4LXXA

Crystal structure wlard, a sugar 3n-formyl transferase in the presence of dtdp-fuc3nfo and 5-n-formyl-thf
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
273
structure length
273
Chain Sequence
b'GHMIKICIAGKNNIAVNSLQFILKNYFEADQIVVIPNKNDKGIDSWQKSLLKFALDNNIKIVTLDEIYNIEQIIFFSLEFDQIIKIENFKSDRLFNIHFSALPKYKGVFTSITPILNNELESGVTLHRIDNGIDTGNIIDQHCFPIDINDTARDLYFNYLKYGESIFKKNIQTIINNSYKDLKQTNINSSYFSRKDINLVHKINFKKTSFEIHNQIRAFIFQEYQLPIINNSKIIKSILANEFIGYNVFEEFENYFIISGIDGFKIIAQKLNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WlaRD, a sugar 3N-formyl transferase
publication title Structure of a sugar N-formyltransferase from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Transferase
total genus 90
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lxxA00
4LXUA 4LXQA 4LY3A 1Z7EA 4LY0A 4LXYA 4WKGA 4LXXA 4LXTA
chains in the Genus database with same CATH superfamily
1V37A 3I9KA 1XJQA 4HPWA 3EBPA 3AVTA 3I72A 2N3ZA 2HUPA 3QLUC 1Z4MA 2M1ZA 2MOKA 3PA8A 3DKRA 1Q57A 2PVSA 2V4UA 3QJGA 2IHVA 4TTAA 3N2LA 3MBKA 3TQIA 2FCAA 5T6MA 1U65A 2VCEA 1X19A 1C8VB 4DY4A 3N8IA 3MJDA 2B4AA 2BKEA 4GGOA 4HC4A 3I28A 1ZGBA 5DOZA 4OQDA 5BV8A 3OBBA 1OIVA 3DFMA 1OLUA 2HJ9A 2B98A 3A6GA 1XZFA 3LWDA 1NPDA 3ZWQA 4AMYA 3HUDA 2HK6A 2HRDA 4IDEA 4HJRA 1MIOA 3LX5A 3MS7A 3B7WA 1Q1AA 4Y67A 4EB6A 2WU0A 1EDDA 1I6WA 4XD7A 4AQ7A 4DIMA 2PX5A 4C01A 1RZ3A 3M8KA 4C0QC 3UEOA 5HE9A 2VTKA 3Q9NA 2GJSA 2NV2B 2LCFA 4F8EA 4MQFB 3FCUB 2P9GA 2Z95A 3OLZA 3TEMA 3L8FA 3PUJA 1A72A 4RWZA 1FVFA 1DWOA 2P5UA 3C45A 4AXBA 4PS0A 2W2XA 4ZCMA 1M6YA 2CVOA 4WERA 3UIEA 3OTOB 1Z8NA 3MG9A 4YMSA 5A9TA 5JDCA 4OCZA 1P61B 2WM2A 2YV3A 4CCYB 3C8UA 2Z9DA 2YXNA 4RIGA 2DTEA 2I87A 3IAUA 3KFXA 4FE7A 1L5KA 4I8DA 1OI4A 1QYRA 3GCZA 3PQ4A 2ID7A 4N12A 2Y1LA 3KIPA 4RWEA 3V3KA 4C0AC 4DC0A 3UV6A 1Y34E 1Z0IA 1JPUA 2VAWA 3CM0A 1D4OA 1U2EA 2AF4C 3QEOA 5GOTA 2O8CA 2II6A 5A1TA 1BA3A 5C5EA 2VZ0A 1UJBA 3QU2A 4CKWB 2JHFA 4EBFA 1L7PA 2YOFA 4GOJA 4EENA 1AB5A 1JJVA 5LP6B 2XNJA 3DZGA 2J33A 3AR9A 5TMEA 4OJYA 4QPDA 1EFVB 3PDWA 1XGKA 4P0TA 4UMFA 1ESZA 2L18A 3HZOA 2J46A 2HFJA 3ACBA 1SKAA 4ZKDA 3EZFA 5IF9A 5G41A 2HSEA 3LT5A 2E82A 1W4ZA 2ZSBA 4HNUA 1JPNA 1QE0A 4I9NA 4B6RA 1DEOA 2MMGA 3UTCA 1U28A 2F3UA 3PA6A 1IQPA 2LE0A 1TU0A 3HKEB 3EW9A 3H1AA 1CW2B 1SXJC 1ZA2A 1E2MA 2IHUA 1NX6A 3KFLA 3DMDA 4L5BA 2BKAA 4J9UE 4QFMA 2AKAB 1AK2A 3SK0A 1X1QA 4KR7A 1JHXA 3QNUA 3JQBC 2IKSA 1P1CA 3U4HA 4Z0NA 1GTG1 2B2NA 3IT0A 3JU3A 3T7RA 3TXYA 1YAHA 5IT4A 3JZAA 5CLIA 1XQ1A 4JGIA 1J2RA 1M1NA 4WOKA 4C6RA 1Z37A 3LKVA 3T1OA 1YFZA 2AB0A 2GN4A 5DM0A 4EUHA 2AZMA 3EIHA 4IRMA 4XX1A 1XV5A 4Z7OB 1C3OB 3Q1KA 4XOUA 3BJEA 3UJDA 2AOUB 1SQGA 3EARA 2KYRA 5CPBA 3UW3A 1CE8B 1DC8A 2W2QA 1UPCA 1TM1E 4IOKA 5SZHB 3DEZA 4IGFA 4KQ9A 4C0JA 4EGSA 2HMTA 3A6EA 3H18A 1QFSA 1S2OA 3N75A 5BW5A 4L0CA 3GEBA 4MTLA 1T43A 1G8KA 3VYUB 5AUOB 1NXWA 4D0SA 1SA0A 1U63A 2OHFA 4XD7D 5K3FB 4CQLA 4E14A 5CFQA 2VHTA 2W6JA 1II8B 4OLHA 4R4JA 4GBGA 4LX0A 3LPDA 4A26A 4EK9A 2WWHA 5ENVA 1EK2A 4EHAA 5LQAA 2VH1A 2X5OA 3R40A 3NT2A 4ZGBA 3BGIA 3MRSA 4A82A 1PG0A 1RRMA 2ZXUA 1DWPA 5K4AA 2LXNA 3FLAA 2RH9B 1PX0A 4R98A 3H3FA 2X14A 1G291 2YXEA 6ADHA 1L8OA 4D9GA 5EJFA 1M8GA 5CAEA 5HTKA 1HORA 4OPMA 3F4LA 3GWZA 5T4HA 4LF4B 4LXIA 3FCAA 1M2EA 2OCAA 4I4NA 2ZYAA 2B92A 3QWHA 4ED9A 3GRYA 1FU4A 3IQFA 4DG9A 1VL2A 1IOZA 1GZVA 1QVZA 4DSNA 1QJ4A 4X62B 2V96A 1T6YA 2SCUA 4G4IA 1KZ9A 4N41A 4CETA 3AWIA 1TJ3A 2CXUA 4D42A 2C9YA 4JU9A 3E03A 2E4YA 4UDOA 4ZVUA 4G3XA 3GG2A 4EGJA 1ETHA 2AYXA 3BXXA 4C1NA 4LQLA 4AXXA 1SOMA 3U81A 5F2EA 4D8WA 4G4GA 3WYFA 2QTFA 3E35A 1CZNA 4IF6A 4QBIA 1A9RA 1SUDA 4YJGA 2YBEA 4KFTA 4Y18A 2IPOA 2V58A 1L5SA 3R76A 1TMOA 5A4IS 3NHMA 4R3UC 1KOFA 2QMYA 3QPCA 1IN8A 1UP4A 4KO3S 4RGYA 5DRYA 1NULA 2YYAA 5KOHA 1UZUA 2OG2A 2NXEA 3FW1A 4AZVA 1FYEA 2BSXA 3IP1A 4DQUA 5T8KA 2TMYA 2PKWA 2VYND 1OA1A 2B7BA 4OA8A 4ZARA 3DWGA 2C8LA 2Y3IA 3TX6A 1PZNA 1B42A 3GLGE 2YKGA 3CH6A 1M2OB 1P5JA 2VO1A 4I46A 5ALWA 4Z9FA 2A30A 3GHHA 2H92A 2Q7XA 2KM1A 2W58A 2PMKA 3CW2A 4XSGA 1QRUA 1QU3A 2PUWA 2FFQA 1LC3A 1JWAB 2J9FB 2EC5A 1LPMA 2Z5FA 2X9LA 2H2GA 5CCEA 1W6RA 3DE6X 1CFZA 3L8CA 2V9ZA 1IDN1 3O9ZA 1QOQB 1VKJA 3ND8A 4BV9A 1PS8A 3M0EA 2H1IA 1CYEA 5JLJA 3KJNA 1JQ3A 4KE7A 2OB2A 3LBAA 1WMDA 2W48A 5DK6A 3QX8A 2PLFA 2OHHA 1PWYE 5IKXA 5HA5A 5B55A 3JASA 2QZJA 3G6KA 1ZISA 2W6CX 3HCCA 4KQCA 5D3MB 3SWWA 4H7FA 4GP9A 2FK8A 5LXTF 3WJ7A 3G7UA 1CK4A 5FFMA 4B5KA 1RQ2A 2W6JD 1P8AA 3I83A 2XGSA 4RZ2A 2EV9A 1HWYA 2XUAA 2P41A 4LE0A 5C8YF 2JA1A 2XE4A 1FDIA 4BNYA 4ZVTA 3QPWA 1Y3BE 3BXGA 1JWBB 2DUNA 3H1EA 2D1RA 1H2BA 2GD6A 3OC0A 4WDRA 4X20B 5JARA 3BZBA 2BELA 1VC2A 2OKCA 5REQB 3PP8A 3ZW7A 2GRUA 1AKNA 1LF5A 2HA5A 2YV1A 3OZEA 5KYYB 1A88A 4LGVA 1PQPA 1U7WA 3GVIA 4EOGA 1YVPA 1VECA 3KYCB 1C3VA 3SBXA 1MG0A 2AJBA 1HZZC 4HGYA 1AQJA 1M1YA 4JC4A 4DVJA 1QFMA 5JI3E 4D1YA 3GJ7A 1GL9B 1KR5A 3ZV7A 5KNBH 3R77A 1ZMOA 5AJYA 1NG1A 1GZSA 1USVA 4KRFA 4UHEA 1U6KA 5EY5B 4XR9A 1CY0A 3IYLW 3MWGA 5SYAA 4FHEA 2CCJA 2H4JA 2GWRA 1KI7A 3X1ZA 3TI9A 4BIIA 5AK6A 1I4LD 3HXQA 2XMRA 3HHPA 3RYCA 2A94A 2AMFA 3I12A 2FUKA 2Z5GA 3ESXA 1UDBA 3U2QA 3W77A 3W8EA 2ZJ6A 3KM0A 4IDPA 2D2EA 4NFLA 4D6XA 3ICPA 4B33A 5IJ9B 3BH7A 3D3JA 2X2EA 4IIVA 4LV6A 1X2EA 1HYGA 1MD9A 2R1ZA 2CLSA 3G2OA 3C8MA 3IB6A 1UJ5A 3OPQA 1L4MA 4GX1A 2OGZA 3F67A 4F46A 2VZ9A 1BU5A 3LPLA 3WMFA 2AXEA 2FHSA 4D81A 5FD8A 4B6OA 4XKJA 4LV5B 3TZCA 6REQA 4KIWA 2NO5A 1N6HA 2OY0A 4H3SA 3WLSA 2PZBA 1SBYA 3LVQE 5CA0F 1JDTA 1RMTA 2WE7A 2B2CA 4DVGA 3BD9A 5D51S 4HVAA 1OLOA 1PWXA 2ZI5A 3H7IA 4YACA 4XFKA 3RAEC 3LKZA 3BQ9A 2P4QA 3DE0X 4GVXA 1U8XX 1POXA 4BPRA 1G5TA 5A6SA 2H1FA 4QULA 3C41J 4UHKA 5G0TA 4C76A 2CVQA 2EGGA 3W8RA 1F7VA 4RGVA 2ZDQA 3CW9A 4IZOA 4RZUA 1N75A 1XTRA 3NGLA 3T34A 3UMSA 5LYJF 2AG6A 4WMLA 1JG2A 4YP5A 3ELYA 1SBTA 1G7RA 1FUEA 2E5FA 3DKPA 3TSYA 3CUUA 1WNTA 4UMDA 1JFRA 1Y0BA 3HMQA 2GUGA 4DV6B 5AM2A 4I1UA 4JODA 2CWDA 5MFPA 2DETA 4AQYB 2H4FA 3ZU6A 3OM1A 1XAIA 4FDTA 1IMJA 3A3YA 4ZT7A 3GDFA 3GOQA 3CVXA 4ZO9A 3UJ3X 1I6KA 1W2HA 3AT1A 2HNAA 2QMQA 1GYRA 1L3BA 3KPUA 4FT2A 1MJGA 3PC2A 3MBOA 5F3RA 3F97A 4Y0NA 1WF6A 3O8QA 2GK7A 1QIJA 3FD8A 4BEWA 1QGUB 1XZLA 3N70A 4MB0A 1SUAA 4BLWA 1QV6A 3ETJA 5ER9A 1Z5GA 3LP8A 4KIUA 4LDAA 1MB0A 2XITA 2YWEA 3GELA 3B13B 2WFLA 4LOKA 4NAUA 4TMZA 4PSAA 5FO1A 2WSSA 4X54A 1NXXA 1TZKA 5A3QA 2C7VA 2JLSA 3B82A 3GA5A 3OTHA 3FTCA 1Z6ZA 1KO8A 4KJXA 1KI1A 3KJFA 5C3UA 3W6UA 3F9IA 4OI4A 5BXQC 2J5BA 3S44A 3CNOA 4C3VA 1ULTA 2XOEA 4G0NA 2PNFA 3CW8X 5CT5A 1TM4E 4IDCA 2VDLB 3EY9A 5AKZA 1OW3B 2P7IA 1ZNYA 3GYGA 3SE7A 4LYJA 4BNUA 2YOGA 3IEKA 3KXIA 1E3TA 1QK3A 3H4IA 1HYBA 1QYVA 4D8VA 1F2VA 1U98A 2YY5A 3R7WB 2FZKA 3AINA 3PGKA 3R4CA 4B8WA 3N2ZB 3PD0A 2NUAA 4MUAA 3SHVA 5AK4A 5HSGA 2B7LA 2YW9A 1UBTS 1DARA 2I6SA 4FUTA 4TRNA 4E31A 2XYVA 4DZZA 2AZXA 2AN1A 4CCSA 3WIEA 2CUKA 2HBYA 3IEPA 4OAPA 4BU0A 4CL0A 3SJCA 4DGSA 3HO1A 1Q20A 2WU3A 1PFWA 1WVIA 2Q4EA 2XUHA 2DUJA 2NU7A 1UM9B 3CZRA 3Q2KA 3IEVA 3LHKA 2I4LA 1ZDMA 2G07A 2IW3A 2P2CA 1M0EA 4CTMA 2JAXA 3WE7A 5LMNB 2JBHA 4CEJB 1GTJ1 4QYMA 1NOKA 3X2EA 3I42A 3OHMA 3GNLA 4KXWA 4NZZA 5FBZA 2J6CA 1UJ6A 2W2OA 5DU2A 5DM70 3ANYB 4ND1A 3KOWA 3PV0A 1UINA 4G0ZA 4FKBA 4QNRA 3THRA 3E9CA 2A14A 3FFXA 1E62A 5JCZA 1QCDA 2X76A 2PV0A 3WRXC 2Q1UA 3DBVO 1XDUA 4R8KA 3JQ9A 1CS4C 3HV2A 3I3SR 4HLNA 1L4NA 4ZT3A 4HSEA 1K7XB 4HKTA 4WACA 1ODFA 1U2TA 1YKFA 2HK9A 2Q21A 3KKMA 2IUUA 2OFFA 5H02A 4EMSA 2NO9A 4NS1A 1NBHA 1QPGA 1BROA 2A1TS 2V6JA 4RSRA 1M6HA 1RZUA 4TWJA 3GCGA 5FOSA 5D3QA 5A02A 3ECCA 1Z5OA 1TU4A 4I66A 2EVWX 1SHUX 4TL7A 3ZY2A 1RXWA 1LDMA 4UHJA 3ZN2A 3TFOA 4IEFB 1DTWB 3SBEA 3CE9A 4LHEA 4YQFA 1I6MA 1JKXA 3GRVA 4P7KA 4L9AA 1I0IA 5F21A 3D02A 1U7DA 1NKSA 2BWJA 1QX3A 1ZN2A 4WXHA 4IDOA 4N47A 3VTFA 3S8EA 1GAEO 1NTOA 3GUCA 3W2GA 3TIIA 1OTHA 4DRXB 3PX7A 4OBEA 5FPPA 1EGVB 2UVPA 4RV4A 2XGMA 3KJEA 2NXJA 4YJ2A 4DB4A 5B3AA 4IMPA 2VA8A 4ZCQA 1NLFA 2YV5A 3I1YA 2ZBPA 4RE5A 4QICA 5BNFA 2WSSD 3PNPA 4R3WA 4B85A 2YC2C 3DNFA 1O94A 5H16A 1ISFA 2D5AA 3LXRA 4KDCA 4CLRA 4CL2A 3CUEF 5C53B 1HKHA 3HGMA 1TM5E 1KBZA 1V11B 3EISA 4U7HA 3HP7A 4RFSA 1VJRA 2Y71A 1IXRC 4U02A 5LM3A 2Y0BA 3G0IA 3KZVA 2DFTA 1T4BA 1VB5A 4ITVA 2AA3A 4TMXA 1GNSA 1PQYA 2G3YA 1MHPA 1V43A 4ID9A 3UYLA 4LFAB 4K0KB 2WPNA 3DEIA 3HH8A 1AX9A 5E1MA 5ICGA 3PWKA 4ARCA 4RZIA 2ZTUA 4N76A 1WEHA 4EG7A 5IHPA 3AUAA 1Y8QB 5TMBA 4OHWA 1ABFA 3NH9A 4ZMSA 2I2CA 1CUGA 3MINA 3R6LA 2WSIA 3HC7A 1IDOA 1VGRA 1QKIA 5J2TA 2ZZKA 2ZRKA 2B61A 1VZ3A 1OWPA 3G13A 2P1ZA 4R1LA 2WQ7A 4RIHA 1XTQA 1YZHA 1HE2A 2FGKA 2CLHB 1E2EA 2IE8A 1AK9A 1M2VB 2BMJA 2AI1A 1XG5A 3CX6A 4RDCA 4DLYA 5DBFA 4E2WA 3GQVA 3ORSA 1GKYA 4BNDB 3ZHCA 3D43A 3WAKA 1GZDA 4ZWNA 2D5BA 1IWBB 4KG7A 3RUDA 4GLBA 2XDYA 1N8SA 1K3FA 1WD5A 1EJ0A 1PT6A 2AXQA 1O97D 2G7ZA 3Q40A 4RVFA 3OIDA 4AWBA 4DSZA 3T9DA 5HTOA 3C8HA 1E63A 3FAZA 4GPIB 1XVIA 3OFNA 1OREA 4ASUA 3WFZA 2B3TA 1YONA 1GTZA 3GEHA 4NBVA 3QNMA 5JAMA 4FR5A 4D0GA 4CR7A 1LV8A 1ZAKA 2D2IA 2YMMA 2PKQO 3KXKA 3PGXA 4MWTA 5T5QA 4C30A 2P2GA 5IAJA 2PJRA 1U1EA 4M7WA 2CMKA 2IUFA 2I1VB 3WHPA 2FUG6 2YYYA 5A5FA 1J25A 2OCBA 3RFCA 4EMBA 4UDXX 2VHYA 4CIWA 2V55B 4JBGA 4LYFA 3GUUA 4M21A 5HOEA 2YHSA 4P82A 3D4LA 1VJ1A 3RWOA 4CF3A 4QYIA 1T5TA 3AUUA 3IDSA 3EMVA 4WFKA 3WLNA 1O94D 4WL0A 1RC1A 3WDMA 3TGLA 4TTQA 1I7DA 3FXAA 1QYDA 4UVEA 5FI3A 2W71A 2AI2A 4DLAA 5K8TA 1RCFA 4INJA 3D8HA 2F1JA 3EJWA 3LQ2A 3WRWA 1T35A 2CL7X 3IESA 4U2CA 4DWWA 1QP4A 5ENDA 5I7AA 4OU4A 2Q5JA 3TD2A 5B1DA 4ES6A 1Z33A 4WESA 4DMKA 1EIWA 3V48A 1UOEA 3JYLA 3L6UA 3A2NA 1UOQA 1VKNA 1CJBA 5I48A 1P80A 2R7AA 4CEIB 4BP9A 5AI4A 1LU9A 1WUHS 1P2VA 1XWFA 1YQXA 3FWZA 3QY0A 1P3JA 1VCIA 4UU8A 3I32A 3BL5A 3HV0A 2EQAA 2IFTA 5TXGA 4BNZA 1PVVA 3GAAA 1G98A 4JJIA 3ZCXA 1R0KA 2AN3A 1P2DA 4EAQA 5DHSA 4BQNA 4LMPA 3O91A 3F6EX 3LQQA 1SD1A 2IGTA 1C9MA 2P6OA 4P98A 1E7YA 1JT2A 2A78A 3WNBA 1V1RA 2J45A 2XQVA 3BCUA 1CJVC 3MIIA 3QKWA 1X74A 1DUSA 1SZJG 1TM7E 3VPBA 3QG1A 2F6RA 3QIAA 4JJ6A 4TV8B 3GJQA 2FOLA 4YT8A 1YVRA 4RK6A 3IPXA 1E1LA 4NAVA 2DGDA 4IGIA 3L18A 1EAYA 4J0GA 3GHYA 1N1DA 2G0TA 2H2IA 3CLUC 3FM9A 4GE0A 1RD4A 4ZDKA 6ABPA 2W42A 4FGWA 4GIBA 4X65B 1YS4A 4NC9A 2OMKA 1VSTA 4OQNA 5TS3A 1EVIA 2R4UA 2X19A 4OM8A 4TZTA 5I4KA 1QKKA 3T9EA 3KDSE 3O2JA 1XCMA 4B09A 1FVHA 4DEXA 4QDZA 4ASUD 2F1KA 2BFAA 5AHKA 4CXMA 3VU3A 5IKPA 1U9IA 3TXAA 2R79A 1ZPDA 1JVNA 3KB2A 4ER5A 4TZ0A 4AJLA 1D5CA 1UH5A 4JVMA 3EDMA 4K40A 4CUJA 2V1UA 1PEYA 2A0KA 2DPMA 3FSGD 3RKSA 2GCPA 5KYNA 5EP1A 4IOMA 1ZO8A 3LWBA 5DBGA 4RTPA 3AJDA 1JI0A 2UXCB 2GLXA 2UUPA 3QXGA 4V38A 4ND5A 3CNNA 1M3SA 4LNAA 4V1CA 1L3IA 4R9RA 2PFSA 4XIFA 5CJPA 1GP2A 1NI4A 4PQFA 4ALMA 3L4SO 1K9SA 3PUKA 3ORHA 3G2IA 1B1CA 2FAXA 5L3QA 3ZJTA 3ZHUA 3E9DA 1K68A 2YUTA 3G2HA 4RPJA 3U7QB 2D2VA 1XTPA 5BSWA 1XZBA 2FPUA 5L3SA 2VC2B 2VEDA 2O2YA 1KQPA 3EQZA 3H6GA 1NSTA 1F3LA 2AV6A 3KU4A 3JRXA 4FN5A 4EHJA 1EZ1A 3WMEA 4FTWA 3ON5A 2I8CA 2AD1A 2XQGA 4R1PA 4CDNA 1KEPA 2SKCA 5C3MA 4Z8XA 5K3CA 1D0VA 6Q21A 3FFBA 4H6XA 4M89A 1DUIA 3QF4B 4IMJB 5JY1A 2JLWA 4C4SA 4QJ5A 5C1OA 3TINA 1VPVA 4YJ3A 2M98A 1XQ9A 3S2UA 2K5UA 1T1SA 1UBFA 3SBOA 4RA6A 1QR6A 3DAYA 1SXHA 2AZDA 1WHSB 1XRNA 1FLNA 1Z26A 3C3BA 2BE9A 1UCFA 3TOVA 4F11A 2H7VA 1KY2A 1X7XB 1U1GA 2ZTVA 1AV7A 3URKA 2D74A 1Y5LA 3LFTA 4IZIA 3SY8A 3UKOA 1QIIA 3U3KA 1Z06A 4WZ6A 2YZKA 4ARVA 3CF4G 4V0LA 2HA2A 3G1TA 2QSJA 3I9JA 5DTIA 2W22A 3UOAB 3ZIAA 2BTOA 3NBKA 2G17A 2IOFA 2H5JA 2MU1A 5FPQA 1YBVA 3OPYB 2ZPTX 2CLIB 3SJZA 3UB3A 1XCPA 5DKFA 1Q3KA 2WNSA 4CBVA 5LQMA 3I52A 1EP1B 4JC8A 3CUWA 4FUQA 1MB3A 5DM4A 5DP2A 3V3TA 4OLJA 1DBWA 4M7RA 3OFKA 4AS3A 3AP3A 1WQ1R 4KXMA 5ETJA 3WJAA 2FWPA 4WNIA 5A62A 1NXSA 3DBHA 3HJGA 1V5IA 3R0IA 4I55A 4QPZA 4KOEC 4EYSA 2J32A 3VISA 1HKUA 3PD1A 1XJCA 4JYZA 1LNZA 3ETLA 4MX8A 1SXQA 4R2IA 1NBWB 2PKCA 3I2YX 4ZMRA 2EP5A 4A5OA 1A8UA 1QH8A 1RLUA 2X2FA 3LU1A 5FUMA 4U9HS 1ODIA 3EC2A 4C7XA 2YWJA 4KXNA 4M4SA 4DLTA 4B3SB 3RHSA 3IT1A 4BE7B 1N5KA 1QXSA 2GASA 3FX2A 2OC4A 1K6IA 4LF6B 3G2JA 3VR5D 1CEEA 5KYXB 2YIDA 1PR5A 2WFZA 4GR5A 2Z8YM 4NSNA 3PNOA 4EYKA 1RWNA 3N3BC 3O1HB 1RPZA 2XR1A 3ES9A 3EZYA 4ALNA 4D4IA 2ONJA 1O95C 4DCNA 3DAPA 3G2QA 4DIBA 2IYFA 3IOYA 4S04A 5HMLA 1FQWA 3GLKA 4ICIA 4OQ4A 5A7FA 2E89A 3AEKB 3I1FA 2PMCA 4RF5A 4RZSA 3AF5A 1QZZA 1RZRA 5CDFA 2G76A 2NU6A 3HZZA 1GRVA 2LCQA 4NK5A 4W4TA 4BMPB 1I13A 4DMLA 1FP7A 3GLHA 4ZVRA 1PJSA 3NM5A 3W78A 1P0IA 4Q6BA 3KUKA 1N0HA 3MLAA 4XLTA 5JECA 1CZOA 3K0SA 4EA6A 3K0CC 2OSBA 3I62A 1HT3A 1YO6A 2A5LA 2COKA 3IP6A 3C3CA 5IAAA 5ALEA 3HGTA 2HDHA 2ZI9A 3HVHA 3QVKA 3PNBA 4PZZA 4XXHA 4LSZA 1CV2A 1IC6A 2QVGA 3NHUA 4WPGA 1TA9A 3EYAA 3IVGA 4I1RA 1U1IA 1FJHA 4ZV7A 4KCGA 2ZYTX 3L84A 4IKPA 1N5JA 2WFAA 4LHSA 4TV9F 1U2QA 2CXXA 3LT4A 1U1DA 2IYTA 1J7KA 3D5EA 2OZLA 2YN2A 4P08A 5COAA 1XTBA 2HIAA 2JLQA 2RIPA 3FYUA 1JQAA 3HJAA 1BQEA 3GGJA 4LHWA 1DS6A 5TEWA 2NACA 4O02B 3WADA 3E58A 2QE6A 2WK1A 2ZYUX 5HE8A 5ITVA 4BP1A 3IVXA 2NUBA 3BTSA 2PL5A 1RHJA 3DO8A 1TAGA 5JH7A 1E89A 3ZIAD 2P3QA 5J2UA 4FJ0A 5I6DA 3DCIA 1VP3A 3BH0A 4WOPA 1PT5A 4BVHA 2WIFA 2I6UA 2VHCA 4MTCA 1H4QA 4G37A 3IKLA 4CKEB 1GKKA 3EZ9A 2ADOA 3NKFA 4BMCA 5LQDA 1O54A 3Q0EA 1GCGA 1P1KA 2VFAA 5H68A 1E2NA 3B6KA 2X6RA 4ZAWA 1EEXB 1CETA 3VSAA 1Y3HA 4XVCA 1D4FA 5INTA 4PCAA 4P86A 4X7MA 3BQMB 4OSOA 3INNA 1DBSA 2R8OA 4CNQA 3KLNA 4W9NA 9LDTA 2CHGA 2ZJ2A 4HFRA 4UBNA 1JEDA 1WIWA 1GLGA 2QLJA 2F3TA 3N2GA 3NAQA 4PRZA 4JR1A 4B2YA 5FEUA 1KEKA 9GPBA 3S1AB 3CEMA 4RH3A 3ICCA 2YWCA 1QLHA 4FIZA 4KI0A 4XYGA 2CMHA 1HE3A 4DWJA 5GVSA 4L9RA 1UPBA 4BJ5A 1HTWA 3N2KA 1VA4A 1XQYA 3C3KA 4TYWA 1V5GA 2J08A 4RJKA 1FFYA 4HHEA 1MFZA 4B3TB 4XCXA 1CUWA 3M4ZA 3OHPA 4XIGS 1LDEA 3GLFB 5IVKA 2I91A 1K8XB 3RUEA 3ZLBA 4KYTA 4EA7A 2LIPA 5ENZA 2FSIA 3ZYCA 4JP3A 2WTXA 5BSRA 1I7NA 3SF8A 3E7XA 3TNJA 1KVUA 1QHXA 1QMPA 2OV1A 1PJ2A 3QE4A 2RK3A 4J0JA 4NJOA 2XWPA 4NJMB 3REQA 1UQUA 1T2VA 4GRIA 3WL5A 2BFMA 4YTEA 2ZRGA 2VUHB 1N8KA 3ROEA 4F12A 4UM9B 1SKUA 2XNHA 2ZBGA 3H05A 4HUQB 4UCQA 5L9AA 4K1LA 1F8GA 1T8SA 1T3TA 4GYWA 5DX0A 4QZVA 3MFYA 5DNUA 5K0EA 3ET4A 5ESWA 4KBFA 3DQPA 4XWAA 3BGOS 3QE9Y 4NWIA 3EOAI 3DSRA 1L7MA 2A5DA 2XKBA 1FDWA 3WQBA 1O6ZA 3ZHVA 3LO8A 1KNXA 2QYSA 4B46A 4D8YA 2JB9A 1UMCA 3N0RA 1DBIA 3ZY4A 1EI9A 1WPQA 4QGGA 2YCLA 4KQFA 3EGDB 4OXXA 5EMKA 1I80A 2AOTA 3NOOA 1PR4A 3ZWAA 5JCJD 4JI4B 1GILA 2A3RA 3C6BA 2OOKA 3IV6A 5K0GA 4Y1RA 3SZRA 1ESDA 4QJIA 3JQDA 4ZREA 5BWNA 2W9XA 1JR4A 3ELWA 1D1TA 4GZ5A 4J4BA 3LCJA 3QV2A 1VE5A 1EK6A 1P4SA 2ST1A 1ORWA 2C9DA 2Z2IA 4QHSA 5EMHA 1NBME 1SUCA 3BBLA 4MA5A 2CFCA 2JASA 2MHCA 4LJAA 1NUTA 4PR0A 5JS2A 3T5BA 4N54A 2C7RA 4F56A 2X2PA 4YAKA 4KPFC 2QVLA 5A9SA 3CWQA 4HK4A 1FF9A 3BYZA 1MPTA 4KFRA 4EPVA 5AKGA 4I50B 4PIVA 1Z7GA 4HI0E 1WKCA 1DO2A 4YMVA 1QH1A 1GU0A 1N5IA 4FHFA 5GIOE 5A5VA 2FHPA 2RHRA 4IXTA 2P68A 1N9ZA 2CNLA 2O1SA 4IQ4A 4CU5A 5L6LB 3JWPA 1K8YB 4ZP1A 2OHJA 3S81A 1ZH0A 4B71A 2IF2A 3VH2A 1QAMA 1E4OA 2PSSA 4AP5A 4DMUB 1IBLB 2P2SA 1FNNA 4PYLA 3SYRA 3LBNA 4MRMA 3G2KA 4G89A 5D5QA 2G6TA 4F21A 2J4FA 2FE1A 3Q8LA 1W9HA 3O2NA 4CMJA 2R6HA 2GNAA 3A0UA 2K87A 4RELA 4IWYA 1NXOA 2Y8EA 3QU4A 3HI4A 4QYXA 3GJRA 5E1OA 1YZVA 3PLNA 1UP6A 3RTBA 2VCHA 3D0RA 1GA4A 3OKCA 2ZJ7A 3ND9A 4PTZA 3V42A 2ZUDA 1BVRA 2TECE 1PTJA 3AKCA 3JAKA 3KX2A 3NBQA 4G1EB 1KI6A 2AXNA 3KVOA 3PHBE 1L4GA 3TIFA 2W6QA 1VIMA 3G89A 2WWYA 1F2TA 5GWXA 5JJCA 1ZUWA 4YMTA 4RBNA 3VAYA 3ZQ4A 2G09A 3PHIA 3M3PA 2HF2A 3V8QA 2HDWA 4QXPA 2OG1A 2WIDA 3CG0A 1TCVA 4IYRA 1CY6A 2QT9A 2WA2A 1F14A 3NC1C 3U9SA 4MP8A 5J4YA 1QDLB 3IELA 1MVLA 5JPIA 5CITA 3JX9A 3OAAA 1LBQA 2EG9A 2AC2A 2P8SA 3ICEA 3EEOA 1MB9A 3PNYA 4XJSA 1T4DA 3OA0A 1UBCA 2OILA 4MYTA 5JEDA 4W8GA 2RHDA 1HPLA 1H5NA 1SBCA 4WXMA 4ZHQB 4PRYA 3WO0A 1NNSA 2DCMA 5HZMA 1FFWA 5I7WA 4JP5A 1XVLA 4L3OA 1Y7PA 3TE6A 4C3OB 4LCBA 4GI7A 2ENWA 4DTIA 5C4MA 2Y66A 2JFPA 2QD3A 2V4MA 2E48A 4DBVO 5D84A 5IWCA 5KTTA 2PRSA 1T10A 3E4DA 2XCRB 2N47A 2Y1XA 5IASA 4HPJB 5G02A 2IEAA 2P78A 3I5UA 4RACA 3VDQA 1BXZA 1ZOLA 2RHGB 1TAHA 4KMMA 2FETA 4CG3A 3DNMA 3OC6A 2CHEA 2CLKB 2VH5R 4PYJA 1AKMA 2C95A 2GCEA 3TQHA 3F3MA 4LTMA 1VKOA 3BIWA 3VU8A 1Y4ZA 2MYPA 4ZOCA 3ROTA 5CA1F 2WF5A 2FR8C 3I4CA 1F2UA 3TLYA 1L8AA 3D64A 2XMPA 4KL8S 1O77A 2FPPA 3AFNA 4PONA 2FSHA 2F43B 5CIQA 3W1VA 4L5CA 3ML1A 2XCSB 5BSKA 2QSYA 5CH5A 4RM3A 1AGRA 4RQTA 5HKOA 4BV3A 4EY5A 4A8HA 4ER0A 1NNI1 4DCCA 1T9DA 3ABZA 3HWX1 2A1IA 1RJ9B 3SHOA 1G3RA 5KREA 4OKSA 5C8DA 1ZMBA 1NMQA 2BDTA 2ERYA 3QIVA 5J59A 4IUBS 4YUZA 1NFFA 1P3DA 2FMIA 4H2DA 1I94B 2AF3C 5C5CA 4PGHA 4V0OA 4QOIA 4QU0A 2AWOA 4MS4B 3Q3VA 1OUMA 3GNTA 4WWHA 3I6MA 3CLSC 1OCEA 4M0DA 2JA2A 1YS7A 1J00A 1Z7YA 2YZGA 4MWCA 4QDOA 1RWVA 3TBKA 3OMXA 1ZJWA 3V2UA 1F6BA 4OMCA 3WP1B 1BXGA 2JFHA 4LTDA 3HVIA 3RSQA 2SHKA 2G7MC 1USUA 1XYYA 3ENWA 2GD2A 2V5UA 1N2GA 2FQ1A 2IEDA 1BDMA 5EUMA 1TVCA 5TF4A 3WHLA 4EECA 1NVVQ 1HMYA 3NUGA 1EUCB 4BO5A 2PY6A 5CLHA 3GRRA 1R88A 1XO1A 2FXIA 5D6NA 4QQNA 3L9XA 1L5RA 3MWEB 4CKBA 2JFNA 2KJQA 1U02A 2Y1DA 4E11A 1J7JA 2ZWMA 1NW6A 3SD7A 2E4ZA 1G7CA 2JAWA 2VWQA 3L06A 3OAAD 5BUSA 2ZBRA 3Q72A 1J2UA 2XXAA 2F9MA 3RAJA 1NJGA 2JEOA 2BMWA 1EM6A 2QGNA 3EVGA 3P8ZA 5JWOA 1IL0A 2NO1A 1H1LA 5IYZB 4BAUA 2JNWA 3N5KA 4L72A 2EAUA 4ENTA 4Z1MA 4F8JA 5AW8A 3MHTA 3T3OA 1C4XA 5JATA 1E18A 4HAIA 2XEXA 2ZWPA 3RTDA 5LZ9A 3KKZA 3CVVA 1S7CA 3JZFA 3M5DA 3IUMA 2QN2A 3QA9A 1YJBA 3GFQA 3NQ41 4HB4A 5C5IA 4UBIA 2AG0A 1KZ6A 1ML3A 3PXEA 1MNAA 3MJTA 2DUWA 2OECA 1YZKA 2ZB3A 2J6IA 1Z6YA 4M37A 1I6LA 4ZALA 1NXTA 4D3SA 3CNBA 2H2DA 4A91A 4YO7A 1G9TA 5AVVA 2FYTA 1O6CA 1WB6A 1XF1A 4HDSA 4LY9A 3VSCA 3W1WA 2DEUA 2OP1A 3X1XA 2W6ZA 2GNPA 3IVRA 3JQ7B 3WIBA 3NJ4A 1ULUA 1ZHFA 2E5WA 2CMFA 2A67A 3HDQA 4JL6A 1P8JA 1Q1BA 2EHJA 1C9EA 5IC5A 4W99A 3PDIB 2ESRA 3PTLA 4HWKA 4J0IA 5FUQA 5EC8A 1TM3E 4I81A 3HCPA 3CZQA 3NDJA 3THYA 5TR9A 3ZGOA 2I2WA 2REQB 1E7MA 3KO8A 5KMGB 3OU6A 4K05A 1R6AA 4A23A 1RC0A 1HTBA 1KPIA 1YOVB 2CMDA 1X1DA 1H1TA 3AR5A 1M5RA 1XAHA 1KDYA 1NAIA 1U7ZA 2C7PA 5AVTA 2B1GA 2R87A 3PXCX 3OU7A 4G97A 3FVTA 1N2ZA 3L01A 5ILQA 2P0YA 2ZYDA 3C1UA 1G17A 3DOIA 5HFAA 4DV3B 3WJ2A 2QG9A 2Q2VA 3OQBA 4ILEA 3ZJ5A 2P9JA 2PZAA 4B7UA 2CFSA 4NU6A 3D5QA 2O06A 5BYJA 1CRZA 4FEAA 4XGIA 3ZKWB 1GIAA 4PYMA 2QNBA 3SP1A 5IJ0B 2H08A 4UXJA 1GL6A 1XZNA 3H1BA 2VK1A 4XYMA 3K6JA 3HTXA 4M8KA 3BILA 3CUKA 2J5KA 3GGSA 4PQYA 3SYLA 3SEZA 3U44A 3DEHA 3ZDAA 3PVSA 4LKOA 4WECA 2HT6A 1RDFA 4XVHA 1XMQB 1K0UA 2J3LA 3WGJA 1VMIA 2VWGA 2GZRA 2IHTA 3MMNA 4LBYA 4XM1A 4PSKA 5T4EA 2YRXA 4RHEA 3R7LA 3TNYA 4A2CA 4D3XA 4MH0R 2HMAA 2ZUFA 1O96A 1ODJA 1G5RA 4KKXB 2P4HX 1RM3A 2NP6A 3A1SA 4DT1A 1EPUA 2O3JA 5SICE 1YVDA 3ITNA 2DSTA 5DCWA 1H4VB 2VF7A 1K7CA 4TTVA 4BMNA 10MHA 1AUQA 2W4QA 3EXG2 1YQEA 3JALA 4OG2A 4EM6A 3FGOA 4QJ4A 5ARDA 3BXHA 4YCLA 2OTCA 2RJNA 3CRQA 1OA0A 1VM6A 4KSYA 3ZTTA 3ZDQA 4Z1MD 4GMFA 4OQFA 3UH0A 3KQKA 2CUTA 4IFEA 4L51A 1N6KA 2AC4A 1WTCA 3NM4A 1T9GR 1C14A 3GLUA 1G4HA 4BWFB 1T9HA 1Y7HA 4JUFA 1J9ZA 4MB6A 3ZLUA 2QL5A 3CWCA 3FN4A 1EGQA 5LC1A 3Q7IA 1HT0A 7MDHA 3JD0A 4XJTA 3BZWA 1I14A 2YHUA 4P54A 3ZEIA 3RARA 2YS6A 2I29A 1BWPA 2B0JA 3W2HA 4XPIA 2GEBA 1M0SA 5F5NA 1DC6A 2IYUA 1AZSC 3VJKA 1UOPA 1JQDA 2Z57A 4R7GA 3G5AA 1YBMA 2FEAA 3W4JA 3NBUA 1GN8A 2Z3VA 5IH3A 3VZDA 4ARSA 3ZHSA 3I01M 3WHIA 1XZQA 3FF1A 1G41A 4HMOA 2D2XA 4MJXA 1PZFA 3I6QA 2YICA 3TRJA 1B0ZA 1J23A 3H4MA 3OBIA 4WJLA 3FF4A 1SIWA 3NOQA 3T0GA 4ADSG 4Z2YA 1O87A 4I4TF 1US8B 4UHCA 2I4OA 1F0PA 3EHEA 1NI5A 2WD9A 4N7MA 2G83A 4R7ZA 4WE3A 1TGVA 1ZGAA 1A7KA 2EWMA 2X1LA 3IHKA 3MB8A 1SBNE 4TSRA 4X6LA 1FFXB 4OLFA 5ALXA 1FU7A 2BI4A 4FGUA 5FBRB 2BFDB 1EXMA 3EVDA 1UFKA 4DILA 4EYGA 4HZUB 1KEEB 1LF0A 1L0BA 4IWNA 5GONF 2RCYA 5FUWA 3TLXA 5H3CA 4J7AA 3TR0A 2CLEB 5IULC 4P7BA 1OHHA 4ND7A 2PX2A 2BM0A 5ALOA 3K9NA 3GLGB 1WLYA 3V1TC 1V2HE 1BXRA 1CDEA 1W36B 4BVKA 1FLVA 3G23A 1CBUA 3M5PA 2FR0A 1OLSA 3DL0A 3LIPA 3A31A 1UT6A 2OCPA 1LW7A 4W1SA 3SC6A 3I2HA 1G6OA 1PJBA 5ELMA 2IEGA 3HU3A 3TW0A 2OCIA 3ESDA 3FDZB 1TVMA 3QKSB 4E5KA 2JGAA 1XL1A 2NUPB 1BSVA 3L6EA 3GV0A 4HDOB 2HOQA 1KY5A 1V9CA 5IX8A 1JLRA 1DJLA 1K8QA 3I8XA 4F97A 3DL4A 1RKQA 2IZ5A 3G8DA 3OESA 1CFJA 3E7WA 5ED0A 1MC8A 2P27A 3MUOA 4J3NA 3PZBA 3N9IA 1KZYC 1RABA 3OT1B 1TQ4A 4IRUB 3KOZA 3W79A 4BY9E 3PYXA 4AZ0B 4BFTA 2O7SA 2JAHA 1RXCA 2XMGA 2ODAA 1QTQA 1BIFA 3AX6A 3FZQA 3OD5A 4FCCA 4P6VF 3QELA 1NBAA 5AVKA 3RPEA 2V7TA 5IDXA 3CFYA 2A58A 1QS0B 2WNHA 3GZNB 4HMQA 4AWAA 2QQEA 3B70A 3UOGA 2HIMA 3WNCA 4BVJA 4TXHA 5JPDA 3K1ZA 3NJ8A 3U17A 4AMBA 1BZYA 3C8DA 3MA0A 4BMZA 1XTTA 4YB8A 4O4LB 4UD6A 3EFHA 4LJRA 4TMYA 3RDPA 5BN5A 4Y6QA 4TTJA 3AF2A 1CF4A 2UU9B 2VJMB 1NONA 2EX0A 3CYFA 3OE4A 4N5HX 1ZGZA 1UQTA 2FKAA 2ID9A 5K3SA 2QIPA 1QG0A 3IILA 2QA5A 1C8LA 4M0FA 4Q1CA 4RTMA 1P7CA 2NTJA 2UUOA 1BVUA 4D4KA 1NQAO 2A1UA 1HOTA 1PP4A 1RTKA 4KAJA 3AJRA 2XD4A 4FS3A 3R7DA 4CMBA 1JKJB 1UEJA 1TCAA 5AVXA 3DCNA 5DLPA 4RH0A 3DYBA 2QVBA 2QRVB 5FA5A 1SCKA 4ALKA 3CN9A 4O0LA 5LA6F 1LTHR 3I05A 4PN7A 2VRCA 3DOCA 3B2QA 4UCWA 5KI6A 4DPLA 4LOLA 3KPWA 1OH7A 1IULA 1B6RA 3NZEA 3LVBA 3ZWMA 3RS5A 4CMGA 2ZE8A 1X1BA 1T5LA 5DGIA 4K9DA 1ISHA 4HX9A 4J2HA 1AN9A 4NE2A 4ZQGA 1JFSA 3R44A 1YR9A 5JXWA 4DQVA 3I30X 3L0ZA 3L7BA 1R9GA 2WNIA 3R6TA 3FR7A 4BFZA 2IP2A 4U6QA 4UUBA 4F2DA 4WCDA 1RAIA 2XXJA 1SVSA 3C70A 1XMVA 2A5FA 2C84A 1IEVA 2EYUA 2R25B 3DF7A 3A1FA 3GRKA 3UHPA 2F2TA 3I0MA 4JI6B 4Q9NA 1J90A 1FTNA 4CMHA 1OHHD 1QGYA 3WLJA 1IRXA 3Q8WA 2ZUEA 1QM5A 2DPGA 4TKVB 3ESCA 1DIBA 5HQ3A 1ZJ6A 3DTNA 3NETA 2O2CA 4G5SA 1NJSA 5TQ2A 1NJ2A 5TF0A 5JNLA 4HPXB 3ZD6A 2C2YA 4EY3A 1VLLA 3H5NA 4EHNA 3JR3A 1X2BA 3UMFA 4XRGA 4UM9D 3UPTA 2ZBDA 4MRRA 1RYEA 1UKBA 4H9GA 3T99A 3MFQA 4P92A 3OSZA 2GPWA 4BFVA 1KS2A 4EYEA 4KSBA 4FZRA 1VA5A 2ZIXB 2CV2A 2ZOSA 3F6RA 3HB7A 3L92A 5K99A 3NYWA 3AY3A 2HMUA 1X3SA 2A6PA 3Q3HA 3BJRA 4HNAB 4BTEA 1XMPA 1KRHA 3JSAA 2GS9A 4QTTB 5JZBA 1MJGM 2VR1A 1PJCA 1T2NA 2JZCA 5ICMA 2LDXA 4TMTA 1T4GA 1YA6A 4FM9A 5CBKA 1P5HA 2JGDA 4TSFA 4DCPA 2JH3A 4MAAA 4TQGA 4L9WA 5HGJA 1B3RA 1GVNB 1OJLA 2ZTLA 3ISJA 1HY3A 4M9SA 1YE3A 2E18A 3NATA 1FFBA 3BTVA 4B3XA 1JIXA 3WBKA 2WINI 2XF8A 2XD9A 2YJGA 4Y30A 4YXFA 4JWTA 4RM2A 5CT8A 4Q1BA 3S70A 1D1PA 3AONB 3PYMA 4TWAA 5FI0B 5E8JA 3OPYI 2PGXA 1KA9H 3G9ZA 3HYNA 3MMSA 4FLMA 4KQXA 4NV0A 5EEGA 1L4FA 1ZC3A 4QUGA 5E2IA 1ZGHA 1PV2A 3NMUF 2OBYA 4GR4A 4FEGA 3GGCA 4OHFA 1H2AS 3KELA 3ZTWA 3IIJA 4IS2A 1O0BA 3N07A 1PTKA 1C0LA 5K3EA 2H65A 1HC7A 2FF7A 5AUQA 2NV6A 1NUHA 3DBLA 5EHIA 3ZD9A 1ZNXA 3HYLA 2QR3A 1AQLA 5EZ5A 1CJSA 1J8DA 5HRUA 3W9SA 3VKHA 1WB5A 1QPBA 1Z5VA 2L19A 3B9PA 1V7QA 4K6MA 3SS8A 3GW8A 3RK1A 5HKBA 5LN1A 3TG8A 1DNPA 5KTOA 2CCGA 3ZK9A 1RCTE 1IAVA 1V7PC 1XCGB 1J33A 2VRCD 3U0VA 3BMOA 2BFEB 3HVRA 3R5SA 1LK0A 5LQCA 2HWWA 4DEVA 1C1DB 5EJMA 3EUFA 3SLKA 4JLSA 1GKIA 3RUIA 4I9GA 4BRZA 2J6BA 4OM7A 4O4IF 3GDHA 2VBFA 4MR8B 5JUWA 1KYQA 1QH9A 4I6GA 1PJRA 2Y0CA 1N78A 4GWGA 4E5VA 3ANSA 5JZSA 5CVJA 1J4AA 3CF4A 3E5HA 4GI3A 3N7UA 2O8FB 3QITA 3E22B 1U6JA 4QOSA 4TTPA 4FFLA 1MQ9A 1RIIA 3TL6A 2QI9F 4IAOA 4R8SA 3V34A 2ODWA 4NVRA 2WLTA 421PA 3GT3A 4LJ9A 4N9WA 1BGVA 3QOYA 5LQNA 1XDSA 4W82A 3JARB 3MTJA 3DOFA 4NNPA 1BX3A 4URZR 2Y76A 2A9JA 3EIQA 2QLBA 4AYTA 5DX1A 1Z0FA 3COPA 4PRLA 3NUQA 3SVZA 2GAFA 4F4HA 3QPUA 2OGSA 4JY7A 5GP1A 2X0RA 2IITA 4F3KA 4G1UC 1M34A 1Z07A 5H3HA 2J09A 1DXQA 3HJNA 1ORRA 5EKDA 5A03A 4OUDA 1SM4A 1Z08A 4EA8A 5AW5A 3GEMA 2VBIA 2CJXA 1L5LA 5AIBA 2HU7A 4E4YA 2ZRCA 2GDJA 5B4UA 1XMXA 4L2IB 3T1TA 3D3KA 4FSHA 1YF3A 1VZ2A 5EZYA 4X8MA 1DKOA 4MV0A 2NZWA 4M0CA 2PUGA 3JQFA 3CE6A 3R3HA 3EXEB 2GVZC 2YFKA 5IM5A 2ZP1A 4KI7A 3RODA 4ARBA 4EHFA 5BV0A 5DE3A 2O57A 4KPGA 4HD8A 5FBHA 4GL2A 4IIGA 1Z2NX 4KKVA 1JRLA 2J4DA 3A05A 3QMPA 3O8OB 1MC5A 1NJ5A 3C14C 1ZONA 1UT8A 3IMEA 1DAHA 1DMRA 2VTEA 5GMOA 5JXJA 2R1VA 3NHYA 5BYKA 1A4XA 4L27A 1CQXA 3I6IA 4EPYA 3GA7A 1JTEA 2B7CA 2ES4A 5GM1A 3WDKA 3CG4A 1TO2E 4U7WA 2HA4A 4RY2A 4NI5A 2ZJAA 4ONEA 5DI3B 3QW2A 2H07A 1ZI8A 2DFVA 3HLYA 3B9QA 1G55A 3GLVA 1W85A 2G1UA 5EUCA 2B4QA 1MA0A 3DUFB 2BTQB 4L5AA 5JS8A 5JO0A 2FEPA 3KFVA 4NY1A 2NZXA 5C18A 5JADA 3EB9A 3LA6A 2ISSD 1NQUA 2Z2KA 3Q7EA 5F2NA 1UC9A 2OESA 2WW8A 1Q17A 3U3DA 1M7GA 4G8JA 4FFDA 3LE8A 3HNPA 3IPAA 3K8OE 3LWNA 1DV2A 2FXVA 2BFWA 2HIHA 2QNRA 3DYIA 3DZIA 3I23A 3EVZA 3QH4A 4NRDA 4WX2B 4ZGGA 1QIHA 1JSXA 3KL2A 3G49A 5LP6C 3A9CA 4YMHA 4H4EA 3B1FA 1ULHA 4BNLA 2ZM6B 1AKQA 2AMVA 3IEIA 3Q9LA 2XZDA 5DMHA 3OWHA 3DMYA 5FLYA 2B1RA 1GEGA 3H0CA 3FHTA 3AUXA 3HA3A 4RZHA 5IPFA 5A0FA 1S4QA 1C80A 3ETDA 4OFBA 4JJ4A 4RMHA 4DLZA 4I3FA 4PM4A 1YKSA 1ZUNA 4UEJA 1M2FA 3G0DA 3P5BA 1L5NA 1E3WA 1ZD1A 2WM8A 1JR3A 1C9DB 1XKQA 4PXSA 2HDOA 4YBRA 2F9FA 2R00C 2IPLA 2YQ4A 3UB2A 3DDCA 2B4KA 4UNIA 2AFHE 3M6IA 4IWXA 2O1XA 4JK3A 1TW2A 3ZE0B 4ENWA 3KHSA 3U5TA 1AJEA 4PZLA 2AYYA 2DP4E 2RKOA 3QEMB 4IUDS 4UATA 3ASVA 3BRWA 1BCRA 4BWVA 5B6JA 2R8RA 4GZ3A 1Z45A 4NBSA 1BHJA 1MLDA 4W5QA 1HDCA 4FS8A 3B1WA 2LDBA 1CULC 3F98A 3ENKA 3TD9A 5BV2P 4EFLA 3JTMA 3CTPA 1ZRMA 2GN8A 1Z2EA 2ZYHA 3IBTA 5ALNA 2ZROA 4OGKA 2PZJA 4R2KA 3L7JA 4WKNA 5FNVA 1BWRA 5LQKA 3O4VA 3NC4A 3JYOA 4IJ5A 1KFCB 4B6GA 1PW7A 3N8KA 2FLKA 4LAFA 4OXKA 1E4YA 1AVTA 4O4HB 4D9FA 4XOIA 1C1XA 4AJ9A 4HDKA 2V7EA 4GP6A 3O95A 1DBRA 4UAUA 5C7YA 3AERA 2ZJ0A 2NUTB 1A9XB 1XHEA 4JNCA 3RYHA 5K9ZA 4QNNA 1OBFO 1TC2A 2O5EA 4V0RA 2EJUA 3H1FA 4G86A 3CN7A 1JJFA 4LXYA 1N3IA 2J8ZA 2X7HA 1ID1A 4HRVA 2E6KA 2F1IA 2V6IA 4F38A 3HVUA 4Q0MA 5K6RA 1E5QA 2JIRA 4F6RA 3EXHB 1CEYA 1T3GA 1W8DA 3GO4A 4DNFA 4BRWA 4JKYA 3CUTA 5BR4A 1SBIA 1AQNA 1G5QA 4C2TA 2BGRA 3L02A 4MGYR 4PNZA 3IQZA 2O4UX 1X38A 4Z4HA 9MHTA 3KYIB 3M7IA 1YC5A 3SSOA 3A37A 1NURA 2OXCA 1LPOA 2YFYA 2R1UA 3ST7A 4XM2A 4KPYA 1XZGA 5F3WB 3FB1A 2FZ4A 3UGKA 1CVLA 1VXRA 4H6PA 4URYR 2YZMA 4KXFB 2QJWA 1AKYA 3P4UA 2OXFA 1KBOA 2OV6A 2JFFA 1LDNA 1ZICA 4L4XA 4GLLA 4HBGA 1UK9A 3IMGA 1NJ6A 4PLVA 3ZDBA 1QF7A 3Q10A 1V1MA 4D44A 5A1JA 4P35A 3PJRA 1XN4A 3F6CA 5AXAA 5MF6A 1EZZA 3ZVMA 2Y1OA 3PCRB 3FWYA 5CNMA 4KLNA 3TL2A 5C34B 3LRPA 3V46A 1QAQA 3ZW8A 1GPBA 3WWEA 2FPLA 3QX9A 1EVEA 2C42A 2KPOA 4EUNA 5LMUB 1KYZA 4YAJA 3LCRA 3PUIA 1CZHA 1P29A 1I2CA 2V1XA 2PBZA 2PSJA 4XRRA 3RC3A 2CFIA 5J4HA 1GJRA 1JHMA 1KIAA 2QTNA 3E3NA 3HKCA 4J1TC 4QO7A 5FT9A 2WJAA 3VFDA 2CV1A 3F7TA 2E55A 4LBVA 3ELDA 1G8PA 1HDXA 1O58A 2VEOA 4KXVA 1JR3D 3HG7A 1YMUA 1Y80A 1RADA 4QOEA 2CLOB 2AJ8A 3F74A 3GFGA 1KMCA 1VLZA 5A5EA 1ENPA 2X9VA 4G0QA 1B8VA 2QN3A 3HDHA 4BGEA 4BFUA 5CTJA 4XASA 1R37A 4O59O 1NJ1A 1G5HA 3BRWD 3AJAA 4MQMA 2GBLA 5TDHA 3PSAA 5F77A 1M10A 1UBGA 2A1TR 4IIYA 4S0XA 4U39A 3P2JA 2RHLA 4BO0A 4LN1A 2QTGA 4BCBA 1SO8A 3MGBA 1W4CA 4ZZIA 1CNFA 3HP4A 2DT8A 1DC7A 3OLVA 1SK9A 2HLHA 5JJKA 2FFJA 2C4NA 5JQGB 4Y0VA 1USWA 2OORC 4FKMA 4ZTUB 1VPLA 2JIMA 1R0SA 2IYEA 2UZ0A 1RAGA 1MMFB 1TQ8A 3E7DA 3OHSX 4I6EA 3PRHA 4AY3A 2IP1A 1JJAA 2Z6VA 5IEBA 1ESNA 2FSPA 1EHCA 2VHUA 3WLEA 3OFVA 4GQIA 4OMFG 2DBQA 2FMUA 4LSMA 1JZSA 1J8FA 1E4EA 1QKJA 2WD7A 1KJWA 3H9GA 4MIKA 1N57A 3BFJA 1TM2A 1EFRA 5M7EA 4YFVA 1N5RA 3WRVA 1ST2A 5CFPA 1ZOPA 4NDZA 5MHTA 2AG1A 3NTQA 3KJXA 2Q5FA 3JVIA 4BYGA 1AG9A 4TLAA 1OFVA 4KR2A 1C7IA 2J7KA 2R6ZA 4JLNA 1TC1A 1Q0LA 2YVLA 2V97A 3AY6A 1QWSA 3V80A 4F9TA 4HYTA 1Y8RA 2C77A 3MUEA 1UJ4A 4IDBA 4I1VA 3WK9A 2QD2A 4YRJA 3CBQA 3NM6B 3GT7A 4QRDA 3KAJA 2HCRA 4TXLA 4X6UA 4WKGA 3N05A 2GTHA 2Q2WA 3FVWA 3NDRA 5BRNA 1E6UA 4BX8A 3SMVA 5AI9A 1XIVA 3DBRB 3NHPA 2HHAA 3AF1A 2RJOA 1IOVA 1T0BA 1YB5A 1ACMA 1YD7A 2G0NA 3QMMA 4KH1A 3WG9A 1E3EA 5EYPB 2V74B 1JHYA 4O0MA 3OO1A 4C29A 3O2QB 2HZ7A 2X86A 3BHJA 1ONSA 1QX4A 2AK3A 3ZI7A 4BECA 3ROXA 4H7KA 1ZQ9A 2EX1A 2NVUA 3CKLA 1P3Y1 1ZUD1 1RLTA 1PX2A 4OI2A 2VRWA 2HCJB 1UPTA 1ECBA 1VKHA 1XFDA 3X1DA 3ZGZA 2JFBA 4IRXA 3D0QA 2PE5A 1Y8ZA 2O8BA 4D6YA 4LF9B 5C0OE 2HEGA 5DTEA 2YVUA 1EG2A 1E3DA 5DGHA 2R85A 4FXPA 6AT1A 1E2GA 5EWLB 4YLEA 1RJEA 3LQKA 1M6VB 5FLXA 5ALYA 1Z8DA 3UHJA 1A4IA 3PI7A 2X0FA 4BE4A 1RI4A 4KE8A 1RYHA 3O0DA 3VMFA 4AMVA 4UD2A 5EE0A 5JASA 1PIWA 2OXEA 1MV5A 4GKKB 3LX4A 1TF7A 1YC2A 1P5FA 1C9JA 1U11A 2I6TA 5EXSA 5B1IA 4IOLA 4D8TA 4NXMB 3SKVA 1Q74A 2PYIA 3BRSA 3L49A 4PO1A 5FADA 2R9VA 1RYDA 3BHMA 1L1EA 5CHEA 5CCBA 5F5XA 3M6MD 5AW4A 1OH6A 1B1AA 1S01A 3P2MA 4HQFA 4E2YA 3AF4A 3BORA 3EFOA 3K72B 3MWLA 5C2JB 3W2FA 1RP7A 1WXWA 5CB0A 2ONKA 4F2WA 3WJ1A 3MOSA 2Q0XA 2UYCA 1KJ8A 1VCOA 2PX3A 3EMDA 1K8ZB 3A1WA 5ALHA 2ZQZA 2R84A 1U3UA 2RGXA 2HNKA 3CRVA 4DMGA 2SKDA 2QSZA 4AY6A 4A8JB 4OVKA 1J8QA 2R60A 1VFNA 1WCV1 3I4FA 5BT8A 1EFRD 2QSUA 3B6JA 2FOXA 2PQ0A 3MT8A 3U3OA 3DT8A 2OM2A 2FN8A 2VS1A 3IVAA 2AEJA 3PUXA 5DN9A 3QVGA 1G60A 1VOTA 5IF3A 4DA0A 2CDNA 4WLNA 1QG4A 3W05A 1QGDA 5KTYA 5DOVA 2O8DA 2Z4SA 5KBYA 3DM9B 4MKXA 1DCKA 3KS9A 4LCEA 1KDTA 4MA0A 4Q1VA 4IMRA 4UTXA 3T54A 1ZIOA 5LIRA 1N2CE 5H83A 4K87A 2P2YA 2NM0A 1D4AA 1U3CA 1V5EA 2OVFA 4N03A 2JGRA 2ODNA 5F4ZA 4YV0A 2GTIA 5EJ7A 1KWKA 2GYVA 3THOA 3IO3A 4WZBE 2BH9A 1KZ4A 2O7VA 4LX8A 2VHEA 4I3HA 2JAUA 2X8JA 5ALVA 2ZWAA 1U8TA 2G70A 1WCIA 3EGOA 4I5FA 4QIHA 5AKXA 3BOSA 3CRNA 4YCCA 3LQ1A 4QUEA 1KAQA 4M8IA 4D26A 1RXYA 5KHOC 3TUJC 4TT3D 4EO4A 5JE8A 2D0IA 3I2IA 1IN1A 3QFRA 3IEMA 1LPPA 1II8A 3WFIA 3DHVA 3D6TB 2D62A 4OFZA 1P4HA 3C3MA 4Q9DA 4X6XA 4DBLE 3ZCRA 2N1BA 5JHGB 3RAPR 1QTNA 1U9ZA 2VT6A 2VTBB 4OIFA 1R4MA 3HWSA 3O7WA 2W2KB 5ITZA 2R8PA 2FN4A 3HN2A 3NYIA 5E6SB 4TRRA 4X7RA 4MVCA 2W2VA 2JCVA 1MOPA 1RWXA 4WASA 3EVFA 3U39A 4BZQA 1QSGA 1JAXA 4PYNA 4L08A 4XUEA 3E9RA 4QASA 5E7IA 1GCOA 2GSDA 2ECOA 1ZJYA 2JD2A 5J43A 1PG5A 4HNGA 4L5JA 2GFQA 3A9WA 5ALZA 1M74A 1LFDB 1PN3A 3L0PA 5K0FA 1G59A 4F7DA 3TRIA 3TQQA 1UXOA 1OXVA 3DGEC 1Y48E 4RFLA 5I9BA 3B3JA 5K8CA 1GGMA 4HQNA 4TZ6A 3HL0A 4EEZA 3OUTA 4F84A 2XVZA 2PRYA 2IH2A 5JYCA 3BWDD 4NCAA 1OX4B 2F64A 3TGWA 1EHYA 2WYIA 5EJ9A 3E84A 4HS9A 4QTZA 4QM7A 4B45A 4Z51A 1TJNA 4GPAA 1GZ3A 4CG0A 2IELA 4JYPA 5E1BA 3RNOA 3GLSA 1CKEA 1UIRA 2Q6TA 3D6VA 1RAFA 4LNUB 1BDJA 3CPJB 2X7JA 1Z2OX 2EXXA 4J1TA 1DP4A 2YN0A 3C5CA 2TS1A 4FSDA 3UK1A 1WKBA 2FU5C 4NYMQ 3BMNA 2RONA 1Y98A 3VXKA 2V45A 1EFUA 3KTAA 2VZ8A 3PJDA 5L53A 3KYBA 1ODKA 4XGQA 3N1UA 2EP7A 2G36A 1KJQA 4RHXA 3HO8A 3U3JA 2C82A 1NYTA 3CINA 3DLPX 4ENRA 4U7DA 1R8YA 3H9UA 1V3UA 1NNLA 3N0XA 4Q3AA 2ZT5A 2PXXA 1F8FA 4KTVE 2EDAA 1HYQA 2X0EA 5LXTB 3PC3A 4H27A 3VSBA 1IU9A 3NT5A 4PCLA 2PG3A 5CTAA 4GU5A 4YHBA 1R27A 1V3QE 3KR1A 1UK7A 4PAQA 5EWJB 3RQIA 4EL0A 1NWHA 1YJ8A 3NCHA 1RE1A 2LWIA 5KIAA 4LISA 3M89A 3DE1X 5C8YB 1G8HA 2GEVA 2I66A 2RGNC 4KXXA 4U9IS 1UXHA 4D80A 3HDGA 1G4UR 3AQIA 1JJIA 3ZPXA 2OXTA 4CMEA 2MSDB 2O5VA 2V7PA 2NNLD 3R7AA 3V8MA 2OO5A 5I9SA 3MCZA 3QVXA 3AESB 3BXZA 1E9EA 4TLMB 3CR8A 3FYDA 3MJSA 2BONA 5DTRA 3UMVA 4BEVA 2Q4DA 4L4RA 3X1MA 3EPLA 1K1EA 1UM8A 1V3TA 1WG8A 2H17A 2IE0A 2R2GA 2W2TA 2W8ZA 3KVVA 1KY3A 3I6YA 1UBRS 4LC0A 3HCNA 4LOHA 5KC9A 2YIJA 1UZLA 3COZA 4NFYA 1PR2A 2RAUA 3HUEA 4UUNA 4D56A 4AKHA 3AM3A 4M22A 2HQBA 3E61A 3GPIA 4CHTA 2ORIA 4B43A 5AW7A 3KYDB 3WXMA 1SUEA 3MTQA 4ZTBA 3V00A 1HUQA 1RKXA 1ZN9A 3G8YA 1ZSYA 2BFFB 3AEQB 4MKHA 2PFGA 2PNJA 2A8YA 4KQ6A 3EWAA 3CNLA 2DH6A 3AL0C 4F06A 3TJMA 2BHSA 4E51A 4PSUA 4TS3A 2PGNA 4KHZA 1XKLA 4EH1A 2C88A 2A84A 1R6UA 1JG4A 1Q1NA 3NTUA 4TTTS 1P7WA 5TY0A 4F5WA 1GADO 4MR7B 5EIEA 1BH6A 3IEXA 5L7TA 5GV8A 1VLVA 1DXOA 1U8CB 4R0VA 2R62A 4Q7LA 4I55F 3KQHA 2JIPA 5ALJA 3HA7A 3HMKA 1OZHA 1PLLA 4G8BA 4UFNA 4AG3A 2C8JA 1DU4A 1X7ZA 2G72A 3D8NA 4IH1A 3CVJA 3R7NA 4MJ7A 3UNXA 3JWJA 4J76A 5CA0B 4OV6B 3K7EA 1LDGA 4MYDA 4LIPD 4MGEA 2WJJA 1F17A 3D5TA 2GPTA 3CF0A 5JS7A 5KYWB 1I10A 3LQRA 1F51E 3HRHA 5IAOA 3CONA 4ILKA 4MAMA 3RVRA 4Q9LA 4RD3A 4US0R 4KE6A 1D09A 3GRPA 1PS0A 3UQZA 4PN3A 1HNNA 3A7DA 3JQQA 5B7PA 4NDAA 2FSVC 2DLCX 1IHYA 2QUIA 2V3CC 1FPMA 4KUEA 4XUCA 5LYJB 1M6EX 1E5LA 1NVTA 4MCJA 3X44A 4DCMA 4GL4A 1FUKA 4IBOA 1IYZA 3IUBA 1SXPA 1CUZA 5HK9A 3GVCA 5JAOA 2QBYA 3B6ZA 4OQQA 4QUHA 5K8LA 1GFIA 2OBNA 3H1GA 3AFOA 4OP2A 5A3VA 5SYMA 3RIHA 1ZZEA 3O0TA 1RP1A 4D79A 4FP9A 3MPOA 5IUKC 1WUIS 2VPZA 3DMPA 3DZBA 2A9KA 4DMFA 1U7XA 2BGLA 2GETA 1CDZA 3QKRA 1M6WA 3WGMA 2YW2A 4Z2AA 4HWPA 4EJSA 3MELA 5KJEA 1TCBA 3CR7A 2XGOA 1D0SA 3X1WA 1NN3A 5ALTA 3I92A 1G8GA 1S0UA 5CDHA 3HI6A 1EX1A 4GSKA 4KH0A 3THXB 1FJGB 3NKLA 2ATCA 3J80A 4WIAA 3X2SA 4A0QA 1ZHHA 2NPIA 4HXEB 3LNTA 4MEJA 5HDQA 4DQDA 4RVSA 3ER8A 1SAYA 2C9CA 4ARUA 2GM5A 2UYYA 1XZ8A 1HNZB 5CM8B 1DAFA 2GXQA 4D0NA 2ZAGA 4OLAA 1SB9A 3O1JC 5DYGA 1E32A 5HDBB 1TX4B 1U0OC 1VSQA 4F9GA 1KJIA 2ZUTA 2G9UA 2PRKA 2VAMA 4HEJA 4IQGA 4W63A 3ROQA 2IOHA 2W2MA 3KR2A 3WWDA 4QYSA 3CVUA 1CZUA 1FPQA 2BKVA 2VF8A 1X6VA 4OX9Y 2EKBA 4PS1A 5K5EA 3DE5X 2HGZA 3A14A 3DVLA 4EUKA 1E2BA 3S40A 5CVDA 5KNCH 3QGMA 2FQQA 3LWZA 2GEUA 3ND5A 4H0CA 4M0EA 5ECGC 2ZR8A 4XR4A 5H81A 5LZ2A 1CLUA 4PGAA 5KAPA 2Q45A 1GPJA 2X40A 4BO6A 1DL5A 4D96A 1IBRA 1YBFA 3IKTA 3Q8XB 3ZXIA 2W6NA 1XA0A 3ECSA 2WWWA 4WV3A 1W5EA 2DWQA 2OP0A 4N9QA 4BGIA 3M6FA 3E7PA 3UK2A 3WY9A 5J4VA 3G5UA 2YYZA 4I1IA 4KEAA 4BASA 4BMOB 4GPTA 4LI0A 2WU4A 1VRCA 1E2JA 2JKZA 2ZSAA 1JEQB 2Q27A 1C30A 2NPFA 1U8ZA 3ZQKA 3A8TA 3OQJA 4JI1B 1K4YA 4Y6GB 5JSZA 2QPLA 3SEFA 1LRJA 4GKVA 4WDQA 2GK4A 1A5SB 3MJVA 4D74A 4UW9A 5JWHA 4GBED 3CVYA 4BKUA 1TE2A 2R44A 4JP2A 3BXPA 3IMKA 5DHFA 2QRMA 4DBZA 1DLJA 4MWSA 2VRNA 1SRRA 2C83A 1WQ3A 3H5AA 3KDPA 1C0IA 1CJMA 4E1BA 1MAVA 4KYUA 4RK0A 1HI9A 2R66A 1I1HA 4E5MA 3B12A 1FQOA 3DEYX 3FY4A 4X1YB 1IBMB 1XZJA 3K71B 1XC7A 3USZA 3GVXA 3HLTA 1S2NA 1U4NA 3FWNA 2CEKA 1TK2A 4GC5A 4PO9A 1Z2DA 1VPEA 3KJQA 1GKLA 3LA8A 1H2RS 1AE1A 1I32A 2EU8A 4MVJD 4RLQA 4DA8A 4X7BA 4Z3OA 5G4KB 4DIEA 1Y63A 3AVYA 4FSXA 3AJ8A 2Y1WA 5B2FA 1GGEA 3B2EA 4KLAA 3A6PC 2W6OA 3OETA 3BREA 1NVAA 1RVV1 3MK31 3DOHA 1JNXX 4I9HA 1S7GA 3RR2A 4MUYA 5FORA 1N34B 3TBFA 2WSBA 1F20A 1IEXA 3ZBTA 5GTDA 3NP7A 5IUJC 2OHXA 3H5OA 4RHCA 3BWEA 4JYMA 4M6WA 4RC9A 5JLAA 3ANTA 2QQFA 3H6KA 2AN9A 4DCVA 1Q12A 4G85A 1D2HA 3P2IA 2CLDX 1DCMA 4G0VA 1BWQA 1XEAA 1RHUA 3QOWA 2OVBA 5LOVB 4JV5B 1APBA 3L6RA 3QUBA 1ODCA 1PSZA 1W46A 5M2QA 4YGXB 1A27A 3U3MA 1CIJA 1YV9A 5T64A 1KC1A 1YHYA 2J0EA 2E49A 1MABA 2EL9A 1GZ4A 1ZY2A 2GO1A 2C9MA 1Q21A 2QJOA 4L78A 4MWBA 1KMNA 3FDIA 1WR8A 1V2GA 4LZAA 1TYAE 1UBJS 3OTIA 1TIPA 4MJLA 1QB7A 4N0PA 4ZU3A 4BX2A 1RAHA 2IEIA 3MZ0A 3TQTA 4WN9B 3ZUGA 4IV8A 2HSDA 1SIBE 4XQCA 4B8YA 1QZUA 2KB0A 4JELA 1T3SA 2HYDA 2O2EA 3DOOA 4UTPA 4HDRB 4YCNA 2J0SA 2CMGA 3AP2A 2G4VA 1YR1A 2O3UA 3B78A 4ZYYA 1M72A 1J21A 1R4AA 5EZSA 5FLKA 3W3ZB 2O14A 2YV2A 3RC7A 4R9UC 1JTFA 3OG9A 4LJ8A 5JISA 3CT6A 1EQUA 3H9QA 4Y6LA 3OQIA 3QBEA 5IMBA 2Q2OA 4C6TB 1ST3A 2PUTA 1EDZA 2Z30A 5DP1A 4ZT5A 2H1WA 4KQIA 1R8QA 3OWOA 1DMSA 1BC5A 1Z38A 3V4SA 4CZ2A 5I4BA 2C5FA 3LZCA 3GGDA 3LKDA 4I8IA 1Q6ZA 3DEKA 4W7HA 1FTSA 1SVKA 2Q1YA 4P3NA 4E4RA 2V6FA 2X23A 3QEAZ 3QBVA 5E4TA 4AECA 1QLJA 2E6UX 3LUHA 3A32A 5DEOA 3RRYA 3GARA 1SQSA 3IUSA 4ZCSA 2FB9A 5KTMA 4V0KA 1ZK2A 5GAJA 1IVSA 3R9XB 2AG8A 4J3FA 4TN1A 3NHFA 4RZXA 4RESA 5F78A 2YRWA 1VL6A 2IEBA 1B4DA 5BNIA 3AVUA 5HHTA 3HUUA 1D5WA 5JV5A 1GGFA 4I0WB 4YVFA 3P9RA 5IUNC 4DR2B 2BP7B 2YC4C 2NP7A 4QBHA 1M6NA 1Z13A 4UPEA 4TLEA 4G23A 5KZMB 2Q41A 1MQ8B 2O19A 2J3QA 5KWSA 1BYIA 4ESEA 5CGZA 1WEKA 4DM7A 1Z4LA 2GZMA 4JOSA 1J56A 1F5SA 2HDNB 2P8JA 3PDUA 5AJUA 4FMCF 1KNQA 1KYWA 4X3CA 3GH1A 2OYCA 3T9AA 4RANA 4DNQA 1CRLA 2ZBQA 3HWRA 4I3GA 3TW8A 2HYIC 3P9ZA 5FAXA 3SGLA 5HR5A 2FKNA 2IHZA 3K5PA 4JA2A 5L6MB 4BGVA 2RBEA 2BD0A 5JMOA 3JRNA 4TV8F 1P73A 3ZYZA 1T5OA 2AEFA 1BJKA 4FYWA 4MWEA 2XTAA 2JF0A 4GGMX 4HLUC 1D6NA 3OJXA 5GJBA 1VKRA 4OYLA 2NYVA 2POQX 2ZXFA 3L1HA 3OEED 3VV2A 4EQ6B 3WQHA 4CLOB 3SZGA 3VJMA 2VZLA 3CLRC 4QRHA 2GBFA 3ZQJA 2XLCA 3S2IA 3C6QA 2PRZA 4JBNA 2GUWA 4LRTB 5DWDA 4CM4A 1KVSA 1Z56C 3E2IA 3EF1A 4W5WA 4Z4EA 1TQ2A 2ZWOA 4QBTA 5LQJA 3RFUA 2O50A 2O1WA 5ESDA 4P4LA 3RGGA 521PA 4D99A 4EKDA 1QFJA 1UC4B 3ZY5A 4U7PB 4GO1A 1EJ2A 1KMQA 1ZK0A 2DY1A 2GF9A 3MBIA 1ADFA 3OKPA 2EARA 2VDUE 3PPYA 1E2HA 4HQKA 2F8MA 3SXPA 3JPWA 1LVGA 3N0VA 1L4YA 3HR8A 3EA0A 2QU8A 3PRKE 5E6UA 3IUPA 4B32A 2MWMA 4Z6KA 2FJPA 1NSYA 2HK8A 4N48A 1K08A 1SOWA 1S2IA 2GQ0A 3TYXA 2PQMA 2PZMA 5C52B 4P5PA 4C2AA 3SKXA 3D2AA 4CIAA 3QX7A 2GBCA 3ZE6A 1VYHA 3H0EA 4PRKA 2RGAA 3H9JA 4P80A 5KYUB 1OXMA 3HB0A 5HEKA 4BLQA 2AGVA 1C81A 2JCYA 4ITRC 3PEEA 2F3SA 4IXMA 4Y6PA 5DSTA 3RJ5A 1QHGA 4K9MA 1NZDA 3E6AA 3OEHA 5DEIA 1ENYA 1H8EA 5A4KA 2VDWA 2FUNB 1ECCA 1OU4A 3KPJA 4KWTA 2C96A 1GSOA 3D1LA 1G6Q1 3DDWA 3Q9SA 4F3NA 3RS7A 1TVKB 1PQ4A 2O3TA 2MSLA 2VJYA 2XUZA 4UHBA 5CXXA 3S0JA 5J4KA 1ODTC 2PGLA 4HUTA 2CW5A 4Y2XA 2WB2A 4IL5A 1BFUA 3L7AA 5F7ZA 3MSXA 2I7VA 1ML4A 3F6YA 4HGOA 3AFMA 3KOYA 3O94A 1LLQA 2ZAYA 5BSMA 2Z2XA 4XWKA 4X60A 4IS3A 3D6AA 2QAGA 3EGXB 5LWHA 1D4ZA 1E9SA 2VOEA 2ZJOA 4ZOAA 2NZ8A 3W9BA 1OD6A 1RS0A 4JJ7A 4Z4QA 1Z0SA 3BBPA 4EMTA 3AOEC 5DW0A 3D7NA 3K31A 1M7HA 4LDJA 1BU8A 1OPRA 4QODA 4L6CA 2FZLA 1OZFA 5AJVB 5CR9A 5A4JA 3Q8MA 1IXYA 1GA6A 2TYSB 4C7JA 3ULKA 4CKCA 2V65A 3BEOA 1ZH6A 3VTAA 2YQ5A 1EDEA 1Q1EA 4MB2A 5ECDA 3VI4B 4JLVA 1KIFA 4MV8A 2IPXA 3BCSA 1NLZA 5BVGB 5KVSA 1F8YA 3I2JA 3FSEA 3RB8A 4F9EA 3F4KA 1A9QA 2OFXA 1PJQA 3EVNA 4HYEA 3TIVA 1KDVA 3U7QA 1J2EA 2XUOA 1FP6A 4P7JA 5ICCA 3BXOA 3OJFA 3R2JA 4HH0A 4JL5A 1M8JA 3UW1A 5AVWA 1T3LA 3D4BA 3U7IA 1ZSVA 1CZLA 1XYGA 2SNIE 5EIXA 3AY7A 1C50A 1Q19A 4YRAA 2VUIB 4L8LA 2XZPA 5AKHA 1NC3A 1XYVA 2FFHA 2J0UB 4RK4A 1KQOA 4LV8B 1DG1G 4OHMA 3VSDA 4ZOLF 5EEHA 1GG5A 1JR6A 4YUAA 2PM8A 2CF6A 3E23A 1NZJA 1Y33E 1H2FA 2FZCA 2E1PA 4YA6A 3RWMB 3WFJA 1GL7A 1R64A 4UBLA 4ZTZB 4AS1A 3FPKA 3O8DA 3ZU3A 1K5DA 2JFYA 1ISSA 4DG8A 3I61A 2JGLA 2YNMC 2LKCA 4B4KA 4LBZA 4WGGA 3E1KA 4N3NA 5CH3A 1DJMA 2D8MA 3VZRA 3LFHA 3TQOA 2AFIA 1MX3A 1RYNA 2ZBUA 1KJJA 3I9LA 5G53C 3GRUA 3A4LA 3KKPA 3H2GA 2JCBA 4N8SA 1SCDA 3H04A 4DFDA 1UR5A 3H99A 1JQKA 2JFWA 4KQ2A 3OEHD 2WIAA 5HX7A 3OPYA 2E85A 3NHBA 1XXLA 1ZEMA 3CEAA 1L4KA 4Q7MB 4MULA 3E5NA 1L6RA 3PLAE 3EASA 1FNSA 2PFKA 2PL9A 4UKDA 3NU1A 3H8WA 1GLNA 2OYSA 2PX0A 1G3UA 4M46A 3RFFA 2HGSA 4PX2A 2NO0A 3TEFA 2R6AA 2Z83A 2WC1A 4LJ5A 2P5YA 3GX1A 2GOYA 4OREX 4DOMA 2REXB 2WVJA 3A27A 3SLGA 1YL5A 4ON9A 1WXFA 2MYUA 3KAQA 3IVMA 2W70A 1MP0A 3D3EA 3VDNB 1FX0B 3HCFA 2LZ0A 3DVAA 4DDMA 3GQBA 1OVMA 5A6VA 1IIRA 3H5WA 2XDQA 1PEKE 1GPH1 1MZVA 2KWIA 5AOBA 3G17A 5ICFA 5BN4A 2HW8A 1KHHA 5CLQA 1WHTA 2J07A 2OQ2A 4RJ2A 2LVBA 4QL3A 4Y8VA 2R1TB 5FQNA 3TGPA 4RVOA 2NT4A 4R31A 1QK5A 4ACAA 5KYXA 1W88A 2VDVE 1TT5A 2OUKA 5KYVA 3DV0B 5PGMA 2IVZA 2IYOA 3ENQA 3CV3A 5AJTA 5L4SA 5BRAA 5JXIA 2D59A 4IIFA 4X1IB 1KOJA 2BCEA 5FFNA 4B82A 1FK8A 3JWEA 1P1BA 1E1QA 2B37A 2XNSA 3C7KA 3R7SA 1F48A 3PQ8A 4CMIA 4WNAB 1ZXLA 4B2LA 3FVQA 2PIDA 4JHXA 4YX9A 4UNRA 2Y0EA 1HFJA 4S1VA 2R65A 2EWWA 1MV8A 3KSMA 2H8KA 2ORYA 3NT4A 2FRXA 1KXZA 4H4CA 3T7DA 1EDBA 4QT4A 3HFGA 2P1DA 3K0AA 1PCXA 3KVRA 3CNEA 1XNJA 3SU8A 2CDBA 1TUGA 4S2EA 3D2CA 5TMPA 3PR2B 2OCDA 1EVQA 1M0WA 4XWGA 2QX8A 2GPYA 2XZTA 3QVSA 1T6BY 4DR6B 4DLRA 2O2ZA 2WYOA 1FQJA 2PANA 4HXFB 3X2FA 1KDRA 5E6RA 3W9UA 4BV2A 1BOOA 1JSZA 2GH1A 1BE1A 1G7SA 2OPBA 2XADA 3GGOA 3JYQA 3QQ5A 4C5CA 4QDUA 2IS4A 4N4AA 4F2PA 4GI1A 2FPGA 2RI1A 2ZATA 3IJ5A 4YRDA 1AH2A 3V32A 4ZJZA 4ESVA 5HMMA 3M3HA 3U3RA 3GG9A 5CH8A 3HSSA 1ATIA 1YS2X 3RC9A 3KBBA 5CBPA 4OI0A 3BAZA 2A86A 1YKGA 1Z9BA 4L4YA 3U4QA 3K6RA 3OT5A 1T36A 4ENPA 4X64B 2RBGA 3AHCA 1S89A 3O3CA 4YDHB 5KYGA 3MGAA 4R5HA 3IT3A 1F9EA 4OUKX 1V6AA 2NO6A 5D5HA 5B5SA 5LPNA 2NU8B 4CF6A 3OX3A 3GJ4A 5HQJA 3EEIA 3WNDA 1I8TA 5EKUA 2GWHA 3PFGA 5KU1A 1U3FA 3L7DA 3WXBA 4RE6A 3C7AA 3BAFA 3NHWA 3SXUB 1U8AA 3WSVA 4C0BA 1D6MA 2YY7A 1GG9A 1U2GC 4E13A 4YAUA 5D8DA 3VO1A 4ZI2A 2FP3A 2IU6A 3OZ7A 3GLQA 3TSAA 4LNHA 4AMGA 1VIDA 1IBSA 3KQYA 1JN0A 3DHWC 2O6LA 1WAMA 3L6OO 3LQYA 4BOYA 2Q5IA 2I22A 1VYUA 2HREA 4JU8A 3VDRA 3CQ9A 1RRKA 3QVOA 1W49A 1U0SY 5ALQA 3TPFA 2EW2A 3WDLA 2Y77A 1A2OA 2KQUA 4D3ZA 3MQFA 1PFKA 1OMOA 1KMMA 1EB9A 4MWDA 2Y27A 5CM2Z 3PRYA 3ETGA 3M1LA 1EE9A 1KRXA 1KZ1A 3EA5A 2IGBA 4L4ZA 4OHXA 3EHDA 3HA5A 2ZRIA 3NTOA 1P19A 4IEIA 4W8OA 1PK8A 1MAUA 2WU8A 3ESQA 3Q7PA 5EVCA 3T94A 1E1NA 3ODGA 2ZRDA 1X8KA 1IM2A 1SHTX 2QXUA 3FPAA 4KPUB 4FR0A 5E7MA 2FH5B 1EP9A 2P67A 5JAUA 3ZE2B 4WBNA 1LPNA 3I6ZA 1JHAA 3OIYA 4RY0A 4REMA 1FMFA 4GX2A 4EKIA 4RD4A 5FO0A 1FNCA 2R4TA 2EBUA 4LCJA 3UT5B 2GB4A 3AF0A 4DXDA 1FYFA 1KAOA 3KHUA 4I9UA 2ZI6A 3RTGA 4CT0A 1TLFA 2EQ5A 3C3PA 2QX6A 1TT7A 4DL9A 3KNZA 1GZUA 1Y4SA 4C2UA 2HBRA 5LKAA 3ZOZA 2C1XA 4KUGA 1EB8A 3HB4X 1MAHA 1ZD8A 1YULA 1YNOA 2P6MA 3JATB 3BA1A 4TS4A 4Q9IA 1HFEL 4IHJB 1WCWA 3FSJX 3DMRA 3BIFA 4JXJA 2H1RA 5BOSA 2JFUA 1XQVA 3C5EA 3CPEA 3O21A 4RS4A 2MTBA 4F1JA 4PZAA 3TAXA 2RGDA 1GSIA 1CT9A 4LDPA 2WAYA 4AJPA 3L7OA 3V4ZA 3W5SA 4AF8A 4D9KA 1UMBA 1W1WA 4RQBA 3N53A 3VBCA 3ZWKA 1FW8A 5B36A 3FYTA 4B73A 4CEHB 1HM5A 2O4CA 1TNDA 5CFOA 1I7PA 1UEXC 1IHDA 2FE4A 3AKDA 4M55A 2HU5A 2XSZA 3ONNA 3CJRA 3OFSA 4A36A 3WGKA 4I99A 4XTRA 2H5EA 3ENNA 4UE3S 5L95A 1TAUA 2AFHB 2RKBA 2UUBB 3W3AH 3FLBA 2QMHA 5AK3A 5FF9A 4XLLA 4G9BA 3PNMA 4D98A 2X13A 2C7GA 4ND8A 2V7XA 4I5EA 3QVMA 3MYYA 2NXCA 4K9LA 1QCYA 5IT0A 4JJKA 3ADCA 3W5UA 4TM7A 1AQ6A 4HX2A 4MLDA 5IN4A 4MW5A 2JGJA 2CLFB 3OX2A 4NENB 4UULA 5IDWA 1GZ6A 2C5HA 2HX1A 2ZPUA 3CKMA 4ZHQF 1W30A 2HRBA 3SM9A 5H4GA 4G5HA 4BNMA 4ZK2A 2IZ6A 3O4GA 1XTIA 2GD0A 4KGDA 4PZCA 4Q4JB 3NC0C 2GPBA 1C4OA 1QV7A 3DTTA 3NVDA 1J0EA 4I5GA 3TSOA 4H3HB 2YMQA 3QVLA 4IG9A 4M1EA 4A6DA 2OE2A 3ZX5A 5CDFE 2JJ1A 5DYYA 1UKEA 3MIZA 4PAGA 3GLHE 4XI9A 2I1LA 3ZOKA 4NBKA 4B76A 2X22A 3QA3E 1OWLA 2BKXA 3INGA 2YMLA 5K0JA 3ZDCA 3T1HB 1NRWA 1UDCA 1V8BA 2PQ6A 2R5WA 4B2PA 1NQVA 3D3WA 4DXHA 4DUYB 4EUFA 4E32A 4G4SP 1YR3A 3OUUA 1VBKA 3MS2A 4HH4A 5CDYA 2LV8A 3FUXA 4MVYA 1VSBA 2ZRAA 1T9BA 2GK6A