 1T5TA 4G5RA 4MMXB 2X7HA 4UTOA 4B8WA 1OASA 1V7CA 4JIGA 4ZO8A 5HKBA 4I46A 1SD5A 4ACBA 4DNOA 3IODA 1R8XA 1A0OA 2ZJFA 4AU1A 1YQ9A 1TQDA 2I3GA 1QZZA 3ML1A 3EMKA 3FMOB 4BO9A 5DNAA 5HRCA 1O96A 5HJ5A 3UHPA 1TW3A 2F64A 1P3JA 3WNQA 4CM4B 1SR8A 3B60A 4D5EA 2QRNA 2WU0A 2IXGA 3HKBA 4LWZA 3VPAA 2MMGA 4AM8A 1J1UA 1J90A 1BWPA 5DTMA 4BLTA 4L4YA 1FFGA 2PVCA 3ADPA 3O95A 3PP8A 4K6OA 4WUVA 5GJBA 1T9CA 1PZGA 4ARSA 4JJ7A 1CJUC 2H2DA 4OX9B 4GYKA 1JFRA 4Z1OA 3GXOA 4YO7A 1LB1B 2GVZC 2P62A 4P31A 4V1CI 5JH7B 1NT4A 1IBKB 3AL0C 3HYCA 3G7NA 2W6IA 1DAHA 2OWDA 4IEEA 4BX3A 3RUAA 1L1FA 1WXXA 2QPLA 1DRWA 3WOVA 4HZGA 3P20A 3UJAA 5JOQA 2A5GA 1I6KA 4A16A 3HA7A 1QAMA 4BN0A 1TM4E 1TQ6A 1TUBA 3ILVA 4G5SA 4RNDB 4D9BA 4CR7A 3HI6A 1XZKA 1Q16A 1QB8A 3LY8A 3UT5B 3MGCA 5FCDA 3UYKA 2C5LA 1Q1GA 5T64A 3U9SA 4IGIA 4MP3A 5DASA 5DTQA 2WAXA 3HFGA 5F2EA 5FUBA 4R8MA 1LLDA 1T13A 1Z7YA 1J06A 3RRMA 5L4LA 4WOPA 1P45A 3LBNA 2QN6A 2F3RA 2GZ2A 1KK2A 4DE5A 3ZBUA 1BFDA 5CJPA 3WK8A 1GNQA 3PFHA 1KZ1A 3D3QA 5DGTA 4AMYA 3ECCA 5FOWA 3PKIA 4DUPA 3SEZA 1R18A 4TYWA 4GOLD 1BE8A 4FDUA 4ARUA 3EGCA 3F3KA 3LYUA 1EUDB 3HG7A 2AUNA 1XAHA 2IYSA 2JGAA 3FNIA 2PK3A 3KOUA 4NCKA 3M4XA 4WUTA 1IUKA 4OQMA 1USWA 2PKYX 3VU8A 4XARA 1V3UA 5F73A 3WXBA 3AL3A 1E6CA 3VGJA 1DXOA 1U2EA 3PI7A 5CHEA 1DWQA 2C57A 1X1QA 1IZ7A 2QD3A 2J46A 4RIGA 4R2WA 1FXWA 3HJBA 1P6UA 2IK8A 3JQ8A 4Q9KA 1LNZA 5J2TB 5ES4B 2OGZA 1M8GA 4TV9B 1BEUB 2DR3A 4RPGA 1B93A 3UJ3X 1QH0A 1MAAA 2HU5A 3NHKA 1L8QA 1UUFA 2Y1GA 1Z2NX 4HWSA 4KXXA 3ROEA 3RYTC 4TLEA 4RVGA 1CQZA 2CF5A 4P80A 2XYQA 2Z5FA 3QMWA 1P0IA 2FHSA 1BHJA 1BHQ1 1RI5A 3KQTA 3ZIDA 4LBWA 1EZ1A 1PR4A 5ER6A 1C1DB 4W9MC 3D6TB 1AKUA 2HBYA 4CDGA 4F1KA 2O7QA 5JADA 4L75A 2WY2D 5BQPA 4IWXA 1KKLA 3E27A 2UZ1B 4HI0E 3SE7A 1PSZA 2D0IA 3C7AA 3EUFA 3K0AB 4FLEA 2I6GA 1V25A 2ZWIA 4J4HA 1S2DA 4CUKA 5SZIA 1GDTA 5CM2Z 5G0SA 3E61A 3ZX5A 4HPWA 4MLZA 1T5SA 1JG6A 1QGZA 3ZCTA 3MXTA 1FSSA 2X42A 2XTJA 1T43A 1W0CA 2XHEA 4HNSA 4AF6A 4Z4IA 2ZRIA 2C3UA 3EARA 5CA0A 2PKQO 5DHTA 4Q4JA 4FR0A 5HEKA 1WY5A 3LC7O 2IE0A 4Y98A 1KAHA 1LWOA 2I2AA 4LDNA 3MJ4A 4D1YA 1VL8A 4NQRA 2QAGC 3MGBA 4MJ7A 3EZNA 5HS6A 1R6UA 1PV4A 2PMKA 4PC1A 4CU2A 4F6RA 3BGSA 3OU7A 2CFRA 3TNLA 4BFYA 4Q4CA 3C4VA 4DLPA 3H7AA 1AQYA 1ZH8A 2ZKIA 1QAQA 5TR9A 1CE8A 3L8DA 5CA1F 3HNOA 2XZOA 1EZZA 4NKRA 2O8FB 2BDUA 2RGAA 4DJEC 1W6RA 4IJVA 4WMLA 1KH3A 3DLBA 1CF2O 1VTKA 4AULA 1XQYA 4UBLA 3W06A 1QRTA 2Q62A 2X1VA 2AN9A 4RGQA 4BN5A 4DV7B 4CEHA 4EJFA 1ESMA 3JAKA 4CMIA 5HIMA 3P9QA 3V5NA 3WL7A 4HNAB 3ZQ4A 1NYRA 4UVEA 2I62A 2XPCA 3R5KA 2KQUA 1GCGA 1WXIA 2NZXA 4BMDA 4F6CA 1DAEA 3QUCA 1E6EA 1E2LA 3R7NA 2EBHX 1QJCA 5AQ1A 4XWKA 3PGLA 1RZUA 3GEMA 4DADA 4JV5B 2WJWA 3G0IA 3E7PA 1KMCA 4HUJA 2FSGA 2H0QA 2VDMB 2XF2A 2Y66A 4CLDA 4AO6A 2CY0A 2QVZX 4CIAA 5J4KA 4LF7B 3L0IB 3U9LA 2ACVA 1FZQA 2ZVQX 3RNOA 1MXFA 3FBWA 4YB8A 2VYQA 4FN5A 5EE9A 3Q72A 4WASA 1NW6A 5KWIA 4W5NA 3ZTWA 3ZU4A 2IV3A 4K9DA 2H1OA 5AT1A 4B6RA 5IZCA 1W76A 1X8LA 4N0EA 4O4LB 2JFHA 2ZXUA 1RYZA 5AIBA 1XAJA 3M6AA 4JJZA 1VHJA 5EWMB 1OKKA 1OLUA 2I54A 3RSGA 3T15A 3SFZA 4RFLA 4V0NA 5LDDC 1UBEA 3T3MB 2UUBB 5L3RA 1T2AA 1LI5A 2B83A 3VM6A 1XRPA 1XF1A 3EG5A 3GPIA 3HV2A 3N2GB 4QECA 4FHDA 3WP1B 5ILGA 1FUEA 1XL1A 2IW1A 2NZVG 3I2KA 4H0CA 4EL5A 1EYZA 4PIMA 2XOKA 2Y6UA 5BSGA 2OAQ1 2Z1NA 4MICA 2ZYWX 3FA2A 4ASUA 4EQZA 4EW2A 4RORA 2FK8A 2FU5C 2JI8A 3C74A 1XBTA 1KFEB 1YZFA 4ZK6A 2CFSA 3A36A 3A6HA 1EJBA 3QFRA 4C6TA 6GPBA 3EASA 2GEFA 3DC7A 4XTRA 1WRBA 2IHJA 2VS1A 3KPWA 3M33A 3L4BC 3QEAZ 3ETLA 1TCUA 4EEKA 1I4WA 2J6BA 2QN1A 3II6X 1DBSA 1KVTA 3RFTA 2GJ4A 4K9SA 3MG9A 3P4UA 3ZVNA 1U2ZA 3K7EA 1WOMA 3FDFA 2AMVA 1UM8A 5D7NA 4WNAA 3OETA 5EMJA 2XUJA 1BE1A 1B16A 2OV2A 2XNHA 1JU9A 1L7DA 3EF3A 2PMBA 4Q4HB 4B81A 1KA9H 4PWZA 1KR2A 1G9TA 1RXSA 1CERA 4H35A 4XQGA 4FUTA 5FPTA 3UV6A 4C4XA 2Q27A 5JXWA 5KNBH 2VSYA 4FZJA 5IS2A 4ZANA 1NQOA 1HQCA 1QIFA 1EWVA 1MVOA 2NZWA 2VTEA 2NAFA 4KW7A 4A10A 4CMEC 3H99A 3RNLA 5TGTA 1U0BB 1H2HA 2ZITA 3I9LA 2A9JA 3WS7A 4X84A 4HGNA 5HE9A 2XMSA 5KQRA 4DVGA 2FW1A 2SKEA 1A98A 1FNSA 1K8YB 3CR7A 1AB6A 4N6GA 3OEEA 4FN4A 4HEA6 4Q82A 4EYKA 3O3MB 3ZVKA 1SD1A 3HR8A 3JV7A 1R9JA 2PVPA 3KKNA 4YPOA 1YACA 4IFBA 2ZJ0A 2BEVB 2NV0A 4WZAA 4V0RA 3SLKA 3ST7A 4C3UA 4QVGA 1T10A 4EB8A 1FB5A 4G5XA 2RFLA 3DZGA 1W30A 4MV6A 1XMIA 3SDZA 1SCIA 3FKJA 3QHQA 1K27A 4E1VA 3F7TA 2IELA 4LN1A 3NHSA 4H7JA 1RHKA 2Y4NA 3BE5A 5JVDA 1P5HA 1NN5A 2P77A 4FGSA 4L28A 3VR1A 1I5OA 1J8QA 3GJ7A 5E38A 4OG2A 1L5MA 1HDZA 5DYGA 1VCOA 1HQYE 3PENA 2AYYA 3AEQB 1Z12A 2R1UA 4RFSA 4WINA 5EQTA 5FNVF 4YWHA 3BC1A 2PD3A 3RLIA 2D8MA 5KVVA 4MS4A 1K3FA 3OX1A 1EX7A 1T5DX 2AQKA 3SSAA 4ZJPA 2IP1A 4QYWA 5H16A 5E1DA 3NG1A 1PJ3A 3MTAA 5INTA 1ZGHA 1SEVA 1NTOA 1T4CA 3N2NA 1T5IA 4MKIA 4H7IA 1OMOA 2FX3A 4ZVPA 1L8LA 2X40A 3D4IA 2PUVA 1CC1S 3MS2A 3NRJA 3PNMA 4GICA 4Q1EA 4X97A 2WJHA 3F8SA 4QBGB 4OHBA 3VOBA 3WK7A 5E2BA 1N5OX 2HYIC 5D3QA 3OZWA 2QE7A 4GX2A 2FI1A 3Q3GE 2JEOA 2OXCA 4X7BA 2QTNA 1L8AA 2HTEA 1E4YA 1AHIA 5AK3A 1HLPA 2LIVA 4HFMA 4EH1A 5JC8A 1G7CA 3ZTYA 4RLSA 1AX9A 1FNBA 1LF0A 2AR7A 5KEIA 3A05A 3IOEA 3NUGA 4L6AA 5AHKA 3GP8A 2DQZA 4LSMA 4E5SA 4V24A 1YB1A 4Y1EA 2HRZA 3CQ9A 3G2LA 4FSDA 4QXAA 4OLAA 1EFDN 5DVZA 2IH5A 1H4SA 3M6VA 4MVJD 4URXR 3S7ZA 1XQVA 4B1FA 1UC4B 3QELB 2ZFUA 2YJ4A 1MW8X 4JUAA 3UENA 5CT8A 2GZAA 2R8OA 5P8WA 5I7HA 2XGSA 4J7XA 5SYMA 4C30A 5ALLA 2V5UA 5CD9A 2BFAA 4M60A 3VPFA 1V3TA 1DTEA 1JWBB 1Y3FE 2EKPA 2W2PA 5HZGA 4Z9AA 5COBA 4JL5A 3P9XA 2QDKA 1E7SA 1OXVA 1Z0JA 1IN5A 4LDQA 6ABPA 4JITA 1M6VB 2FFAA 5BSFA 1W36D 5EXXA 2OV4A 5KNBA 1R6BX 1TAGA 3ET4A 4LTMA 3G2PA 3DLTA 1VPDA 3CX8A 3O92A 3O8OB 3WGOA 2RONA 3CURA 2XNDA 4X64B 3ZUGA 1OW3B 1LW6E 1NV8A 2W6NA 3H5OA 1JALA 2LW7A 4EABA 1Z0AA 3C7DB 3P97A 2AG5A 1RHQA 3JU3A 3W2TA 3W6UA 4QUEA 4MUKA 1T2FA 5FJJA 1Q44A 1TLFA 3N07A 4E70A 1FUYB 4LY3A 1ABFA 3IAS1 1G8MA 4L07A 3RASA 3KZXA 2FLKA 4FS8A 3VR5A 3P2JA 1JE1A 1XP8A 4NU5A 2ZSBA 1OTYA 4Y6QA 5EKSA 3ZHQA 4JT2A 5H82A 4YPVA 4B6EA 4KACA 2DCMA 1XCGB 2VT3A 4MVJF 1H8EA 3E4CA 3MNFA 4PANA 3VHXB 3QKSA 3LZCA 3O4JA 2FMFA 4RX1A 3A2NA 1L6IA 2C2OA 4QQRA 5BYJA 3WBFA 4CF3A 3AUTA 3LT0A 3LP8A 4IDDA 2F8LA 4Y0AA 1N5LA 2DU8A 2X23A 4FHFA 1QG4A 3TTWA 1N2CE 5AW7A 2FQ1A 2Q2VA 2OPBA 3QHAA 4LDJA 1LPBB 1YJBA 1XL0A 2IZ5A 1MFZA 2EV9A 3B1JA 5FWXA 3EIOA 1PVOA 4FGWA 4QBTA 2VP9A 3FTQA 3PRJA 4OK6A 3TXYA 4BJHB 1L5KA 2N1MA 2X4DA 4XWOA 1NDQA 3MSCA 1DIBA 3DF7A 2TS1A 2HREA 5BT9A 3PFGA 4G65A 2GPYA 2FF5A 3RANA 4EKEA 1M83A 5A2GA 4YHBA 5FRDA 2EJWA 2HMTA 2CFOA 3S3TA 2JLCA 1UMBB 2ZUCA 2H9YA 1TE2A 3I9OA 5CG2A 4LISA 4XUGB 1CKEA 1ZU5A 1IY9A 4CLHA 1VSBA 1QV9A 1E79A 3OJCA 5DXJA 2O8BB 4R2MA 3R24A 1ULBA 1ADGA 3W04A 4Z4FA 3K2IA 1BU8A 3QG5A 1CUZA 2G5CA 3CJRA 4DWJA 1EFPA 3O0DA 3QKWA 3UWOA 1N5IA 3K94A 2IP2A 3QA3E 3U1VA 1JXQA 1YOVB 1JZSA 3FCYA 2GN4A 3FDXA 1TYZA 2QGNA 2V74B 4M1EA 3GRAA 4OBXA 2WSSA 4L5AA 2C1EA 4X41A 1ZI6A 4HB4A 4NYMQ 3DEJA 3RTAA 3HLYA 1K7EB 4UFOA 3N7TA 4R2HA 4MMYB 3CF4G 1XRQA 5J59A 1XZAA 4NU6A 4LTDA 3GY0A 4EJSB 4ETIA 3UGQA 1RFLA 3A28A 3D6UA 1YONA 3GCGA 3HYRA 4BE9A 1V6AA 3TTYA 3K0SA 1OHHD 4JZKA 4TMZA 4Y67A 4ZTBA 1S2OA 4ZU3A 3ER8A 1A9OA 1JEDA 2EHJA 3H1BA 2QVYX 1SNYA 2QN7A 1LPAB 3X3HA 3IKLA 5K4AA 4BQOA 1GUBA 1XZIA 1B4DA 4AKHA 3V00A 1BXGB 1O77A 2D1TA 2HSDA 1TK3A 4JMPA 4V0MA 4PFQA 4YCJA 2XUQA 3KB1A 3OJLA 1KOLA 1Y5NA 1OKKD 1LQTA 1RYMA 4FBMA 4PHTA 3FNFA 2FPMA 4EX6A 2OK7A 4UVGA 1KAOA 3DVRX 1LA2A 5FL3A 4CG1A 1H9CA 3WBJA 1JYFA 3HRHA 2W22A 5E6RB 5BW5A 5LQNA 2LE0A 3RCBA 2QT0A 4AZVA 3ZX4A 1P0FA 3DBIA 2XSZD 2B21A 4AK9A 4PV7A 1ZXBA 3DB2A 4JNKA 1RLIA 3KOOA 4DA7A 1QGED 3BILA 3BMNB 3DKIA 3QX7A 3DMTC 4MWOA 1M2VB 3CISA 1N6PA 1YUBA 3DEAA 2P6RA 5IJZA 1Y7PA 1QVZA 5FO1A 3RRFA 1UPBA 4B71A 1JHOA 1QTRA 2OKCA 3FIJA 3L0DA 4HBZA 3DOEA 3ZHZA 3NC0C 1VBFA 3ILXA 3HJGA 3FPBA 3RC7A 1J99A 1MO4A 2ZYAA 1M0EA 3LWZA 5JROA 2H3EA 3B9RA 2NYVA 3VKFA 3E5RA 3CVYA 2Q6TA 1U5AA 2DPHA 5A9SB 1XEFA 1EVEA 3S2ZA 1T91A 1SKUA 1V8FA 1VMEA 2QP3A 1NLMA 1EFRD 3A32A 3A4LA 4BO8A 2WUVA 5HQTA 4WFJA 4YONB 4PLZA 2DR0A 1XC7A 2GJ9A 4DWWA 4I3HA 5EKUA 3PGA1 3PHJA 4QPDA 3NAQA 4WECA 3PQ5A 3ZJVA 1K68A 4XDHA 2CLMB 4ZYZA 1W4ZA 4DV5B 2P3LA 1W44A 3JWIA 1TM7E 4ARAA 1DOAA 5DM70 4FVTA 3FN4A 3DAFA 3KT6A 3PRKE 4F7WA 3EULA 4IOKA 4D0SA 3OFNA 1DEOA 3BWVA 1T26A 2FXIA 1MHTA 3CV3A 5AI4A 5KREA 2RAUA 3SQNA 1KFKB 4MDYA 4GGOA 1U5CA 3K92A 1R5OA 3VC1A 4PONA 3ZKWB 5A06A 1XNGA 3IUYA 5AW4A 1U65A 6ADHA 2Z58A 3IRUA 3NBAA 4U7GA 2YUIA 2EU8A 2ZBFA 3CH5A 5F78A 2RJ3A 1DO8A 3GROA 3PJRA 3HEMA 4CG3A 2XBLA 2MSCB 1DKOA 4X6LA 5JVDB 4DQXA 1UH5A 1QCYA 3G85A 1DCMA 1SCJA 2VDOB 2P2GA 1EJ0A 3AKYA 3CWCA 4EQ6A 3FCXA 4HHEA 1XEWX 3IB3A 3FB1A 4UNPA 5IKOA 1DXQA 1PVDA 4BMYA 1AO3A 1GCIA 1X92A 2QRHA 1TFUA 3KJHA 1DQSA 1G0OA 1WLSA 4HAIA 2ZJ3A 4YAJA 1IY2A 3KVOA 3B5EA 4DCUA 1FMFA 3H0CA 3T7EA 4CNQA 1GGFA 3TQIA 5DTJA 4CN9A 2EF1A 4ZEMA 4TXJA 3AO0B 3SHFA 1QHHB 1CXZA 3HH8A 4ZHQF 3C3KA 2ZRAA 2HF2A 3C4QA 1QIIA 2XI4A 5BWCA 4KAAA 4MWSA 2J59A 2Y77A 1KMIY 3COYA 3G88A 3QPUA 4I4TB 5AH0A 4R1NA 1EESA 2P30A 4BZZA 5EXPA 2FSSA 4MYCA 1MNAA 5GTDA 2RGXA 3OZSA 4ZODA 3FOFC 1OAOA 1U9CA 3O2JA 1FE8A 4HAVA 4I50A 1AK9A 1P39A 4I9NA 4M0UA 4BQEA 1WMEA 2WWGA 1QBKC 1UMCA 1Y8CA 3GAMA 3T3IA 2Y1XA 4BMVA 5BV0A 3GFGA 2BKUA 3GEIA 3HB5X 4M0MA 4E03A 4IXTA 2GR9A 5C37A 2OV3A 5FUYA 2NV2B 3ZD7A 2VDNB 3L1HA 4OIMA 3PGVA 1GPWB 3F5QA 3LWDA 3MSXA 4D43A 4CTOA 1KY2A 4GDMA 3U5ZB 5YASA 4H15A 1PDVA 2A1UB 1Z8DA 1M1YA 2IYNA 4N0PA 2OPHA 3TZEA 3OFND 4ZYYA 1ZR4A 2YHUA 4WHMA 2X0IA 1GIAA 1AV7A 2CFCA 1IY8A 2FHPA 1YBFA 5TS2A 1VBKA 1DBVO 2PGNA 2BUCA 2DHRA 3BWMA 3SP1A 2Y67A 3RVPA 1YS2X 1K75A 2VLIA 5CNJA 4AKEA 1E2HA 4EMTA 5J58A 2ORYA 4G9GA 4AS3A 1DAGA 4CU5A 1J33A 4HDOB 1XNHA 3K8YA 3KEOA 3PYXA 1JSZA 2AMJA 4NR0A 1J0DA 1IVYA 2JLSA 3VZPA 2ZRPA 5I9IA 3LUGA 4GP7A 1Z56C 4UNSA 5HM8A 1DG1G 5LQCA 3RSHA 4FDTA 1JT2A 1K6JA 3WYBA 1SUSA 3IBCA 3LG2A 2LPMA 2UUOA 1SK8A 3JD4A 3BXGA 4IQ0A 3NIDB 4G56A 3AJEA 3BS4A 3GO4A 4ZT4A 5JSUA 4E2YA 4C6SA 3B36A 1GILA 4PYLA 4DB2A 1OF1A 1VBMA 4KIJA 3KQSA 4YIKA 4QREA 2MYUA 4NCBA 2IYLD 2HK9A 2XNSA 2F2TA 1UEIA 2BI7A 2BGLA 3K35A 4RJKA 4YGXB 5AM2A 2DVMA 1UANA 5HW0A 1CLEA 1ONNA 4L95C 3AGPA 3CCBA 2AI3A 2PH3A 1KDOA 5EUCA 2I78A 3GGGA 3B70A 1S8FA 1DAKA 1Q7EA 1YK0A 5KTPA 1XSEA 3JQFC 4KDEA 5F3WB 4YBZA 5FOVA 3OQMA 2W48A 2YNMA 3RKRA 4FNAA 5JV5A 2E0IA 3WYEA 3L6DA 3PWSA 2NN3C 1TEVA 2NX2A 421PA 5BWOA 5BVGB 1PNQA 4CL8A 3G9ZA 2UZIR 2AXPA 3RUIA 2ECFA 4NCJA 2FLVA 3BCUA 3L8GA 3FI9A 4LSWA 3TR6A 4A2WA 4QGSA 1D2CA 3F3MA 4ZAWA 1EINA 3KKQA 3OPYI 4F72A 1Z28A 2P9JA 4D9FA 3RTBA 5L7YA 4XJTA 3MOSA 5BYAA 4BV3A 5TDHA 4RHCA 1U0TA 3RBXA 1GWNA 2PKQP 3F7NA 2IYFA 3FYHA 4Z53A 2DWOA 1T3SA 3RB8A 2RGNC 2XEDA 3WWDA 4EY4A 4EMBA 5BOVA 1X1SA 3MHPA 2IDZA 2NVOA 3B7WA 3O7MA 2BISA 3WE7A 5JZBA 5DLPA 1T0IA 3DD5A 3CJQA 3IMCA 1OJLA 4UC0A 5IVIA 1TLTA 3LHIA 4R41A 2IEYA 4LKRA 4QRHA 5DDIP 4QOJA 1CRZA 7REQB 3KOMA 3RQSA 1W0JD 1JQJC 1NVVQ 1SHJA 3E8XA 1PFGA 3HY3A 4DMLA 1JSRA 3S8YA 1W36C 3DZKA 1VFNA 5JTTA 1QOPB 1PLKA 4B4WA 5CYPA 4KWTA 4RSHA 1U9IA 2IVZA 3F6PA 4RPIA 4C3VA 1L2TA 1L7OA 1NVBA 2OZKA 3DV0A 3SS7X 1SBTA 5JQGF 3N0RA 2B35A 1PP4A 3I37X 3VSCA 1YOVA 5IF3A 1ESZA 2JBAB 3K6RA 3FJYA 4IHJA 3BRQA 4JROA 5C8YB 2B94A 2PX4A 2UUPA 4RESA 5MN6A 4CEIB 1DJMA 3ZWBA 5L3SA 4QDJA 1LDBA 3MCWA 2ZUSA 1KIFA 4HYTA 2MCFA 3WYNA 1VMDA 1XE3A 3PS9A 2IUTA 3S1AA 4P3XA 1N9ZA 2VK2A 3ICVA 2F62A 2OAEA 4UBNA 4YT2A 1XYVA 5U9CA 2WU8A 1XEWY 2YNMD 3IVAA 2P6UA 3M89A 4GXTA 2DSTA 3I3OA 4AZ3B 3D3NA 3U7HB 2BCEA 2WPNA 3ORQA 2RC6A 1R27A 2WABA 3C5EA 4M9ZA 2X9GA 3V34A 2ZKLA 4N8EA 2B34A 3COWA 3D6VA 5IDQA 5G1OA 2PBFA 4F04A 1IOVA 1Z2PX 2PQMA 4LF5B 1ML3A 1Q95A 4D74A 1GO2A 4UCFA 2NVUA 4Z51A 1A3CA 1E3JA 1ZOIA 2RG1A 3CX3A 2IYUA 4H6VA 3ADOA 4KV7A 2H07A 2F1IA 2FQQA 4LA4A 5AFSA 1AKVA 1GXSA 2J0UB 3MHTA 2F4VB 3EC7A 2ANBA 3GLHB 4ER0A 1CWUA 4F2WA 5KPDA 1E2DA 1QXSA 3JPWA 2A33A 2W6JA 4DM7A 4LG1A 1SIUA 4LX8A 3C5WP 3QLUA 4LHVA 3RRBA 3FVQA 3CVJA 1G63A 2W2LA 1JSLA 4PAQA 4P53A 3A4MA 1FFDA 2RBGA 1CY2A 4M38A 4X7RA 5DBGA 1HURA 3DTVB 3L7JA 3V80A 2JFXA 5U4QA 1KEUA 2ZG6A 3NTRA 1SZCA 3UH0A 4F8YA 3ZDQA 1PR6A 2JCGA 1IEXA 2DRIA 4HTAA 2VH5R 3BKWA 2QLLA 4XPZA 2J0SA 3RVOA 5KNCD 1G8YA 1M2JA 2HDWA 1FP1D 3PQ8A 3PB3A 4PWYA 3QF7A 3ZV3A 4WA8A 4JUFA 1LPMA 3ENQA 1WCXA 3KJNA 5F4BA 4DIFA 1TJPB 4LZOA 1SBHA 2HY7A 1Z73A 2AQ8A 2GFIA 1NUPA 2RHLA 1ATZA 1NLFA 4RPLA 3WP0A 5ITSA 4I4CA 5AK0A 3DEZA 3E5MA 4KIGA 3GBVA 1D4FA 4CCWA 4H1VA 5EIXA 4JI7B 1JIQA 5IAKA 4EB6B 2DBZA 2I91A 5GADl 2ZRKA 2H65A 1XDBA 5DT9A 1NU8A 5DWDA 4IZIA 1NIPA 2ZQYA 4M7RA 3IBSA 3IUSA 3KKKA 2NWQA 4F56A 5DN6A 2R47A 3E0QA 4KYIB 4ECEA 1IXZA 3ZE7A 4O4IF 4RGYA 2XYRA 2BUBA 3VC2A 4FONA 5JJCA 3DYBA 2Y0DA 4LHYA 2ZCVA 4QNMA 4F3YA 5JO0A 4QEZA 3NM5A 2JKYA 2F8SA 3D8TA 4CKBB 3X2EA 3IUBA 1ZK3A 2DCUA 3E70C 1A72A 3ET5A 1EIWA 3IE2A 3FM9A 1N2GA 3DLIA 3JS5A 5CB4A 4FFSA 3W5AA 4WZBB 4KQ6A 4LZZA 1B6TA 2YVLA 3NBYC 5CPFA 1IBSA 4Q19A 1KDVA 5JD3A 3F5MA 4JLAA 2W2VA 1RADA 7AT1A 5K3EA 4BQPA 2H5IA 2R4QA 4FSHA 1KEZA 3LFUA 4TSKA 4ADSG 5CDSA 1NJ2A 5FEMA 5IARA 1A7UA 2G5GX 5TJHA 4Q24A 1SU7A 3LT1A 2O2HA 4G84A 4B87A 3AJ9A 2PUCA 1GCUA 5LR6A 5TPZA 4ND8A 3AJDA 1RI3A 3B9QA 3ZWYA 3RIMA 5AW1A 5AUQA 3DE7X 2PZ8A 4GZ5A 4OBEA 2AKYA 1Z08A 2X9VA 1N6LA 3LX8A 1XAIA 2CK3D 2JKVA 5BQOA 4J0KA 4O2BA 3JQCA 4TS3A 3WA7A 2O2EA 4BPRA 1QX4A 1E1RD 2YINC 3FLBA 2DWPA 4J2TA 4UBOA 4YRSA 4LRSB 3FSGA 4WIAA 4B2PA 1GQ2A 1O96B 2E3JA 1BVYF 3B2EA 3DXFA 4PYMA 2GWRA 2FG5A 3DOFA 1AGXA 1ZH6A 4LOIA 3S4YA 4LS3A 4KFUA 4N54A 3X1JA 3L4KA 1Y98A 1YFZA 2HU8A 2A5YB 3GA0A 4RFSB 1JB1A 3AEQA 4JLOA 2PUTA 4ME6A 3ZHXA 1P4SA 1ZJ4A 4LYYA 5PNTA 3SKVA 3QVMA 3C3AA 1FW8A 3BK7A 4AX4A 3QF4B 1ORTA 4HLNA 3BIXA 1YAHA 3W0LB 1C1YA 3ORSA 4QOGA 4WDRA 2WFLA 4FMCB 3W2GA 3DL4A 2WJYA 1MAUA 1EFKA 1ZRSA 3FSEA 1CR0A 2BTEA 4DYVA 4AY3A 3WADA 2PLRA 2OY0A 3EY9A 4HEHA 5GONF 1C29B 3HJUA 5LIRA 2XUAA 4R0VA 3WQRA 2HZBA 1Q7GA 1OYYA 2FWIA 8AT1A 4A2QA 2ZTUA 3G8AA 3ABIA 1PSWA 1E6UA 5SICE 3W5BA 1KZ4A 4K8OA 3SG0A 2Z2ZA 1PW5A 2Z8YM 3UG6A 1TXGA 2HCBA 2Q6LA 3QU7A 3ABQB 1JILA 2EARA 2OQVA 1UP4A 4Q9AA 1M2OB 2GCPA 2Z2YA 4AB1A 5FWYA 2H8GA 2HUNA 5LP1A 1I7DA 1WG8A 2IHYA 2N1BA 3HKDB 3I6BA 4OH1A 1ODCA 9LDTA 3NDIA 3OQHA 3CGGA 4GOXA 3PPWA 1FSFA 1HXHA 5IDWA 1F12A 2TRSB 4LJ9A 4Z9BA 1SBYA 5A4AA 1ONSA 1N6IA 3CB2A 3RTEA 2HADA 3KSAC 3GMIA 3CVUA 2GM3A 2OOSA 4OAQA 3VI3B 5K3CA 5AIAA 2O2YA 5EMHA 2H0AA 2R6AA 3ZCQA 4DA0A 1UXOA 1OV6A 5T57A 5KNDD 4WY2A 3DBRB 4NG5A 2AXNA 2DGDA 3QXGA 4WFKA 5KVAA 2F55A 3M82A 4WBNA 4J16C 2YYAA 1V1MA 4IHQA 1SBCA 1TMKA 4H0FA 1DVRA 4HB2A 4QAQA 4WFIA 3I2YX 4LF8B 1I3OA 1PUXA 1Y9EA 2JL1A 3VR5D 5LD2B 3TQCA 2W6ZA 3O21A 1FRVA 2FUG1 3HKEB 2Y93A 1IZYA 1JIJA 1RM5A 3L7OA 4LJ5A 3PXDA 4NJEB 2FFJA 2XBMA 2ISQA 4D9NA 5KWVA 2H1LA 2HPVA 1RZRD 3WICA 1FC0A 4LXYA 2DR2A 5LQMA 1Z45A 4M6WA 2BFFA 4D4LA 4ALKA 4NS1A 3IDAA 4BGVA 2AXQA 4PS0A 1HOXA 2E5LB 2AKEA 4PQYA 4PZDA 4XYBA 4RWZA 2C5SA 2RIRA 4R1SA 3IAHA 1RKXA 1C0EA 4JI1B 2A4MA 5TQ0B 4KE8A 1I7LA 1KSGA 5LZ2A 4LMRA 2QW8A 5KBYA 3T4PA 2ILTA 2JJMA 2V6GA 3LDHA 1WM1A 4J7CA 3TPZA 4BO6A 5JU6A 5B36A 3IALA 1C0LA 5BRNA 2NVUB 4D99A 1CLUA 4UE3S 2OB2A 2R7NA 1H94A 1XZPA 1JZTA 2I7DA 3PK0A 3ZJYA 4BAUA 3CIFA 4ROSA 1G59A 4W82A 3FCOA 1AGRA 1YCGA 2BFBA 5KVQA 3UPTA 1WQ4A 2XAAA 3BGOS 1ONOA 4HDKB 3QSYA 4X45A 4YO8A 1VCNA 2C4NA 3IT0A 2NTJA 2D7DA 3OT4A 1NUUA 1GG9A 1PWEA 2IYYA 2YMPA 3CXUA 4MKHA 5EA2A 1Y1RA 2XYVA 3O75A 1TT5B 1MABA 3S2UA 2YJ5A 1JXMA 2AI2A 4Q6WA 5EEHA 1KP3A 5BWLA 1AE1A 4XFDA 2ZUVA 4DM4A 2JS7A 4H7KA 3V48A 4ZJZA 5C7OO 2I8AA 3BWBA 5HCIA 4UZEA 3EZ9A 1O9GA 1DCFA 4D46A 2Q7OE 3EBPA 1SKBA 3KQKA 2UAGA 3WLTA 2HR1A 1GSHA 2VRNA 4NVRA 1NY6A 3DFIA 1Y4ZA 3OPNA 3WYFA 2IOFA 4F6RB 2Q3LA 4MH0R 4XI9A 4N7JA 3CRMA 3EDRA 2AF3C 3FXAA 1GQSA 2I7CA 1UPCA 3ZH2A 2I2BA 4G8JA 1EEHA 4YJ2F 1OSNA 3GLIE 1FVHA 3ESDA 1XYGA 4G5FA 4ZQFA 2ZE6A 3W4JA 4ER6A 3IDSA 2P2CA 4JOCA 3NHYA 1AS2A 3UC5A 4AYWA 5E9AA 1C9DB 1HSOA 5IKPA 4Q4JB 3CH6A 2H4YA 4M36A 4M1WA 4GMDA 3OIVA 4EHBA 4UEOA 4CEIA 4MIKA 3A31A 3BAFA 5CH3A 5IVDA 5C8YA 4QYXA 4XR4A 2AE1A 3I6MA 1H4TA 3LCVB 3NGXA 1WS6A 3WVNA 4DAEA 2H06A 1RABA 4M3NA 2G7ZA 5G0VA 4JCOA 3HP4A 2X9NA 1BGVA 5K5EA 1I4OA 5JAUA 2RDMA 2Q0SA 2IHVA 2ZSJA 3E9DA 4S1NA 5U1PA 4LEIA 5AUOB 2CJYA 1G7TA 2ZBPA 2V5VA 3EZGA 3OX4A 3UQZA 5KYXA 5DYIA 2PJRA 1KI6B 1V8BA 3UIEA 8MHTA 3B1YA 3LUAA 3OU2A 3IT2A 3CLTD 3PTLA 4JYAB 3RT7A 1Y4UA 2GPNA 4NENB 2Q99A 1I6LA 3TNJA 2QRZA 1X7ZA 2IYVA 4XWGA 3WIEA 4BZWA 2GJAA 1JKJA 4HN4B 1SCQA 4OA8A 2I2DA 3GLFE 1GTMA 2KLHA 4RD3A 2C2YA 3M0EA 3HXTA 2FLWA 1GSOA 2IEDA 4RELA 4IZOA 3VO1A 3BWCA 2ZBRA 4H7FA 1LVHA 2MJLA 3X1KA 1JSXA 4BBZA 4YRFA 4G0YA 5DK6A 5EERA 1JHQA 3J80A 4DC0A 1B3RA 2XXJA 5LZ4A 3K0EA 4BBPA 2EZ4A 2XKBA 2O0KA 1DE0A 2A0YA 3SEQA 3LQ4A 3BFPA 2NPOA 3VKUA 3H5AA 5F51A 2JI7A 5TXGA 3B6JA 1SB8A 2FOIA 1JLSA 5ALMA 4AKSA 1NI3A 3TI9A 3ZWKA 4PSCA 1JLHA 1H9BA 5CXSA 3QVLA 2XODA 5DBOA 2W98A 4CDNA 2H2HA 2V7VA 3H2GA 2ZIXB 2NXWA 4HQ6A 1QG6A 1LPOA 2R7AA 1RP1A 3VR4A 1JLRA 1TO2E 5A0FA 3RS0A 1Z29A 1IB0A 4O5OA 5LNK1 2FSFA 4UMEA 3LIIA 3VU1A 3HB7A 3AVQA 3WWCA 1F4LA 1G5IA 1Z17A 3KKEA 3N8HA 4ZI3A 2RAVA 1Y3DE 3A4NA 5WRFA 5BWBA 1MUUA 2OFWA 1BOFA 4KJXA 4GI7A 3R44A 4OYYA 1C81A 4ZYVA 5ITWA 1GGNA 2R1VA 4F5YA 1VI2A 2OCGA 1X80B 2YFHA 4GRIA 4AMVA 1A77A 3L8MA 4TKZA 2ZT5A 3YASA 5MGBA 4HXGA 3C1UA 3JVUA 3C7TA 3GGCA 1H1TA 1H3FA 4E5VA 4HVTA 1FQOA 1CR1A 3ICWA 5FBHA 3SN6A 1GYRA 3ZZNA 3I32A 1RKVA 1M8JA 3K2EA 1BCRB 4HP8A 1HUQA 1D6MA 2ZSKA 5DM60 4CBVA 4CKXA 3ABRB 4QFBA 1RJWA 1Z38A 2R65A 3D3EA 4JSRA 4Y2HA 1ZGGA 4YUZA 1YRHA 4YRNA 4Q7LA 4BNZA 5KYUA 2YTZA 4JLMA 1KH2A 2BTOA 3V6MA 5LUBA 4PF1A 1VKNA 5HKKD 2JGIA 5JNLA 5TE9A 2WTUA 1FYWA 1G3MA 1C1XB 3IP8A 3IC5A 3KK0A 1CBUA 5IPFA 1CY6A 2BFDB 2GZDA 2OILA 5G1NA 5KSPA 4DFDA 5LPNA 5EY5B 3HN2A 3VISA 4BEJA 3HA2A 3R0IA 3DS8A 3FTEA 3WC4A 2OCIA 4KV9A 1OTXA 1HLGA 1WULS 2CMFA 4LUCA 1LK5A 1Z06A 4MQFB 4O3FA 2F1OA 3MM4A 5J1TB 3RJTA 3I09A 3VPDA 3I30X 1U1DA 4HGYA 1XVVA 2X19A 4FZVA 1E9DA 4S2EA 5JFOA 4MSUA 5B58T 1JAIA 2HMSA 4XLLA 1C5KA 1NA5A 2QJRA 1ODLA 4QOFA 5D1HA 1B8VA 5DNWA 1VSQA 4ZKDA 5ALWA 2BH2A 1L1RA 2Q9AA 2XQFA 1TGYA 1KMQA 3IIKA 3ZK9A 4XVUA 3SYMA 2Q1UA 1ZWLA 1MFPA 1RCUA 1NVAA 3MZ0A 1UOOA 2QR2A 3NHPA 2FPUA 2P68A 2C0CA 1UOPA 3FNBA 2OHGA 3PVCA 5CR9A 2BBTA 4YLEA 5DGCA 1QUEA 1RWMA 1ZRMA 4PO9A 1SQ0A 1G21A 1FFBA 1P72A 1SPBS 1Z5VA 2JLQA 4UREA 4BGDA 2Q3EA 2XZLA 1K4KA 4MI9A 4EMUA 1G6OA 4E7PA 1BWRA 2OTCA 2DULA 5IUKC 4W8GA 2M1ZA 2J5QA 1PKEA 5KNCA 1Q3TA 1Z34A 5FBLB 4FFPA 4F84A 3F49S 4WLUA 3IPCA 4U9HS 1MF7A 2H7VA 2NTNA 4D4HA 5CDGA 1Z4JA 1L4MA 5L95A 2GPTA 1FBNA 1XFDA 5IULC 1W4LA 2VJBA 1N0UA 1UPXA 2P5TB 3DVLA 4FZ5A 3DHNA 1RNLA 3SZOA 3IEMA 1E1MA 2DLNA 4BE7B 4X8MA 3D2AA 4M99A 2G6TA 3RS5A 3LVRE 2YJ3A 2BDEA 4PN7A 2UVQA 4B6QA 4I55A 1OH6A 1P61B 3BULA 3QFTA 1CY7A 2YZGA 4HDAA 1ULTA 2EJCA 121PA 3P0EA 4IZHA 2ZTSA 5JI3E 2C5GA 4FNGA 1J0CA 1EUQA 1WZUA 5CMLA 4RYDA 2SHKA 2VG8A 1SQGA 4NK5A 4YMLA 3DCYA 2G3YA 1P31A 3RVRA 3O1JC 2C0QA 1DXYA 3OQIA 3UWKA 1GPKA 5BUZA 2FPGB 1H6CA 2FR1A 1YQWA 3DMPA 2COUA 2A3NA 5JAQA 4EL0A 4JC4