4LXGA

Crystal structure of dxnb2, a carbon - carbon bond hydrolase from sphingomonas wittichii rw1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
276
structure length
274
Chain Sequence
b'MFEQFESKFIDCDGIRTHYIEMGEGDPLVLVHGGGAGADGRSNFADNFPIFARHMRVIAYDMVGFGQTDAPDPAGFAYTQAARTDHLISFIKALGLSKICLIGNSMGGTTACGAALKAPELIDRLVLMGAAVNISPDDMVADDLAAVMSYDGSEEGMRKIIAALTHSYQPTDDIVHYRHEASLRPTTTAAYKATMGWAKQNGLYYSPEQLASLTMPVLVLGGKNDVMVPVRKVIDQILAIPQAIGHVFPNCGHWVMIEYPEEFCTQTLHFFGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MCP Hydrolase
publication title The Lid Domain of the MCP Hydrolase DxnB2 Contributes to the Reactivity toward Recalcitrant PCB Metabolites.
pubmed doi rcsb
source organism Sphingomonas wittichii rw1
molecule tags Hydrolase
total genus 92
structure length 274
sequence length 276
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lxgA00
4PO3X 1C7JA 5ALOA 4CCWA 1HPLA 1KU0A 4PQEA 4FTWA 5HK8A 3B12A 1OXMA 2XB6A 2G5TA 1E5TA 4BDTA 5K3CA 1DWPA 1T2NA 2C4HA 3KXPA 4N5IX 1XRNA 1ZIYA 3MGAA 2ZJ7A 3VISA 1JU4A 3BL8A 5FUMA 1K8QA 2DCMA 3G9UA 2PKYX 1FFCA 4H35A 2JGKA 2JGJA 1K4YA 1P0PA 1THTA 4J03A 3I2FA 5F4ZA 4JUIA 3EBLA 2ZJFA 3C5WP 5ALFA 5JAHA 3WKAA 4JH0A 1AUOA 4E46A 1AX9A 2AJLI 4J3JA 2WUEA 4G1FA 3HSSA 1HDEA 2BUBA 2BGRA 1L7AA 3ZPXA 3RK4A 2XUFA 5CT8A 5C8XA 5EIAA 1EHYA 1QTIA 3HJUA 4FLFA 3S2ZA 4UFOA 4QDZA 4CI9A 5ALNA 4FNMA 5J3JA 2EDAA 3FVTA 1TCBA 4C6HA 4H7HA 3ICVA 3N0TA 5ALEA 1K63A 4PSDA 3PUIA 4QDXA 3C70A 4QDTA 1EDBA 1ORVA 5IVIA 4B9AA 5I8PA 3H0CA 2RGUA 4MXDA 4ZV9A 2ORYA 1UKAA 4QA9A 1EB9A 1MX1A 4DLNA 2QUBA 2WFLB 2BUCA 2XMZA 2XMCA 4N8DA 4AZ0A 4WDQA 2B20A 1YB7A 4B81A 2C5FA 5K3FB 1XZHA 1H2YA 3PDCA 3VJKA 4H77A 1ZJ4A 1GKLA 4H18A 2VT6A 5DNVA 1QZ3A 2XUIA 3W9BA 1ZIXA 2R11A 1YB6A 1TCCA 2GYUA 3ZWQA 3FLAA 2PSJA 3AZPA 4J7AA 1QIGA 3H2KA 4OB7A 1N1MA 1XKLA 3V1KA 3I1IA 3WK8A 4Q3LA 3SX4A 3B3QA 1UOPA 3LLCA 3CN7A 3W05A 1A88A 3CCBA 5LZ8A 1K6EA 4WY8A 4OU4A 1R9NA 4J0DA 3D2BA 4QDUA 1R50A 4FOLA 4W1QA 5KBYA 2G5PA 2I78A 1E8NA 4IO0A 4HVTA 2WM2A 1EK2A 4QLAA 2XUAA 4BVJA 3H2HA 3V1NA 2ZJ6A 1A8QA 1IUNA 1BU8A 2PM8A 2XLBA 1VKHA 1QFMA 3DD5A 1CR6A 3BE8A 1XLVA 5HF9A 5AI4A 2VAXA 2XE4A 4OUKX 5CTAA 4U2BA 2IX9A 3O9MA 5AICA 4IHAA 3GA7A 1EX9A 1Y7HA 2ROQA 1MNQA 3WK4A 4U2GA 5ALMA 2Y6UA 4XVCA 1QGED 3O4HA 4EHBA 3ZLVA 2V97A 1J06A 4KJXA 3FYUC 4H7KA 2WFLA 2WUFA 4X71A 2B61A 3WWOA 1A7UA 2WG2A 5CW2A 5K3DA 2CJPA 2HU7A 3KD2A 5K3FA 2XUHA 2WUDA 1JMYA 3ZLUA 1MT3A 2QTBA 4OB8A 3X3HA 5E4JA 4P9NA 1ODCA 5JALA 1VA4A 5HF8A 2Z3WA 4HTAA 1EB8A 4E15A 3FLBA 1ZJ5A 5AK3A 5FDFA 5LZ2A 3R3WA 4IH9A 1GKKA 1P0IA 1W6RA 4GEGA 3HC7A 5EI5A 3JYHA 4C01A 1E89A 4QZVA 4RNCA 1BS9A 1J1IA 4G8CA 3M81A 2OGTA 3G9TA 5T4EA 4BTLA 5LP1A 4FMPA 2BCEA 5AOBA 5CXUA 1FFDA 1TQHA 3FOBA 1X70A 5DLPA 5ALZA 1H2ZA 5AI9A 3FVRA 1TRHA 5AI5A 3WKDA 1XZAA 5CT6A 3W04A 5AM5A 2WU3A 5DTJA 4KAFA 4F5ZA 4PSCA 1BCRA 3RKSA 1BN7A 4BCBA 2WLSA 3PICA 5ALUA 3JWEA 3E0XA 1QONA 1WHTA 3H17A 4M0EA 3C6ZA 1QTRA 1ZGCA 1Y7IA 5ALYA 3QPCA 4BBZA 2O7VA 3DQZA 3K2IA 4NS4A 1TCAA 4B0OA 3WQHA 2B9VA 1G42A 3ESDA 3LP5A 4MQLA 1IZ7A 2Y1KA 4UPDA 4PNZA 2OCGA 2WHQA 2H1IA 2XQIA 1UKCA 2O2IA 1CLEA 3RLIA 3WWCA 4OU5A 4KRXA 3WMRA 2FJ0A 1ZD3A 5CBKA 5AM4A 4MEAA 2CUTA 1XZJA 1YSCA 5AP9A 1JT2A 4DMFA 1WPRA 1DTEA 3VVLA 1CUAA 4YPVA 4ZXFA 4X97A 4DSZA 5IVKA 1F6WA 1LNSA 2OCLA 1UOQA 4FBMA 1IUPA 4I3FA 1GGVA 2C0PA 3WZMA 5DYYA 5H3HA 2W22A 3IULA 4P93A 4DNQA 3O9VA 4GI1A 2WHPB 1CUGA 2JGEA 1EVQA 1BCSA 1T4MA 5C8VA 5EFZA 3O0DA 3ZI7A 5HFAA 1ZI8A 1MJ5A 4KE9A 2HADA 3LIIA 5T4BA 3DCNA 2WFZA 3ZLTA 4GBGA 2OPHA 4CG1A 5AK5A 4JYMA 4C89A 1CUVA 1DX4A 4FKBA 2JEYA 1X2BA 4X6XA 4P92A 4H7FA 4Z49A 1M33A 4X3CA 3GFFA 1XFDA 1QE3A 3MUOA 3ILSA 3G7NA 4QNNA 2QOEA 2ZYIA 3G0GA 1R3DA 2XLCA 1TIBA 3ANSA 1MX9A 5HQ3B 4LYEA 4HS9A 2WFMA 3C8DA 5ALKA 2YASA 4J0GA 1VE6A 5D6OA 2FX5A 1WHSA 4PF1A 2CKMA 1TAHA 1E3QA 2H9YA 4TGLA 5LZ9A 2OGSA 1DQZA 3R3ZA 4Y2VA 4BC0A 4QWMA 5CRIA 3W2TA 5ALDA 2WQZA 4KE6A 3O4IA 4KAJA 1A8UA 1ZD2P 3Q0TA 1W1IA 5K3AA 4WFIA 2ECFA 3FCYA 4OB6A 1LPAB 2BAGA 2BFNA 3LS2A 1K5PA 2HDWA 3WZLA 3AIMA 5CURA 2RHTA 1S8OA 3H04A 2CMFA 2YH2A 4FLMA 1QIKA 2WHPA 1MX5A 4J0KA 3IB3A 4ETWA 1DX6A 4ZRDA 5ALWA 4AXBA 4X93A 1IVYA 4BAGA 3EQ9A 2O7RA 2JF0A 4AO6A 3LIPA 3DOIA 5K3EA 3A6ZA 1XZBA 2XMRA 2DQZA 4MWTA 1QIIA 4NVRA 5ALJA 3IUMA 2Y2VA 3QM1A 1UOOA 4Y2PA 2HA2A 5E4YA 4X6YA 1ZD4A 4KAAA 5CT9A 4MYDA 3WL8A 4A16A 3WLAA 4H0CA 1LLFA 1I6WA 3TJMA 1CUFA 5JD4A 1XZDA 1UK6A 2XQGA 4BRSA 2VT7A 1GT6A 5LZ5A 2WIJA 5CH3A 1UK8A 1FSSA 3AINA 3V1LA 1LPSA 5LZ4A 1JJFA 4Y9SA 4Y2JA 5HQ3A 4H7JA 3C45A 1J07A 4EUSA 4BE9A 2PU7A 4BVLA 4OYYA 1KU6A 5YASA 5JD5A 5AKXA 1NX9A 3M82A 5FOQA 2QT9A 3WKBA 5JZBA 1ZOIA 5EHZA 4BYMA 4S0XA 4XJVA 1N8SA 4TVKA 2HFJA 4UHCA 2QXTA 2VJBA 4GLBA 5ALVA 3DEAA 2GBIA 4JNCA 4Q3OA 2JEZA 2XI4A 3BIXA 3OTQA 4EB0A 4F0JA 3I2GA 1SCKA 2PSHA 4UBMA 5AKLA 5ALRA 1XRLA 3C6XA 3GUUA 4BP9A 2OAEA 3QMWA 4MYSA 4MEBA 1JI3A 3E4DA 3R0VA 1JKMA 1F8UA 4GW3A 5JYCA 1U4NA 5AK4A 2OQVA 3H2IA 2Z5GA 4UFPA 4I4CA 2C7BA 1ETHA 5A62A 5AI0A 1PJAA 1U2EA 2GZRA 3TRDA 3DOHA 4FFWA 5JATA 4CG3A 4EY5A 4BDSA 5JZSA 2O2GA 4PSUA 1BN6A 1DWOA 2GZSA 3HABA 4EA6A 1WB5A 2BJHA 3ICWA 5AIBA 4C4YA 4LXGA 1BRTA 3QH4A 5CMLA 5EHQA 2YXPX 1IZ8A 3CCCA 2NW6A 4ZWNA 2YYSA 4F60A 3DLTA 2DFPA 2HA0A 3KWFA 2ACKA 2HU8A 2XUGA 4LXIA 1OCEA 4AB1A 4EZIA 2GBGA 1QIFA 2XMBA 1Z68A 1XLWA 3WA7A 2WJ3A 1GZ7A 3ED1A 2QVBA 2VTVA 2OGZA 4RGYA 1CUHA 1W75A 1XZKA 3EQ8A 3GZJA 1XRQA 3WYNA 1L7QA 2XMSA 4CCYB 5HKAA 1XZIA 4RPCA 4B80A 5AM2A 3KSRA 3MVEA 2X5XA 4DMCA 4WJLA 4E11A 2OCKA 2RHWA 5FP0A 4B85A 4AZ3A 2JGLA 4AQDA 3F9CA 1X2EA 2E3JA 3ZV7A 1E66A 4G5XA 4U2EA 2Z3ZA 3IDAA 2WSLA 1XQXA 1AGYA 3H2JA 3PE6A 3V48A 1N5RA 1VXOA 1EDEA 4XX1A 1USWA 4ROTA 2C58A 1CUYA 3FBWA 1EA5A 3WWDA 3D7RA 2K2QB 4QEKA 4WFJA 3PF9A 3G0DA 4FDMA 3QBJA 1W52X 3R3YA 5AOCA 1QLWA 3V1MA 3WWEA 1DU4A 2JGMA 3H1BA 4KE8A 2AJCA 1XQVA 2W6CX 5HFNA 3C6BA 3HRHA 3WK7A 3Q8WA 1VA5A 4M0FA 5DJ5A 4B6GA 3EF3A 4Q34A 1LZKA 1XQWA 4X6UA 1XZMA 5IVHA 1EI9A 1Q0RA 3WA6A 3HXKA 2XUQA 5FXMA 5AI8A 3PFCA 4BVKA 1SCIA 3D59A 2H7CA 4QWWA 5A7HA 2I03A 5EGNA 1XKTA 3A2LA 3FLEA 2OLEA 1QOZA 3A2NA 4YX9A 4Q82A 2VQ6A 1NU6A 5AKHA 4AN1A 2GBCA 2WILA 3I2JA 2PSDA 3WYDA 4CCYA 2X8BA 3UUEA 2C5GA 2XT0A 4W1PA 2HA6A 3WK5A 1B41A 3OC0A 5IVDA 1QJ4A 1CIJA 1PV1A 2ZSHA 3V9AA 4EBBA 5AKZA 2PVSA 5AHXA 4OD0A 3SK0A 2Z8XA 3FNBA 1A8SA 1JJIA 3IUNA 1CUUA 3D2AA 3PI6A 2ES4A 3K9BA 2PUHA 4HZGA 2AJ8A 3R3XA 3FYTA 4J0HA 4OYLA 3HI4A 4G9EA 1BE0A 3NWOA 3A2MA 3IVMA 3AFIA 5AJHA 2V96A 3G9ZA 1VOTA 6YASA 4UHHA 3DKKA 4X91A 3DYVA 4RE5A 5IKXA 5A2GA 4BAUA 4X94A 4DNFA 3ESCA 1H23A 4L0CA 1Q0ZA 4X90A 4HAIA 2WG1A 3PF8A 4UFNA 5BV7A 3OM8A 4J0CA 5FLKA 5FKJA 2PBLA 4W1RA 4LHEA 3DL7A 1AMNA 4INZA 4DGQA 2ZVDA 5FPPA 2ZYRA 4B9EA 1AZWA 4B0PA 4BZZA 4H7DA 4Y2TA 3HEAA 5AKKA 3YASA 4Y2XA 1U8EA 5CT5A 1XRMA 4PV7A 2WTNA 4CIAA 1G66A 2UZ0A 4AMYA 4NMWA 5JIBA 3DJYA 1XRPA 2WJ6A 3PFBA 4Y2YA 1FJ2A 3AJAA 4K6KA 3BDIA 1CUSA 2WTMA 5JADA 3IUQA 4L3WA 4ZREA 3B5EA 1G4HA 2WG0A 1O6FA 2BKLA 3I6ZA 3BF7A 2RI6A 4FLEA 4QDOA 5HF6A 3L1HA 1VZ3A 1LPMA 1RWQA 1GPLA 3G9XA 5BWBA 5KWJA 4U2DA 3H18A 4GWLA 3U1TA 2XUJA 4AMZA 3BJRA 4OPMA 4ARBA 2DHEA 3WJ1A 5LZ7A 2AJDA 5LKRA 3WWPA 4B82A 1UK7A 2H7YA 1CRLA 1P0QA 2WUGA 1YASA 1VXRA 3QITA 4HRYA 1YA8A 3T4UA 4A5SA 3L1IA 2QJWA 2WIDA 2QKYA 3CN9A 4AO8A 5C81A 2OCIA 4BB0A 3C43A 1MU0A 2D5LA 3RM3A 2ZSIA 1JU3A 1HBJA 1HLGA 1MNAA 5DTIA 2XUOA 4YASA 4Y2RA 2ACEA 3N2ZB 2CB9A 3WI7A 5D3KA 5JANA 5ESRA 2XQKA 1XZCA 3MUNA 1B6GA 3H19A 4DNOA 3I6MA 4X7BA 3KWJA 2HA5A 3AZQA 1EVEA 4B7ZA 2XUKA 4FFVA 4DM7A 2WU4A 1YS1X 3BF8A 1FFBA 4ZGBA 1RYYA 1QFSA 4N8EA 3WJ2A 1DQYA 4D9JA 1QIDA 3D0KA 4HXEB 3WIOA 3QPDA 5EHXA 4HXGA 3FSGA 1YA4A 2XDWA 2VAVA 4KACA 1CUIA 4H7EA 5ALSA 3VXKA 1FFEA 5HCUA 4DNPA 2Y2UA 3I2KA 4O08A 2OAGA 1EDDA 1AURA 4MJ3A 5ALPA 5DNUA 4QLOA 5JARA 3F67A 4UHFA 5T4HA 5AM3A 3D5EA 3JW8A 1ODSA 1CUWA 3WKCA 5JAOA 3QMVA 2EDCA 4DTCA 4JYPA 2WKWA 2PPLA 4AN0A 1FFAA 5A6VA 1LPOA 3R3UA 4I19A 3A70A 2LIPA 1DT3A 3G8YA 5AKEA 2OQIA 5SYNA 5AI6A 5KWIA 5AKYA 2CZQA 3F97A 5LIPA 3AIOA 1VZ2A 3C5VA 4C4XA 2HU5A 2QXUA 5AKJA 2OXEA 4WY5A 2QS9A 3TEJA 5HK9A 5KREA 1LZLA 4EY4A 1LBTA 1VJ5A 3KOOA 1CUJA 4OSEA 1C4XA 2Y6VA 3UMJA 5C7YA 2HM7A 2PSEA 1HL7A 4P08A 3STYA 3WKEA 3STUA 4Q05A 3DKRA 1D07A 1VE7A 5IH7A 5FRDA 3HACA 2VF2A 1LPPA 4UHBA 3IIIA 3QMMA 4KE7A 4GXNA 4BATA 5AH0A 2DHCA 1CUXA 2Z8ZA 4K6GA 4W1SA 3NOXA 4DYHA 3D3NA 2WIGA 3VKFA 1QO9A 4HXFB 4X00A 4UBIA 2QUAA 5AM1A 1OILA 1ISPA 4LIPD 4G8DA 3W9UA 3GROA 1WOMA 1GQRA 2EEPA 4MQMA 4UBLA 3BDVA 3U0VA 2CEKA 4AX4A 3KDAA 3AUKA 2QM0A 1YS2X 1JJBA 3TGLA 3EQ7A 4U2CA 1LBSA 3FYUB 4BCDA 2QZPA 1LGYA 4C88A 3BWXA 3QVMA 4LYDA 4BCCA 1ZD5A 5ALGA 3QZUA 5LLSA 5ALXA 2VSQA 2HA4A 4L9AA 2VJAA 5DNWA 2J3QA 1XZLA 3R3VA 5EHNA 3H1AA 3S8YA 4Q1VA 4UUQA 2AXEA 3GELA 2GYVA 1TK3A 4G4GA 4KYVA 3P2MA 1H2WA 1IUOA 2I3ZA 2IIVA 2HL6A 1XRRA 2ZYHA 1DINA 5DYTA 4BE4A 5I7UA 3STTA 2QR5A 1JFRA 4G9GA 1MAAA 1H22A 4XIIA 1XZGA 1GPNA 2O2HA 4AO7A 1QO7A 1EH5A 3AZOA 2XQFA 1CQZA 1SOMA 1WB6A 4L72A 3HLKA 3F96A 4J0JA 1KEZA 2GBFA 1F0NA 3C8HA 3VDXA 1R4ZA 4DSAA 4OCZA 2XUPA 2DHDA 1CUBA 5LYYA 4E14A 2HRRA 1UKBA 3LCRA 3AIKA 2XMDA 5JD6A 1MN6A 5E2IA 1MAHA 2CBGA 4ITVA 1LPNA 1P0MA 3OOSA 2OG1A 4BZWA 5CH5A 3RARA 4ZV7A 3G0BA 4LXHA 1YCDA 5AIAA 5ALTA 1SFRA 3L1JA 4BTVA 1Y37A 1U65A 2XMQA 3SWWA 4Q3KA 2J3DA 4B83A 2BGNA 4JEIA 1EINA 3FYUA 1PFQA 4BAZA 4F21A 3QYJA 1XZEA 4W63A 2HA3A 1WB4A 4CFSA 3IURA 3W06A 5DYWA 4IH4A 1CUCA 1THGA 5AM0A 3I6YA 3NUZA 5AKIA 5ALLA 1R9MA 3O4JA 4MWSA 2HIHA 1UT6A 3M83A 2V98A 1UWCA 1BEEA 2RAUA 2VA9A 1CVLA 5CT4A 2DR0A 4TPKA 2XQJA 4K2AA 3DNMA 1O6GA 5JZ9A 2WHRA 1GXSA 3I28A 4H7IA 3FAKA 4G4JA 2VEOA 2HRQA 3ESAA 4X95A 5C8ZA 2HHAA 1DT5A 1G5FA 3DS8A 2R8BA 2WIKA 3BJMA 2PSFA 4N8SA 4W9RA 5LKAA 5BWCA 4J0IA 1LPBB 3NGMA 3QPAA 1CV2A 3STVA 5A7FA 4KEAA 2ZYSA 5A7GA 1DWQA 4EY8A 2RONA 2JGFA 4IH1A 2Q0XA 1ZGBA 2PU5A 1QIHA 3BIWA 5EIHA 3G0IA 3ESBA 2B4KA 2QRUA 3I2HA 1ZICA 2FJPA 4ZI5A 3D4LA 2VJCA 3WL5A 3GBSA 4EY7A 1XLUA 4GECA 5AOAA 2GYWA 3STWA 3BXPA 3SC2A 4V2IA 4X85A 3DDUA 4ARAA 3DL4A 5DWDA 3O4GA 4Y2UA 3VJMA 2DSNA 2PL5A 1QIMA 1CUZA 2J4FA 1ODTC 2G63A 3K6KA 5CXXA 2IITA 4Y2SA 4KR0A 4IQ4A 5D7BA 1XQYA 2QMQA 2HFKA 1N5MA 1CQWA 2HA7A 4GHWA 3STXA 3T52A 1MO2A 5HZGA 3FWHA 2JGIA 1EK1A 5E4TA 1BEZA 2AJBA 2RIPA 5JASA 2JIDA 5FV4A 3E1GA 1TKRA 2VJDA 2P8SA 3PUHA 3I2IA 1ACJA 4FWBA 2V9ZA 3FCXA 2PX6A 3VVMA 1AQLA 1JMKC 4C4ZA 3R41A 2XMGA 1NU8A 1ORWA 3AILA 3CXUA 1Q84A 5JAPA 2WIFA 4PW0A 3F8SA 1HKHA 1CFJA 1R88A 4EY6A 2G4LA 4DIUA 4M0MA 4X92A 1SC9A 1ZI9A 1IMJA 3C6YA 4G4IA 4B84A 1CUDA 1H2XA 4UHEA 3ANTA 2I3DA 5ISMA 3C87A 5AK6A 7YASA 3D2CA 4LKOA 5K5EA 1E8MA 4C87A 4A23A 3HYSA 4NZZA 5ALHA 2D0DA 1UFOA 1W4LA 4XWGA 4KRYA 1YAJA 4YK7A 2BUAA 1HQDA 4G8BA 1EXWA 4BRZA 4GDMA 3F98A 1CEXA 3EIOA 2VATA 5D3ZA 5ALIA 4Y2QA 1CPYA 1XROA 4N5HX 2J4CA 3O95A 1ZI6A 5FPQA 1UXOA 1F0PA 3IBTA 2XUDA 3DYIA 1AKNA 1L7RA 3WL7A 4CG2A 4CIBA 1AC5A 4RE6A 1UK9A 2PUJA 5CH8A 3IA2A 1QIEA 1GPKA 1VLQA 3G02A 3M3DA 4DMKA 4HRXA 4WFKA 1XZFA 4DMHA 1C7IA 1QIJA 4BP8A 5AKGA 2X76A 5I9IA 3R40A 4WCVA 1GQSA 2C0QA 3WL6A 5T4FA 4QE3A 1MTZA 5K3BA 5HF5A 1SCQA 1WPXA 5BOVA 1E8DA 5ALQA 5A71A 3E3AA 1YR2A 1WM1A 3HZOA 3G0CA 3WIBA 1Q83A 1RP1A 2WJ4A 4BC1A 4WDRA 4UBJA 1CUEA 1R1DA 4UHDA 1YAHA 4UBOA 5EIEA 5AO9A 5SYMA 2ONCA 1J2EA 4K5QA 4Y7DA 2QJRA 3WK9A 5HKBA 3OURA 3I1YA 1MPXA 3IUJA 4FNGA 2JBWA 1BROA 3H2GA 4UBNA 2FUKA 1ACLA 3OG9A 4FBLA 1UZAA 4K6HA 3UUFA 4UBKA 3VJLA 2DQYA 5JAUA 4FHZA 3FSGD 1W76A 4U2FA 3WK6A 2H7XA 3OPMA 1WCYA
chains in the Genus database with same CATH superfamily
1K3TA 2DUMA 2B4YA 2GB4A 4PO3X 4XM0A 5FWYA 1C7JA 5IN4A 1XIVA 1HDYA 1CS4C 1IJEA 2OHVA 5DBHX 4FTWA 1GUZA 5HK8A 3B12A 2F43B 1OXMA 1F3LA 2GD1O 5JE8A 3RKUA 3U31A 3C7CB 8MHTA 1EYZA 1IHYA 4D45A 1W19A 3HPQA 5TPZD 3N3BC 2AN3A 4I46A 3CPHA 3ORHA 2C4HA 2UYYA 4DMRA 4CDRA 4WINA 1GEGA 1Q16A 3SJCA 3ZDRA 2ZAYA 1HE2A 1UDAA 1NQOA 2J6BA 2JARA 2P2CA 2RI0A 3ND5A 1JU4A 4H17A 3UWPA 4A9AA 4BUZA 2CYAA 4OKSA 5EGSA 2CCJA 1S8NA 3G17A 3WWZA 3W34A 5FUMA 1Z26A 4YO7A 1QJCA 1TQ6A 4FZRA 3O7MA 5CVJA 3T34A 4IIUA 3ZV3A 2D7DA 2VCEA 1JTEA 3TOXA 4CDMA 4UC0A 1WCXA 5LUBA 1KQOA 3NWJA 2JGKA 3FF1A 2A58A 3K16A 1QH9A 1P0PA 1VJ0A 4M22A 3GCZA 4J03A 4CNBA 2XJ4A 2AV6A 2R7AA 4RTMA 2JBHA 1ZGZA 2IE8A 2P79A 3I23A 3AFOA 3EBLA 5HS6A 1K5GA 1PR6A 1KI3A 3B2NA 4INOA 1S3SA 2ZE7A 5ALFA 2QD5A 3V8MA 3WKAA 2QA5A 3F3YA 3NONA 2DBQA 4E46A 3OFND 1Y3HA 1ZCJA 4RJJA 4YCBA 4F3CA 1GL7A 2O8VA 1AX9A 1UBRS 1Z2AA 2W48A 3BBLA 3PHLA 5F7JA 4YDHB 3RRXA 3SQNA 1MIHA 1EJ0A 2IU3A 4MR7A 2EAUA 2NYVA 1PR0A 1NG1A 1WZIA 1X86B 3K5PA 3WTCA 1P5RA 2GA9A 1HDEA 3EDRA 4RLHA 3ZDDA 3BCRA 1ZL0A 2WNIA 5JI2E 4V0ME 5FTKA 4YRBA 4BJ6A 2O9JA 5EERA 1WMEA 2F1RA 3HK2A 3RK4A 1OA1A 2EJVA 5FOWA 3CVUA 4HHEA 4AZVA 4B09A 3R0JA 4UQPA 2GF2A 5CCEA 1EHYA 1QTIA 2IHTA 2KM1A 2Q1XA 2QYOA 2C2WA 3W6NA 4O4JF 2FPUA 1J8FA 1KKMA 3CR3C 1UKYA 3N1UA 4OF4A 1EGAA 4B73A 1XMQB 3TQRA 3GJ0A 4KIFA 1QWOA 3HCEA 1UKVY 3FVTA 1MTOA 4KLNA 2DHRA 2CLHB 1G6OA 2CSXA 3UAYA 4C6HA 1V47A 2VK1A 3WLEA 4B3BA 1Z2NX 1U0GA 4WK0B 4MUEA 4H7HA 4RY9A 3CUUA 2BJVA 2WJZB 5K0FA 2ZTHA 4CMKA 1P2DA 4AK9A 4PSDA 1X9IA 2A67A 3DV2A 2XCIA 1QCCA 2E48A 1N6NA 2AEMA 4DMLA 3C70A 2WUVA 4QYMA 5AVJA 3B1ZA 3L05A 5LJLA 2EGGA 1WRBA 3PJDA 1ORVA 1G3IA 1TO6A 4LTNA 4NMLA 4CDNA 4BXOA 4QICA 2CHVA 3H3FA 2RGUA 3PEYA 4CQMB 1G8GA 2I9KA 1W1UA 1U8CB 4HSGA 4L9SA 4U7FA 3U0BA 3CKMA 1W73A 3ZC3A 3RC8A 3A1UA 3CLUD 4K1LA 4OK3A 2Q2WA 3LUAA 3UK2A 1IBLB 1ICIA 2H08A 4B3HA 4KGXA 3RUFA 4W5TA 4EDFA 4YRNA 3IVAA 4UPEA 2BUCA 2NPIA 2VZLA 4IDAA 4C43A 3L7KA 5I3ZA 1HOTA 1KMMA 3L9XA 3QMPA 2XTNA 4GKBA 2P2ZA 1XRJA 2M32A 2ZI9A 4V0RA 1B0UA 2YZMA 5FFMA 4M87A 5CNKA 2JAPA 3URMA 1T2DA 1J0AA 1FDTA 1ES9A 1UKZA 2AS0A 1XZHA 4V39A 4DL9A 1I80A 1P7PA 5IXJA 1HEUA 1DHRA 2VK2A 1ACMA 1ARZA 1X1RA 4H77A 2XYPA 4MHSA 4RY2A 2F43A 3LWNA 1CB0A 1QR2A 2F3UA 3UJ6A 3MRXA 1RBMA 3K73O 1RYEA 2Q6IA 4RCYA 4IQ8A 2XUIA 3VTAA 4D9FA 2CLSA 2IPNA 3EEOA 3NKVA 2A1UB 4X64B 1YJBA 4OQEA 4RC9A 1KMHB 2JH3A 1LKZA 5C7OO 2GYUA 2JGNA 4LNUB 3FY4A 3UB2A 3BHIA 4JFRA 2OHGA 4ZO4A 1B8UA 1UPBA 3O75A 4FB4A 621PA 3BXZA 5TR9A 3FTNA 4OJTA 1N1MA 1EHCA 1OH8A 5TGZA 3LT0A 4HYEA 3V2HA 4N6OA 4DWVA 1E94E 1K7EB 3AKDA 4UEWA 2H2AA 1TCVA 3PT5A 4J1NA 5HCNA 4QODA 3LZCA 4DDMA 3ESRA 3B3QA 2VXCA 3KQOA 4OI2A 3PD7A 2JFZA 2XUZA 4FC6A 3D7KA 4A1OA 3C39A 1RQ7A 3B6KA 2ZT6A 3C6MA 4KVZA 4N5NA 5BNZA 1A88A 4OX9Y 5DP1A 3RTEA 4CDGA 4E5NA 5J4YA 1AN0A 3RSLA 2QAIA 5EP3A 1K6EA 1JZSA 3I0MA 3FNIA 4TXLA 3RAFC 1KY3A 4GZMA 2EFCB 5BWNA 1E3JA 1VL1A 1JPJA 4K6MA 4QDUA 4DM3A 4ZN6A 3DWIA 1Z2CA 2H2DA 5KBYA 4BEBA 1PTKA 3F71A 4P3PA 4G9BA 3AFHA 3H2BA 3RT1A 5JEEA 1CZLA 1DPFA 1P9WA 2RKOA 3L8EA 3P5SA 3LW7A 3FPGA 2I2DA 3C3PA 2YNMD 1B76A 4E31A 1E79D 1ZN2A 3G0OA 1E58A 2ZKIA 1ZO8A 3EOZA 1U7XA 1ZDMA 4IO0A 4MW6A 3MBKA 2EP7A 3OTWA 3NYIA 1N2EA 3VR6A 5B1EA 3U60B 4TLLB 3CNOA 4KQXA 3BMXA 3EISA 1ZR2A 1IM5A 1CNMA 2JGAA 3TQOA 2NTVA 4R9VA 2ZJ6A 2IODA 1VI2A 2EF1A 4HLUC 3FMVA 4PQFA 4D92A 1GUBA 2PM8A 1BCRB 1VKHA 3IBSA 1QFMA 2XPCA 2VF7A 3MXOA 5ED0A 3X0DA 4BP1A 4CLRB 2F48A 4CIXA 5A5GA 1NP6A 5JS2A 5AVOA 1H0HA 2TYSB 3FHOA 3MTAA 1XLVA 2VBGA 4FBGA 4C0LA 4COOA 2VAXA 3JQBC 2B3TA 3LCMA 4OUKX 2ZIZA 1OKKA 4QOSA 5CTAA 3SMQA 4HVCA 4GL2A 1RW4A 2Q1WA 2QW1A 1WHTB 1HYBA 1XD8A 4I1RA 5AXCA 4ATNA 1P9LA 2CK3D 4MDFA 3QBDA 1D03A 1TM2A 3NW9A 1DKUA 1VPEA 3RRBA 1EX6A 3GLHB 3WK4A 4U2GA 3UNXA 2Y6UA 3NVKI 5DBIA 3M4JA 1QGED 3EA5A 4B7XA 2RGNA 3O4HA 4JX8A 4CQMA 1Q15A 2QTFA 3R0ZA 4KJXA 2FSGA 1RI5A 2RKWA 4K81B 3RS5A 1CNEA 3T7CA 1FU8A 2HW8A 5HZKA 2E49A 3K4PA 3V97A 1BWRA 4FYPA 1JEQB 4G09A 1D1PA 2XODA 2JRLA 1WX1A 2ZJYA 4RD4A 1XJQA 1FU4A 1P17A 3A9TA 3FETA 3L1UA 1T0PA 2HDNB 3E8SA 3LDAA 3VKHA 1NVUQ 2Q5QA 5KPJA 2JLQA 2GLXA 4QRHA 5E4FA 3WWOA 3OFJA 1PT7A 1AXEA 3G82C 3TRKA 3OLQA 3PJFA 5CW2A 1E60A 2CJPA 2HU7A 3GVXA 3GA0A 3H1EA 5E2BA 1J0EA 2DF8A 4CL2A 1PWXA 1CU1A 3KCQA 1VB5A 4LZOA 5F2KA 3ZLUA 4GX2A 3LPCA 4IY1A 1QYCA 1D0VA 3M70A 3TLAA 2O2XA 4J29A 5IX8A 5AW6A 3TK1A 5KI6A 5BVGB 4BU1A 1VA4A 5JALA 4X7MA 4FPXA 5HF8A 1OTHA 1NJSA 2FPGB 1EB8A 3CVOA 4P7FA 2WIAA 2A1UA 3SJAA 4DS3A 4JV5B 1KMHA 1L8AA 1MT0A 5G0VA 2V7UA 2B9EA 3M4NA 3IODA 3UAGA 1SC4A 2FMTA 2G06A 3DDSA 4LNUA 4V0OA 5CFMA 3OZUA 4YRGA 1WP4A 2ZS8A 4GR5A 1SR8A 3BE6A 3QX8A 5F4BA 1K6XA 2W93A 4UE3S 2ZE8A 5LQCA 4P0TA 5LZ2A 1FXUA 3GUZA 3HCAA 3N6XA 2V4UA 1SBHA 2H63A 2P2YA 1E7RA 3L0DA 4WKCA 1GKKA 1G19A 2XGMA 4PFJA 3KPUA 5EPUA 1E2LA 1PKEA 2AI3A 5TPWB 1YE5A 4YUXA 4BFVA 1GSHA 3T6KA 4MP6A 4X7PA 3UUWA 3CPJB 1C9KA 2PFSA 3R9IA 5KSYA 2IJGX 2BOVA 1GGKA 4JLJA 4O1HA 4Y9UA 4TLAA 1SCUB 3B7WA 1GPDG 1YONA 4QATA 3UJAA 2WB4A 3UVEA 3U7FB 2OGTA 2VPQA 1WLSA 3P97A 5T4EA 3M3PA 3SJBA 4H1WA 5IT9A 3M1IA 5LP1A 1QH1B 1YHZA 3KQQA 2W8ZA 3GLUA 2P7HA 3NG1A 4EW2A 1ONSA 5CXUA 4KWTA 1X70A 3U56A 1AUQA 3ETGA 2GI4A 5CPFA 1ZN8A 1G20B 1AIPA 5AI9A 3TSAA 5FEUA 3BKWA 3W6PA 3LKDA 1TRHA 4LXXA 5AI5A 4YAEA 2O4CA 5CPBA 5JYBA 5F78A 3DAYA 1DI0A 4J3NA 2EJTA 5CT6A 5DBEX 5H16A 2CY0A 3NV7A 5C0OE 1GYQA 1RWPA 1YH3A 2WU3A 3BWEA 1JILA 3LX8A 3TX6A 4ENPA 1WETA 1N3BA 4GAEA 4AIRA 1LDMA 3I45A 1KQ3A 5FPSA 1N8KA 4YAGA 4IL5A 1ADFA 4II3A 4B3GA 5JPCA 2QZSA 4U6SA 1BCRA 2QAJA 3O2SB 4GLFA 1D2RA 1NXTA 3G8DA 3T3MB 4CLRA 1XNQB 1GCIA 4XR9A 3MBOA 4BLSA 4F71A 2DERA 1W9MA 3I9NA 5IK2A 1YL6A 3BREA 4BCBA 5H80A 3E9CA 3O3OB 3LUFA 5DLDA 1H2AS 1Y3DE 3E0XA 1PX0A 3LFHA 3LHSA 4ND3A 4GYJA 1YNSA 2X8WA 4KHZA 1WHTA 3VC7A 5D84A 3SHVA 3QU4A 3QVOA 2HQBA 4JDUA 3A2KA 4BMXA 2HK9A 2GSDA 1QTRA 1Y7IA 2O7QA 3GLHA 4NV3A 3GV0A 3COWA 4V2UA 2ZPAA 4TT3A 5FORA 1KFCB 2Y9PB 2XT9A 3WIVA 3DTYA 4E13A 2VUTA 2Z09A 3EX7C 4BBZA 3OZFA 3DQZA 3K2IA 1E4EA 2OZPA 2QG6A 3AXTA 1XQ9A 4M98A 1QO0A 4BJ3A 1G42A 1JEDA 2JLRA 3JY6A 3K1TA 4U7WA 1A7KA 1KJ8A 3BXXA 1N92A 4MQLA 4MYRA 5DW3A 3FBGA 1JEQA 4AJJA 5L4LA 1GDTA 4UPDA 4ZVMA 1AKUA 2YINC 5E1BA 2ZI5A 4WN3A 4YRJA 3PZRA 4OM7A 1WHSB 2XQIA 2A6PA 4DLTA 3WRYC 5K03A 1CLEA 5K8UA 2REXB 4BRUA 3LDGA 3RLIA 3ELYA 4K88A 1U4SA 5EMKA 1QQBA 2QZ4A 4LKRA 1I0LA 3A4IA 4TLBA 3WLOA 1TZMA 1Z75A 1OBFO 2WSYB 2YYAA 1JAZA 2ZJ5A 1Q7BA 2JFUA 5AM4A 4MEAA 4F8JA 4N7RA 5DHAA 4YC7A 4GBMA 5AP9A 5TY0A 5ABPA 2WOOA 1IK4A 1DAIA 4RKRA 4F1WA 5BWLA 5IDXA 2PGNA 3PRJA 4P4UA 2E4ZA 1DKQA 4MUBA 4ER7A 1VIDA 1WPRA 4G4SO 4LF4B 4U0JA 3F3SA 2FF7A 2OTCA 1P1RA 4F7WA 4E33A 2EBFX 5BVGA 3Q8KA 1CUAA 5CP8A 3FKQA 4YPVA 1WBBA 2FPGA 3AUJB 2E37A 5DO9A 4X97A 2CFOA 1JTFA 1F6WA 1LNSA 2NO4A 1V0JA 5LQJA 1UOQA 5L6LB 5G1NA 1A04A 1ZLYA 5A9SB 2DPLA 3AG6A 1T6ZA 4E2XA 1OYYA 5J9FA 3N75A 2R8RA 4V0SA 2KMLA 3KSBC 3HH8A 3WGJA 2QPAA 3F3KA 4HT3B 1Q3KA 4HNHA 2J67A 1H6AA 4AJLA 1ZMBA 1TGYA 4YUWA 5L8VA 5DYYA 4KGVA 1I1QB 2XEDA 4RZXA 4UD6A 4ACAA 5CVUA 1XEXA 3M2TA 3IULA 4C0XA 2O5EA 2EWVA 3AHGA 3N76A 3O9VA 4PYLA 5TPWA 4GI1A 1R4AA 4YMGA 5GADl 1FFYA 3VPFA 1Z8NA 2YWEA 4R3WA 4PHFA 4Q7KA 1CUGA 3ZU2A 2CDRA 1HFEL 2QG4A 2UYCA 2BBSA 2KHZA 2ZJ0A 3OJLA 4M9SA 3SIXA 2XGOA 1N78A 1T4MA 3VH1A 4IW3B 2XBLA 3R7WB 1KEUA 4HNGA 4I5DA 4CHTA 4LJAA 1EBUA 2KBFA 1SCUA 2X0JA 3A10A 4J49A 3LPLA 4M1EA 4NCXA 5L7TA 3JXEA 4NU8X 2V45A 1M0SA 4JLWA 4MUGA 4B3IA 4MVXA 1QH1A 4KE9A 1OAKA 2HADA 5T4BA 3DCNA 4GYWA 1QK4A 1VSBA 3UKOA 1DELA 1G20A 3H4TA 2CXOA 3ST7A 2J9GA 1XMPA 4MRNA 3T4PA 4BN4A 4GBGA 4AAYA 1JWLA 3EC1A 1DKMA 1NKTA 4FDTA 5AK5A 1BTOA 3QGMA 4ENWA 2VDPB 3CSSA 1GAEO 1ZM9A 3HDQA 4IIJB 3LP6A 4C89A 1XYYA 1P5JA 2BTEA 1CUVA 4IUDS 4MTLA 1A5TA 1DX4A 4FKBA 1BEUB 1LK0A 2I91A 2ZRBA 3ZOZA 3I0ZA 5FFNA 3I4LA 4OMCA 2PTHA 3NHBA 4H7FA 1V8BA 1M0TA 2MDTA 1MH9A 3DPUA 3QG1A 3GZ4A 4X3CA 4ZQGA 3KAQA 3ZK9A 1MLDA 1TKCA 2X0RA 3ESQA 1G8JA 4RS3A 1XFDA 4FE7A 4MAMA 1PCXA 6ADHA 4EIWA 4D4IA 1H8HD 1WKVA 1XNGA 3ZNPA 4BHTA 4C14A 1W0JA 4JOSA 2LCQA 3FNGA 1VM6A 1Z5VA 3CSUA 3CVJA 4TV8B 1OFVA 1HOXA 3G2IA 4FW8A 3C41J 4RORA 4UXHA 3RPEA 3L5OA 1OTXA 5J63A 2H06A 2XLCA 3PYMA 5KTOA 3IRUA 3MS4A 3OEWA 4XTRA 3TOSA 4MQBA 2DGDA 1X7WB 4NAVA 5ECGC 1M34B 5HQ3B 1DC7A 4K9RA 3R7NA 5EJAA 4ZKEA 4ALKA 4HS9A 2FMFA 2I3BA 3KUXA 1RWBA 1GGFA 1FP1D 7MDHA 3C8DA 4OKIA 4XQ9A 2GD6A 1ZM2A 5ALKA 1T6YA 4J0GA 1G6HA 5F23A 4BLOA 1DG3A 1VDZA 1BJKA 1J42A 4RACA 3ZGNA 5KHOC 3VMMA 1U3DA 3BILA 1ZNZA 1U11A 2CXUA 2CMGA 1X7XB 1UT8A 1JR2A 4QL3A 4NIMA 1Z0DA 1WHSA 1FSZA 3F47A 4N7BA 1FOEB 1E4OA 4PF1A 3OZSA 3RSFA 1T26A 4A5OA 3TTSA 3KQLA 4BY9E 1MEJA 1O4VA 1O6BA 2LV8A 3TXXA 4D4LA 2CKMA 5FTJA 2MMGA 1Y6ZA 2BEUA 4TGLA 5GPBA 4J90A 2O07A 5JRDS 3A4TA 5JLJA 4L5AA 5FWDA 5KS2A 4EQ6B 4NENB 4U9HS 5CRIA 2F17A 2XT6A 4HH0A 2GPAA 2CCGA 4FXPA 1W87A 2WQZA 3HVUA 4LF5B 3RRFA 4EGSA 4PZYA 1L5RA 4KAJA 3SZUA 1ZD2P 1ZGJA 1GU0A 4P98A 4F97A 4X8OA 1IJBA 2QYTA 3R74A 5K3AA 1G7TA 4UATA 3AR5A 3EN0A 4WFIA 2OGWA 1WD7A 5TJ9A 5A9SA 2JJ2D 5I7HA 3SS7X 2IZ6A 1SUDA 3C4QA 2UUBB 4RZ2A 2B35A 4OI1A 2HDWA 3LBNA 2ORIA 2BYTA 3U48A 3BG5A 5C8YB 3LF2A 3QSYA 2A7QA 4ZV4A 3AIMA 3BTOA 4C7VA 4JIMA 3REQB 1H42A 2W43A 1KSHA 4JL5A 2EW1A 3ISJA 3UB4A 3H04A 2OAQ1 1T9CA 2AZTA 3PNPA 3O4VA 3COSA 2YH2A 2DY1A 3GHYA 1QIKA 3GT0A 3E5RA 1B8NA 1M6HA 2CNWA 3LY5A 3W78A 4CM9A 5I45A 4ETWA 1KP2A 3IEIA 4J7UA 4ZRDA 3LVFO 1N77A 1XG5A 3OICA 3M5CA 5C80A 5KNBD 2IX3A 1FY2A 1K7XB 4UJ3A 4BAGA 4TTJA 4Y6RA 1M8PA 2EF0A 2JFVA 2XNJA 2VHVA 2ZYGA 1V41E 1MO4A 2HBYA 3H2YA 4QBTA 1GAWA 4AO6A 4WXHA 3A6ZA 3L07A 2NXCA 1KP3A 1EMDA 1GN9A 3OCUA 2HF2A 1QRSA 4QJ3A 5FUYA 1RWKA 4MARA 4CTMA 4NVRA 3ZQ6A 5GONB 1SAYA 5DI3A 3G23A 4FHEA 1L4MA 1UIRA 4MV8A 2IHJA 2VC2B 4MQ4A 3I58A 4TS1A 2F67A 4EHNA 3RUIA 1CD5A 1RRPA 4BEVA 2C7GA 3QM1A 3KOZA 4IIJA 5EXXA 5A2QA 2HA2A 3ADDA 3L8CA 2V8BA 3DVAB 3HYRA 1B2LA 3CGWA 3NRJA 5EQTA 5GZ6A 1ZD4A 2HJRA 5AW9A 3OBIA 3SCZA 3TAXA 4LTDA 1YUBA 4ICIA 2L42A 4MLDA 7REQB 1B0AA 5FPYA 4MYDA 3LJKA 1DG1G 4GWKA 1CJUC 4JLUA 1V1RB 4L07A 4WLUA 3WLAA 2GAAA 3DOEA 3KQKA 4FFNA 1A82A 2X3UA 1SC3A 3ETEA 2GT1A 2QV0A 1CUFA 1DEHA 4MW0A 5K6AA 3KXDA 3GIDA 1B8VA 1UK6A 1GT6A 4DCNA 4G0PA 1M10A 3OZGA 5LOVB 4TV8A 1Z0UA 3M8KA 1UK8A 2ACWA 5D85A 1U94A 5DEIA 1S3FA 3M6WA 3QOYA 2W6NA 4NP6A 3SYMA 4EG0A 4ZIRB 3G0HA 1VIYA 1SZCA 2FCRA 4IRXA 4TQAA 5JS1A 3MRTA 3V1LA 1LPSA 2EJUA 3EGOA 2IHBA 1X7WA 2QJOA 3CHYA 3CZ9A 1M34A 4RF4A 1Z0JA 4LRYA 4Y2JA 5HQ3A 1W34A 2UUCB 3ZGZA 2PRYA 3M9WA 1BGWA 1YB5A 3FI0A 4FT2A 4OGWA 3VZRA 3A25A 4L4SA 3G3EA 1VLVA 1NVVQ 3RTCA 1J07A 4CV2A 2AG6A 1TO1E 2ZAGA 4ZZ0A 2B7BA 1SPBS 2OESA 1HE1C 3L5KA 1Q95A 2IHKA 4OYYA 2M9MA 1OR8A 2Z3VA 4ZCPA 1VDMA 1KU6A 2N42A 1OGIA 1R6TA 2PS3A 5D5HA 4A0RA 1LLQA 5JD5A 5C18A 2E18A 2JGRA 1NX9A 1X7XA 3OD5A 3EDCA 4D9KA 4WZBB 4R5MA 1I1HA 3Q3VA 5FOQA 2ZZNA 1U3GA 3WKBA 3S7ZA 4Q7QA 4PYRA 5EHZA 2W6QA 2QLTA 4WE3A 5AD1A 1Z38A 1NN0A 3KT0A 4PAOA 1T1IA 2UZ3A 4D6YA 4RESA 3IKTA 3MQFA 4XJVA 3F7TA 2QJFA 5ENVA 1KAGA 1YQEA 3IV9A 3BH6A 4EQ6A 3VKGA 2QXTA 3P9SA 4BVHA 2AN9A 2BR3A 4NENA 4XOIA 5EIBD 1W36C 5ALVA 3IP8A 2GBIA 2VP9A 1U6IA 3EW9A 1AQ6A 1FXSA 2FMHA 2D0IA 3DZ8A 1E1MA 3FWPA 3K7EA 4L9WA 3PGMA 1BO6A 4MB6A 3WB0A 4B34A 5IANA 3PQ4A 1PSWA 3GVPA 1G38A 1E1LA 1SUAA 4F0JA 2H2HA 1A76A 3GRCA 3RK1A 5CX1A 2I80A 4ZC8A 1A9RA 1PSDA 4LNHA 4X45A 1P31A 5ALRA 4A8HA 2X2EA 4DQDA 1RXWA 3V7FA 1M7GA 2R00A 4ZYZA 4EMBA 3QMWA 3GJQA 1W6UA 1RC1A 2QLJA 1TT5B 4XDYA 1FJHA 2BJWA 1BWQA 4KPGA 1JI3A 4Q48A 3KSMA 4GOOD 4ZVRA 1C8VB 4WA8A 4Q1AA 4EI9A 4PG6A 2QV7A 3ZJ4A 4Z4FA 3IVRA 2AFVA 1RS0A 3ZGYA 1QMPA 2XD4A 5AK4A 4D5EA 1JWAB 1WSWA 1EZ1A 3CKKA 1G1AA 4IOJA 1D4OA 4UFPA 5J23A 4WD3A 1N0IA 2BMFA 2ILVA 2CUKA 5JQWA 3DE0X 1D0SA 4UJ5A 4YP0A 4ZZ3A 1M6NA 1ZU4A 1PJAA 3EFHA 3IDFA 3WYEA 5IJ9B 1WCIB 3AP3A 1H2BA 3WJAA 1CYEA 1QGZA 1K6IA 2IUYA 2J46A 1L8XA 1QP4A 4CG3A 1VJDA 4B33A 1JFVA 4EY5A 4YR7A 5K0NA 1NY5A 4JI5B 4PZAA 3BRSA 2G9ZA 3AF4A 5TC4A 4PX5A 5GONA 4REOA 1DAPA 4JDPA 1NQTA 5FB3A 3WGGA 3RSQA 5AW7A 3DDWA 2VYNA 3RVOA 1T9HA 1KRHA 1WB5A 1SKAA 2ATCA 2RHCA 3ICWA 1QAQA 3RD5A 3DVAA 4YJGB 3ZWVA 4LWOA 4KVFA 5AIBA 7REQA 4EG6A 4LXGA 2YHUA 3BWYA 4L78A 1FCJA 3T5CA 4QSMA 1V1RA 2A0FA 3T7KA 2ZIAA 3CCCA 4R1SA 1BS1A 2FUNB 1EIWA 2PL9A 3IJRA 3UMVA 2XSZD 2HA0A 3DMTA 2BL4A 4JOQA 1T4CB 1JYFA 3L93A 1PG0A 1HY3A 4D9HA 5KOJB 3UJHA 3HFGA 1Q0SA 2WJPA 3G1WA 3V4ZA 1PVVA 4LXIA 4ITVA 5A0VA 4EZIA 2VQEB 5FBVB 5LOVA 4G67A 3CVVA 1YZKA 4DLUA 4OHCA 3ROMA 4EO4A 1PZNA 4ZIRA 1IZ0A 1Z68A 1D2NA 3JTEA 1T0JB 3WA7A 2P90A 1F20A 4MIEA 2JG3A 2ABWA 1SZJG 3LQ2A 4CETA 4JNKA 1T5BA 1CUHA 1W75A 1XZKA 1E79A 1TZKA 3EQ8A 4JC4A 1PK8A 4U9UA 1SZPA 1SG9A 2EW8A 2HCRA 8ATCA 4BP3A 1EUZA 1XAGA 3GJXC 1R27A 2JEOA 3EY4A 4MVJF 3VNSA 1Z7GA 2FZEA 1DEOA 3KOMA 3HDGA 4LOIA 4REMA 3WYNA 2J6IA 4HUQB 5HKAA 1O8CA 1TE2A 4E3WA 3D6TB 3Q7EA 4I36A 1NPYA 4RPCA 5BWOA 5SV2A 4BNDB 1NBWB 1BGXT 4YT8A 1SUIA 1SB8A 3CR8A 3GP5A 3ZTTA 1GAXA 1JDBB 2HEGA 3CC8A 4WZBA 2A9QA 2CVZA 3I73A 4WJLA 1OYWA 2C8VA 4D9MA 2AX4A 1X6VA 4F86A 5JFGA 2AWNA 2FPSA 4EEKA 5CDGA 1E2GA 3E3MA 1Z4JA 3OCZA 3LO8A 3ZV5A 2OCKA 1EAMA 4U5QA 3EFEA 2FKNA 2JD2A 4TSKA 2EGHA 2JGLA 4B79A 1ZXXA 2ZYDA 2EOAA 1J9EA 2Q21A 4DQVA 1X2EA 2E3JA 4XCQA 4I4NA 3RRJA 4CL3A 1E18A 1ST3A 3PQ2A 4YAKA 4G5XA 1LDYA 1JHRA 1PQWA 1WO8A 3JD0A 5BSEA 2WSLA 3AKZA 3C8MA 3GPBA 1H6CA 3FZEA 5GGYA 5SYAA 4JI4B 1U3TA 3H2JA 3PE6A 4RUKA 5LQSA 2XZPA 4UTZA 1VJTA 1N5RA 3QY9A 4L16A 1K2WA 4OJMX 1ORIA 2JAXA 1NL3A 2LGJA 3HCCA 4YRFA 2IY9A 2JI9A 3ZZUA 1JAXA 4XZ3A 4BN0A 1BVHA 1USWA 3RROA 1MDFA 2E4YA 5I4BA 1DO8A 5TIIA 1CF2O 1EA5A 3SN6A 5A3JA 1BE8A 2Y3IA 4PYKA 4QEKA 1U2SA 2XF8A 3F3MA 4WFJA 4EOGA 3IBGA 4G5GA 1TT5A 1Y5LA 3PF9A 2E9SA 1KMCA 3A6DA 5D1NA 4YH1A 3UHJA 4OK6A 1SQ6A 3G0DA 4YS6A 4CUZA 2WMDA 3QBJA 2BBTA 2G9RA 2IQ5A 3H1TA 4XYGA 1T3TA 5AOCA 1QLWA 1IXKA 4LWPA 1JDUA 2XOEA 3ZZ1A 1XCLA 1GG2A 4PS0A 3EZNA 3VI4B 1CP3A 3KETA 1MQ8B 3IV7A 1WZUA 3ITNA 2ORVA 2RGYA 5ITZB 2VSOA 3QVJA 3KQVA 3HRHA 1CR0A 1T2FA 2Z4RA 3R5KA 3QY0A 3E2MA 1WCIA 5IJ9A 3MMPA 4II2A 4PAGA 4B4OA 2PL1A 3L8YA 2ZXEA 4UAVA 4HMPA 4BMNA 3DCIA 4FN5A 1VA5A 1FNMA 3AL2A 3MTGA 4JJ7A 5DJ5A 1B16A 2EIXA 5DM1A 2HO5A 1LZKA 4IX9A 1UM9B 1JQ5A 2DUWA 5LXTB 1GPAA 1H8EA 2CXXA 5BR4A 1V7QA 1XDZA 2H1OA 3GRKA 3C6KA 5FLXA 2XVXA 4BKUA 4D8WA 1UBFA 3ZVKA 3F1LA 1Z5WA 3DFIA 4AULA 1AN9A 2XZOA 4YJGA 3HXKA 2ZTUA 1FLDA 5FQNA 3SJ7A 5FXMA 5AI8A 4HSEA 1SCIA 1SOUA 2JRCA 3NWBA 4PZZA 4WBNB 3TTUA 1W30A 4B4WA 2ODAA 2RGNC 3ONEA 2W4IA 2WJIA 3VU8A 1SMKA 2YJ6A 1T36B 5L4SA 5A7HA 3VKUA 1RPZA 2B2NA 5EJ7A 5KOJA 5CU7A 1L7NA 1YZHA 2ZJ2A 4J2TA 2YJTD 4R8LA 2CJXA 1YA6A 3KZ1E 4DG9A 2ZQYA 4EBFA 1GAJA 2KX7A 1MZVA 3OF3A 2ZCUA 4I9NA 5LCXA 1RZRD 3AF0A 3IEMA 721PA 2EWMA 2V55B 4I3GA 2NOAA 4HAZA 4H59A 4BJ1A 2CNKA 5EZYB 3EULA 5LP6B 2CNBA 5SZKB 1RRGA 2PLAA 2WHEA 3ASZA 3LYLA 4MI1A 5EE3A 2PRIA 3JAKA 3K0AB 1PWEA 1TECE 2PS9A 4C3OB 3AUXA 2FX3A 2H1LA 3DCYA 4PIVA 3INNA 4RLQA 5TEVA 4DKXA 1V3QE 4US1R 3H9JA 5BRAA 3PIDA 3TNFA 4OK5A 5FWXA 5EA2A 2B0JA 5TGTA 2WILA 3I2YX 3TFOA 1GAQA 2ARKA 4HPXB 3KZKA 3WYDA 2DPHA 3HDHA 1JLSA 1V8PA 2RAPA 3OCWA 4HUQA 5EE0A 4G0VA 2PUAA 1NOKA 3VX3A 1NX6A 2H7VA 4BNDA 2BFPA 2FEMA 4M46A 2JLZA 1NR1A 2PH1A 2HB6A 1Z5GA 1ECLA 3FNEA 3HGTA 1B41A 4IXMA 2NU9B 4UM9B 4Y6LA 2OWDA 2C99A 2FGJA 1Z4NA 4YDQA 4G24A 5A5VA 1CIJA 3AVOA 4I1YA 4RZQA 4TMVA 5K0BA 5L7YA 5TSDA 4ZO6A 4EUNA 5B2FA 3F9RA 1V6SA 3BQMB 1U1IA 4EBBA 4G5RA 4QFDA 1T29A 5DKFA 2CV1A 3NAQA 4AWBA 2SCUB 2PO7A 1NMZA 1VL5A 1OPXA 3KUCA 2PVSA 2ZUUA 1XU9A 6ABPA 1NYQA 1CF4A 1OVGA 5KJEA 4OD0A 4RZSA 2XOKA 3JWHA 1CYDA 2XV1A 4CFZA 4EDHA 1KYQA 3L8FA 2OV6A 1CUUA 3D2AA 3HR4A 3I01M 4F8YA 1DUSA 3K9BA 2PUHA 4J6EA 5ANRB 2CCKA 2YN4A 4YJ3F 1KJWA 2AJ8A 1QH0A 2OQRA 3HVJA 4Q9IA 5C53B 1PL7A 3R3XA 1JDVA 2PLRA 1JR3D 3MWLA 1YD7A 4J0HA 4RK7A 4YDRA 4JCCA 1VCMA 1Z3CA 3CJTA 4HJRA 4GRIA 4JELA 2VHUA 3NNNA 4N5LA 2QMHA 3TAUA 2HQ1A 1XL0A 2PAAA 4MV9A 2GRUA 3K9WA 3PX2A 3A2MA 1GJRA 3G9ZA 3EF1A 4NE7A 4YRDA 5FD8A 3OX2A 4X91A 3TW4A 5AVRA 1UL1X 2R5FA 3O03A 2DHQA 1DXOA 3S2EA 5A2GA 3IHTA 4MW5A 5ARCA 4X94A 3TIGA 3NPMA 1H23A 3SQWA 3ZDXB 1B15A 1Q7RA 4QPCA 3FB1A 3FDXA 4P3YA 1AVTA 1SK8A 1X8KA 4R84A 5FWAA 4HAIA 3FGNA 4PNHA 3ZX5A 3ZWCA 3HJNA 3PF8A 2VQSA 4RELA 4RPHA 3WNQA 1Q92A 2OZVA 3PZBA 2BSQA 3VM6A 4EB3A 1P73A 5CA1F 4FGLA 5ITZA 4Z8XA 3OZDA 5EMHA 4RH3A 4DZZA 4CN8A 5FKJA 2FOIA 2G5GX 2YW9A 3NRCA 4UXIA 1QPZA 2ZB8A 2NX2A 5WRFA 2C7RA 4YGYA 1OROA 3A28A 1R16A 1KYXA 1EZ4A 8AT1A 1Z0FA 1MQSA 4CQLB 1KARA 2B4TO 5GV8A 1G291 3K31A 2GZMA 5LYJB 2RARA 4Z5XA 2XB8A 5FPPA 1WMBA 4RETA 4BO8A 4JB8A 2BF4A 4KIJA 4R9UC 2C3MA 1NE2A 4B9EA 1IRIA 1XD9A 4G2NA 4RK4A 2I4TA 5ECWA 2HWUA 2QVYX 4UNNA 5COQA 3UAXA 4ZTBA 5JDCA 4P7GA 5BNTA 1O2DA 1OZAA 4WK2B 4UCQA 5KQRA 4LJ5A 4H7DA 1MP0A 1NPDA 4TRMA 3HEAA 3QVUA 2JLWA 1MRZA 1FBNA 1DBPA 3YASA 4EPYA 1SC6A 1PAUA 1PUIA 1YDHA 1U8EA 1YS7A 2HBZA 2HHLA 3R20A 2W2LA 3HP7A 1T36A 2X23A 3L0OA 3NYWA 1X8JA 5KINB 2V7WA 5CT5A 2P78A 2PRJA 1XRMA 3V3KA 3VPSA 1FYDA 4BVFA 3VU0A 5KEIA 1DCMA 1SG6A 2JCYA 1EBBA 2WTNA 3GFTA 3CG4A 2VPXA 2WSSD 3HKEB 3KHSA 4NBLA 2F3SA 4AG6A 2QBYB 4V24A 3TB4A 4WJZA 4KC0A 4JBWA 2BGLA 4QLBA 3DZJA 2E1RA 3MWDB 2ONZA 1QH8B 5TT1A 5LP6A 4OY3A 4TWRA 1RQRA 3S44A 3K0AA 1FJ2A 3KV1A 1M75A 5ICCA 3MAJA 3L46A 4MDEA 4HNUA 3RYTC 4MYUA 3GJRA 1CUSA 1BKYA 4UD2A 3Q2KA 1AGRA 3TMKA 1UFQA 4L3WA 3K1ZA 2X4DA 3ET4A 3OTIA 1LWNA 1GZVA 3B5EA 1YI0A 2ZIUB 3IX7A 1AQJA 1SCAA 1IUKA 2CXTA 3SSAA 3NEAA 1AE1A 2BKLA 2GN6A 3LT4A 3EY9A 5KYGA 4N48A 4MW2A 2A8YA 5BT8A 2XRFA 2CE7A 2YFYA 3O31A 1GGMA 3U44B 3OPQA 4TMKA 2YV4A 4WL0A 6PFKA 4OIMA 3K2EA 2G9NA 1YQGA 1F9EA 2PV0A 4IUYA 4LMRA 2HSEA 3VR5D 1VZ3A 5C3MA 2EG5A 3B82A 1LPMA 2SCUA 1GL9B 3TX2A 1ISJA 2DWCA 1P80A 3DV9A 4GSKA 3PEWA 3G9XA 3UHFA 5BWBA 1ESMA 1ZG3A 5KWJA 1KWKA 4KFCA 4GWLA 2XZLA 5IDVA 4ETIA 2R6AA 1UXKA 1M0EA 2PS0A 4S04A 1YU9A 1KF0A 1UEIA 2P5UA 3BGSA 1MIOB 5G41A 1DQRA 2DHEA 4ARBA 4R69A 5TF4A 4NICA 2Q2NA 4W5OA 2X6TA 3RGGA 3JQAB 1KDZA 4YEDA 1B0PA 1UK7A 3WDSA 2H7YA 1RQ2A 2GTIA 3KL4A 3HA5A 4D82A 3FKSD 1TD9A 5JCPA 3PXBA 1YASA 1V43A 3JQ8B 2Z5VA 4CKCB 4HRYA 4XR4A 4AF6A 4EKEA 4FQ5A 1DQPA 2CJFA 5DSZA 5LMZA 3T4UA 4TS9A 1GZ4A 4G41A 4MCHA 4A5SA 3L1IA 1QOPB 1B74A 2LP4Y 4NMMA 2WIDA 2V5VA 5EJ8A 1A71A 2QY6A 1VIAA 2NAPA 2XGGA 2VDWB 3G5UA 1D2CA 2QIPA 2D5LA 5FTWA 1S3GA 1T0IA 5KTYA 2EX1A 2ODPA 2HREA 1Z6ZA 2JIZD 4MGHA 4UM8B 1MJFA 3CEMA 5CFLA 2VO1A 3PNBA 3TSYA 5JJBA 2ADMA 4RIEA 3P94A 2R96A 2Q6LA 5KHLB 1NF8A 2QRGA 2WPNA 2KS6A 1PR2A 1QWSA 1AGPA 1NQXA 3P26A 4PE5B 2G83A 3TUZC 1QP0A 3QELB 1E9BA 3K15A 3WI7A 3LE8A 4E5VA 5CM9C 5ESRA 4ID3A 3WHPA 1IAVA 5H59A 4CQLA 3IEKA 1BMDA 3QE0A 1JEOA 3F6PA 3QHQA 5LYJA 4G2TA 2C9YA 1AK2A 3C4VA 3OESA 5D1HA 3B2EA 4X7BA 5DN6A 2W98A 1XCBA 2WD8A 3AZQA 4L50A 3VR3A 2JLYA 4BWFB 5IRCD 2C7VA 3DE1X 3FNRA 2Q2OA 2GPYA 2XUKA 1UIMA 3N8IA 2PXXA 1QHHB 3HB5X 4ND6A 4BO7A 2A92A 1QF7A 4CMGA 4FUTA 1RWVA 1ODKA 2JFNA 4OHOA 2CD7A 2ZUVA 1W5SA 3AI3A 3I3SR 2QYSA 3E4CA 1TW3A 4QUIA 3VBEA 2EHJA 5CB0A 2NU7B 2XH8A 3VC2A 2WU4A 3NCHA 2PXAA 2MJLA 2HK6A 3IO5A 4K6OA 3NHAA 1OXVA 2IE0A 4EO9A 3HO1A 3PXDA 3BF8A 3OMXA 2DULA 5K51A 3HKEA 3HA2A 4A91A 3UJNA 1V8FA 1FFBA 3OOEA 4L8LA 4CMCA 5JJCA 4PZLA 5KTPA 2QBYA 1YQUA 2REOA 2DJ5A 1ZW6A 3DLHA 2F59A 2R6CA 4IJ6A 5FA8A 2L2QA 3MWDA 5AW2A 3L6EA 4R2LA 1SVUA 4DARA 3WICA 1R37A 3JQ6A 1P1IA 2CUNA 1KI9A 2FWJA 2YQZA 4ASUD 4B3XA 3O8DA 2B69A 2PZJA 1YQ9A 3JRNA 2VK4A 5GJVC 1BX3A 3QKRB 4RV5A 4CZ2A 4V0LA 2VAVA 4YRZA 3EASA 4RVCA 4H7EA 1UJ2A 4O33A 5AUOB 3NVDA 1PW7A 3VXKA 4D9CA 5M34A 1OV4A 1I2BA 1DJNA 3KC2A 5CJ2A 2QNRA 4OQLA 2MINB 2UUOA 3I2KA 3ND6A 2OA0A 1NRWA 4PZ0A 3GMSA 1AURA 1G20E 3ZJYA 2XB4A 2E55A 1Z8HA 4BEWA 4YP6A 4HAWA 3F8WA 3VSCA 3L8HA 5JARA 2F8TA 2UUAB 2GCGA 4F4UA 4KWCA 3OEEA 3ROKA 3F67A 5LUAA 3U44A 3BQ9A 3GGCA 3BPSA 5HDQA 2P67A 2JLUA 2XRZA 1FNNA 2ADFA 3D5EA 3JW8A 4Q39A 2RHDA 4FS3A 4XXHA 5JAOA 2EDCA 3R9KA 4DTCA 2VJYA 2YBEA 4MV5A 2D7JA 3SKYA 1NRXA 1P7VA 4DCCA 4Z4QA 2DWUA 3OF5A 5KCMA 3O94A 3SQMA 1E5DA 4ZMBA 1S1MA 3GLGB 1C3OB 1CDOA 2NTJA 4LS3A 2Z1MA 3P0FA 5KJ6A 1T15A 3CW9A 3R2JA 4UVDA 4HQ0A 2OYSA 5BRNA 1MIOA 3FFXA 4ZT7A 3WR5A 1DC5A 2AE1A 2VNIA 3WB1A 1VSTA 3BE5A 3EPKA 1A98A 2HZBA 1U2TA 3A70A 3KZMA 4IIHA 4LV6A 3BFJA 3JQAA 3PUZA 3G8YA 2GLUA 4H4DA 2YHBA 3GMDA 4KAXA 4PLFA 1E3SA 1HRKA 3AHFA 5B4TA 3SHTA 4F4IA 3RGWS 4F6LA 1T1RA 1VP3A 5CYOA 4I50F 4LZZA 3JQ8A 2VHXA 4CKCA 4AICA 5AKYA 3QQPA 3WGUA 3ZY4A 3MJ4A 4Q3BA 2CZQA 3AV0B 2IHZA 1TM7E 4E5DA 1ZLXA 2F8MA 1WXIA 2QXUA 3CJRA 5HM8A 1GKYA 4BFLA 3VR4A 2CE2X 4KR9A 5CEFA 5CLLA 1FYXA 2A88A 4KN9S 4BLQA 2CLMB 5KNCA 1BDJA 3KTOA 4RPJA 2QX9A 2IIQA 4RGBA 3F8TA 3SYRA 4BNJA 1IHDA 5KDDA 6CHYA 3U4HA 4NJMB 4EHKA 1I9GA 1LZLA 2ICAA 2IXTA 1W5EA 2OCYC 5T6BA 1LBTA 3ETJA 4MQ5A 5KSWB 2C61A 3F6SA 2QL6A 5AXAA 5FH9A 4URHA 2G1KA 4F1JA 3QELA 5IPFA 1TFUA 3I12A 5JNTA 5K4AA 5DX0A 1NLMA 4HNSA 4HWPA 1X8LA 2ZP1A 1HL7A 3CJQA 3QEOA 2K4MA 4P08A 4ZVNA 2O6HA 4BNKA 3KUDA 1NQVA 4D8YA 4FCVA 3KZCA 3STYA 3STUA 1RDFA 1D07A 1SXPA 4YAIA 4G65A 3VYTB 1LSJA 3L4BA 5CDUA 5IH7A 3UG6A 2ZWVA 3UOWA 4C7JA 2Q1YA 3BIOA 2Y4NA 1VIVA 3DWFA 4UOQA 2NU6B 1LPPA 1QHHA 1U90A 2ZW9A 4DIBA 3QMMA 4KE7A 1XTZA 1KYZA 2VDRB 2GJ8A 2NQTA 2XE6A 2DHCA 5CLJA 2K2WA 5DASA 3REOA 1ODIA 3PD0A 2NU7A 4LSZA 1PGJA 3HUDA 4YT2A 4TYNA 2ZXFA 2VNHA 3NOXA 3QVLA 1KY2A 4LGCA 3D3NA 3E7DA 5B7GA 2WIGA 3HGQA 1TMKA 4EZBA 4NBSA 3V1TC 5HJ2A 4AS3A 4ECAA 3GJYA 2VHWA 4O29A 1R0BA 1NSYA 2N47A 1L7PA 1CNFA 5AM1A 2BGGA 4JR2A 1ZBQA 5BNIA 2FKAA 4BQSA 2IUSA 4LIPD 1RKQA 4NZOA 3RUCA 3QE2A 5FO1A 4CLDA 4BB9A 1JIIA 3R7SA 3FPAA 3T94A 4LJ6A 1BE6A 1L7BA 3A3YA 4MQMA 1RHRA 3FWNA 4D3ZA 3UH1A 3BDVA 4XA8A 2CEKA 1YOBA 3QKRA 4KFSA 2HK7A 4DR6B 2QM0A 4KBFA 4LMAA 1OMOA 1KJ9A 2EQ5A 1RLTA 2HC9A 2MIIA 5FTMA 3T3DA 2ZIXA 5IYZF 4XB1A 1Y0BA 4XQCA 2YHIB 4Y1GA 1X15A 4KSYA 1I5EA 2ZBEA 3BHJA 2PKWA 3BWXA 3DAOA 2MINA 1ZVKA 4LYDA 4URZR 5JMTA 2O8CB 1JG3A 1K3UB 3OUTA 4E5SA 1RM5A 3FF4A 4UDNA 5ALXA 3PFFA 4HUJA 2HA4A 4K26A 4X1IB 2ESRA 5EP2A 2I22A 3KTAB 4RZIA 2H4YA 4L8YA 1I2ZA 3SYTA 1PIWA 1T2UA 3H9BA 5FX2A 1THMA 1Q21A 3UWSA 2J3QA 1XZLA 5EHNA 3NFRA 1I4LD 2R00C 3RANA 4C7XA 3S8YA 1A9YA 3JWIA 2PUFA 2G71A 4PSVA 4TQGA 2DVMA 3OM9A 1Y3IA 4BV2A 3GELA 4DDWA 1WU8A 3J81k 4MUYA 4QQRA 4ND7A 4G4GA 4PIPA 1WXGA 1V96A 5EFOA 1OT3A 4MKHA 1C3OA 2J09A 5EUBA 3LC7O 4IDHA 3AB8A 1O3YA 4GMXA 1F4PA 3GGSA 3F73A 5IM5A 2CNNA 4HB0A 2ZYHA 5KSZA 3N3AC 4N3GA 4C5AA 4IMRA 1DINA 5E38A 1G8YA 1PJLA 4KMOA 3TXYA 5AW3A 1Z4IA 2YOGA 1MXFA 1PU2A 4BE4A 3PV0A 3MHTA 3FGPA 4J91A 1E61A 1M1NB 1SPXA 1T6XA 4N12A 4A2CA 1ZK0A 1NQ5A 5A3VA 1VLLA 4TKLA 5AVKA 2J6CA 4RMIA 2ASEA 2FFHA 2QPLA 1U5BA 4C5CA 4AO7A 1PFGA 3EGVA 3Q3HA 1NFFA 4YWHA 2C7QA 3FMGA 1DJQA 1D4ZA 1XXHB 4HWGA 3RUPA 2GXQA 1H3FA 2C54A 4ND2A 5BR7A 4L72A 3TEFA 1ZUHA 4RXMA 3NIFB 1WB9A 3W5HA 4J16A 1K9SA 2VJOA 5JNVA 3CEJA 4NJMA 2QTWB 3ELDA 1KEZA 2F55A 4A8JB 4TMZA 1GNRA 1GPMA 1L5MA 3H6HA 5EJ2A 1XVTA 5B53A 3RBZA 3UO8B 1P0FA 4DSAA 1H2HA 4OCZA 2F62A 4ND4A 4Y7CA 2XUPA 3DMTC 4YUYA 5LYYA 1MVLA 1PEKE 2YUIA 1UQRA 3WLHA 4J8PA 5DCYA 2GK6A 2HRRA 2QY9A 1UKBA 1FFGA 3CZMA 2TSYB 4FYXA 4ZT4A 4HDKB 3RUEA 3LCRA 3RHTA 5HGXA 3QXHA 4CYMA 5JG7A 2QN7A 4S24A 1H5UA 1X7YB 3UM9A 3OECA 1EK0A 4HDAA 4IEEA 2X3FA 2FWMX 2J3JA 3AR4A 4ZEWA 3EXHB 1A5BB 2YWXA 1BYUA 3FUVA 3JQRA 1MN6A 4RHUA 2JA2A 1GPWB 3HJHA 2CLLB 4HDOB 4IJUA 4P53A 5E2IA 1MAHA 3TL6A 2NU6A 4RV9A 5CA0F 2I33A 5JECA 3E61A 4R98A 2CBGA 3CH6A 3ETLA 3E8XA 3P45A 4TMTA 5BSVA 1FDVA 3O8NA 1H2EA 4QBGB 1PX2A 2IS6A 1YQXA 3IAM1 1LPNA 3L0BA 3NORA 4INPA 4KWEA 3DBRA 1ZD1A 3LZ6A 1VCOA 2VRWA 3RRNA 1FNBA 2ZYUX 4JLKA 2JCBA 5CVDA 1K8YB 5IABA 1QC5B 3VOTA 1NG9A 4PBSA 4RJLA 2J4DA 5D7NA 1Z7EA 4LXHA 1M2HA 4MDYA 4YVFA 5DGIA 1MABB 3RWBA 2ETXA 2D1FA 2FR0A 3N0VA 3T7DA 4JHXA 1ZA2A 1DFGA 2I34A 3LOUA 3ZWBA 3LGXA 1VE3A 5AIAA 2UZ4A 2IS2A 1B6SA 2ATVA 2AT1A 2H54A 1RLIA 5K0EA 3VZSA 4NXMB 1N2XA 5CCBA 1RWWA 5U4XA 1BA3A 2HRCA 2NVWA 2PA0A 3JQCA 3NPAA 4FK8A 4HPWA 4IQGA 4DIMA 5D5QA 4M1ZA 5F2NA 5TRTA 4E30A 1NYTA 2YHIA 1PFQA 4B6FA 1O94A 2H29A 2P41A 5HZHA 3L6UA 1CJVC 3L01A 2O8CA 3L4EA 5U9CA 5DHSA 2FUG1 5J2TF 4Z9AA 5H1YA 1VCNA 4X1IA 4Q12A 3B3AA 3PGXA 4FKZA 1AV6A 4LSGA 3KTAA 1KAQA 3ROXA 1IXRC 3CQ9A 4MH0R 3ZDFA 1RHMA 4HYQA 5EQDA 5F5NA 5AM0A 4FJ1A 3PT9A 3A1CA 1KQPA 3NUZA 5AKIA 1WV1A 1KI2A 2BMVA 4V38A 4DQUA 5JJIA 5GVRA 3O4JA 4XM1A 2HNKA 2HIHA 4NWIA 3RSHA 2HQSA 2GFQA 5FTLA 1C41A 2AHRA 2NTEA 5GZ3A 2O50A 1BEEA 3TXAA 5AVXA 1SUCA 4GGMX 3OKAA 1CVLA 1KY5A 3GVIA 5HVNA 4R1OA 3H9UA 4PGAA 4F4FA 2GEVA 3S55A 2X8JB 3RTAA 3VBCA 3OFSA 2I6UA 5ADVA 4H9GA 2P35A 4HLNA 3FXAA 3FB4A 2AZDA 3SE0A 3N86A 1W85B 3KBBA 4G84A 4KIWA 5JZ9A 3BDAA 2C04A 1J8QA 1N6IA 3NYRA 4FEAA 2WHRA 1GV1A 1ZSVA 2BFEB 1U63A 2RB5A 3BGOS 2GUGA 4NYJQ 1M1NA 2HRQA 1ZEMA 1ZX1A 3RU9A 2H85A 2HHAA 1N7HA 3DXFA 4PLGA 1U3WA 1QKIA 3Q3EA 4K7JA 4ZK6A 1G5FA 4DHWA 2R8BA 3GEGA 5J4LA 1NNSA 3OPYB 3IJEB 4U00A 2VWGA 4WHMA 3SVTA 2ENUA 2I2BA 3WMXA 4KXFB 1L7DA 2HBRA 3QFCA 4Z54A 2H1SA 1XXHA 1DEXA 4J0IA 4NU0A 3TRHA 2C29D 1HFWA 2R47A 3C16C 4YJHB 2F7SA 4L76A 3K05A 1D0IA 2PYDA 3QXCA 1JLHA 4ZZ2A 1PLJA 1EAYA 3A32A 1UUFA 4A73A 4A8JA 4WZBE 4M0PA 2BE9A 2P6PA 4JXKA 1Z13A 5C7IO 4OLJA 4J1TA 1NQUA 3GFQA 1V3TA 1NVWQ 3L7LA 3QF7A 5F9MA 3BBPA 4C7KA 4XWKA 5A7GA 3ZWXA 1GKIA 3DLAA 2QLNA 3MSCA 1RJ9B 5GQSA 1P3Y1 2V6JA 1D8TA 4ML3A 1QM5A 4HDKA 4KPFC 3RE1A 1O1YA 5LBTA 3WXBA 2P3LA 3PUYA 2X2OA 3T0IA 5CFRA 2IHYA 2Z8YA 2C4UA 3MS7A 5HILA 4IH1A 3TRIA 4C4AA 3MB8A 4EVQA 2Q3CA 1IPFA 2H59A 3FWZA 2XGJA 3EXHA 2IPOA 1XTTA 1LX6A 1ZGBA 2PU5A 2YWDA 4HDSB 4OI4A 5JLAA 4LN1A 2Q3MA 2WV7A 3Q5DA 4ND5A 2NSLA 3JWGA 3ROEA 1EESA 2B1IA 5IAGA 5D87A 1FF9A 3KR1A 3ESBA 3VSDA 3HUUA 2AHOA 5EQFA 2QRUA 2PWBA 3IOBA 4E2YA 2C7PA 1I3MA 2YN0A 2XIJA 4EPXA 3JU3A 4ZI5A 3D4LA 1DS6A 5IF9A 2VJCA 4D9BA 5A4AA 4JY7A 1JE0A 3I32A 4P80A 3I64A 4JMPA 2Q4EA 3AERB 4LZNA 2GYWA 2Y77A 2JCVA 3U7IA 4YV7A 3K96A 2WVJA 1QC5A 3V8BA 5KDOA 1W93A 3HY4A 3IO3A 3OIVA 1JDBC 3WAKA 5DT9A 3N8NA 2PXCA 1OH7A 4YCLA 1YNOA 2QTVB 5G4KB 1DMSA 1ZH6A 1MABA 3HL4A 3O1JC 2QGFA 5DWDA 1GPUA 4BPBA 1DAKA 3OA2A 1DLIA 2HCTA 3DT8A 1QDUA 2B1QA 3CX4A 4U6NA 3VJMA 3ZK7A 1DJMA 3VYRB 2VTEA 1NLYA 3T1NA 5P21A 4CV3A 1TEZA 1Z5ZA 5H4HA 1QHIA 3TUJC 2EZTA 1H2FA 4RMJA 4KO4S 2VFAA 1W4AA 2W2PA 2Z4SA 4NPAA 3G2HA 1LVHA 3G49A 3AMVA 4YRCA 3K6KA 3QUCA 2IITA 2FN7A 2QM7A 1ZCZA 1A1VA 1YF3A 3R8CA 5K01A 1A5AB 4DMMA 4I6GA 4JSRA 4C05A 3D6HA 2QAGB 3QU9A 1RLOA 3TPZA 3TQIA 1CQWA 4M21A 3OA0A 4WOCA 3M2PA 3U6BA 3AB3A 2QZJA 3EIXA 4G01B 4GQBA 4L75A 3BYZA 4L4YA 3LA6A 1VFNA 4MUFA 3P9PA 4NLLA 4RAQA 1DVRA 1XMIA 1NVXQ 1WW3A 4MVWA 5IVPA 2EP8A 4OYHA 1T1GA 1SXJB 2DPMA 3QEMB 2WF7A 5H9WA 3H5AA 1U7TA 3DBOB 4R1QA 1WUYA 1X8XA 3MWYW 5JASA 3CRW1 1PTJA 2NV6A 1IZZA 1JHDA 5FV4A 4MVJH 2X8JA 5JC8A 3UIEA 4GMFA 2OE2A 2VHCA 2VJDA 2WDPA 3EDMA 4R9RA 2ZXUA 1TQDA 3PUHA 1W85A 2R8PA 4CV1A 4TVOA 2Q1UA 2WVAA 2V9ZA 2VAWA 3PHCA 4KQMA 2BFEA 1VGQA 1TPYA 4PEVA 2N46A 5H7XA 2HLNA 1TM5E 5FJIA 3X2SA 1M5RA 1JMKC 3GUCA 2GNAA 2B1RA 3C3YA 3GLTA 2J5XA 2P9JA 3R41A 3ZDEA 4PN7A 2PUDA 4MITA 4RY0A 1XWWA 2XMGA 3OPYA 4LRUA 3VR2A 4DJTA 1NU8A 1ORWA 2BF7A 2PT9A 2PRKA 5C7LO 1KEEB 3FPKA 3OO1A 4RS4A 4YJHA 4PBRA 5D8DA 1E2KA 2R6ZA 3DOJA 3P7MA 3PCRB 4ZOLB 4ZMSA 1TI7A 4RTOA 2PUGA 5JDCC 2PX8A 3F8SA 4DAEA 1R88A 4Q9KA 2RHMA 4H60A 2IV7A 5LFAA 4O1IA 3I52A 4F5EA 1F1BA 2OM2A 5KKAA 4DIUA 4DR2B 1YHYA 3VNAA 6REQB 4W5WA 4X92A 3DO5A 1EP3B 1ZI9A 1SC9A 1X13A 2ZBQA 2J3MA 4L4ZA 5BQ5A 4AF7A 1HORA 1Z6YA 4B84A 4NBVA 1RJ9A 1BG6A 2AMVA 2CV0A 2O2SA 3ANTA 3R5JA 2F00A 2CZCA 2P68A 2ZBDA 1Q1EA 1QMGA 3C87A 4D1YA 1UDRA 2WHYA 3MFYA 4OV6B 4Q4LA 1F8YA 1TLTA 3V7NA 2F9FA 1B1AA 2A9PA 5JO0A 3K8OE 4HDSA 4OA8A 5K5EA 5LP6C 1BE1A 2HJHA 4QPNA 4ENTA 1NV8A 1E8MA 4OHMA 4C87A 2B92A 2A30A 3KAJA 2VYCA 4MRSA 2XMPA 1D09A 1BWSA 4I66A 1RBZA 3TLEA 4MUAA 2RJOA 3HCFA 4JC5A 1SUPA 1UFOA 1L1EA 1W4LA 1A5SB 3UXYA 1G5QA 4KRYA 4S1VA 3COPA 1R5OA 5DX1A 1YAJA 1ISGA 2GZ3A 3EEBA 2WTXA 5KTTA 4RO0A 4LPSA 1EXDA 4A03A 3H16A 4J2HA 3FLMA 3B6ZA 4ZRNA 2V7BA 3NT4A 2YOHA 1UBUS 3DEZA 2R5NA 3CPSA 4EATA 2D5AA 2H3EA 1XTVA 2NO0A 2C2XA 4P3OA 4OXKA 5ALIA 1N2IA 1XVAA 2BLNA 1QGAA 2C9MA 2IXBA 3RTDA 1DBVO 1TUGA 5HJ7A 2FV8A 1PKXA 5D6NA 3VVCA 1P5FA 5FPQA 1M2OB 2H2FA 4FR0A 3ZH2A 3IBTA 2PZBA 1DXQA 2IYFA 3NX4A 4H1VA 1OC2A 3IT0A 3QEKA 4IFIA 1VI6A 1XJ5A 2F2TA 3QX9A 1I7PA 2M1ZA 4I8XA 1MJNA 3GRYA 1QE5A 2RCNA 4AJHA 5KPDA 4HEA6 3AVUA 4IYJA 1D9ZA 4LCEA 4ZQIA 1SELA 1FYWA 4XVUA 3EH2A 5EE5B 2BEJA 4WKGA 1AKYA 2IPLA 5DT2A 4RE6A 1NUHA 1NONA 1JT9A 4J94A 1LSSA 2D8MA 1OHHA 2GAJA 4DA8A 3AG5A 5TLSA 1VLQA 3ER8A 1C8KA 2RKBA 2CNDA 3D6AA 2J3IA 4HRXA 4E08A 1ZJZA 1QTQA 3PDIB 1ZR4A 3AIIA 1SXJA 2P5TB 3QEMA 3RO7A 4BU0A 5BURA 2NLOA 1R8JA 3NCTA 1C7IA 3ZY3A 3B3FA 1JLRA 2H9IA 4TV9B 5AKGA 2OXCA 4ASUA 1VJ1A 3CW2A 3HDVA 2QUJA 1EK6A 1FFXB 2ECOA 2HPVA 2X76A 3AJ9A 3B78A 3N74A 3R40A 4WCVA 3EXG1 2P1DA 1QRRA 1CIVA 3P27A 3PB3A 2QNBA 5DHQA 4II7A 3TL3A 3ZGXA 4EVRA 1TKBA 1Z0SA 4KZKA 4JIGA 1ILEA 2RG7A 1JHMA 3LT5A 1MRSA 5BR8B 1YQDA 4J3FA 4HH3C 4K03A 2L18A 4FP9A 1N32B 3L4JA 3WO1A 4OLFA 2H07A 4HD8A 2IFTA 5JPDA 2J6HA 3K6JA 1Y6QA 2Y0DA 2AQKA 2RGDA 5GIPE 1TX4B 2CL0X 4M54A 4NH0A 5ILGA 2VKQA 4RGQA 3UMRA 2IU6A 1I14A 1CY8A 4D80A 1P0CA 1PJQA 3CUVA 1KEEA 5BSWA 1YWGO 2GN9A 3PGVA 4CJXA 3HVRA 4PXSA 1RJEA 3NT5A 4BC1A 5LQDA 2FMXA 2I6XA 5ES3A 4UBJA 1VGRA 1AF7A 3I92A 3KNZA 4YRAA 2WYWA 1IEXA 2HF7A 1OWNA 3H11B 2MSWA 2OL4A 3OKPA 5EAIA 1YAHA 2KWIA 4UBOA 2PJUA 4KMRA 3UAOA 2J3EA 4BZPA 4WNYA 2Z98A 6REQA 4O4HF 1SUFA 2G1AA 3S5JA 3UYKA 4LOAA 1OFIA 4KQCA 4K5QA 3OLVA 4OH7A 3T9DA 3CZQA 2PNFA 1HM5A 2AW3A 1YFLA 3W4JA 3VGPA 4P58A 3GB9A 3ZVLA 4M2LA 3TSZA 5HKBA 2WZQA 1D6NA 3EWNA 3I1YA 3NQ41 4DLBA 1MPXA 2C98A 3O8QA 5DYGA 2ZQ5A 4TXHA 1A2KC 3HE3A 2JBWA 2PBFA 1BROA 1P3JA 4BB6A 1ZM4A 3Q7RA 3RBXA 2PMWB 2D5IA 5AW8A 5CFOA 4YI5A 2EV9A 1Q0LA 5IG2A