4LXXA

Crystal structure wlard, a sugar 3n-formyl transferase in the presence of dtdp-fuc3nfo and 5-n-formyl-thf
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
273
structure length
273
Chain Sequence
GHMIKICIAGKNNIAVNSLQFILKNYFEADQIVVIPNKNDKGIDSWQKSLLKFALDNNIKIVTLDEIYNIEQIIFFSLEFDQIIKIENFKSDRLFNIHFSALPKYKGVFTSITPILNNELESGVTLHRIDNGIDTGNIIDQHCFPIDINDTARDLYFNYLKYGESIFKKNIQTIINNSYKDLKQTNINSSYFSRKDINLVHKINFKKTSFEIHNQIRAFIFQEYQLPIINNSKIIKSILANEFIGYNVFEEFENYFIISGIDGFKIIAQKLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a sugar N-formyltransferase from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Transferase
molecule keywords WlaRD, a sugar 3N-formyl transferase
total genus 90
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lxxA00
4LXQA 4LXYA 4LY3A 4LY0A 4LXXA 1Z7EA 4WKGA 4LXUA 4LXTA
chains in the Genus database with same CATH superfamily
3S2ZA 3FRJA 5I4KA 3NBQA 5DM1A 2BKUA 1IPFA 1JHQA 2WIFA 4Q4AA 4EITA 4DR3B 4WJZA 3EGVA 3LKBA 4G0MA 1T2DA 1SCKA 4R3NA 1R4AA 1E1QD 3L01A 1LVUA 2CMDA 4X63A 5TRTA 1Q6YA 3A36A 1ZAYA 3BDVA 4PZEA 5CNIA 3OEHD 4ZRMA 4PBTA 2ZRBA 3F4BA 3H84A 3GDHA 2G70A 1DLIA 3HRIA 2RONA 2GN2A 5IYZB 4Z4EA 1QHIA 3OFJA 1JA9A 2BIFA 3MCUA 5LUAA 3QWFA 1Q20A 2I2XB 1H85A 4LW8A 3HABA 3LCVB 3KVNA 3HDTA 4RAOA 2DJ5A 4JR2A 4M0CA 3L6UA 1MJGM 1WSBA 3L6DA 5FBQB 5CTAA 2LE0A 1OFIA 4PSAA 1QFZA 4K40A 3EG9A 3WYEA 4AWXA 2OCXA 1QH8A 3OJEA 4OPMA 4WLFA 4FGWA 2PFSA 5J9FA 5K3FA 5LA6F 4F6RA 3OTQA 4J0QA 4LOAA 3KQUA 4YRKA 1QSGA 2OZLB 2CFRA 3G8AA 3HDVA 4LY9A 2CHEA 4DTCA 6REQA 4XPIB 4D46A 2ZTMA 3RVJA 1O87A 3ISTA 2DYKA 3OSZA 3GDWA 2C58A 1UBKS 4IO1A 1EFLA 5H81A 3TIFA 1C9DB 4PSCA 1Q15A 1TT5A 2FCRA 2UVPA 3VNBA 5EHIA 5CFQA 3FPAA 2PRSA 4X66B 5CVEA 3QX8A 2FCAA 1W19A 5FQNA 4L9RA 2GYUA 3RWOA 4GMDA 3NTVA 3SQWA 1QAOA 3ZIDA 3DTTA 1HPLA 1V1MA 1QYRA 3BRCA 2ZJ1A 1NXWA 2Z2YA 3W3AA 4HH3C 2HMVA 1NUSA 1ZOSA 1PR1A 3DM9B 1JILA 4KXUA 3OOJA 5L8VA 1FDRA 1Z2PX 3OJFA 4MKHA 4W99A 1EE1A 2DHRA 1MQSA 4YJ3F 4TX1A 1P73A 5BVHA 4A7PA 1N5KA 4IOLA 3MTDA 4IQ0A 1B8UA 4IHJF 3GWGA 5EEHA 2Q6OA 5FWYB 3V7FA 1RT9A 1HKUA 4ZHQA 5B6JA 3OQMA 3IAEA 3B1ZA 1RZRD 4YFYA 4CTOA 3OLVA 4Z3KA 3G68A 3E9YA 4IR7A 3RFVA 4AG6A 2VYVD 3LJKA 4D02A 3A6ZA 3HQ4O 2Q4RA 3TCKA 3ZR4B 3FOFC 5CLGA 3U4HA 1QNFA 2W6JD 3O7MA 1Z6YA 4GDMA 2IHZA 3PPYA 5J5AA 1DCTA 3Q85A 4K6CA 3ZDXB 3ZZ1A 3MB8A 4KWCA 3I6BA 2AS0A 7GPBA 2YZNA 2ID7A 2QTRA 3OY2A 3SF8B 5LDGA 2YFYA 5KJ1A 1ZU4A 3WA7A 1SCUB 4NEQA 1AMOA 3I30X 4G67A 1C0IA 4OREX 1DXYA 2F9LA 2CE2X 3BWMA 3AKEA 2IZ0A 2XDYA 4P84A 1NPDA 1XTPA 3O31A 5E1BA 2NQ2C 3PBKA 2WF6A 3A6GA 1L8QA 4EYGA 5BSGA 1NVUQ 2RGYA 4MVJP 4MW9A 3HO6A 4RULA 3ER8A 3DJFA 2XQFA 4IYRA 2QN8A 2A0KA 2E4ZA 2XSZD 5KINB 2VT2A 1EA5A 2O2XA 1RWMA 2VQDA 2Y0BA 3ZDYB 1X39A 2G9RA 5DISB 3A2LA 1MFZA 2V7PA 2M32A 3WL4A 4EWLA 3E5MA 1TC1A 3KKEA 2HHLA 4PLZA 4PWYA 1VKHA 4HZIA 4F11A 4WESA 3QUTA 5DASA 2GESA 3VYRB 5ECYA 3UK0A 5KOIA 2BUCA 2DG2A 1XRSB 2UUAB 4BO0A 1IN4A 2DUNA 2GARA 4UEKA 3CVJA 1A7UA 5HXAA 2JK0A 4AZ0B 1UANA 1T4BA 2IITA 3K1JA 5KKNB 3CJQA 3I2FA 1BFDA 3C4JA 4KE6A 4KXXA 3KU1A 2OAQ1 1Y6GA 1JJBA 4D5GA 2P68A 4JVOA 1CR4A 3DMFA 3ZQKA 4ARZA 3KQQA 4F8JA 2AOVA 3G9UA 2B78A 3ITDA 2TYSB 2HBYA 3U1TA 3GJSA 1C30B 4ZQFA 4ND2A 1G21E 2IE0A 2RKWA 2DH6A 3EEBA 4CUKA 1WA5A 4Y2GA 1FYVA 5DXFA 1EXDA 1K0UA 3IA2A 3U3DA 3DCJA 2P4QA 1NT4A 2WKPA 5LU8A 4I99A 3CVYA 1EVLA 3DB2A 3OEED 5JASA 3CLUC 4NG4A 1I13A 1NQOA 1S01A 5E6UB 2OPBA 3K9LA 5F35A 3ZGLA 3Q2KA 4NARA 4CQJA 1A4XA 2G25A 4Y2XA 5EP2A 5DM2A 1SC1A 4G36A 4OMDA 5D3MB 3T94A 4CTMA 4ARUA 4BP1A 2IE8A 2Q5IA 4XXHA 2FEKA 4C0BA 1GUDA 2H18A 3MMZA 1HH4A 3MNFA 2AWOA 2ZVPX 5BXQC 1QHSA 2Y1CA 1B14A 2R48A 3F6SA 3RVSA 4DCGA 2XDQA 3RG2A 6Q21A 1E2MA 2X42A 5T7BA 2PQMA 5IVKA 1HE3A 2A94A 4EKDA 2FFQA 5FWDA 1XT6A 2H65A 3BHJA 3T3GA 4BFVA 1EBBA 2QYOA 2EIHA 3CRQA 2J4FA 4NMLA 4R31A 5ALDA 3T0GA 3TFQA 4BNTA 3YASA 3ZGYA 3S70A 1P0PA 2CFCA 3ED5A 3HUUA 5BUCA 3DVAB 2OVBA 4ND8A 1EIWA 1HC7A 1HQKA 4O4HF 3TZQA 4X6UA 4CF6A 5BR4A 2F64A 1GL6A 1H5UA 4LRYA 1RHRA 1IBRA 1XU4A 1U65A 5FPPA 1JEQB 1FQKA 1ONNA 2X40A 2XDWA 4HB4A 4WCFC 3LSYA 4Q3NA 3VTKA 4AF7A 4LF4B 4Y7DA 1Q1QA 4BO3A 3HDQA 2WU0A 4JC8A 5AUPB 1J8QA 1T26A 4MGEA 1KERA 1R5OA 2PS0A 4KPUA 3W5VA 1C7RA 2XA9A 2R6GA 4GX5A 3WBKA 4JI4B 4AIRA 1DRWA 4LDQA 2EWMA 5HVNA 3KAKA 5JYDA 3GAMA 3ESCA 1TYCA 3EDMA 4RKYA 4ZMBA 1HLPA 5F33A 2H8GA 2E1RA 2IIPA 2IQ5A 5M5BA 4IILA 2H0AA 4FGUA 5A9RA 4KR6A 4RL4A 2GK3A 2GPWA 4DQVA 3KLMX 1K8YB 1SCQA 2BFAA 1CQIA 3IOBA 3NWJA 4MB2A 1D9XA 5HRAA 1GR0A 1MTZA 4AJEA 2P7HA 1CUFA 1NURA 2B7CA 1L2TA 3VO8A 1L7AA 5T64A 2A78A 2R6ZA 3Q9LA 1T5DX 4XIJA 1XDBA 3HB9A 4U8GA 2GKOA 4MUJA 4ESVA 1RVV1 3A6LA 3MTJA 3HC7A 4S24A 3WQSB 4IRMA 2IUTA 5EJ5A 3AJAA 4ZEVA 5ADWA 4R0VA 4EVSA 2PMEA 1RRMA 4RLSA 4BQSA 4CXMA 4BXOA 2RARA 3UO8B 2FLWA 3OCYA 1A9TA 3B1VA 2PJUA 2VJLA 5K1ZA 1ACMA 1EQUA 4ZICA 5K45A 5IAJA 1KC1A 5E1DA 3TSWA 3DE3X 3U7JA 3IT3A 4XWKA 2H1SA 2PH7A 1QGUA 1EZ4A 1U8ZA 3Q7EA 4XEUA 4P0PB 1CZOA 5BY2A 1J06A 3FI0A 1KH3A 4IL5A 4YAUA 1VSVA 2PX8A 3HCEA 2C1EA 4BMVA 3L8YA 3FNRA 1HETA 1CS0B 2VUIB 2A2ZA 1USIA 1XZBA 3TLYA 3U3MA 3V55A 5A0VA 1I2MA 4LQLA 4WXMA 4RSHA 4CCSA 3BT7A 4CM8B 4XWWA 3JAMA 3QNMA 5C31A 4JYZA 2QGFA 5AK6A 4EKIA 2FQWA 1Z2EA 3GX1A 3A6FA 1IEWA 1F20A 1VIDA 4D82A 2H4HA 3K5IA 3GVPA 2WYVA 2YYSA 4UUOA 2CHVA 3IBSA 4HH1A 4YRDA 3WL7A 1X3SA 1DO0A 3TH5A 3VNAA 1P74A 5HUQA 5J2UF 5BT8A 3ZH2A 4HUQB 3KS9A 1QK4A 3F6EX 1OUMA 2AOTB 1YDMA 1JNXX 3H86A 4LF9B 2PSFA 1VHJA 1W85A 2FGJA 2R3SA 1CQJA 3FVRA 4FFSA 5JEEA 4FE4A 1G20E 3HJHA 4G0WA 4JY7A 1RJ9B 1DKNA 2P6OA 5JXJA 1W1UA 3TUJC 4IMIB 4LA4A 4ZI7A 1T1IA 2I2AA 3HTXA 4R1LA 5AOBA 1E9FA 3QMPA 2FPGA 4EAQA 3UCEA 3AONB 1MRSA 1FXWF 2B20A 1SCJA 1ULSA 1M2VA 1RBYA 3R3ZA 5SYAA 3CE6A 1I2AA 5AM0A 3ZWWA 5JCZA 1GCUA 3QVKA 4HLNA 1RWQA 4Q19A 3ICPA 3M2TA 4XLLA 1PTJA 2HRBA 5KYGA 1KMHB 2R2AA 3JQBA 1RBMA 4MR7B 2PGDA 3VR6A 1B6SA 4C0KA 2ERXA 3ONFA 4NE2A 5C80A 3DE6X 3TAUA 4HJXA 2PUAA 2ZE8A 3RC9A 3HBFA 5FWAA 3UYLA 1TK9A 4CMGA 4MVJM 2QGNA 4IWXA 4BRUA 2O8EB 3KR2A 3W2EA 2ZR8A 3RNOA 1G2PA 4PLTA 3EZNA 4F4UA 4U0KA 5EMNA 1G9XA 3R8CA 3UJCA 3IYLW 4EJSC 3QYAA 2CJWA 2PX0A 2R7AA 2V7WA 3D3NA 4NAUA 4X41A 4YNBA 1A9XA 2D2FA 2C92A 1VLHA 3DMTA 5SV2A 5T8KC 5YASA 4UHHA 3WK9A 3OPNA 2B0CA 1UBOS 2JHPA 4M87A 3EK2A 5K4GA 4IO0A 1BNCA 1E7MA 2KLHA 3LKZA 1U3VA 4G5HA 4NCKA 2IP4A 1ETUA 3HDGA 1DG1G 4U2BA 4ECAA 2ORYA 3FDJA 4DV5B 5CHEA 4J0EA 2XTJA 1EAYA 3FKSD 2PCJA 4U6QA 5LP6B 3FMVA 3L93A 2I7DA 2V5AA 3MRTA 1US8A 4UJ3A 2P1DA 2O2ZA 3H5IA 4FR2A 1SU8A 4OHUA 4UNSA 5EGNA 1NWHA 3V00A 2H3EA 3WLHA 3GEHA 2NYVA 2UZIR 1KY5A 3W9BA 2NAFA 1M2WA 3BIFA 3QKSA 2HRZA 1QCYA 2P30A 3CNHA 3K0FA 5HOQA 3WB9A 3KALA 4Q18A 2QTFA 3F96A 4OQEA 3WYFA 1SRRA 4ZHSA 2GYWA 2PD3A 4FKBA 4LRXA 4TT3A 5E1OA 4E2XA 1V0JA 4I55F 4XJVA 4I5DA 3C4VA 4RHYA 3EXG2 1B1AA 1ZSNA 4M7PA 4AUMA 3NNNA 5EIEA 4I19A 1AA6A 4PGHA 3B7GA 3O74A 4IUCS 5F7OA 2HRDA 2ECFA 5CA0A 3CU5A 3U48A 4I55A 4FOOA 5C5DA 1T5TA 4Y2YA 4C0SA 4WNAA 4KDCA 3X2SA 3FOAA 5AJWA 4ND4A 2CNBA 3ZTWA 4ZOBA 1ATIA 1OGJA 2Q5FA 3AYZB 5J4KA 2XTNA 1YB5A 4PXAA 4CIDA 3G88A 4I1UA 5F64A 2VA9A 3OFVA 2O8BB 1IQPA 1EFCA 3PD0A 1C7FA 1QHEA 3T1QA 1ZL0A 3NHPA 2YASA 3D1VA 4DSTA 2BT4A 5KQSA 1ZVVA 2HNAA 1KFBB 3LC0A 1RLJA 5CFOA 5EG5A 2LBPA 2XW6A 1A96A 3SBEA 1KBZA 1XZIA 1YDGA 3COYA 5I9SA 5K0BA 2GAOA 3CY6A 3FNHA 4OHVA 2GPTA 3H4TA 3CRVA 4QNMA 3DC7A 2YV4A 4TL6A 4KQ9A 1ZGJA 5CM9C 2EFYA 2VDMB 4HZGA 3HWRA 5DWQA 3ZWCA 3OEHA 3U40A 2ZIVB 3P26A 4DNOA 1Q0RA 4UNQA 4XR4A 3TM4A 3KXKA 2C8LA 1XQ9A 1TM3E 1US8B 1C80A 1A2OA 1A7JA 3A6DA 4MROA 4PX5A 4S1PA 4TLBA 3CPJB 3S27A 3TJMA 3GLGA 5EESA 5LP6A 1ELOA 4ZRDA 1U0NA 4N40A 2J3EA 2CV2A 3NDPA 3N7AA 4WJKB 4BWVA 1SOMA 2YWHA 3O4JA 1Z7EA 5CAEB 2ZZMA 1VI5A 2JA2A 3CF4A 5A9TA 4GSKA 4O4LA 5KWJA 4LXXA 1C1DB 3X1ZA 3BCUA 2MMGA 3L4BC 1YD7A 2OO5C 1U9IC 1BMFD 3A6EA 1HLDA 4MRNA 2R8XA 1EQ2A 1T1GA 4PYQA 3NXSA 1E0AA 1XEFA 2HSDA 2OP0A 2QP9X 4RJ2A 3FY4A 4YAJA 3QLJA 4N0DA 1ZD9A 3OLXA 3AUTA 1SCBA 1TOAA 3GGDA 1I94B 2CWDA 2CXPA 1DAEA 4WXRA 2I4TA 2Q3JA 3ORRA 4FYMA 4MVJH 4LCEA 1WMBA 2ICAA 2IH2A 1AKQA 1H2FA 3MQFA 4MP8A 4TLMB 2IEGA 2VRNA 4F06A 1RC8A 1MC5A 4GUAA 1KMHA 4JLSA 4P2GA 1GTL1 5AHXA 2DBZA 4OYYA 1U4SA 1NE2A 1ZUNA 1PT5A 1UT8A 3CZAA 1E4VA 3JASB 4ZVVA 3O21A 3B5JA 1GSIA 1UBGA 3N5KA 4AN0A 4EQ6B 3WIBA 1PJTA 1P0CA 1JIXA 1KYTA 3X3HA 4EABA 2P40A 3DV9A 4EQ6A 1QHFA 3IUMA 3VPHA 1MO2A 5AW6A 4ZOLA 1VG9B 2RBKA 4MP6A 4LXYA 2QDXA 3P5SA 1GEEA 4HO1X 3KSDO 3D59A 3VZBA 4Q4LA 1GDDA 1LW7A 1T3ZA 4IX9A 3V4FA 3WKEA 2QVXX 2D7DA 3M0EA 4TLCA 2FWPA 2R6JA 3DMNA 4Q3EA 4YO8A 4WA7A 5F76A 3LKVA 4U7FA 4X7MA 5GP1A 5TT1A 1Y8RB 4YDSA 4KWTA 2FPXA 5CDGA 2I91A 4EFLA 3DPIA 1AK9A 2GM4A 1ULHA 5JJ5A 3LXRA 4OLHA 4DAEA 3E2IA 1R0XA 3DKKA 3V4RA 2L19A 3GGGA 1CJMA 1K5HA 2IOHA 3I09A 4AD8A 2PZEA 2ONCA 2R8EA 3AF1A 1HRKA 4MW6A 2P7IA 1QM5A 2OO7A 4O5AA 4S04A 2JLRA 2QXYA 1U8CB 4RORA 2ATXA 4MJLA 1ID1A 1D2NA 1JKMA 4HTFA 2V1XA 1O9HA 3H1PA 5F5NA 2AE2A 3AZPA 4GZ3A 4ZAWA 1OHHD 3T99A 3NVKI 1RYHA 1T2CA 3PFIA 3TBFA 4HLCA 4WUVA 1JI0A 2QNIA 5ARDA 1NAIA 1DEHA 1CZNA 1G0OA 3N7TA 4BCBA 2PD6A 4P3XA 4PV7A 1GPWB 1I2BA 5AW0A 2RD2A 3QKWA 1DX6A 5FO0A 3HJCA 5C46F 3FTEA 4C5AA 3H05A 3PXCX 3KVRA 1AB6A 2FXVA 4Y9SA 1O9GA 3AOGA 2OFPA 3SS8A 4E13A 1TQ4A 3JRXA 3NASA 4RJLA 2MSKA 4AUNA 2IX3A 2B1IA 3FHCB 3I6MA 4FZJA 1Z37A 4DGSA 3G0HA 4FC7A 4MQ6A 1YMVA 1UEJA 4EK9A 2W98A 1YS2X 1UQUA 1O4WA 2FP4B 1TRKA 4OFZA 3U3OA 3UGQA 1KAMA 2ZT7A 4OOEA 3NDBB 4HLQB 3STHA 2J59A 4AJ9A 3HXQA 1FDIA 3QFRA 2VK4A 1RKBA 2XCRB 1M2HA 5KU7A 3JAKB 4G4SP 1SVUA 4LHYA 3R0IA 4L5AA 4WLUA 1GKIA 3QHAA 2QUAA 1Z0UA 3H9JA 4EP1A 5CIYA 4JVMA 3I1JA 1XK6A 4RQUA 1W36C 2QA5A 4BPRA 4U6NA 4WN9B 1S3IA 1GAJA 3RF7A 4GHWA 3U2QA 3EQ8A 2IHUA 3IUJA 3AYXB 3LY9A 1AZLA 1Y6ZA 1WY5A 1TW2A 2EQ5A 2AJTA 2QYSA 2WVAA 1GFSA 1OVGA 1EAMA 1TZBA 2OPHA 5HJEA 2WSBA 3MWJA 3QKSB 4OU4A 1HGXA 2W2MA 1IB6A 5ENDA 2ZWPA 1PSDA 1V47A 3LVBA 1GFWA 2WG2A 4NBSA 1D1TA 4YRFA 4GS5A 3BRSA 3E8MA 3RODA 1BXGA 4AQDA 5KPJA 4IAOA 4L9AA 2X5XA 3DMDA 2O2IA 3FBTA 4W5JA 1GITA 4X1OA 5IH3A 1ESNA 2X7XA 4PCUA 3W8FA 1AKMA 1NBEA 1WPQA 1S2OA 4Q4JB 1RKUA 1WUJS 3LCJA 3CCBA 4UNPA 5ANRB 4CM4A 3C1AA 5D5HA 1ZR2A 1UC9A 1NL3A 3ABQB 4PO3X 3DMRA 1PWHA 2HIMA 3QGMA 4W1SA 4KR9A 4NMXB 5KX5F 4M88A 1PL6A 4BZQA 2VDQB 4PSVA 1CP3A 2VK8A 4FFBB 4GXTA 5CRIA 3TEJA 2GA9A 4FSDA 1RHJA 4NHOA 1N4DA 4ZVKA 1K5DA 4ETMA 2PMWB 3EXHC 5GVRA 4UEOA 1SGWA 1GSHA 2FK7A 4I9GA 1BVYF 2C5AA 1PUXA 2ZI3A 3NR2A 5K3CA 3RS3A 3NHAA 4JUFA 3U7EB 4F4JA 1SY7A 2FWRA 2ZCUA 3BERA 4XZ3A 4N5HX 3G8YA 1V3TA 3AEUB 3R3WA 2SNIE 2AT1A 3FOCA 3NANA 3AP1A 3LE8A 4N0MA 3PC4A 4MUKA 5KVCA 4JIGA 3W6UA 4BC0A 3I28A 4WEOA 3I6IA 4Y2VA 1OLSA 1N57A 3BUSA 5FOUA 5FNVF 3DP9A 4XPZA 3PIRA 3ZHOA 1VI6A 3BH0A 4Y9RA 4E2YA 3VV3A 1QJ4A 3FOBA 2FPGB 4OL9A 2FQQA 5JXHA 5HFNA 2IDMA 3I23A 3DZKA 3LA8A 5FOWA 4C0XA 5K8VA 4TL7A 4TVKA 1R6UA 5E4FA 4JCCA 4Q1EA 5EIHA 3OLYA 2OXFA 1D7OA 3ESAA 1I2CA 3FPSA 3MCVA 4ZXFA 3V33A 4EJMA 1UKYA 1VIAA 1PNVA 1PJ4A 4MS4B 5DSXA 3U3XA 4TVOA 3KQPA 3SN6A 2PA3A 2EJUA 2RK6A 3CX3A 4J2OA 3SSOA 3GUZA 4K8RB 3SZUA 3UUWA 2C54A 1EXNA 1VTKA 3RABA 3PHJA 1L7MA 4OAQA 2B3TA 1SK9A 4BJ5A 2CXQA 4HNSA 5L3ZA 3ADDA 1TJNA 1SCUA 2I4RA 4GOKA 3ZIUA 2P91A 5G0UA 2R5NA 3L7LA 4GMFA 3UK7A 4QAJA 4X20A 2YNMC 1RKVA 4OI2A 1ULUA 2FR8C 1CS0A 4O0MA 5H7XA 1L5FA 3RPEA 1R9GA 1UXGA 1RHMA 1VMAA 1GEGA 2ZI4A 3FZGA 1EB9A 4ZA2A 3UFXB 3NWBA 5ITWA 3C5HA 5AW1A 1H3EA 3WQRA 2REOA 4MWSA 2W2LD 1FXSA 4OMUA 2VPXA 3VNQA 4L0CA 1E9DA 3GRPA 1OVMA 4B3HA 3L4JA 1FQJA 3EGWA 2OV2A 3B1KA 2O3JA 5FWYA 1L6RA 1X38A 2ETXA 2GEJA 4R9NA 1J2RA 2XCLA 3M5WA 1J9EA 2PXHA 2Q3CA 2XUOA 4PPQA 3OE7D 3RGWS 3EA5A 3ZJYA 5JJCA 1TA0A 5HNKA 1KDPA 4OHCA 5D87A 3LHKA 2J9ZB 2D1TA 3W5UA 4MQUA 2XAAA 4JUBA 2CLFB 2B82A 1T43A 4DANA 5EFZA 2NZYA 1ZVKA 2N1MA 2VSFA 4JFAA 1CETA 1GPDG 1GZUA 1IATA 2FWNA 1YQXA 1YCFA 1K92A 1KJYA 3HS3A 3SLKA 1VOTA 1MX9A 2ZE6A 1U80A 1GNQA 1YL6A 4MCJA 1T5LA 3PFNA 3RFXA 4HFMA 3SQXA 1FRNA 2AMJA 2NVOA 3DDOA 4B73A 4C6HA 5FB3A 5KYYA 2WIJA 1FRQA 1CQZA 1PTJC 3USZA 4ALMA 2MSWA 1EK5A 1BDJA 3P96A 3PKIA 4J7AA 3M9WA 5KI6A 4B3SB 4HWPA 3IIEA 3N2KA 1XU7A 4DYDA 4QNRA 3PENA 3U3KA 3NVDA 2J41A 1QTNA 1T36A 3BXZA 3A11A 3UVEA 1H4SA 1WQ4A 1KI4A 1JEQA 2BFOA 1ABEA 1U3CA 1UJ4A 2HK8A 3AFIA 3T9EA 1X7HA 2OGZA 4G9GA 3UWKA 4QBHA 2XQGA 2UUBB 1ZRMA 1I8TA 1V4BA 1PK8A 1XCBA 3DVAA 3N53A 4HVAA 1F17A 4KWIA 5LBUA 3IODA 3X1MA 5JNVA 2X5NA 2G0AA 1A0OA 1N7JA 1NZJA 1QYVA 1R15A 1Y48E 2OGWA 3A4TA 2B35A 3EEOA 1KI7A 4OBBA 5JH7B 1U7HA 2PJDA 3H8SA 1XRPA 4P4LA 3N2YA 3R5HA 1ZNYA 5ADHA 2ZREA 4IVRA 1ZWLA 3IBTA 3OM9A 5FTKA 1OCEA 1R0ZA 1YK0A 3AIOA 4GYKA 4G0QA 4ZZ2A 3R7LA 2FQ1A 3RH0A 3SDBA 1HEUA 3W6NA 4MVJI 5AHKA 5AVKA 4A2QA 3TIVA 2BW0A 2XMPA 5JH7A 5JD4A 4J91A 5CIQA 4WL0A 2WTXA 1LF5A 5JDIA 2A5YB 3I2YX 2B7BA 2F43B 4G1FA 4KQ2A 3R7WB 1S8NA 1VM6A 3EB9A 4YCLA 3BK1A 4ISBA 1CLEA 1RPAA 1VIVA 1WXQA 3CPSA 4UM5A 1OWOA 2AEMA 1J49A 4CDMA 5SYNA 4UBMA 3REGA 5D2CA 4D6YA 1GKKA 3VZCA 2YVUA 4NBVA 2Q49A 2VP2A 3QPBA 2O2HA 1Z17A 1OAAA 2ZRPA 5EAIA 3KIPA 3TGWA 1UBTS 4KMRA 3QVOA 4KR0A 4O25A 2OD7A 3VJMA 3EIHA 1EFAA 2EU8A 1RYMA 2RDMA 3G02A 3CVWA 3D7RA 1Z13A 3MAAC 5JIBA 1C3LA 3ZDDA 4RZ2A 3P9XA 4MLPA 2DR0A 4ZO4A 4Z1MD 3J81k 1W75A 1NW8A 1DARA 1RPTA 3F7MA 1E99A 1X9GA 3IMGA 4MQMA 2GN9A 4MVYA 3FUXA 3EH2A 3IRVA 3K4QA 1SOAA 2OAGA 2P79A 5CHYA 1NJGA 4DV1B 1ZESA 3Q1LA 4F9EA 1QRRA 2YMQA 1FXWA 1DQPA 1D6SA 2PUDA 1X80A 1FUEA 1K88A 3EDCA 2X19A 2X3YA 1E9VA 4I4TF 1I5EA 4CLEA 1DBRA 1GQYA 1VMDA 3OF5A 4PG4A 5KIAA 4OLFA 3MD0A 4KITB 3K32A 1SD1A 1M7BA 2HMAA 3MC1A 2IDZA 1JG7A 4EG0A 2Y05A 2RB4A 3PQ8A 2OO3A 1DIAA 1VYTA 1GYPA 3CG4A 1B8OA 3EWAA 2TECE 3ETDA 5AK0A 1OLXB 1WVIA 2BISA 2WJGA 3JQDA 2DFKB 4BCDA 4Z5XA 5JJIA 4LK2A 2J0QA 3BGWA 2PA0A 1RRFA 1GZ5A 4Q9HA 1GT91 3DLIA 4MWDA 1TMOA 2ZRFA 3KB1A 3TNFA 1Y34E 4CQMA 2YVKA 5JZ9A 2ZIAA 3PGXA 2YV2A 4YLYA 1CVRA 4QJ5A 1NVTA 5LXTB 3FF4A 2UVQA 4KOEC 1AU9A 4GX0A 4KIUA 1EHCA 3SIRA 2I3GA 4NU0A 4AY3A 3F5QA 4A4DA 4PC7A 2HA5A 4V39A 3RKUA 3A9WA 4E7OA 4TZ6A 1GTRA 1OBOA 1RZUA 1MOPA 3HNPA 4B3BA 5CBKA 5HG0A 5EJ9A 1W0CA 2AKAB 1TTPB 1E6KA 3O0TA 3VAZA 2Y66A 3UHAA 1KVSA 3JZFA 5BV1A 2R68A 2WF7A 3NX4A 5B2EA 2OEPA 2NZJA 4B3RB 1CB0A 3L04A 3NFRA 4U4AA 1UMCB 1I3LA 2ZJ6A 3ORSA 4IJ6A 5EXXA 2NWQA 5BYBA 4UNRA 1DBSA 1S6YA 5FF9A 3D8TA 3N07A 5IN5A 1J8DA 1Z7YA 1WSWA 4JGIA 3H1AA 2IHVA 5DX8A 3V9AA 4MLDA 1KGDA 1WETA 4OIFA 2B94A 1Q7EA 2WYIA 2FETA 3C6KA 2H5IA 4TGLA 3SR3A 1MAVA 4IDAA 4KJZA 4DCMA 2IH5A 4N41A 1NF3A 2VNAA 4YAOA 1LQUA 1I80A 4WNIA 3ZTYA 4BYGA 1BWRA 1YS4A 3GJ5A 4CKWB 1VJDA 3C5VA 5EPEA 3VHQA 5AUOB 2JBWA 3MG9A 5TF0A 3UKDA 4WBXC 3RRFA 1CEYA 5AW8A 5IUNC 3AEUA 1GT6A 3P9PA 4G6ZA 4YEDA 4PXYA 4LRTB 3VH1A 3P9KA 3FDXA 5I7SA 1SR8A 1N2IA 1CUYA 4JZKA 2A9RA 4Y1EA 1FS6A 5CYPA 1A69A 3N87A 4JEUA 3BHIA 4K6FA 2QAGC 3G3EA 3SKXA 3UM9A 4JSTA 2IU3A 5JHHB 5TPZA 1MNAA 2Q6KA 1I5RA 2YWXA 4H4CA 2OZLA 3KKZA 4X91A 6ADHA 2V7BA 3ZY4A 5GV7A 2J7PD 3GWZA 1A5ZA 2Z3ZA 2YMMA 3AJ9A 3H6KA 4LXHA 1S9HA 1VBNA 1Z6PA 3MYYA 4W5OA 2TMYA 4DLVA 2I2DA 2OCAA 4MINA 2G4VA 3EG9B 3I9KA 3M6AA 1IIBA 2WR8A 4YMTA 3AVYA 2PV0A 3ONEA 4O1MA 1PNQA 3HXKA 3Q8KA 4H35A 2EYUA 4LIPD 1PDOA 4JUDX 5EKDA 1F9EA 1Z6XA 3C5CA 2YRFA 3AEXA 3PLAE 2PSDA 2C7GA 4FYHA 4MW0A 5G2OA 2Q1YA 1L8AA 2HYDA 2DWCA 3B53X 2X2FA 2J5QA 3WQQA 2FSFA 4KOAA 2GJ8A 3TIIA 2RGEA 3DOUA 4EYSA 5CLQA 2XKBA 2EKZA 3JQEA 3ROTA 3VHRA 2ZB4A 3GGPA 2VRCA 4XFDA 2FPLA 3VVMA 3ZBQA 3B1FA 16PKA 4B6FA 3ZXSA 4LGYA 3PICA 3CW2A 2V9ZA 3CMMA 1FP4B 1S7GA 2GLTA 3P9RA 4OTZA 1UOPA 2C5SA 3EDYA 2QTWB 1BH6A 1Q21A 2E7ZA 2H1FA 3DS8A 1AKVA 1MG0A 4C01A 5CD9A 4G2TA 3EF1A 2SECE 4JNKA 5G3ZA 2UKDA 1HTWA 3LL4A 4UUMA 4ENRA 3PWKA 2JRCA 3KZNA 4AKTA 5TGTA 1ISGA 2J3QA 3HI6A 1GAEO 1HG0A 3H97A 1WY7A 3UWPA 3C7DB 4HH4A 1Q44A 3L7OA 4BV2A 2CL6X 1LC3A 1UP7A 5TMPA 2JC3A 2GF9A 2Q2QA 2PU5A 3QLUA 2HJRA 3R9WA 1OYWA 2QENA 4ENTA 3P8ZA 4DE5A 5CVDA 3TLGB 4EJFA 1Y89A 2Q8QA 3TOCA 1HNWB 4CR7A 4LRWA 5ICFA 3THWB 1FLNA 2VF2A 4L9SA 4L85A 3GFSA 1QG6A 1CUDA 4GEGA 2NXEA 4LMBA 4ND5A 4AY2A 3IJEB 3ICWA 2WDPA 2ATCA 3QLVC 1TUGA 1PR3A 4OX9Y 1CR6A 1OMOA 3HM9A 1G291 3ZV6A 1OA0A 1Z6AA 3CURA 3DWFA 1NR5A 3L4EA 1KKUA 4ZO8A 2GRJA 3G8DA 3HJFA 1EGHA 5KQMA 4B6JA 1JLKA 5GZ3A 3ZZUA 2ZUCA 5LJLA 1WNTA 3RF6A 4XH9B 2ZW9A 4YJGB 4M0LA 3V1KA 4L73A 3G2PA 2PRJA 2H31A 2J87A 4P86A 2RIRA 8GPBA 2GN8A 1RMQA 3OUZA 4RFVA 1XD2A 1LVHA 1KJZA 1YR2A 3KAJA 4WBNF 2IEBA 3HNOA 3NUGA 3KOWA 4X8HA 2V65A 1Z12A 4OQ4A 4NU6A 3A2KA 5CK4A 1IHUA 2QRMA 2YZMA 1GA1A 4GBGA 4KI7A 4MYSA 4OFBA 4PX3A 2FR0A 1F06A 5HF5A 3Q15C 2F3TA 5C1DA 1EZ1A 2V96A 1RPNA 2HW8A 5J4LA 2OFFA 1KMMA 2Q3LA 5KYXB 2HA2A 5CK5A 1N2HA 4TQ9A 3KJFA 4BNJA 4CFYA 4COOA 1OKKA 3KT0A 5IEBA 4GVPA 4LXTA 1QCDA 4I9UA 1OBCA 3WWCA 3Q1KA 1B93A 1N7GA 1M75A 1LK7A 4X1YA 1C2TA 1K9SA 2VJNA 2L0XA 3NEJA 3TXAA 3V1NA 1NXTA 3WGYA 1ZUNB 3RVRA 4BQQA 3AUKA 2QLJA 2JCVA 4LCBA 3ZDCA 2KJQA 3NS7A 4MYRA 2XBMA 1WB4A 1XWWA 1T2VA 3BQMB 1KSHA 4LSZA 3ZX4A 3ETJA 3ANYB 2JCXA 1P5JA 1HOTA 4WFJA 4NS4A 3DOFA 5DULA 1L1RA 2HV9A 5LWQA 2DSNA 3NM6B 4JGGA 1Q7GA 1Y8AA 3CUVA 4Z9BA 3R9IA 3RRJA 3ZN2A 4CKCB 3GA0A 4URFA 1U6JA 4G0VA 2WV9A 3R9XB 3IUYA 1WXEA 3EZXA 3QVTA 3OJLA 1KMIY 3DDZX 5DIZA 4EJ2A 3A0UA 1CFJA 4PAMA 1L3BA 2FPOA 3L84A 1XAGA 1DC3A 5EN4A 4S12A 3DF9A 4HGOA 4EUFA 4ZAXA 3HKBB 4GM4A 1SXJA 3ROEA 1ZNWA 3AFNA 2WM3A 3O2QB 3BRQA 4L0DA 1C1DA 3KQHA 2ZM6B 4DUYB 4IQ4A 3DLTA 3HYSA 2X7JA 3O9MA 5C8YB 3KEMA 4AQYB 2COKA 2YUTA 4E1VA 4GVLA 4K1LA 3UMJA 3JRWA 3WWPA 2ONYA 1IN1A 1NUPA 2GD2A 1CU1A 3EXAA 1OFVA 4HS9A 5A06A 5JAZA 2I3AA 2R87A 1XAIA 1BCSB 1QAMA 3BMOA 3CF2A 1Z5ZA 1D2GA 3IERA 1XZKA 3V42A 1GLVA 2GSWA 1JMVA 3QOFA 2CXXA 4GLBA 2Q4EA 1ZHOA 4DXHA 3C8ZA 3UJ6A 2GJKA 5B4UA 1MKYA 3WBFA 1R0SA 4KX3A 3LX8A 2FJ0A 1F1BA 5C8YF 2Y1FA 3CLTC 4AMYA 3ECAA 4RZQA 2PPVA 2F3RA 3ZY2A 3O8CA 1OW3B 1Z2NX 1KJ9A 4DLUA 5AKXA 3DKVA 3TL2A 3T4EA 2C59A 1SQSA 3OIDA 4IICA 5I3ZA 4LN1A 3QX3A 3HVRA 2X5OA 3KRTA 4K8OA 1FFXA 1T6NA 4WY2A 5FCDA 4CQMB 5ILGA 5K6TA 1OI2A 1EP9A 1X1RA 2QRJA 1NQVA 3DVRX 4KNWA 2IQIA 2O1XA 4NMHA 3VR2A 2O8BA 5EKXA 5FLXA 3AP2A 4YV1A 1WTAA 3PFHA 1ZBDA 4HAZA 1DKPA 4G56A 2CXNA 3DEHA 3T7AA 4CCYA 1JQEA 4LZJA 3ZKWA 4C1BA 5BQPA 3JVVA 4YGXB 3W77A 4B3JA 2HRCA 5FT9A 4CIXA 4EA7A 5CA0B 2M6LA 4REMA 1XZLA 1R6TA 1RMTA 4AMUA 1WRBA 4C7BA 3VI4B 1RKXA 3AQ4A 1IXKA 3PKJA 3LSTA 4XUCA 4YJHB 4M9RA 4YCMA 2YHUA 4XGRA 1EK1A 1L5HB 3C7KA 2WWVD 2VUUA 1SU6A 2QVBA 4TROA 5DBEX 2G8LA 1RLOA 2D1YA 3CLRD 4LJ7A 2PSHA 1OI4A 4U7TB 4AICA 5LP6C 1FFEA 4PCAA 1K3FA 3U7HB 1RWPA 1Z5GA 2QX4A 3ZCTA 1LWNA 4QKQA 3DMGA 1I0LA 3VPCA 1EK2A 4HMPA 5JC8A 3D1JA 2BGJA 1JKXA 1N8KA 3WSVA 3CF6R 2PBFA 3C3XA 1GJRA 1GPUA 4BVHA 4IHKA 1XA0A 3D4PA 5EUMA 4AJOA 3BH6A 3THSA 3OZAA 1JVSA 3AO0B 1T9GR 3MBOA 3P9QA 5CJJA 3SZOA 2AFHB 5EE9A 3TZHA 4FNAA 2BR4A 3TRHA 4BGDA 5IFLA 1KYXA 2JLAA 1KHTA 4JJFA 3CCFA 2CL0X 1N6IA 4NJMA 5TLSA 3A9UA 4TLEA 3OHPA 3PXXA 3FUCA 3GEGA 3FNFA 4R7ZA 1I7LA 3DFIA 3LBNA 2FSUA 1EUYA 3LPLA 3LOUA 1M1YA 1EP1B 3EF3A 3TL6A 1M6VB 1C1XB 3H2ZA 2C57A 3FPHA 2CB0A 2P5UA 6GPBA 2PWAA 3DEZA 5IJXA 2Z5GA 1HT0A 4L2IB 2FZ5A 2H7VA 4ED9A 1CNMA 3K9WA 4PC2A 3JD0A 4AN1A 4O1IA 1RC1A 2HK7A 5FPSA 3I2IA 1T8YA 2CWWA 5I9NA 3I2HA 3ICOA 4GWGA 4V0RA 3CF0A 3L6RA 4B6PA 1YR3A 3JRNA 1IM8A 4EHIA 2QTBA 2NTNA 4MI9A 5DSZA 4CM3A 5AVQA 3NHLA 3KAQA 1I14A 1CUZA 2AR0A 4YAFA 2IELA 4L1KA 4HEJA 2CVZA 4AWAA 3NONA 4E21A 4EYEA 1Y6FA 4DV2B 3H5OA 3D0RA 1ZW6A 2YVLA 2X2EA 1WUKS 3AR3A 1U0RA 3HUFA 5EKUA 4LISA 3EYAA 2AX4A 1VL2A 2C2ZA 2G07A 1KZ1A 3R5TA 4GYYA 4JVLA 4MAMA 3E7DA 4GAEA 2AJCA 1XDGA 3Q41A 1ZAKA 4Y8VA 3FJ1A 1D2MA 2OM2A 4ZT2A 1HMYA 3STXA 1GPMA 4MIYA 1ZN7A 2Y27A 4XDYA 1XRMA 4IDGA 4R7GA 3H1GA 5JNSA 3W7AA 1CIVA 2W5UA 1KF0A 3MXTA 2AC4A 2H3HA 2OHVA 3PRJA 4DLSA 4RTQA 2XNKA 3OOHA 4KVZA 3P9ZA 5JRDS 4A36A 4LJYA 4BX9A 4ZJZA 2LP4Y 2PGIA 3IQXA 5T4FA 4LBZA 5G40A 3THXA 2ZP1A 2OHIA 3ROMA 3FLBA 4KVAA 3W8NA 4F1JA 3C6MA 3H8WA 1A2KC 4YUYA 4OJQA 5IARA 1BGVA 3OQHA 2KLBA 4V3BA 3A3KA 4BQRA 1QBGA 5LQKA 1UPFA 2QD5A 2CXTA 2Q2VA 3IJ5A 1JIJA 4MH0R 5GJWC 3GNSA 5C34B 2VAXA 3ED1A 5DKFA 1Z39A 3HUDA 5BPHA 2HJHA 1R0KA 1L7NA 1MR3F 2OFOA 2WWWA 4DSUA 3ZVNA 2IS1A 2XTZA 5D7NA 5FUMA 3R4CA 4YIKA 3RBVA 1CR0A 1TW3A 5KKAA 1GDHA 3AT1A 2HF9A 1JR3D 3W2GA 2M6RA 3IP8A 3H3JA 1TA4A 4OLAA 3TVYA 4RS4A 4P0TA 4EG5A 1KI9A 2I76A 1RAFA 2IYRA 4EO7A 1WMFA 4EG4A 1NC3A 4DDKA 2AOXA 5IDYA 5TS2A 3SFZA 4EGQA 5HQTA 4OLBA 4J75A 3VR4H 4YRTA 1ECPA 4QXQA 1J1ZA 2FPRA 3L1IA 3WLSA 3MGKA 2IYXA 4R8KA 2I78A 1P2DA 4HOYA 5ARBA 3QV1A 2BR5A 2N9UA 2PQ0A 2UZ0A 1T0JB 1X7YB 2YXNA 3LCCA 1BXKA 4RGQA 3HCRA 2O8CA 4ZWNA 1J99A 3OG9A 2W58A 2Z95A 3O47A 1CQIB 1N0WA 4NFLA 4RH0A 4EG3A 4BLUA 4DEXA 4GT1A 1UP6A 1V5WA 3IILA 3K8QA 2XRMA 3AF6A 1Z6QA 1BCRA 2WPDA 2WMDA 1NMSA 4DC9A 5EWJB 1Q16A 2ZIXB 1K6XA 1F8GA 3BGOS 3EFHA 3KL4A 3DJYA 3N6RA 1DV1A 3QXCA 3UJ9A 3ZLVA 1DWQA 1XLTA 2EFHB 1UQRA 1ORIA 1X1DA 4HWSA 4DNQA 4KZPA 3EBOA 1P45A 1UDBA 2F6RA 2CHUA 2PUWA 3R23A 4M9UA 1XYGA 1CV2A 2VPWA 3M6MD 5EKTA 5G0VA 1N8NA 1X2BA 1K86A 1WPRA 1LH0A 5EIXA 4A3SA 3HZHA 3LY7A 2VRBA 3BIJA 4MDEA 1UF9A 3DOIA 1JHXA 2YJ4A 1PUJA 1T8UA 1TJPB 1W8IA 1OTYA 5DV9A 1A5BB 1H05A 4M54A 1CIPA 3GEBA 5EWMB 5L7YA 3ANLA 5SY6A 5HQ3A 4IMRA 4QJBA 4DN6A 1KK0A 1LU9A 4I50F 4MUMA 4V0QA 2QAGA 2HPAA 3H5RA 1F8XA 2G6BA 2OCGA 3BEOA 3NRJA 3PXDA 4Z99A 4E33A 4JR1A 1ZHFA 4DQ0A 2EFJA 1BMQA 1LQ2A 1XVAA 2WIBA 5HZGA 3D81A 1QQ7A 3VDMA 4PS0A 4D6XA 3BWVA 5TS3A 2EP7A 2HBZA 2CLHB 1GTJ1 2JHAA 4KO1S 4NMWA 4XE5A 1BXZA 3QE2A 3NEAA 4DVJA 4DC0A 5KTTA 1LLFA 4HAVA 4LGCA 1FU7A 1CXZA 1HT1E 2RGXA 2UZ1A 2XDQB 4F86A 5HIKA 3TMYA 3K30A 1GAXA 4UCWA 3L4KA 2JLQA 4ZK6A 5DU2A 3UW1A 2XWPA 3L18A 1P2GA 3ZCSA 3K6SB 4LDZA 1I10A 4J1TC 2RCYA 4LHEA 2HBRA 4H7FA 1A2QA 2FSHA 2JI8A 3SNHA 5AVVA 2JI7A 5FFMA 1G3QA 5DTRA 5CXQA 5JZSA 3F67A 2HO4A 1IPHA 3K9HA 2FDCA 2VP6A 4HR7A 1SD2A 4YRPA 1PZXA 2R4QA 3KKOA 4H7JA 2MINB 4KQIA 5IPFA 4YJ2B 3NIFB 1SZDA 4EHHA 4LWQA 4KXWA 1VHQA 3B9RA 1ZINA 2VYFA 1QMPA 1T4MA 4ZU6X 1OYYA 2BI4A 4OXXA 1D9ZA 4C5CA 3LDHA 1VLLA 4O2BF 3O3NB 4GF5A 1Z4OA 4CHTA 1E2JA 1I3KA 3CWZA 1KGSA 3HDYA 4PEVA 1U7DA 1X87A 4W6QA 1I5OA 3A3PA 1PKXA 4DG8A 1UKZA 1ML4A 2VF8A 5ALKA 5B3LA 4IZIA 3WDLA 3WICA 5JVDA 4C88A 1ZCFA 3TQHA 1E4EA 1V2GA 2DMRA 1IZ8A 2VSOA 2EERA 4S1TA 3SQNA 3T9FA 1M5UA 4I3HA 3PUHA 1XXHB 3BILA 4J94A 1QKJA 3IGFA 4MJ3A 4HNTA 5AVTA 3EW7A 3E2PA 1Y33E 5C8XA 3PHBE 1AS2A 3B3FA 4G5XA 4WRRA 4CF5A 3BWDD 8ABPA 1XPUA 1Y98A 1LZKA 2X23A 1L4FA 4NYIR 1YL7A 3ZBUA 3OPYB 5JDCA 4KIGA 2JH9A 1SRQA 1IN7A 4PX2A 5KQGA 1C3VA 1GLGA 4GVXA 3P0HA 6ABPA 2D3WA 4E3ZA 3LF1A 1OT3A 3IEKA 4LOLA 4N18A 5FR2A 4EGFA 5U4XA 5HWSA 1G5FA 1HSZA 5L4LA 1P44A 2QD3A 3OEEA 2XQIA 1F6BA 2QPOA 2YN0A 3RREA 1CZUA 3WC4A 1XXHE 1YZYA 3FOZA 4LEIA 2XMZA 3PJFA 4RCZA 3H2JA 4X61A 1DBVO 1JDTA 4I50A 5G53C 1VB3A 2ZAOA 3I5XA 4A27A 2D0IA 2VYND 4EDFA 1N2CB 3BICA 5KOHB 3C1TA 3DL7A 2WSLA 4FW9A 4UTVA 2I7XA 2QZSA 3COVA 5HGXA 2ZB2A 1UKVY 2JHFA 4QXOA 1GV0A 3ODGA 2IK8A 4URHA 1U1EA 5D86A 4G23A 4RF3A 1E2IA 2X6RA 4FLFA 4FONA 4EY7A 2PWBA 3R76A 1Z0IA 1FYWA 2C9BA 3HWX1 2W7TA 2JKZA 3NETA 4C89A 4ZHQB 3ZK9A 3ZYZA 4G4IA 4AZ3A 1B73A 2JI9A 5DNWA 5A4IS 1FSGA 3DFMA 4LF8B 4WPGA 4NVRA 2EJWA 2JJQA 1DAGA 5FBZA 3UAXA 3OKCA 1AQJA 1Y3CE 4KYVA 3MUOA 4V1CA 4H0CA 4L28A 4AVYA 3LL7A 1P72A 4DZZA 2OXCA 1BX3A 2JFHA 1EFRA 3G2MA 1P3Y1 4ZOEA 2BMFA 2ASEA 2DLCX 3IIIA 1J0BA 2W2TA 4BNDA 4JQSA 4KPEC 4DBLC 1WMEA 3KBBA 4DADA 1PLKA 3TI7A 5DN6D 3Q8MA 2QVGA 3HACA 4MWTA 4UBKA 421PA 5FBHA 5BW8A 1VKRA 1QRUA 2EL9A 2VTVA 2EF1A 2J08A 4JHLA 5F1YA 1TT5B 5DHPA 4ERNA 1I7QB 3QVGA 3JQ9C 1RE1A 3WTBA 3O92A 1R4ZA 1TQDA 2OCLA 4FLEA 3RNLA 1MHTA 2JLCA 5DGDA 2R6AA 4TUYA 2BFBB 2ZUSA 3FROA 1YQ9A 3CX6A 4EIWA 3TAXA 2X8LA 1QLWA 2V45A 1ZGAA 1CYDA 3E15A 3UMCA 1CY2A 1Q0ZA 3V4ZA 1Q7BA 2GA8A 3GU3A 4NL4H 1E2BA 2FK8A 2X9GA 2CUZA 3H4IA 3KB6A 4KN5A 2WHYA 3UXHA 3HYNA 4A2PA 4RX1A 1YFLA 2C2OA 4CMCA 4HNGA 5IJWA 5JT1A 3TBHA 2Y3IA 2B8JA 4BTVA 3L1UA 4L4XA 1JWBB 4AN4A 1HO3A 4QULA 3ZBTA 4RSMA 3SS9X 3WLMA 3KTOA 4IKOA 2PD4A 2PYZA 1SH7A 3IO5A 3RRYA 5IC6A 1QB7A 3G2HA 1V7PC 2WVJA 3ZUGA 1Z62A 1Z7WA 3C16C 3UGJA 1R5NA 2ZIEA 3J7TA 4J0KA 4WKCA 1I33A 3N0XA 3S1AA 1DG3A 1BMFA 2AL7A 2D5BA 2CXSA 1H1DA 5DNUA 4P58A 5TARA 2TMKA 2MU1A 2PQ6A 1RJWA 3I01A 4Q4AB 4E5PA 2XNDA 1Q7TA 5A3VA 3ZLUA 4L5CA 4FHEA 4EL0A 5JQWA 1NTOA 1X0XA 3JQPA 4RA6B 1KSFX 4TMFA 5AK5A 1M7GA 1C9JA 1ZGBA 2IKQA 2RHMA 1VB5A 4HK4A 1CDZA 1UJ2A 1I4TD 4FYPA 1ZMTA 5J2UB 5ALXA 1E6LA 3HL4A 4X1KA 2OHHA 5CG2A 2J9GA 1ESEA 4ER6A 3OCZA 4YRJA 1UPXA 2BUBA 2ZIUB 3AHCA 3LX5A 1EXMA 1Y4AE 5EINA 2J3JA 3AESA 5ILOA 2O1SA 3UPDA 3COZA 4I6EA 1M34E 1FNDA 2C3OA 4I0WB 4ZVNA 4PBSA 1BH2A 5FOQA 2VPZA 1JKFA 1C5KA 2XOKD 3S28A 1VZ3A 1UZUA 1MV5A 1DT3A 1SBQA 1UFVA 1Z5VA 3TXYA 3U4AA 1IONA 2HSEA 4RETA 1UDXA 3ISVA 3NPMA 3QUAA 4OXQA 4P35A 4TL9A 4WN3A 4AO6A 1FVHA 2QNBA 3TMAA 4D4HA 3CV3A 3HP7A 1JDNA 1EPUA 2ZIFA 2JJ1A 2WJHA 1D09A 1T2AA 3DTVD 3IESA 2GXSA 2A9JA 3OJOA 4OA8A 1DQZA 4H0NA 4J3NA 3RUPA 4BECA 4F72A 2FUG6 1VL1A 1WVGA 5HFAA 5KTYA 1Q1EA 1C7IA 5ADUS 5IWAB 1H2RS 2VT3A 2HREA 3LUHA 5A1JA 2NVWA 5K4HA 3OFND 1IHDA 3O6VA 3D8HA 4ILEA 1NBWB 1TJYA 2JBAA 2JHGA 4EA9A 5LZ4A 3W5IA 3FUUA 3QXXA 2CDRA 4Z9XA 3UB4A 3EN0A 3BD8A 3QM1A 4WCFA 4QT0A 3ZDBA 4L8GA 4DRYA 3CYFA 4JYMA 2HQ1A 3O8OA 1VXRA 4MWGA 2IEZA 4NY1A 5E3IA 4MGYR 5IM4A 3FVQA 2DT5A 1R3UA 5JSKA 1P2SA 3CZ5A 1WKVA 3KJEA 2E89A 1KDZA 3T15A 5P21A 4NNJA 1TYEB 2PLAA 4B5LA 1XTVA 1VP3A 1YMUA 1G20A 1KIFA 2AHRA 1OI3A 4BRZA 4FB4A 7MDHA 3LPNA 1CUJA 1JJIA 2W70A 3R0ZA 4IHAA 1GU0A 4QPZA 5BN5A 1F2TA 3T3IA 3A3NA 1KSGA 4QO7A 2JASA 3PC7A 3PS9A 3WQHA 1EUCA 1PZEA 1J1UA 4BB9A 2YYAA 3PD1A 1J21A 4DLBA 4QFDA 2Q6VA 1R0BA 4F9FA 5I7OA 3EPKA 5DXAA 1ZRNA 3VJKA 3CH4B 3JZAA 2X0JA 3KVOA 1J22A 4RV9A 1AKTA 2AOUB 1YHZA 3OFKA 3W2TA 1SIBE 2PVSA 1IM5A 3I0ZA 2G88A 4NH4A 1SQGA 4TYMA 3K9BA 4EY3A 4R9VA 4LVCA 4O3MA 4UASA 1APBA 1PJQA 5ALVA 4Z0TA 2BEVB 3HB1A 2J4CA 1O94C 3HHEA 4JSRA 1XLVA 2I55A 4QOHA 3TE6A 1QPZA 3IQHX 3CKLA 1WL8A 5COQA 4E4RA 3S2EA 2AJDA 2BKAA 3GZNB 3R24A 2UAGA 5IABA 3GPLA 1ITZA 4A92A 4EFDA 2PUJA 3BFXA 4F0JA 3K8ZA 3R6WA 4KAXA 3UUGA 5F7JA 4B4VA 1FJ2A 4PTLA 4U2GA 5M7EA 1YOVB 4K6KA 5LMUB 5FUBA 5MFZA 4ZCSA 3P19A 1I7SB 4UNIA 3RRBA 2PL3A 4XVQA 1QTIA 3I04M 4BBPA 4G5OA 5IXYA 1BQEA 1L8XA 3VVBA 2NTVA 1CZLA 5BURA 5HTOA 3UIEA 2H9AA 2P9BA 2IUUA 3WFIA 4GPD1 4JMPA 2MYPA 1M54A 4Z2AA 3HWSA 4HDCA 4B6GA 2EW8A 2VDVE 4DARA 1GL3A 1P3DA 1DKRA 1HTTA 1H42A 2VHEA 2X0IA 1IRIA 2ZXEA 3OECA 3SZ3A 2VXOA 3G9QA 1BEZA 4PTYA 2AFIB 4B5KA 5BRJA 2FJPA 1YMQA 1F2UB 1MPTA 1RLUA 3IO3A 3NALA 2X77A 3EVTA 4FCVA 4Z0NA 3WYCA 2ZZKA 2RHWA 2VUSA 1MQAA 4Y2HA 4YH1A 2F8SA 4KCGA 2J30A 3GIDA 3LWBA 4HWGA 1TM1E 1PS0A 2QMOA 3JV7A 4OKIA 4LF7B 4QZVA 4AX8A 3FMIA 2ZAYA 3L1HA 4BV9A 5BWLA 3UAGA 3HKCB 4UHKA 1N2ZA 4Q4HA 1Y8QA 4I4NA 2WHQA 2LKCA 2X5KO 5EJEA 2AFVA 2IF0A 3EXHA 1TAHA 4EYQA 5DTMA 4ZCRA 2QZ4A 1IMJA 4Z53A 2QPAA 5I7EA 5JFGA 4KIWA 3LWZA 5BW5A 4RM2A 3UXYA 4DM3A 1YQDA 1ZD4A 4QHTA 2HK9A 4TZTA 1ESDA 2XYGA 4LJ4A 4N0QA 2XWSA 3B5EA 4TS3A 7MHTA 1WHSA 5KWEA 3PI6A 1B7GO 2ES4A 3CJTA 4TTRA 4PC3A 5J58A 5KVVA 1V2HE 3AI7A 1YUBA 1Z5OA 4IZOA 1E3WB 2J6IA 3OZTA 4KWHA 4MPJA 4DR4B 2JGDA 1ONBA 2V7QD 4Q7MB 1R6VA 3DYVA 1Q2UA 2VDKB 3L6EA 1RM4A 1SB9A 3BF7A 3FBGA 4P4NA 3VYUB 5AM3A 1XPJA 3HYRA 3OQPA 2VEOA 3LUGA 4FW8A 3BVPA 1EINA 1COWD 1E2UA 3AMVA 4JHXA 4WOJA 3UJHA 1P8AA 3VDXA 1HDZA 4EFNA 2TMDA 3DXYA 3WJ1A 5GZ6A 4MVJE 4D0NA 3LOQA 2RKBA 3WX0A 1QAQA 1IZZA 2G9QA 3IUEA 3MS7A 4N54A 1KO1A 4PLVA 2EGGA 4BV3A 5IXJA 2N1BA 5LLDA 3A4LA 2VBIA 4RY0A 3DYIA 3GGCA 1A7KA 4RY8A 1Q5PA 1VRCA 1PQ4A 1XMPA 3W7VA 1PI3A 4G0PA 2JJ2D 1P9OA 5C51B 5KO2A 1SMKA 3IB6A 4I8XA 1C9MA 5EI5A 1JMYA 2XT6A 2NUPA 2FOIA 2RHBA 3E2MA 3HA5A 2XYPA 1E3QA 4C4AA 3O7WA 2WHPA 3EEIA 3NTOA 1A95A 4OY3A 3L6BA 3WISA 4DHEA 5IZCA 2JZNA 4NZNA 4TMKA 3EARA 5KJEA 4M8LA 1E7QA 1F8FA 4J0HA 5GGXA 4QXPA 5CB8A 1NRXA 1R7RA 1P2BA 1T0UA 3H2IA 3RR2A 3RV4A 1TL7C 3TX2A 2BKLA 4R6XA 4YPFA 1PNOA 3CX8A 3O4FA 1CK4A 4B9EA 4NE7A 1V48A 2DKNA 2PL9A 4W7IA 2ZATA 1MVLA 1ZD3A 2O3RA 3K5HA 5JZOA 5LNK1 1XDUA 3SVTA 2VJPA 3ANSA 1OFTA 3MUNA 1OXKB 1THMA 2J46A 3F47A 3NHSA 3VSEA 3UXEA 4DLAA 1G21A 1H8EA 3D5TA 2C1XA 4MKRA 3BFVA 1AX9A 2ZYHA 3GLRA 2MYNA 4KZKA 1NVDA 1VCOA 2Q0XA 1DAOA 1MO3A 1KQNA 1OAOC 2BEWA 5LJIA 4RTOA 3LBYA 2WJVA 5THQA 1C41A 2ZRHA 2AJ8A 3GFPA 5ALGA 3M6XA 4OEHA 2CUKA 1OXXK 1SUBA 1ZM7A 5EYPA 3VQTA 3R7AA 1R5JA 4I1PA 1RMYA 4DDMA 3CINA 3S8EA 4YFVA 3MZ0A 1UMBB 3U4IA 3HR8A 2OV4A 2XIJA 1P0IA 1KZ6A 1YGYA 2IPMA 2NXCA 2QMZA 3OT1A 4KMOA 4QGAA 4ENPA 5LQAA 4W8HA 4ZD6A 3HEAA 3H2HA 3B6EA 1GNTA 3UK2A 4R41A 1HV8A 4QDZA 5C7YA 5C8ZA 1TA9A 1SOWA 3FTNA 5CNJA 2XNDD 4QYIA 1JAIA 1SEPA 2A7XA 3IOEA 3UTDA 3VVCA 1D2RA 2I22A 5FOSA 2GZMA 3WRYC 3QQPA 3HADA 3ACDA 3Q12A 4H0FA 4FFWA 1OX4A 3RS5A 1DJQA 3GOHA 4WD3A 2HO5A 1W5BA 1KP3A 2BCEA 1MENA 1ODIA 2RI0A 5LYJA 1LK5A 1WABA 4CI9A 5J5CA 1YZKA 1TQHA 1X74A 1E1LA 3NOQA 4DG9A 2EKDA 5JD5A 3HU1A 1II8B 5KB3A 4B46A 1L5OA 5G0WA 4BVAA 3KYJB 2GZSA 3LT5A 1DRJA 3DHWC 3RIGA 4AAYA 3DT6A 3LLVA 4B8ZA 1WCIB 1L4BA 2K4MA 1IQRA 1JL3A 3BKXA 3NRBA 4TRJA 4Y30A 4ARBA 5AI9A 4X0EA 3VOTA 1FA9A 3AR8A 4L8WB 1BHSA 1T1RA 2FZ4A 5JW6A 4DWOA 2FG7C 4WK6A 1O54A 2OM6A 2FH5B 1GDTA 1PL7A 1XN4A 1M2OB 4OFXA 2ZDQA 3FCYA 4M8IA 2MYUA 4CL2A 4EMBA 3K0CA 1O4VA 4B85A 4RK4A 1H2BA 3WOVA 5J59A 4QOFA 1R64A 3OLQA 2F8LA 4UTPA 1TD9A 1Y7HA 2BEUA 3HV2A 2FPIB 2VUHB 5GIOE 1B41A 4QDKA 3NBKA 1MOZA 1T6XA 3NJ4A 1CDEA 5CURA 1TK2A 2XB4A 1L5ZA 4INOA 2JFNA 4KBYA 2AD5A 2HT6A 2NV2B 2PKCA 4CV3A 1MMFB 4YAGA 3TB6A 1QS0B 2Y4OA 5CIWA 1BVRA 1Y82A 3PTLA 3TTXA 4DQXA 2F3PA 4GPBA 4K81B 1EU1A 4C0AC 2O48X 2LNDA 2W8ZA 3CONA 5IAEA 3R8XA 4OMCA 5H02A 3QH4A 4OL0A 4CMHA 3K0AA 4G37A 3ITEA 4R69A 5ALZA 1L0BA 4FEAA 3ROFA 4F84A 4UREA 2RHCA 2J4DA 1ZH8A 3FKJA 1QHYA 3L06A 5I8ZA 4DV0B 2YRXA 3D0OA 4K6GA 1LDBA 1K7FB 2QLLA 1P17A 3P0EA 3UMYA 3IBCA 1RQPA 2OR3A 3ZXIA 2NAPA 1T0IA 5BVGB 1FBNA 4CIAA 4YV0A 4FDMA 4HH0A 3PEYA 4NDAA 1XE3A 1JR4A 2XBLA 3AERB 1MZPA 2QG4A 4RXTA 1L8OA 1T29A 4MJXA 2IV3A 3ORYA 2Y0PA 3WV4A 1YRHA 3IE0A 3SX2A 2OXEA 5EGSA 2VTEA 2ZR0A 3HB4X 3PFBA 2V8BA 2RH5A 2ZKLA 1OFUX 3LDUA 3O2JA 4C0LA 5LD2C 1ISMA 4UE3S 1L4LA 5BMOA 4OB8A 3D6TB 3SJUA 3U39A 1GXSA 3K9NA 3DZCA 2W4IA 4XWYA 1DBWA 1O96B 5DGTA 2XHEA 3FG9A 4KUHA 4JYBA 3DKIA 5LUBA 4CF3A 1XL0A 2BKVA 3NYRA 4PQGA 3TRDA 4DLYA 4IQFA 3ST7A 2SCUA 3IT1A 2WUEA 1H0RA 2WWFA 2ZUVA 2CHGA 3L7MA 1CG6A 3MBIA 4YBZA 1Z6GA 1K06A 2RSLA 3LQ1A 4PZDA 3AGPA 3NBMA 4FJ0A 1TADA 3ELWA 3GDFA 3QVVA 5EEGA 2BFCA 5BSMA 3AF2A 4MR8A 3ZHBA 2GZHA 2H5EA 3FMPB 3IP3A 2C4KA 1Z2DA 3HU2A 4YMIA 3RSLA 3QNWA 2VWPA 4MRMA 5HJ5A 4L8FA 1SHTX 4KXQA 4DQUA 5M04A 1O8CA 4GXRA 2EOAA 3A1NA 3HVHA 4FHCA 3RC1A 1W6RA 1J1IA 1CVIA 4OOFA 1R0LA 5FBVB 2WBLC 2JGAA 2FPKA 5FJJA 5BN3B 4V0NA 1FTQA 3MINB 4KK4A 1P33A 2FYTA 1DDIA 3MBKA 1T10A 1FY2A 1O95A 4ZEWA 2NU8B 4B4UA 1WHTA 5KC8A 2MHCA 1C3OA 3K2BA 4BFWA 1MFPA 4PCLA 4EW6A 1FYEA 1R66A 2RCNA 1UFOA 1LCIA 3PITA 4NCJA 1Q0SA 2I6TA 4Z6KA 2W22A 2WOOA 3PIDA 5AO9A 3MJEA 2WHRA 2EEPA 3OPMA 5EJAA 1HDEA 2EQBA 3AM5A 3C6QA 2QZPA 3B6ZA 3K1ZA 3IP6A 4PG6A 2IF2A 2J9FB 4UU0A 1YAJA 1QOZA 1YR6A 4I4LA 1E3IA 5A0TA 1E69A 1NGSA 5TQ0B 4G0UA 5HF9A 3ID6C 3DEKA 5HKAA 1S2DA 2EKPA 3UH0A 4HLUA 1U2SA 2I1LA 4ALKA 1QX4A 4XKJA 2A0YA 4TN5A 2C83A 2OG1A 1CHDA 2BF7A 1QO0D 1JYEA 2C4TA 3KEQA 3HVJA 2ZIGA 4MUBA 1SVMA 3BE4A 3P97A 3RU7A 3VUFA 4ZYYA 2XYQA 4ID3A 1M10A 3G82C 3RFCA 1JZTA 2H29A 1O6BA 5HJ2A 3TDKA 1HY3A 3ZCRA 3LTNC 2H1LA 3GUYA 4HNAA 3MGBA 4CM9D 1R8YA 1EYZA 1WEKA 2DUWA 1Y5NA 3B2NA 3Q98A 4I4CA 2B6HA 1KK3A 5FP0A 4B48A 3AUSA 4M0MA 3QVUA 1ZHHA 1P4RA 5K5EA 4YJFA 5EZYA 4M86A 3SBDA 2F8MA 4FFNA 2G82A 1AK1A 2DCUA 4X00A 2NPFA 1TMGE 4EB3A 2YH2A 4ZFNA 1Q7CA 2C7QA 2O8NA 5JLJA 3JD4A 3KU4A 2EG5A 3AJDA 3E0QA 5IDQA 3NYIA 3GZJA 4LI0A 1QFJA 5C5EA 4EI2A 3KEOA 4TLLB 5BN4B 4KAJA 1FUYB 3SQLA 2BGMA 1JFRA 1IFXA 1UDWA 2BBTA 5CEFA 1CC1S 3HDHA 4MB6A 1EHYA 1P4JA 1Q6ZA 2VF5X 4ND7A 2W6NA 1W0JD 1T25A 2JDID 2V6MA 3DL2A 4DQLA 4PGMA 5EWLA 1Y6RA 2G1KA 2ZSEA 5AH0A 2CV0A 1LRKA 4PZUA 4YT4A 3I8OA 4UUNA 1JDVA 3C15C 5IU6A 1T5IA 2FZLA 3QMMA 1FB5A 3B1JA 1RDFA 4HPJB 1W88A 3AG6A 4MGKR 4BO7A 1JXAA 4QU9A 2A86A 4Y0NA 3TTWA 3RJTA 3FFWA 4G1BA 1KBQA 1X1QA 4KMMA 5I8PA 1TF7A 3G1TA 4G1CA 1E9SA 1YCDA 3NV9A 2O8FA 3GMTA 4TKVA 3AK4A 4YT5A 1W93A 4B4KA 4ZYLA 2Q99A 4X60A 1IBKB 4HEQA 3JQ6A 5IWCA 3SS7X 5FPKA 1EGQA 1PIWA 1QFXA 1H2HA 1NPYA 1U0GA 1V11B 2XVXA 3E3NA 3KHKA 1E5XA 2ZYSA 1SXGA 2AW3A 2QSJA 4N5LA 2A0XA 1WDMA 1Z8NA 2RJNA 1PX0A 1JQDA 2VJQA 1UXKA 2AUTA 4P5EA 4Y9TA 3UKJA 3AJRA 5BV8A 1GTSA 1CR1A 4TV8F 3SJ7A 3G0IA 3KTDA 1DS6A 2QZ9A 3KOYA 4JJ8A 3KE9A 4KSBA 2BGWA 5DNEA 3D9QX 5DOVA 2PKXA 1IHXA 2PBLA 1T1SA 2Z08A 5CM2Z 2HA3A 3AEZA 3E4CA 3ET4A 2QN6A 3ILVA 3JTMA 3K72B 1BGXT 1VA4A 4H17A 1E1CA 4HAYA 4UTXA 1YB2A 5IAOA 2DHCA 2GRUA 3MD9A 1LI4A 1E77A 5IBPA 4UU7A 3KQOA 1XA4A 4QVIA 4RJTA 2WAMA 1JEYA 2BH9A 2F1JA 3VUEA 2C4NA 1U94A 3I1IA 2PVCA 5L4SA 1J23A 1BGWA 4KQGA 2R25B 1XD9A 2AEFA 1WB5A 3HU5A 4Q1FA 1WEHA 2B92A 1ND5A 3SEZA 1XTKA 1PT8A 3LQ2A 3PFGA 5FUYA 3RTDA 1BW9A 1AQLA 1JIKA 1GFIA 2BZ0A 2NLOA 1N77A 3D64A 1SBNE 2JFPA 4JI2B 3TSAA 3FNIA 1I6LA 2P4SA 1LA2A 2NU9A 3RRXA 2QI9F 3B9BA 5L3RA 4KREA 1JWLA 1NXQA 2R8ZA 3GHHA 3SYTA 3UHOA 4PZAA 1LPNA 3IALA 4DUPA 1NMXA 1K7YA 3F90A 4ZDIA 4EMUA 4L8LA 1CJBA 1ZA2A 2PUTA 5K0ZA 4D26A 5F78A 2IPXA 2FX3A 3O8RA 3ZWNA 5C3MA 1KFCB 1SQ6A 1AC5A 2CVPA 2P2YA 3E8XA 1ARZA 3EEQA 1V96A 2WTNA 4DFDA 5I9TA 4DNPA 2ZBVA 3MS4A 2PO5A 2ODWA 3C5EA 1YDWA 2ISSD 4KUGA 2WB2A 1E2FA 3EVAA 1E98A 1FDTA 1YUNA 3VHXA 4UATA 3J7AC 1FMLA 1CF9A 1WZIA 1NE7A 3Q3VA 3GQBA 2ZJ8A 2A1UA 3BTSA 3CNBA 3TD6A 1GPKA 2WM9B 4PRYA 4RBNA 3E1KA 3VR5H 5JNLA 1OXTA 3ZJTA 4J16A 3ZHZA 4JOBA 4RD4A 1HA3A 4YDQA 3HKDB 4LOHA 2VQ3A 3CR3C 4JX9A 3IV9A 5CPBA 4JP5A 5DF1A 3E1GA 1YBHA 7AT1A 2AG5A 1EWVA 1WKBA 2G04A 1XHEA 2H4WA 5DM4A 2VF4X 1KAGA 4MAFA 4YMHA 1U0HC 2WLTA 3LVQE 4GWKA 4MVXA 1FU8A 4XWTA 3H5AA 3BM5A 1X8XA 4M36A 3BL5A 3WB2A 2A8YA 2ZRMA 3KCQA 1Y3AA 3WAKA 3DWIA 4HDQB 3E1SA 4XOUA 4TKUA 1TRHA 4XYEA 2MIIA 4CQLB 2AZ4A 3Q7RA 3BF8A 4QUIA 1TF2A 4OD0A 3TLBA 3P9YA 2XUKA 1E4OA 1QDUA 1YE8A 2CYAA 3HZOA 1E6CA 2ALJA 4JBGA 3SFVA 4C7JA 2XMRA 4HTAA 4YO7A 3OLWA 1I36A 3L2OB 3MYRA 4LJ9A 1RC0A 1LW6E 1DEOA 3Q8WA 4OXKA 3GJYA 3LA6A 3T12A 3TG8A 1JG2A 2PZFA 3J81A 1XKXA 5EIBD 1E59A 4DMHA 1WE2A 2COUA 1LFAA 2NT3A 4ALNA 1HQCA 3FTDA 5AJVB 2NPOA 2J8ZA 4YVFA 2CHFA 3GL9A 4G5FA 3TQSA 4FT2A 2D8MA 3ZJ5A 2PGNA 5AHOA 2REXB 3Q6MA 3PRKE 2R66A 1GNSA 4E30A 2YVAA 1JVNA 2EQAA 1JQ3A 1J2JA 1OROA 5ESXA 4V02A 1Z3CA 4XWAA 2HXSA 5DNAA 1WOYA 3EZLA 2PNFA 4ZVRA 2A1TS 5E7JA 4K86A 3DZHA 5SZIA 4ENSA 2BFFB 4OO3A 2JFOA 1GPJA 2YJ6A 4WACA 3H6GA 4GOLD 1FSSA 4J7CA 1WZUA 3COWA 2V3WA 1UPCA 2JVJA 3C3EA 1PG2A 4DJDC 1JJVA 5GONF 1NOKA 2B61A 2R5WA 4YMLA 3IEUA 1YKGA 5B1SA 3JD1A 4AJNA 3DG9A 4XUGB 1QHHB 2BGNA 3RYFA 2BV3A 5HFJA 4O2AF 5GJBA 2OP1A 5I7FA 2R86A 3WGMA 3BJMA 3WZ2A 4DCUA 3I58A 3MAGA 1FVFA 1HEYA 3BZUA 1YJBA 3I39X 2GF2A 1ZQ9A 2ZBEA 2HA0A 3OCXA 2F1KA 2HLHA 4KQJA 1Q77A 4OQZA 4ADSG 2DOKA 4I1VA 3U81A 5E2BA 4Q66C 5GONB 3TLKA 4N6GA 2Y2VA 4BWFB 4DR1B 2BFEB 3INTA 4KDFA 3ZOZA 3EY4A 4M1ZA 2YOHA 5J1TB 4YYZA 2BWJA 1RCFA 2CXOA 3GPCA 4EFMA 1MA0A 3O4RA 4UHDA 2G4CA 2YDXA 5F7ZA 4CDRA 4NYMQ 4QOGA 1ZUIA 4QREA 1PR9A 1O0BA 3IAM6 4ZGWA 3O84A 2DB3A 4P3NA 1GFZA 3I2KA 1LSSA 4ARSA 2CLKB 1JEDA 1P19A 1UJ5A 2DF8A 3CO0S 4MRSA 1U7UA 4RVUA 3BHNA 5BNTA 1IXRC 1ECGA 1VHLA 1ZGGA 3CB4A 4J8PA 2OORA 1LC0A 3UJBA 3ZD7A 3RS9A 3AM4A 3T7SA 4RVHA 4XQEA 4BHTA 1KJIA 1JPVA 3H8VA 1QIKA 5AIAA 2V6JA 2C42A 1WU7A 2DCMA 3FXAA 2AI3A 4KO4S 1AK2A 1ZK4A 2WNIA 2P2LA 4H3SA 2OHJA 5AJYA 4DBZA 5I9IA 4ZANA 1SBIA 3OZCA 3AJEA 1H5QA 4X44A 3PXGA 2ZI7A 4C4OA 3EWIA 1Z4PX 1AHHA 2BM0A 3STTA 3UCXA 2BTEA 4AULA 1QR2A 4ZO9A 2R6R1 5IUKC 4QG7A 1SXIA 3M4ZA 621PA 2JJYA 3CLHA 1YI1A 5AWFC 4G8JA 4HSGA 4K9MA 2WSIA 3PVSA 4IKEA 2NSLA 521PA 3Q2OA 3UBMA 3V4PB 4GX1A 4EG1A 4BS9A 2Q8PA 2FRXA 4KN9S 5EMKA 2JLVA 3OAAD 1Z74A 3PG5A 3DLCA 1IBLB 1PSWA 1W44A 1H1TA 4TWAA 4ENWA 4Z4IA 4OAPA 2WAOA 3MERA 5I7VA 5AW4A 2E4WA 3SEFA 2HSZA 4JL8A 4NNOA 2Z57A 1VIMA 2QLMA 5E7QA 3S3TA 1XTBA 1UDCA 3L07A 5CDUA 3Q3IA 1BTOA 4FHZA 1FFHA 2WEKA 4O4LF 3F7OA 2QRLA 1W76A 1GNRA 2JDIA 5CVVA 4B7XA 4EPTA 3R40A 1T0HB 4KWEA 2PL1A 1NZFA 1X7WB 2HXYA 3O5AA 4RK7A 3V97A 2VG8A 4TUYF 1NW6A 2IY8A 2DBRA 4HDNB 4Y6GB 5LP6F 2OBLA 4R1SA 4CQNA 3HV0A 1RCUA 4LTNA 5C8VA 4LECA 5B2ZA 3D6FA 3P4UA 2ZVQX 3ROQA 1EE9A 2OGUA 3JYNA 5E6SB 4MS1B 1LS6A 2R96A 4K5QA 3QTTA 5FD8A 3NU1A 1U7OA 1N4AA 2O0JA 1GUBA 1M0TA 4BFCA 4HDSB 3RVDA 4Q4DA 2VOJA 5SICE 1AKYA 3WLFA 4KLCA 1XSEA 2G7ZA 3CZMA 3WLIA 4H6PA 1J2EA 3TB4A 3NXKA 1W59A 5F7XA 5BUSA 4CMAA 1H9BA 3X2EA 1Z38A 2QU7A 3FA2A 1KU0A 5BSRA 4JJAA 2QYTA 1V45E 4DZRA 2AUMA 4LOKA 4Y6OA 1RHUA 1NG1A 4PE5B 3ZIAA 4BQFA 6AT1A 3AVVA 4YCCA 5K51A 4PQYA 2AMFA 2O7NA 3LQFA 4O4IA 1XCOA 2I29A 2BFPA 2VDWA 3WHKA 1NJ8A 4EHFA 1BEUB 1OILA 1PL8A 2PGAA 2UUOA 3KPVA 3PNPA 3UG6A 1NU8A 3AB3A 5K4AA 4EUNA 1CUUA 1DQYA 1ZUWA 3DNMA 3KJGA 5JNUA 3JYHA 3LW7A 2IW3A 2WSSA 4TVBA 3DHNA 3DQPA 1FFGA 3KOMA 2ANBA 2ACWA 5T6MA 1TUEA 2QP3A 2HUNA 4WOBA 4P38A 1SA0B 2VYNA 1BXRB 3M1AA 3NVMB 1RKQA 2IOYA 4WCDA 4G85A 2J09A 4PVCA 5L40A 3D4NA 4X45A 3RYIB 1QGDA 3IS3A 3H18A 5CPFA 10MHA 3V4OA 1WSAA 1TGYA 1W47A 3VU8A 2QSUA 3B6IA 5LMCA 3N6XA 2IEAA 1TKAA 4K0KB 2I0FA 4J0GA 1BIFA 1FL9A 2DKFA 4C2UA 4E12A 3GPDG 3RU9A 1HDRA 1ZUD1 2XA1A 2H5LA 1JHPA 2YY6A 2CD7A 5FORA 4IFIA 2PLNA 4LC0A 1U0SY 5TMDA 4RANA 3NC4A 3UUFA 4CKEB 4F5EA 5FTLA 2ZYGA 4AJIA 2QTVA 1NBAA 2VIIA 4A6PA 4X90A 5BUZA 1IYZA 5CFRA 3JALA 2H7XA 4HADA 4FBLA 2NVUB 1ZN9A 1JV2B 2O2YA 1I3OA 1MVOA 3ZZ0A 1XRLA 4OQDA 2F3UA 4L16A 1GILA 3E3MA 2O8EA 4DRXB 3EGXA 4L74A 4HQFA 3NAZA 1IBMB 1GNPA 4QYXA 1RQRA 3B48A 1XO1A 3MJVA 2J6CA 1GG2A 3K3PA 4D2IA 4AY4A 5GQSA 4FEEA 5H68A 1F0YA 5HS4A 2X3FA 2WUFA 5KNCH 4WA8A 3ESBA 3WFJA 5FH9A 3MPUA 3COSA 2ADMA 5IKXA 3GP3A 3K1AB 3OF2A 4BOYA 1TUIA 4LMPA 3OPYI 2A6PA 2E2WA 4MGHA 5B6PA 1SFRA 4WQMA 1U31A 1YSCA 2OCBA 1M67A 5AVSA 3BMXA 3IIMA 1ZI8A 4AO7A 2DPYA 2V55B 3M82A 5JRJA 4JC4A 2MT9A 1GTMA 2B4RO 1B00A 2Q9CA 5JD6A 1GZVA 3TNYA 2HU5A 3WNDA 1G5HA 2OWEA 4L6IA 4CMIB 2YWCA 5F2EA 4ZALA 4PYOA 1TAGA 1V9SA 2I99A 3L7CA 2FVYA 5H9VA 3T6KA 1JTEA 1VCHA 5SZJA 4XM1A 3VU9A 2UV8A 1YFKA 1FYFA 2EKQA 2DTXA 1L5GB 3RC3A 4DMFA 1A88A 4QVGA 1KQGA 4ETWA 2HHAA 4QEKA 3BWCA 1A8IA 1LX6A 2HHCA 1L4GA 3UAVA 1CX9B 5EIAA 1JLSA 3DHEA 4HFJA 3U4QA 3B8HA 1IDN1 2HPVA 3JWJA 4PHTA 5DCLA 5IC4A 1E2HA 4IWYA 5JR3A 2YXEA 4YS6A 4J7UA 2VTBA 4JBHA 3WIUA 3PJGA 3PX2A 4KLAA 4TRMA 2N46A 2I9PA 2IXTA 4PZZA 2H2HA 4H15A 3AHHA 2XXAB 1T4CA 5COBA 1XZDA 1EDEA 1O5OA 1UKEA 1C0LA 4FDUA 5CR9A 2AI1A 2AXNA 2EDAA 5JVDF 4QDOA 3FX2A 3EPJA 2HWYA 3TSYA 1Q3HA 4EY5A 1YZGA 2JGNA 3OE7A 2ZI5A 3AR9A 1P39A 4B2IA 2IXAA 4Q7KA 4NENB 2VCEA 4YAWA 4O2RA 4RV5A 1QGYA 3QUCA 1QP8A 3EIOA 1X92A 2FSVC 2ZBQA 3MM4A 1TYDE 3LT4A 3SHVA 3ZDAA 1N9ZA 1FP7A 2Q2NA 1NMQA 1V35A 2TSYB 2IYTA 2NXNA 3GLVA 2VN8A 4JKYA 3GLFA 2H00A 1XTIA 1DC6A 5JMOA 4MQEA 4XD2A 3Q0EA 3E03A 4E14A 2NO5A 3V2HA 1ZM2A 4QPDA 3WLNA 1D7AA 2QNRA 3IKVA 1KEPA 2OTCA 1GRNA 4AYWA 4PO8A 2JZOA 1N9KA 2WAAA 1BU5A 4FHFA 3GCDA 3CIFA 4I7EA 3F2VA 5LIRA 2O2CA 4C7OA 3LLUA 4KLRA 5HUHA 1XCLA 4GMXA 1KDRA 4UXHA 3K8YA 3H16A 4E4TA 1PQWA 1HE4A 1VHTA 1Y4DE 7REQA 5EVCA 2C5FA 4Y2TA 1DJMA 4KH1A 1AV7A 2OK8A 3QOWA 2C96A 3MLEA 2ZIWB 1MG5A 1T9KA 2FF5A 2ODTX 3FHLA 2GK6A 3HFRA 5LBIA 4OJKA 3TTVA 1QP4A 1G8AA 3K0EA 2B21A 5REQB 2NG1A 4GI3A 3V4VB 1E3JA 1WMDA 1O1YA 2C9MA 2X13A 4LHZA 5KTSA 4MW4A 1X8LA 2Z09A 2XADA 4R40A 2XRFA 1I7NA 1J8YF 1B0ZA 1NKSA 2XMDA 3BZWA 4YONB 1EIZA 1K5GA 1YE5A 4IHJB 1QGAA 1YRWA 3F97A 4HBZA 5FOVA 4DMGA 4JU8A 1OV4A 3KM0A 5JXGA 2O19A 3LYHA 1FJHA 1W5FA 3BMCB 4S0ZA 4B71A 4LYGA 3GEDA 1MT3A 3AETA 4OQQA 3RT7A 4TLDA 3MAJA 3A1SA 2GVNA 4IXNA 4JSYA 4LE2A 2BFDA 2KM1A 4NHEA 4M8NE 2JAXA 5D3QA 3DL0A 1E9AA 2Q28A 4QXMA 4QOEA 3PQ3A 1KAHA 4I5GA 3DW1X 4EUHA 1H4QA 1HLFA 1XF1A 1YK1A 1G5TA 3EXFB 4IJQA 2KMLA 4DLTA 1CJKC 2WQZA 3N3BC 3DH0A 3I37X 4G2NA 4I2VA 4NFYA 5REQA 3STVA 3WBJA 4PYJA 3QXGA 4Z4CA 2HZBA 1R50A 1NM5C 4IUYA 3LQRA 4O4IF 4X54A 1F3LA 5FV4A 1NV9A 2ET6A 2IDKA 4MP3A 3ZY5A 2VNIA 2YZKA 2JIDA 4BLSA 2CN1A 3KDPA 4EKEA 5JS7A 1W29A 3AVOA 3TF5A 3CZPA 4EB6A 1NYTA 2C2KA 3SF0A 3UC9A 4F7WA 3JQAA 1C9YA 1GU1A 2BKXA 3QYJA 1T3HA 1T2NA 4BRWA 5IUJC 1R8JA 2OCPA 2YHAA 1YBMA 1I1NA 2O23A 3DR5A 3JQQA 4E1BA 2AOWA 1NNUA 3NT2A 4WKPA 4ZT7A 4WI1A 5KX5A 1EDOA 1G8SA 2YJ3A 2YOGA 1WPGA 3FF1A 1VSBA 1P6QA 5DHQA 2P0AA 3LUPA 3W3AD 1FXUA 3VOSA 1C7JA 4H7KA 5FLEX 3NEPX 5G41A 5T57A 5AW3A 4HAUA 4OKSA 1JHUA 2GCPA 4HAOA 4UQOA 2AQHA 1U0LA 3N0RA 3DWEX 4MZXA 2R7MA 2F1HA 2V98A 4HN2A 3OIFA 2WU1A 5DNDA 3OIWA 3VR2D 1U9JA 1RS0A 3SX0A 2ZVJA 1ZCJA 5LYJF 2VSNA 3KBOA 4F6CA 1X9IA 4Q47A 3AHGA 4ZYZA 4DF3A 4OAOA 4S2UA 1RRGA 3ZE9A 1FPMA 1AF4A 2QM7A 1WD7A 3FNEA 5BV0A 1SQ0A 3A27A 4IFTA 1F5SA 3EVBA 3NB0A 5ECGC 3R7SA 4CKXA 1XB2A 3KKKA 1VE3A 2HDNB 3K5WA 4LXIA 3SX4A 2QBYA 2F1IA 4KPYA 4JOQA 4J4BA 3ZDZB 4XAQA 1GL7A 3E3AA 1ZGHA 2C9OA 3G0GA 3R0QA 4UBJA 3X2FA 2DR3A 4HFRA 4BUJA 3TGPA 8ATCA 1Y5IA 3UQYS 4HB3A 3ZWMA 3GLHE 3LGAA 4D8WA 4JI8B 1PFVA 1VRVA 2HQOA 1UJMA 1UFRA 3KKNA 3QA9A 2NU6B 4BFZA 2DP4E 2I3DA 3NYQA 4L5IA 1RRCA 2MSLA 3A1FA 3ZH9B 1I4EB 3G2LA 4GZMA 4Y2QA 4QT4A 1E8MA 1P61B 1YBFA 4D25A 3AFGA 4RCYA 2ZWVA 3REQB 4RMNA 1PUIA 2WG1A 3AQIA 4FR0A 4LQCA 3UAWA 3U17A 1GQFA 4U2KA 3O8QB 2VJOA 3PYMA 4X95A