4LY3A

Crystal structure of wlard, a sugar 3n-formyl transferase in the presence of dtpd-qui3n, dtdp-qui3nfo, and thf
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
271
structure length
271
Chain Sequence
HMIKICIAGKNNIAVNSLQFILKNYFEADQIVVIPNKNDKGIDSWQKSLLKFALDNNIKIVTLDEIYNIEQIIFFSLEFDQIIKIENFKSDRLFNIHFSALPKYKGVFTSITPILNNELESGVTLHRIDNGIDTGNIIDQHCFPIDINDTARDLYFNYLKYGESIFKKNIQTIINNSYKDLKQTNINSSYFSRKDINLVHKINFKKTSFEIHNQIRAFIFQEYQLPIINNSKIIKSILANEFIGYNVFEEFENYFIISGIDGFKIIAQKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WlaRD a sugar 3N formyltransferase
publication title Structure of a sugar N-formyltransferase from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Transferase
total genus 88
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ly3A00
4LXXA 1Z7EA 4LXQA 4LY0A 4LXUA 4LXTA 4WKGA 4LXYA 4LY3A
chains in the Genus database with same CATH superfamily
4X3OA 1C14A 4HWRA 2JFYA 1UOQA 4CTOA 2AQIA 3PYMA 3ZZTA 1POXA 1LPAB 1L3BA 3EFEA 4DR6B 2I0FA 4UHBA 3A3NA 4FDTA 3NHSA 1NF8A 1G7RA 1UODA 1KAGA 5DIZA 3U7QA 3DMYA 4F2DA 1Q91A 5KU7A 1ACMA 1MIHA 2E5FA 3U26A 4HG2A 5A2GA 5FOVA 4AQ7A 3HSKA 4HV4A 2O2SA 3UOWA 3D3EA 4X9XA 1ECBA 2PKRA 2TS1A 4IGFA 3E7FA 4IIFA 4U3JA 3Q8XB 3OQ6A 4HUQA 4ZN6A 1IOZA 5FPTA 1HNXB 1Z6XA 1P6XA 3B1YA 5EE5B 1V37A 2GX6A 2Q99A 2HSDA 2Y4OA 4OH7A 1NLFA 1RFLA 1PR3A 4XYGA 2NVUA 2ATEA 3GLRA 2IA5A 4INZA 2I22A 5IVDA 4H60A 1K7FB 1OB2A 1SA0A 4MA5A 2ZJBA 1T6XA 4L8YA 1JSZA 1XFDA 4RD3A 4O4HB 3RODA 3R41A 3HEAA 3W6NA 2C2BA 2ZWOA 4DE5A 5IM4A 4NZYA 2A9RA 4I4LA 4UCXA 4WMLA 4FFWA 4L9AA 1OAAA 2MYTA 3SYKA 4BZXA 2P6NA 4YLEA 1S1MA 4RTPA 1R12A 2FPOA 2J87A 2NU6B 3S8YA 4CWAA 4YN3A 5HFAA 1JVSA 1JEYB 3ET5A 1P7ZA 2G3YA 2XBUA 4OKIA 4RVNA 5TC4A 3RLIA 4F1KA 2C57A 3EDRA 2QM0A 1QLWA 4B2PA 1QIEA 4M38A 5I7OA 2I7CA 4O5OA 2IYYA 3C1AA 4FEAA 1Y5IA 3WYCA 4L5JA 5FOQA 1MD9A 4Q7JB 4A8JC 4PLVA 5KQRA 1LPNA 2DSNA 2Z2ZA 2O6HA 2NU8B 3QUAA 4PHHA 1VI2A 3FOCA 1AOXA 3N2LA 1P4SA 5AHRA 2I1LA 3EVEA 1VBFA 2BM1A 3GN2A 3JZAA 4HNGA 1NOKA 2QROA 1CRQA 3T1VA 3V4OA 2VWPA 4MW4A 4AY5A 3LSYA 2V0CA 1HE5A 1DT3A 2GK6A 2VDQB 2X77A 3A6JA 3GX1A 5ES3A 2JFXA 4P33A 3A1EA 3BQMB 1V8ZA 2EJTA 2EYQA 4B35A 4J03A 2ZZNA 2XUHA 3ED1A 3B9PA 4IINA 2PT5A 1YB5A 1IRIA 3A4LA 3E7PA 3ROTA 1B74A 2WAOA 1HNNA 3W9UA 4W1PA 4B81A 1JHYA 4S0ZA 1VG8A 1BVUA 2IXBA 2JF0A 1WG8A 2VT2A 4BNKA 5IEBA 2QP9X 1U80A 1Y1LA 5B30A 3RAGA 4RJTA 4A15A 4D0NA 2AG8A 4MQUA 5J63A 5JS1A 1C9JA 3KBBA 4HLNA 3A11A 4MPRA 4A8JB 1FX0A 3DT9A 3H5AA 2A9VA 4MQ4A 5CB4F 5M7EA 4MSUA 3FGPA 4B6EA 3EZFA 1Q1EA 1QORA 1OD6A 2ZUVA 4L51A 4NCAA 5DYNA 1NVEA 4YMSA 2QNRA 5DNYB 2FK8A 4KEAA 5AJYA 4RPCA 4ZMSA 4E1BA 3ZWXA 1I80A 1RHKA 5B1DA 1X13A 5HUQA 1KRXA 2ZWAA 3I9OA 1V16B 3PQ3A 3MB5A 4RETA 3RS0A 3S2UA 1RQ2A 3K72B 1PGNA 4WD3A 3DBRA 4TN5A 1KI7A 4BO2A 5J3JA 4ER0A 4D45A 4MWDA 4Y2JA 3VDXA 4QTXA 3WIBA 1X9HA 5C1IA 1R0YA 4KO4S 1VXRA 2WT9A 5IDWA 2O06A 4JGIA 1KFEB 5DV9A 2W7TA 2JBHA 3BMOB 3HJTA 2IPLA 4RLSA 1XZFA 5JXWA 1P1JA 4MB6A 3DAYA 2J7PD 4KWCA 4LK2A 1KYQA 3PDCA 4YQEA 4EAAA 5A0VA 5TSDA 1I1OA 2QRUA 3NW9A 3OPVA 3RGWS 4NMMA 3MJDA 2WEKA 4N7JA 4EAQA 1AQJA 3EWSA 4GSLA 2J9ZB 2Q5CA 2PA0A 1HC7A 2AUNA 3R3UA 5EESA 2NPFA 5E3IA 1L7NA 1JLLB 1QHIA 1TM2A 2LV8A 3LZ6A 4L27A 5CDFE 2XCOA 1HSZA 3PQDA 1MGPA 1O9GA 3ES9A 3EUAA 1DDGA 2WE8A 4KPUB 4V02A 4TSFD 5AM4A 4BLOA 5IC5A 2PUJA 2A3NA 2NTYC 5H7XA 1H65A 4Q4HB 3L04A 1S6YA 5IZCA 1CS4C 3IHWA 3P4UA 4FJ1A 4U2FA 1IIBA 1PYDA 3KJXA 1RRGA 4ZO4A 1QIJA 2J1LA 3A2KA 1QZUA 1W44A 3P45A 3ZBUA 1NVMB 2EHDA 2PTHA 3P0JA 4B8ZA 3V80A 4P86A 3RIHA 5A5VA 2Q2WA 1TF7A 3EXFB 1A69A 1N8KA 4GEKA 4JI8B 1XV5A 1FX1A 1RLOA 4TSRA 2CHQA 4BC1A 1EHCA 5DSZA 3WGHA 3LZCA 5CB4A 3KQHA 3GRPA 5AXBA 3BXPA 1XTTA 4WH0A 3LM8A 1XLTA 1GZ3A 3OF5A 1FRVA 1ZD3A 1LDNA 4N6NA 3G0CA 4WKNA 3CZQA 3TQCA 3SXPA 4YUVA 5C8ZA 1WJGA 1XNQB 3N75A 4IM7A 4WTOA 1ADCA 1BTOA 5IAKA 3NHPA 5JSHA 1TA9A 4EGSA 3IC5A 3T5AA 5EPEA 5HCNA 4CM1A 2A78A 3GWGA 3KQPA 2QA5A 2XIQA 2P9EA 1CKEA 2OSVA 2QMOA 5ADHA 1ISSA 3MQ4A 4WJLA 1IY9A 3E05A 3QE9Y 1ADFA 2IXAA 3M89A 2ZUUA 2CXRA 3SMVA 1O87A 2XYHA 5I7SA 4K9SA 4ECAA 5LBUA 3IL2A 3N5KA 1KJWA 1ZD4A 3G5TA 3TNJA 4MPPA 4D26A 1EUCB 4IO1A 4DWJA 3KETA 4DLLA 2EP8A 5EJFA 3D4LA 4C29A 4M6WA 3OZRA 3BMCB 4U0KA 5DI9A 5DKFA 5DEIA 1NW5A 1E3IA 2G36A 1GV1A 5HOEA 2OBMA 1Z06A 1BOFA 4M9ZA 4IV8A 3VR3A 3KTOA 2Y1EA 2QYTA 4M8LA 1RMTA 1ICIA 2GCEA 3R6WA 4GI7A 4CG1A 5JS2A 4X63A 2V54A 4UUMA 4D9MA 4BNHA 2BJHA 4MEBA 3NBKA 3RS4A 4JQOA 3CZCA 1WB9A 2I7VA 4CLEA 1GKUB 5EEGA 3H9JA 2E48A 3LLCA 4QULA 3RO7A 1H9CA 2QX6A 5DNWA 5EHIA 5JSUA 4MOWA 1AU9A 1FYXA 2JFHA 3JQBC 2MTBA 1Q15A 2PWZA 4GKVA 4ID9A 1P9WA 1Z5OA 2H9AA 4LBYA 2P9TA 1I0LA 1A5AB 4BVAA 4F4HA 4FCCA 1BC5A 1QDUA 3E6AA 3PR3A 1L9XA 4KREA 3WRYA 4BC0A 2ZJ2A 3KIPA 2VPWA 4WQMA 3UY4A 1FW6A 1DU4A 1FSFA 4HHEA 5EHQA 3S5UA 1KMHB 4D7AA 3RREA 3I9V1 2BELA 2ENWA 4J6EA 4DV3B 1E89A 5CXSA 3BREA 3GQBB 1M5RA 3L0BA 4LFBB 2G6BA 2O3SA 3ZCTA 5HF5A 4A1FA 4CLRA 5KQGA 1EX6A 1S2LA 3EIUA 3NWJA 4BB9A 5GZ3A 4J7AA 4B3JA 3WA6A 4DILA 4Q7QA 4Q3BA 2XAAA 4BPBA 3NB0A 1TE2A 3ZIAD 4LDQA 1I14A 4LJ4A 3KEQA 4ZKEA 3FOWA 4HAZA 1Z7EA 1AGYA 1E3LA 1MXHA 1WOMA 1YWGO 2D0DA 2JBWA 3DJFA 4RSRA 3ROQA 3WWCA 3ZNPA 1ORVA 1PNTA 2WB2A 4HAYA 1XEXA 3MGBA 4P81A 4Y30A 4Y9RA 4UXJA 1U3VA 3QTTA 4UEKA 1OLSA 1QYVA 4Q24A 4UNSA 4FILA 1E9EA 2CXTA 3LY8A 3CNOA 4G0UA 2PKEA 3Q0TA 1D0VA 2B35A 2OBXA 2H9YA 3T5GA 1Z3CA 4DGSA 2GEDA 4DLSA 5BXYA 3LQQA 3CZ4A 4IJQA 1DLJA 2W0MA 4HNSA 4L0QA 1J25A 1SC4A 3IPRA 4C4AA 3KKPA 2HA0A 4MO2A 4DDHA 4RTJA 1ZUIA 1LV8A 2BKVA 2LNDA 2OP0A 3SSOA 1YFKA 3UK1A 5EIXA 1GDTA 4OJMX 1KTIA 2PX2A 1KPGA 4M1YA 1JDVA 4N39A 3OZVA 1PYGA 4R3WA 4RCVA 3E27A 2G9ZA 3M6MD 5K7SA 5PGMA 2O6LA 4LMBA 5K0GA 3K6SA 4JC5A 2GBLA 1P7VA 1QFMA 2GEFA 3DA8A 4MIOA 5BRAA 2CHGA 4Y6QA 2CVZA 2CE7A 5D6OA 1LF5A 1NIPA 1N0UA 1O1YA 1Z38A 2PJUA 3SDBA 4UE2A 4KQHA 1T9DA 3QPUA 3S40A 1IEVA 1TXGA 2YJTD 5IABA 2ZSHA 2RGEA 1FLNA 2FUCA 2VXOA 3PKIA 2ZVPX 4REQB 4MB0A 1E3QA 1ZM4A 3HJRA 3LGXA 3PCRB 3BN3A 1XKTA 4V0SA 1OT3A 4J1SA 4P2BA 4G5GA 1QO7A 2HCFA 2DJ5A 3MA0A 1G21B 4NZZA 5B6JA 1IJEA 4JB3A 3K9QO 1RAIA 2OGUA 5HM8A 5CAEB 4EGAA 4U8HA 3AHFA 3VR6H 4ZYLA 4Y2TA 2E4UA 3AZOA 1D2NA 5H9WA 5K9ZA 2P69A 1EB9A 1W4CA 3E70C 3I72A 1Q44A 3E48A 2V5UA 4NFHA 4GPEA 4RADA 4RABA 3WTBA 2UZIR 3TE6A 4FWBA 2LIVA 3RAFC 2YJGA 1TUGA 2AFHA 2OQVA 5LNK1 3TQHA 3GPLA 3NDBB 2EX4A 2QR2A 5DH9A 3GRFA 2NO9A 4A6DA 4X3CA 2PGNA 3VVMA 2OZEA 3QEBZ 1PUIA 3A4YA 4I50F 1L4BA 4C3ZA 1THTA 2D7JA 4HNHA 5JCOC 2Q27A 4L78A 1Y89A 1YULA 3W8NA 4AS2A 1OI2A 3JATB 3KUUA 4JCCA 3E03A 1EDZA 5DWDA 4BGDA 3WRWA 2ODPA 1PV4A 2YC4C 1NVWQ 3UMMA 2LKCA 2JI6A 2PX6A 4MGEA 4D4GA 4O4JB 2E55A 3ERCA 3RVBA 4Q4DA 2HX1A 3D8UA 3GFSA 1YQUA 1GUBA 3FYHA 2DLCX 4LDPA 3ANXA 3CF2A 1C4XA 5AQ1A 2IE8A 5K0JA 1ZHHA 4LZLA 1QCYA 4WINA 4EJMA 4QGSA 2H7CA 1LEHA 3GHYA 3ZVNA 1WMSA 2B5OA 4IJMA 1YQTA 2H52A 2RBGA 5JEEA 4GOKA 1R74A 1S8FA 1KA9H 4QYTA 1L7OA 2QN3A 5IP5A 2YQZA 3HU2A 3I64A 4IXMA 2B25A 1UWKA 3RYCB 1FTQA 1YR2A 1NPDA 5CVDA 1KVRA 2NQ2C 3C74A 3WLMA 3ICQB 5EE0A 3SE7A 4PLFA 2GXQA 1RWVA 4M1ZA 3SU8A 7MDHA 3HXOA 3EQ6A 1TTQB 4LOAA 3ZY6A 5BV2P 2YJ6A 3OCZA 5C5EA 5DK4A 4UBNA 3SFTA 4C4OA 3KDAA 2W6IA 5SV2A 2O2YA 4LBVA 1RDFA 2HU8A 2VS1A 1TVCA 4D4KA 3AR3A 4UEJA 1YZNA 3OU6A 4E51A 5IULC 2V4MA 5KWIA 4Y6SA 1PTKA 1YHZA 1GQYA 1CRLA 5JJKA 5FUWA 2ECKA 2DP4E 1U2TA 3UV6A 3BQ9A 2WIBA 2YYZA 3IUMA 4JODA 1E3MA 2AD5A 2GWRA 3EGXA 3QYJA 4FYVA 4NJEB 5T4HA 4M9UA 2ZRKA 2YFYA 1U0OC 2GD6A 4H1VA 4UNNA 2IITA 1ZXBA 4EFNA 3PVSA 2ERXA 4XWWA 4QELA 2EL7A 1ZUWA 2QORA 3A14A 3B7GA 4OH1A 2YCLA 1BKYA 3CQ9A 2EARA 3ZW8A 5JC1A 4O59O 2XV1A 3PVZA 5B1IA 3IAM1 5E4TA 3T7SA 2R8ZA 4MPJA 3I4LA 1YRBA 5ICCA 2WU8A 5IX8A 2FB9A 1NFQA 2ATXA 2YY5A 1WEHA 1C41A 2WYIA 2ZYGA 3QU4A 4I50A 3KQWA 4IEIA 4UVGA 4PLCA 5HZHA 1BW9B 3UUGA 3OZTA 1CZLA 3HGTA 2GN4A 4G1VA 4D98A 4KHPB 4J0EA 4WECA 3Q7RA 1ES9A 2QUZA 5B58T 3OCUA 4DDWA 1N5IA 2WBLC 4FMCB 3LF2A 4HYQA 2RE8A 3PIRA 5BSEA 3F5QA 1CHDA 1N5OX 2HBQA 1AMUA 1P4HA 2JS7A 1FFXA 1GPMA 1Y4AE 1ILEA 5JNLA 4BGVA 4PYIA 1VE9A 4XYEA 2BKAA 4K87A 1HZZC 3K3PA 1CF9A 3B12A 4R9VA 3UWDA 5HZMA 2Y05A 2FSFA 2PQMA 3FOBA 5KX5F 4B17A 3CUYA 1UKAA 4ZCIA 2IS1A 3H9EO 4M89A 3N8GA 4X66B 2YY7A 5ALSA 5E0OA 1O0SA 4ZHQB 1Q14A 1XRRA 2X5KO 5AVZA 4NENA 2Q6TA 1Y8ZA 3H9CA 1P6UA 3B5EA 2G77B 1YXMA 4TVOA 3BJEA 3P0IA 1U7ZA 2G67A 4Q1DA 1MDBA 3PICA 1V9CA 1M1YE 3X1WA 5JTTA 4L5CA 5FBVB 4WRRA 3GRRA 1BXZA 3B82A 4YRAA 5D01A 1N5LA 1EFLA 1F7VA 2Y6VA 2YWXA 2VFAA 2R8EA 4CFSA 3ZH2A 2YMMA 1TAQA 1ZJJA 4J91A 2Y1FA 4Q00A 4QXOA 4DMGA 5BSVA 4C08A 5JSQA 3G9XA 4EA9A 1UKCA 1UT5A 5D3MA 1NXOA 3M9LA 4UATA 2PXCA 4QQRA 1F3OA 3CUTA 1R0XA 4DYVA 1PJ4A 3PDHA 4CIBA 2BFPA 1VZ3A 2LKDA 3IDFA 1JYEA 2COEA 3BHNA 3ONWA 4JWTA 4L16A 4BMSA 4MQMA 3HU5A 2B8JA 2GZAA 2WF9A 3L1VA 3QVLA 3ZHOA 1FMLA 3CZ9A 6REQA 2CXPA 1LPBB 2YASA 1WO8A 1U0BB 3B3GA 2CDBA 3G2PA 4BQIA 5EMLA 3BGOS 3PLNA 5JNRA 2BFEA 3Q98A 1N3YA 3DH0A 5F35A 4MDYA 4QO7A 1NVVQ 1CRWG 2J4DA 3U4IA 5FFNA 4IIYA 1W36D 4EOGA 3DBHA 3F78A 4PO3X 2FMHA 4OQQA 2XXBA 4BFTA 2P9ZA 1FFGA 3CPSA 3VZPA 2IY8A 5M04A 3HDVA 4RIIA 1I2CA 4OI2A 3EXHA 5BT9A 3L79A 1RRKA 5ICSA 3HA3A 521PA 3ZIDA 1T5DX 2NT4A 1JBQA 2ZUFA 2DBRA 1RYDA 1SCAA 2HWWA 1N2CE 3KE9A 1VFPA 1GVHA 2G04A 2QTNA 1TZCA 4ZCPA 1QRTA 4WN9A 1W5SA 2R84A 2VO1A 5KX5A 3OT1B 5TPZD 1LX6A 1EJ2A 1RQRA 1RD4A 1HLFA 1EX9A 2CY0A 2QJWA 2V7XA 2XDWA 3DLTA 5F52A 3GJYA 1EFRD 3REQA 3SHOA 2HSGA 3ENVA 4IIUA 3BXGA 2Y0DA 4KVAA 4YH1A 3P9IA 2PX0A 1JIXA 2EIXA 3MFYA 5A7HA 3UWKA 3PFGA 1JN0A 3VR6D 4DMFA 3M4JA 5I5GA 2YZKA 3CGWA 4D3XA 4G3XA 3IODA 3GCXA 4YP0A 3DMRA 4F7DA 3MWYW 1VL6A 4ATNA 3KPUA 1FP1D 3C3PA 4XUCA 2JVKA 2FP4A 4YP5A 4BNLA 3NHMA 2AK3A 4PX5A 1RWBA 5FUMA 3ZGOA 2XSZA 2OCYC 1RNLA 2EJWA 1BROA 5H5JA 4ZGBA 5G02A 3NRCA 1N1GA 4CEIA 1YD7A 4K81B 3KPYA 3T1TA 5T7BA 4RK1A 4C6RA 4JYCA 3SHWA 5LYJF 1H2YA 2KQUA 2BTQA 1T8UA 1MMFB 2P7IA 3DZBA 3FWNA 3NBUA 5ARDA 3SEQA 2GCOA 1E99A 1ANKA 4UEQA 3A7DA 3AL0C 3IMGA 1E2UA 2AB0A 4CKZA 2C8LA 1P2SA 1EEHA 3BHIA 3LLSA 3LUGA 5CNMA 4OQNA 1JJFA 1SC3A 5IBRA 4II7A 4MINA 4OJQA 3JQCA 1DPGA 1BDMA 3MWDB 1ZONA 2ZBPA 1G1AA 3AFGA 1H6CA 4ZJPA 4ZXFA 3X1DA 2V5VA 4Q4AA 3FKJA 4AW9A 1JBKA 4CM9D 3QYFA 2AXQA 4RZHA 2FKNA 2P62A 4J7CA 4OD0A 3WLNA 3THXA 5IPFA 2OCIA 3BGSA 4DLZA 3CE6A 5C4MA 4RDXA 1ZAYA 2BUBA 5EMNA 4QSMA 2XNSA 4BTVA 4R1NA 3RF7A 1FOEB 4KNWA 4KR2A 1JXOA 1X86B 1Z0JA 3ELYA 3FPLA 3GJ0A 4OXIA 2N1BA 1DO0A 1KDYA 2FFBA 4IHJB 5JS8A 1NUAA 1T6BY 4ZK2A 2XB8A 1W49A 3M6AA 3RUIA 3EIFA 4PGHA 1KZ7B 2JK1A 1WW8A 3B36A 3IAS1 1YSCA 4G8JA 1O96A 3BXEA 1J2EA 2NUPB 3NPAA 2XQVA 3KXPA 1XN1A 3I9NA 1T36B 4WZ6A 4ZQIA 1ESCA 5DHSA 3VZDA 1LDMA 4AF8A 4F38A 2BMAA 5HTKA 1TM4E 2WDZA 2VKTA 3MYRA 1BQ4A 4ES6A 1JKFA 4GRAA 3WOVA 2HEGA 4EITA 3H4TA 3MSXA 3UO8B 4MGKR 3LXXA 4WI1A 2GVZC 1TRKA 1Q7TA 3R76A 3ZY4A 1OFIA 4BYMA 2EATA 3QOXA 5SYAA 3KSZO 3R3YA 3CZRA 3TNFA 2ECFA 5U4QA 4EYSA 1FUIA 3TQFA 1ESDA 4BMXA 4ZMRA 3RSFA 4IGIA 3I92A 3MIIA 4RL6A 3CRQA 3GPBA 2QTGA 2E85A 2HCTA 3NALA 3P27A 5KTPA 1VCNA 3RBXA 3V7YA 4ED9A 2V6JA 4NZ9A 5FJJA 4YX9A 2KS6A 4RM3A 3HUTA 1J0EA 5LYJA 4UE6A 2QK4A 3K9BA 4CKEA 1U9IC 3QHQA 1DADA 3RIYA 3N8DA 4C0SA 1K08A 3ZQUA 3ROZA 5L4NA 3AF2A 1YDHA 2X23A 2VQFB 3TINA 5KYWB 4REMA 2M1ZA 4G8CA 1V11B 1UBSB 1L3CA 4M46A 4ZDIA 3DNFA 3N1UA 4PEVA 4BVJA 3EZLA 3PC7A 4AJHA 1SVIA 1G20E 1MIOB 2WWHA 1FQJA 3RTAA 1QG2A 5MN5A 1M66A 4QA9A 1DCFA 3U60B 1FSSA 1Q1GA 1WEKA 3DMHA 1ZEMA 5JS6A 3PC8C 4BAGA 4LXGA 5BSKA 2JRLA 3FROA 3JQ7A 3HUUA 2WQ6A 2I4MA 2R44A 2FQYA 1TUIA 5JZ9A 1KKLA 2IYLD 1XLVA 4QNMA 4RD4A 3MMSA 1WUTA 3T3MB 1Q2XA 1IZYA 5A4AA 2J3JA 1A3CA 1FYEA 3S68A 3MCZA 3AI2A 4HI0E 1WMEA 3KLMX 3VMMA 3UQZA 4YCLA 4KIFA 3OT4A 3VBEA 3VZBA 2IUUA 1RHMA 3SR4A 3O84A 5J2TF 1S89A 4OUKX 1QHHB 1F2TB 1QHYA 2O2IA 1SUIA 3M6XA 5GGYA 1R5BA 5CNIA 2IV2X 4U0JA 1RVV1 3SI7A 4RVSA 1VMDA 4AY4A 3DZFA 1JT9A 3NIDB 5D86A 1OGIA 1OHHD 4GP7A 4HS4A 4TQGA 5DN6D 2MYUA 3HVUA 4Q1VA 3I61A 4BZZA 4HDKA 2ZTMA 2A59A 3BAZA 3HCRA 4PAWA 3QPWA 5JALA 4L07A 1KI9A 2D8MA 3DR5A 3HXLA 3PBKA 4FFBA 4OQXA 2FI1A 4R83A 4RK7A 1NU6A 5BWOA 3PNKA 3KOWA 3PXAA 2FZGA 4XTRA 4YRFA 6Q21A 2AEFA 4RU1A 4IUBS 1KP2A 2GHQA 3IJ5A 3SICE 5BW8A 1G9SA 5EHXA 3KM0A 1DUSA 2XWJI 2JANA 4J0IA 5FADA 3SOZA 3C3XA 4BVGA 4EI9A 1C0LA 4BV9A 1NRXA 2SKEA 3X2FA 1O95C 5AM0A 3B48A 3THOA 3FPGA 4IEFB 3TUZC 1M0SA 2JPDA 3EVAA 3C6QA 3QKUA 1YBVA 1XXHE 4I4NA 2BGJA 1E2JA 2Q62A 1CS0A 2ZT6A 4JLSA 4F4UA 3KE8A 4J1QA 1UP7A 3IAEA 1WTCA 5FF9A 2JH8A 4PZEA 1ZEJA 3CC8A 2GN2A 1NUUA 3FR7A 3KVYA 2I5PO 3HL0A 4NJMA 4L73A 4A73A 3EDCA 5THQA 4HRVA 1DIGA 1RWKA 2HWUA 3K1ZA 1L1FA 3ZK8A 1P3Y1 3VGPA 4AF7A 2HSZA 2Y1DA 4R7GA 3ZKWB 1L9KA 3WHKA 5BUQA 5JWRA 2HHHB 4PO8A 3C1TA 5TMDA 2FUNB 1QMGA 2K2QB 3NAGA 4B7XA 5BQPA 3FDZA 2GO7A 5IJAA 3VOAA 3FMPB 2PGIA 1VBNA 3LP5A 4Z3DA 4EHBA 4JLWA 5AW7A 4IOLA 1J2TA 1CK4A 2YVUA 2Q1XA 3DXFA 4YAKA 2CMKA 1RKXA 2BPOA 3PEWA 4NNJA 1YT5A 4H1TA 4D3YA 3ZV3A 3CRRA 4YRLA 3C3JA 3N0XA 5JTUA 2QTHA 4EUSA 1T35A 2XVMA 4IJUA 1QGOA 2QMUA 4R9UC 2DB3A 4GX2A 3MPUA 4YLGA 5DASA 5JG7A 3OF2A 2QGNA 4B74A 5J2TA 4TMFA 5FWXB 4TGLA 1XL0A 4ZZIA 4V03A 3PD1A 1B3BA 1AZLA 1H94A 2I62A 3RD5A 5BQ5A 3CZPA 3KAKA 3ZDAA 3EXIB 3IKTA 1EDDA 1OZFA 1Z6YA 2MSLA 2YV4A 3IVRA 4JSYA 4XM2A 3RS5A 3ZQKA 5B7NA 2RGRA 1RHQA 3L8MA 1ND6A 3FB4A 4ZARA 3RUCA 2C2YA 4HDSA 3UG6A 5BPFA 3U4QA 1VTKA 1Q74A 2IT1A 4Q4JB 3G68A 5DHUA 3C7TA 3QIVA 3UQYS 1KHHA 4LZJA 4ARZB 4ZRNA 2AJLI 4GNKA 3SQLA 2VYFA 3TEJA 2ZOSA 3BFVA 1J99A 3JQGB 4L5YA 2QM8A 2JLWA 4NCNA 1DJPA 2CHVA 4G4IA 4DREA 2XTJA 5K1ZA 4F3KA 5I9IA 4OGLA 4QDTA 2J0VA 2XIJA 4KJXA 4RGVA 1DG9A 3U81A 4X65B 1NP3A 1U0HC 3RGGA 4PG8A 1DL5A 1ZGBA 4WGFA 1Y8RB 3GYBA 4Z1OA 3GLIB 2VWHA 3SJ7A 4WIAA 2XXAB 4UAVA 2NU6A 3WS7A 3ZBPA 1N34B 2C1XA 4MCIA 1YJ8A 2GPNA 5GIOE 1JEYA 4D97A 4YJHA 3Q9SA 3GFVA 3TZEA 4MYTA 1L5KA 3U9TA 1YBHA 2ZSEA 2ZYAA 1ULHA 2B3DA 3D4PA 3R0XA 2HOQA 1SHZA 2Z83A 3FRHA 4PGGA 1GGHA 4OJYA 1GSAA 4DHEA 1ZK1A 3H2YA 3CO0S 1U65A 2DFNA 4KQ1A 3RTBA 1DTSA 3HWX1 4Y3UA 3L0CA 4PBSA 1C7QA 1P0PA 3JASB 2NU8A 4D9FA 3D1VA 4QGAA 1DZIA 2J5XA 3LNCA 4HXFB 4XLZA 4G6ZA 1FXUA 2QU7A 5FKJA 3AHGA 4BNMA 1KIFA 2VHVA 4H0NA 3NDIA 2C9CA 2C2XA 1SRRA 1IG0A 2EFYA 3MUOA 4QQFA 4BKUA 4BNDB 3G89A 3KEFA 5LZ2A 1CQPA 4DR4B 1H8HD 2V6BA 1GTMA 2IZ0A 1LNQA 4OBEA 4A16A 5K3OA 1XRNA 2AR7A 4TLBA 4G8DA 1O77A 1SD1A 1ZJ4A 2Y0BA 5IFLA 3W7AA 1GPAA 2XYVA 4I1RA 4QPDA 4BLTA 1N92A 3QMMA 4L8WB 2ADFA 3TQOA 4TTPA 3SZUA 2RK3A 4CG0A 4YUZA 2BV3A 4YRJA 1QZZA 3TQRA 4LHVA 2JNWA 4MUFA 3JWEA 2HV9A 1Z4IA 4YAOA 2QQGA 4YAWA 2FPGB 5AOAA 1GKKA 4U7TB 3ZY5A 4DRYA 4Y0NA 3HWWA 1C4OA 3B1FA 3L7LA 3N6VA 4IIEA 2FEPA 3HB7A 5J43A 4NYMQ 1NW9B 3AVOA 1M34E 2IOFK 4GVLA 2VJPA 3FKSA 4TS4A 4TT3D 1U3TA 5DOVA 2DLNA 5AM3A 5JAHA 4ZC1A 3BL5A 3OQJA 4DQKA 3IV7A 3WDMA 2CWDA 1L5HB 2D1RA 2WM3A 1F51E 2HZBA 4L5BA 1SK9A 3FDXA 2R7AA 4AJJA 3QFCA 1ZK4A 1Z2OX 5DISB 3EIXA 4BDTA 4NLLA 3GRKA 6GPBA 5H82A 1ZW1A 1YJXA 3D8RA 1GY8A 3HH8A 1EESA 3QP9A 4PSUA 2J9XB 3GGOA 5FV7A 3QLVA 5CFOA 2VP3A 4JFAA 1NOJA 1JG3A 1IEXA 2XXJA 3JAKA 1BDJA 2UXCB 5CIQA 3C3EA 4MV3A 1A76A 1KDOA 1HPLA 2OT3B 2Z6UA 2CYBA 3QVJA 1A8PA 2UYGA 3EZ9A 3FBTA 2WOOA 3BFXA 3DEZA 3RG8A 4E5PA 1DIAA 3HKDB 1ZI8A 1V39A 5MGBA 3R3WA 1K0UA 3K35A 4QE3A 4UOZA 3ZNNA 3LTNC 4UNPA 3RVDA 3WE7A 1UEXC 1WUYA 2CNWA 3ZV7A 2DX7A 3FLBA 1QPZA 5FAXA 1F8UA 4J3FA 4KOAA 3WLPA 1RAEA 4Q4HA 1WU7A 2OQRA 1CY1A 3K2EA 3HQ4O 4UAUA 4WOPA 4EPRA 3RG2A 1CVLA 5DTMA 2ACVA 7AT1A 1LPMA 4DCMA 2QUKA 2VDLB 2CZCA 3IBGA 2WU4A 4CQMD 4YCMA 5JI3E 3K8OE 3S8EA 3ONDA 4RTLA 1RM4A 5K6TA 2CHUA 2FSHA 1PX2A 1T1SA 1D0IA 3JY6A 1JKXA 3BEDA 5CTAA 2NO7A 3VYRB 3ORFA 3WYEA 3ESBA 2ZSDA 4I2VA 4XM1A 3A04A 1GCOA 1QGED 4OUDB 1EJ6A 2YFHA 2GM4A 1J8VA 3CO5A 4KLRA 4MS4B 4ZZ0A 1B6RA 4J43A 1YE3A 1QFYA 2WTEA 5SICE 4Q66C 4BEWA 3R9XB 1LRLA 3LQ2A 4Q9AA 4AN1A 4NY1A 3EEIA 4B7AA 1GSHA 5L3RA 4R41A 1NNLA 4MP3A 4DT1B 3KZ1E 5HX7A 3HA7A 1AX9A 2NQ8A 3F3SA 2FMXA 1ONSA 1E79A 3ASZA 4BKRA 5IK2D 4OLFA 4N3CA 3EEYA 3IQIX 1JPVA 3BRCA 1E60A 1MPXA 2OZVA 1E0DA 1E1DA 4UBLA 1GJRA 2JFOA 1D1QA 3SHFA 1YHYA 3WFJA 2Z30A 2AMYA 1VJDA 2GFQA 3GT7A 2ZR0A 4UBKA 3M83A 1EUCA 1Z5PA 4LE1A 4ENVA 2G80A 1WDTA 3LPAA 2UUBB 4F86A 1LJUA 3BMCA 1WV1A 4PGFA 1IY2A 5CXXA 4QBKA 3I42A 4EP1A 5BMVB 4O1HA 4OTZA 1OFGA 1G2IA 1W73A 2GMWA 3GJ4A 2VDWB 2WM2A 2R6AA 2Y2UA 3KQTA 3QNUA 4I7EA 1ISHA 3VVCA 1SCJA 3P97A 4FONA 1OH8A 3UAVA 1BCSB 2JAWA 3MRVA 2A86A 2J0QA 2BE7A 4OREX 3L4JA 2NYUA 1JSLA 3DTNA 4HN2A 2QPTA 1WL8A 1XZKA 3Q3VA 4U5XA 1WV0A 4OIFA 2PL5A 3ZHTA 1NLZA 3PIIA 1NBWB 2YZ2A 3DW3X 4EFDA 1K8ZB 1B8NA 1IVSA 4P84A 4YJ2B 2H92A 1JG1A 3GEHA 2YYSA 1N7IA 3VYVA 1BFUA 1UMCA 3H0CA 3M2PA 2IVZA 1MABA 1RIFA 2N42A 1DOZA 4R3UC 7MHTA 3OC6A 5LM3A 3REGA 1V71A 3K53A 4PIMA 2IV7A 1W25A 3QXXA 4HO1X 1KMHA 4MRVA 4HGNA 4YXFA 3ZGZA 2O0LA 1CR2A 5CDYA 3GQBA 2ZSBA 4LKRA 3ZWBA 1CEYA 4FS3A 1XCBA 1YVPA 3ZNOA 4JEHA 5GAJA 3IT3A 1JGTA 1PRYA 1XPJA 3RBAA 1I51A 1DX4A 1AKEA 4GYWA 3RYTC 5EVCA 2E89A 5HGJA 1PFWA 3MTBA 1NJ1A 4NMWA 4RPHA 3CT4A 3LW7A 4GEGA 1WP9A 2VKQA 1HT1E 3HKBA 4KZPA 2KHZA 1CD5A 1Z39A 5KVCA 3IKMB 4DBLE 1BCRB 3KHKA 4HY3A 4PCLA 1I4EB 2HMWA 1OKKA 4EX6A 1M7BA 2QYOA 3V2UA 3JWPA 2F7SA 2N9UA 2I55A 1R10A 1B2RA 3I8SA 1PYOA 1ZM3A 2X0JA 3LVRE 2EP5A 4O4JF 1UOPA 4E22A 1N2HA 1LB1B 4DC0A 1M0EA 2O8FB 4YY3B 1R37A 1G4HA 1RBYA 4TYPA 4DVJA 5EYPB 1Y8AA 4C03A 3VXKA 2BEWB 1Y9AA 4MLDA 4N0DA 2V55B 1IPEA 4OKSA 2JI7A 4J4TA 4RV5A 5CJJA 4EF4A 4N6OA 4GKJB 1J24A 1Q7BA 4GOJA 4URXR 3VMFA 2F43B 1HLPA 4RSGA 3GBVA 3OIVA 2H9IA 5EGSA 3SAJA 4YDQA 2ZIXB 3HO1A 4K46A 3WB9A 3QWIA 4AKEA 1NXPA 3OE7A 5CH8A 1XJCA 2NSYA 1USIA 2JLCA 3IR7A 3GT4A 2FX5A 1NWHA 5C7LO 4Y2PA 1JNXX 4JI2B 4DMUB 1TM1E 1ZM7A 2QTVB 3ETNA 4CLOA 5JC8A 4YPOA 1ADJA 4OHXA 5FAKA 3OOYA 3VPDA 3CUWA 3UGJA 4WOJA 5BOSB 1RYYA 3N6RA 2VJYA 4KBGA 2M9MA 4EGQA 1CJMA 1P81A 2GNPA 3OCJA 1VLHA 3PJGA 4L75A 3GUHA 3IHLA 4KRYA 4XRRA 4CQJA 1N9GA 1T9ZA 4WE3A 1NAIA 3QBVA 4PSVA 5CFLA 3A4MA 1II0A 4HXGA 4PZZA 3OX4A 4B3MB 1T9AA 2DWOA 1NATA 3C3BA 1E2BA 2XZLA 2J8ZA 2PFSA 3IE1A 2FG6C 1QQ5A 2PH5A 4K9KA 2GZ2A 1R5OA 4KZKA 4LEIA 4XR4A 2Z2YA 2OD9A 3TK1A 3LU1A 1ID1A 1GUAA 1P2FA 3G2JA 3HJBA 3L7IA 3MJ4A 5EUBA 4BE9A 4DCGA 3OPYB 5KYKA 1SH7A 3L82B 2VK2A 1SUCA 1KAOA 2TMGA 4CT0A 4LZPA 4RIEA 3DTTA 2HJVA 3LCVB 1T6ZA 2YRFA 4KFTA 4IJ5A 3CFYA 1HYGA 4I6JA 2NZYA 1VPTA 2BF4A 2FTKE 5U1PA 1C2YA 1CQJB 3JQAA 4DR2B 4G1UC 4FMCF 4LWPA 2RONA 1Y48E 1PQUA 4O4JA 4Q02A 3AHJA 5AD1A 2HL6A 1GZ6A 2XUJA 4JBXA 1Q17A 4PBRA 1V26A 5DZSA 5LBTA 4DLNA 2EZTA 2P3LA 3K5IA 1NBHA 1AS2A 2VA8A 4HUJA 4CU5A 1HWYA 2J0SA 4K0RA 3TECE 3BSYA 2X0NA 1SXJE 4BN4A 2B4TO 3OZCA 2WQZA 1J8FA 2HPAA 4RY9A 5J9FA 2GCPA 4JOSA 3KHTA 4FFVA 1NHGA 1BA3A 4OSPA 2JA2A 2DBQA 2EKZA 1TVMA 3JYLA 1AKNA 2C4VA 2UAGA 3VC2A 1O8BA 1Z45A 2O0KA 2Y67A 1FU7A 1KFBB 1UOEA 1TTTA 1U2GC 4R6WA 2ZQZA 4CIXA 3PRKE 5FPKA 2AFIB 4Q7LA 4WOCA 1K3FA 3K8YA 1H1LA 3O3OB 4ZYUA 3RRXA 4I99A 5K01A 3QJGA 5E95A 2PRZA 4R8KA 4HEJA 1L7AA 1F4VA 1Q57A 3UXEA 2IUYA 3GPIA 1E3SA 5BO5A 5K6RA 2CB0A 4YWJA 3ZI7A 2AE2A 5DHPA 4NS1A 3GNLA 5HG0A 1GUFA 5ITWA 3M6VA 1ISMA 1U8AA 2DPGA 4KXLA 4NJEA 4DB2A 1SUAA 2O20A 3BILA 4LISA 2X7XA 5FFMA 2F8TA 3AIKA 3TX6A 3BFPA 3FAKA 3PGKA 1HE1C 1QAQA 2WM9B 3FHOA 3QTLA 3RC9A 2BYTA 1WSDA 3C5HA 5C8VA 2DHCA 2H2IA 3UXHA 5HK8A 2UZ3A 2FEAA 1FSZA 1JEAA 3I4CA 1RLIA 1DJNA 1YZGA 2FZWA 2WA2A 3STYA 2C8VA 1E4VA 4G5FA 3SS8A 3BDIA 1IG3A 4PYOA 3GUUA 1IXKA 3HWRA 2G88A 3HG7A 1KYXA 1EFVA 3A26A 4HL6A 3B38A 4MA4A 3UJ3X 5B1EA 5GJWC 4KLZA 3HR7A 5JJLA 4ZU3A 2RHOA 2DZDA 2XYPA 4S2EA 4BFZA 2YZ7A 3O3NB 3S27A 5AUPB 2ZRNA 3PT5A 3O8NA 1VYHA 3ETLA 5EUCA 3GR6A 1NURA 4IFTA 4JQZA 5DLPA 4PLTA 4EY5A 4C4RA 3OO1A 2JB9A 4LXTA 1TCCA 3OEYA 5K09A 5LQRA 4WDQA 4B3SB 1FBNA 3EXAA 4X20B 1C1DA 1VL2A 5GJBA 2AUMA 2XMQA 1PE0A 3K1YA 2H57A 3TLZA 3W05A 5BMOA 1FMJA 2J6IA 5KSWB 3N07A 4YP7A 5JQWA 4DV4B 3VU9B 2YXLA 1UQRA 3B3QA 4HTFB 4KWTA 1KQ3A 2HMTA 2NMVA 2JL1A 4QUEA 4YRMA 4F84A 2R2AA 4XGRA 3EHDA 1W52X 1GA1A 4Y6GB 2BGNA 2ZP1A 3IXMA 1TADA 5LQKA 1U8FO 4N0EA 4R68A 3C6ZA 2V6IA 2EGUA 1U0GA 2R79A 4MKHA 4RCZA 4XH9B 2EOAA 3LQYA 3NV9A 3ZJVA 5TT0A 1J2RA 4ZAZA 5KQPA 2EFEB 1U7HA 1BGWA 4ZT6A 5B1HA 1ECLA 2RC6A 3ROMA 1NKVA 5ITVA 1HZZA 3JCZA 4CKEB 2EXXA 2X42A 4HJRA 4NOMA 3SC3A 1MZPA 4Z7JA 1O89A 3QHAA 4HDMA 2NNWB 1CEXA 2V5AA 1IZ7A 1REQB 3K8QA 3AR8A 4LXQA 1H66A 1PVVA 4P6VF 3OE1A 3VR2D 4F2PA 4B3HA 1KU6A 3AJ9A 2B1QA 2R5FA 4HQFA 4MP8A 4OQPA 3NBAA 1EQAA 4DJJA 1XU4A 4QVKA 4DC1A 1FFCA 4HWTA 4OI1A 1UJMA 1MENA 3HCNA 4IMJB 3W1WA 4HADA 2UV8A 3M4XA 1LK5A 2JJ1A 4LVOA 4MV7A 4OXKA 2EEZA 5IG2A 4N5DA 4TRJA 5KHOC 2LZ0A 2RHMA 4JNKA 2VNAA 4XX0B 4W5JA 1VKZA 1E1MA 3NEYA 4JUDX 2AZ4A 3T99A 3HEBA 5JSZB 1RU3A 4JZKA 3EBOA 5CH3A 4PLHA 3TRDA 1WBDA 2ONYA 3EJWA 2CL5A 4Z9AA 2ZE8A 3ELUA 4IGKA 1P7CA 4KXVA 4US2R 1MJHA 2WUDA 3FG9A 4EECA 1POWA 4URYR 1EK5A 1ZSYA 3ISJA 3RTCA 4XFKA 2M1XA 1Z2DA 2W2NA 2FDXA 1X38A 3NVMB 1JMKC 4Q9LA 1UZAA 3RVJA 5JJIA 3NGXA 4OXRA 2FG5A 3ZXIA 1IQUA 1EMDA 1AK9A 4K6GA 4FN4A 1RSZA 3LXRA 4TOIA 3RC3A 3T7TA 3A0UA 3CLRD 3JYNA 4WFKA 2OO5C 4D5GA 1B23P 3LUFA 3U3KA 3JPYA 1HO3A 1J5EB 4QOSA 3C8DA 1HT3A 1PR0A 2OFOA 4LF7B 2AEJA 3CISA 1BRTA 1R8XA 3HCEA 2I3BA 4OMUA 4YQZA 5LXTB 4PC6A 3NTUA 3LX8A 2J6HA 3OM8A 3HN2A 4AMUA 1FFBA 2J3KA 3S2IA 3K0SA 1VCMA 2AI1A 2OBYA 4D9BA 1TVEA 1WOYA 2ES4A 2SNIE 1R27A 1P91A 2Q2QA 5CLLA 3DBIA 1VL0A 2O0HA 3KU4A 1UDAA 2I6SA 1UEJA 4RKRA 2IHVA 4H0CA 1Q12A 2IPNA 4HQKA 4YFYA 2VP9A 4O02B 1N2JA 1HQKA 2PH7A 3RABA 5AOVA 3ZDYB 2BGRA 1AQ6A 4DBZA 4RVGA 1AKMA 1XXLA 2XCIA 3N58A 4L8VA 3JD2A 3LJKA 1U6JA 1QAMA 2HH9A 4HATA 3EPKA 3P2EA 4YROA 3L8GA 3WMFA 4MEJA 1K8RA 3EEOA 4GW3A 3D6HA 3TPZA 4GLBA 3VJMA 3GV0A 1JFSA 3I1IA 1HG0A 5CYGA 1G8FA 1HOXA 3DE4X 3F7MA 3R4VA 1Z5GA 1VSUA 4RDHA 3BORA 1D9ZA 2AKAB 2VF2A 2YL2A 3E9ZA 3ETCA 3GGCA 3HCWA 3PQFA 4PONA 3MWDA 2GSDA 5DTJA 4YQYA 1KWKA 1EFUA 4X61A 3MUFA 5CA0B 1FCJA 5HKLA 3SJBA 3GJZA 5DM4A 5T4BA 3E8SA 4DKXA 2W2LD 3DBOB 3ETJA 1OXKB 1L4EA 2PD3A 1XCGB 1AV7A 1UMBA 2F3PA 4JI7B 3PHJA 2PPLA 4WZAB 1ULSA 1TZMA 1GL3A 3P9RA 3OEHD 1XTIA 1KC1A 5CLGA 5LYYA 4IKEA 3NTXA 5LMZA 4KYUA 2IC5A 4D0LB 1ZH2A 3NEPX 2ZXFA 3MUEA 1WIWA 5BQOA 1Z5UA 1I0ZA 4A0GA 3A9VA 3U1BA 2GN0A 4J0FA 3OP1A 1V5FA 2O8EB 3LUDA 4HSEA 4HNUA 2WJWA 4FIZA 4CF6A 1BGVA 2NUPA 5K0BA 3WK6A 2ZI4A 1AH2A 3EDMA 1T36A 1KIAA 2EX1A 2ZB7A 1Y1TA 2HHCA 5AWFC 5D3ZA 1K5GA 2V0NA 4JI3B 4Q39A 1PW7A 4RENA 4JBWA 4IIGA 3NG1A 5FUVA 5C1PA 1ULBA 2OK7A 2JK0A 2QENA 2VBFA 2O2CA 2DJIA 1HXHA 4IJ6A 1YQEA 1KO5A 4FEEA 4TM7A 4CTNA 3ZD7A 3HHEA 3RS8A 7ABPA 4LOIA 5ECDA 4PRLA 2R00C 3TSWA 4LV8B 4ZQFA 4DXDA 4BVEA 1K2WA 4WKPA 1MT3A 3CCFA 1CQXA 2Q3HA 2F59A 4XRGA 3OKCA 1N7HA 3CRVA 1TPZA 2HK6A 1YFJA 1HURA 4WK2B 1GQQA 4IDHA 2B7CA 2PR2A 4TWIA 1YDFA 3UNXA 2NQTA 4X00A 1U2QA 4RYDA 2NAPA 1F9EA 3E7WA 3BXOA 3ICWA 1VPWA 2VJBA 4BP1A 2CF6A 1UBJS 3K0CC 4U2KA 1ZCJA 5DN6A 2V96A 1UXJA 3K0FA 5KYWA 1ACLA 1UPXA 3W3AH 1V11A 3BJZA 5T41A 4G4SP 4WY2A 1Z17A 3GLGE 4M0KA 4ENUA 1XPOA 2J09A 1M2EA 1YVDA 1IBRA 1GWNA 1CP2A 1PFUA 2HQOA 2VH1A 3NBYC 4OGFA 2PBLA 3DAOA 4K88A 1G0OA 3D8HA 5GTDA 1M2VB 1OC4A 1JAHA 1EBUA 1BN7A 2JIBA 2IZ1A 3AUUA 1GG8A 3AHIA 2BR3A 3LLVA 4YDHB 4PR3A 1BMDA 4N5NA 2WU0A 4D9EA 2XTZA 4IQ4A 1ZVKA 3TBKA 5AOCA 3R23A 4MGIR 4N5LA 3QELB 2HBZA 4BAZA 4AU1A 4F8YA 5ALWA 2YV1A 3CSSA 4NC9A 4BRSA 4ZO9A 3DFIA 3RRZA 1ATIA 3VO2A 1Y42X 1OB5A 4YS6A 3B13B 2XOKD 1I9CA 3F8TA 1QHHA 1F2TA 3INTA 5LBIA 3VHXB 2R7KA 3D59A 4P38A 4CI0B 4F3YA 1QHGA 1WZEA 5F9MA 5LIRA 2F8MA 4BHTA 3LK7A 4PBTA 3W9YA 1NE2A 5E4FA 3RIMA 2QPLA 2VJDA 3LA8A 4IDGA 3U3OA 4DDVA 3OZBA 4KIGA 4KGDA 1VGRA 4DJFC 1MRZA 2WM8A 1W0JA 1ZJZA 3LUJA 3O6VA 3PC8A 4OQDA 4RZ3A 4AKIA 3M2TA 1E8MA 1K8QA 3SS7X 4LAFA 4ARVA 5IN4A 3L6OO 3FUCA 3NC1C 3KVOA 5JXJA 2P9QA 3LPMA 2C4NA 3OCWA 1OXMA 1I3LA 1U7OA 3P71T 4YJ3B 3U3MA 4FOPA 4WK6A 1QYXA 1KJ9A 1ETHA 4D3DA 3EXG2 2R4TA 1OAKA 2PLFA 3BGDA 5JWHA 3AIMA 3VVLA 2E6UX 1Q3HA 2X19A 4Q6BA 3MXOA 4P0QB 3PRJA 1CDEA 5KJCA 4FFMA 5AHOA 2JKVA 2OHVA 5AI4A 1AUXA 2CLFB 5SYNA 3KZVA 3VR5D 4CIDA 5C81A 5I8WA 3D5EA 1Z0IA 3JTEA 2ODAA 4K8OA 2WINI 4M53A 4AROA 4DDUA 1RWOA 2C2KA 4YRBA 4JJIA 5JYCA 2DQ4A 1KXJA 1RWWA 2Y27A 2YMLA 3HNRA 3OOEA 3LWBA 1UXHA 4XKJA 2I9PA 2W6CX 2YUTA 3AU9A 3H5IA 3M6IA 1ARZA 1TTHA 4CIYA 4INPA 1WPXA 4B6FA 2WHYA 5DYTA 2HSJA 3S2FA 3FI9A 4AIRA 2LDBA 3WFZA 2HHJA 3C43A 5ICEA 2OORC 4X95A 1NBIA 2WG0A 2EW8A 2Z3WA 3FHLA 4OAPA 2FDRA 2H06A 1ODCA 3ND7A 1RC8A 3TBHA 2GPBA 3PUJA 2YHSA 3Q41A 3L84A 4A3SA 3NVKI 1LK7A 2C5GA 3CW9A 3OECA 3L0PA 1FYWA 2WUGA 4GPIB 3RS3A 4EGJA 4YPVA 1H6AA 2AA3A 2QSUA 1X14A 3K0EA 5WRFA 3SN6A 2PFGA 1FMTA 3ESXA 4UZEA 3ODGA 4K6MA 1XMPA 1FRFS 4U7WA 5AOBA 5FWXA 2GM3A 3OZ7A 2WMDA 3R5JA 3ECCA 4OQZA 4A0FA 4OCZA 5KMGB 2FRXA 3EXIA 1LBTA 4IKPA 1MW9X 3JTMA 1KYIA 1TMGE 2IDJA 1BS2A 2I7TA 4PPGA 1G8MA 4D82A 4GGOA 4P3PA 1U1DA 3E5MA 3LLUA 4FCVA 3WX0A 4B34A 4MCAA 4Q4JA 2VP5A 3L7DA 1KE1A 4D6YA 1Y3FE 4FJ0A 2PCLA 1OAOA 4ML3A 3EGIA 2ZBUA 4C30A 1JQJC 4G01B 4NXMB 3OUZA 3AM5A 4JMPA 4DHWA 3AKDA 3OQIB 5JSFA 5B6IA 4KPEC 5IRCD 2BH2A 2I3AA 3QEJA 5EUQB 4Z0NA 3SR3A 1M6HA 4E5UA 3NHRA 3LE8A 5G1OA 2VEDA 3P1JA 1Y8RA 5E2AA 2FZ5A 4LHXA 4NV1A 1K8YB 3LQRA 1JSRA 5EJ7A 3GLIA 2XXAA 4HDAA 2QLJA 2WW8A 1NMSA 3N53A 3LBFA 1A2OA 5DP1A 3BRWD 3QA3E 1QP4A 2XEDA 4Z1MD 5LZ5A 1UBOS 4RMJA 3UWPA 1W46A 1DGQA 3OWXA 1X7WB 1K89A 1YB4A 1AK1A 1UPFA 3FOAA 2JCYA 1N2OA 5H68A 1F4PA 3JASA 3WJ1A 1NQVA 3L40A 1O6GA 1K68A 3GK3A 4M55A 4MYRA 5KTTA 4ZQGA 4EHLA 1SUPA 4FYMA 4TMTA 1U7DA 3JAWB 1EFAA 4AVYA 2CL0X 2ATCA 3S81A 5I01A 2VQSA 5EMMA 1ZK2A 3NOOA 4EATA 5HJ2A 2WZQA 4BNDA 4B2LA 4OQMA 1NNEA 1VGQA 3B9RA 2VHEA 4WNYA 2V03A 2V9CA 4KDEA 3L1HA 4TKLA 3Q5EA 3N8KA 2Z6VA 1KSGA 2CUZA 2GCNA 4TLLB 4F6CA 4D2IA 2AG0A 3V7WA 3VPHA 1VMEA 4ARCA 2G7ZA 4A0SA 1SCUB 2PBFA 3PIDA 2ZWIA 2FXVA 2IUSA 3OZWA 2EKPA 1JPUA 1KY2A 1C7FA 1GNSA 2YICA 4O33A 3H84A 1OY1A 1WDMA 1KDPA 1NE7A 1XA3A 1IUNA 2QVYX 3A8TA 3ASVA 3PHBE 4LRXA 1LD3A 2F4VB 2KWIA 4BNFA 1U8YA 1L7XA 4DLRA 2FPGA 1EWRA 4GR5A 3WDLA 4KO2S 1N3BA 1GOTA 2VHTA 4YMUA 1VCOA 4E12A 2ZM5A 1HMPA 2A8YA 3TW4A 5CVJA 1XHFA 4PNZA 1JHAA 3ZGYA 4DEVA 4DIOA 3RUEA 2YVAA 3G5LA 3K32A 1SD5A 3G8YA 1K7YA 2Q3MA 4C01A 4IDEA 4EY8A 5KEIA 2WD8A 2DEUA 1X7GA 1KEWA 1HLDA 4URWR 1W4LA 4KN9S 5LLTA 1U99A 10MHA 1DAEA 3EEFA 5JZVA 2IHUA 1JR4A 3NM5A 3AESB 1EZ1A 3VKHA 2FQXA 1KI4A 3UW1A 3ZWVA 2YCBA 3NOXA 4LXIA 1VBKA 3ROXA 1NLUA 2RHCA 3IQDB 1LBEA 1PVOA 3E9NA 3LOPA 5KNDH 1GPNA 1I2ZA 2QQ0A 4D42A 2H4WA 3GEIA 5F12A 3COWA 4OHKA 1BEZA 4CDMA 1R6AA 4GL2A 4FYWA 5BR4A 5REQB 5HQJA 3E1GA 4QEKA 4C9BA 2ID7A 5D85A 5BMVF 2VQEB 3P9CA 2WAXA 3QYPA 4RVCA 1DSSG 1OIVA 2MINB 1ZD9A 2N47A 2RKWA 2V7EA 2XB4A 5IF9A 3CVWA 2I3DA 3QIAA 4DMLA 3EQ8A 3VUEA 2DHEA 1DKPA 2Z1DA 3DD5A 3ZEAA 3QU5A 3NKFA 5EMHA 3I04A 4QLOA 1VMAA 5CPFA 2BTEA 3A2MA 1U4OA 2IXFA 3A6FA 1STOA 3NEAA 2YJNA 5IAJA 3URMA 2F90A 2VRBA 3MG9A 4N03A 4YJ2F 1UAGA 1UZNA 2BC9A 4PM4A 5A4KA 5F9HA 1QANA 3GAFA 4FYKA 5I9NA 4L3WA 1XRPA 3OZAA 4KO1S 3L4SO 2KMLA 2P9FA 4U2GA 1K9VF 4IX9A 3X0DA 3FI0A 3PTZA 4UTPA 3GFPA 1DDIA 3DM9B 3WAGA 5KQSA 4AJPA 1BN6A 1BOOA 1IIRA 1HI9A 2G25A 1V6CA 2AXEA 1NU8A 1EJBA 3QVXA 4ZC8A 1RHJA 4YEDA 4EJFA 4COOA 3AC0A 5KNCD 4CMGA 1W5BA 1BAPA 1RYNA 2G28A 2PIDA 3HVHA 4LXXA 4PXSA 4NECA 2MDTA 2QUJA 2YR0A 3R7NA 5LWQA 3FKQA 4MS4A 5CX1A 4KC0A 4RY2A 1KE2A 1EX7A 1TJ5A 4HYEA 4EUFA 3R9XA 3K6JA 4XZ3A 2MOKA 1R64A 4F45A 1TMOA 2ARKA 2WVJA 3KK0A 4DT1A 3R3JA 3ZVKA 1Z36A 3HUEA 3FVQA 3P9QA 4TWRA 3QFFA 3AJRA 2IOYA 3RC7A 1WCIB 3ZE2B 2CFRA 4ND4A 4GOMD 3CLHA 4DANA 1PT9A 1WF6A 1GARA 1MA3A 4N4AA 1GFWA 4ZOLF 4A26A 5KDDA 2RKOA 2Y68A 1QLJA 3X1JA 1X39A 2G72A 3BD7A 3MS2A 1N4DA 5EHNA 4TWAA 5CMLA 4Q1FA 4CU2A 2NOAA 5E4YA 2AMLA 2IS2A 1J7KA 2QXYA 5TMEA 1T1GA 4WLFA 3D1JA 4PTLA 5TMBA 1WD7A 2H1RA 3RPEA 3JZFA 4C7VA 4F4IA 3PU6A 4TL7A 5A5EA 5BMVA 1V8FA 3IP7A 4RKFA 4WXMA 3BWEA 3GOHA 2VDWA 3C4VA 3AR6A 3HB0A 1TD9A 4MHTA 3QEMB 1QAOA 2AMVA 4P3YA 4C4SA 1H6BA 1K6MA 3NP7A 5D84A 3BVPA 4I3FA 2XUQA 1UANA 3WGVA 2IBMA 1CBUA 2FJUA 3PQ5A 1WE2A 1NW8A 4CI9A 2OUIA 1TM3E 3MWLA 4MLPA 3SZOA 5MFPA 4M0DA 2NYVA 3N39C 4DXHA 1X7XB 1DBQA 1P2VA 5CT9A 2QLMA 4AJ4A 4YJ2A 5M2QA 5KQLA 2GJ8A 2PGXA 2NXCA 1PS9A 4I5EA 2QUAA 1OGYA 4YXWD 4WBNF 4ISCA 1DI0A 3QOYA 5KREA 3JS5A 4NAVA 1I32A 4HNTA 3ER8A 4WVFA 5EQFA 4B9AA 2QPAA 1ZZEA 1XA4A 1SBZA 2HDHA 4B80A 3STTA 3P0HA 1YRAA 3HJUA 3DCIA 4YPFA 3TKYA 4AC9A 1ZO8A 5CXQA 2V6MA 4CMAA 1F7UA 3C8MA 2L82A 4EF6A 1XN4A 5HZGA 3WICA 2COKA 2V6GA 3FR8A 3LFUA 1R16A 2AJ8A 5DT2A 3S2GA 3STWA 4YYEA 4C2AA 3T3DA 5LNK6 2Y99A 2YMQA 3H1EA 3QPAA 1E3JA 4JP2A 3MTQA 4DUYB 1UJCA 1LKZA 2AKYA 4KE9A 5JYDA 1CR0A 3FPEA 3D4NA 3THWB 4D3SA 4EEZA 2JEYA 4ZMBA 2DR0A 1N6NA 3CE9A 3NLLA 2DECA 2WD9A 3C70A 4R2MA 3UCEA 5CYFA 3HZRA 4CDRA 1MTZA 1AXEA 3DOJA 3DQZA 1B8PA 3WLLA 1BCRA 1KBQA 4FCWA 5HF8A 3KT3A 3CH6A 4ZAXA 1ONNA 2YINC 5ALVA 1WSAA 5AK4A 2C4TA 2ZTUA 1GUDA 4ZOLA 1UDRA 5FA8A 1OWLA 5JJBA 1EAMA 2AK2A 2J07A 4BUJA 4QU8A 4P0TA 2IZZA 4AZVA 4P98A 1D4FA 2O8FA 3QITA 2IDKA 3GRYA 1YTLA 3OLZA 2PKQP 5DXFA 2A9OA 2PV0A 1P45A 2C1ZA 1H5UA 3KUDA 4K5QA 4NEQA 4O08A 1WAMA 1EVZA 3ANLA 2ONZA 5EYPA 1HDCA 5LLSA 1R6TA 5CDSA 1LNZA 1P1KA 3FOFC 1PFVA 2X0FA 3DBLB 2UUOA 2O0JA 1Y8CA 5P8WA 4BY9E 1JFLA 4LE2A 4QEDA 1TEVA 4FTWA 1UBUS 3KSBC 2R8PA 5B4UA 1E9SA 1QGDA 4Y1RB 2ZTVA 3Q7PA 2WK1A 3AX6A 3G9TA 2HA7A 3UGKA 4BFLA 1A7UA 3R4CA 3TZKA 3LO8A 1I10A 1VHDA 3WKCA 4QC2A 1FU8A 3UICA 3ZU4A 3D5QA 1JYSA 3AONB 4BNXA 2P75A 3GJ6A 5FXMA 4AKHA 2Q2VA 2DTDA 4WA8A 4KN8A 4Y9DA 3WLIA 1YMVA 3DONA 2QTVA 1GQOA 2DF8A 3VX3A 3D43A 3SBDA 1QYRA 6PFKA 1LSSA 3CR7A 2QR5A 5DW3A 1PLJA 2HMSA 4E09A 1NXTA 4NDZA 4WK4B 3ZHVA 3PFFA 4O4LB 3V8MA 2XMSA 1U3UA 2PUDA 1RZVA 1IPFA 1OX6A 1Y6QA 3TF5A 4GHWA 4ZYWA 1XTBA 2NPOA 1ZDMA 3ESAA 1XEWX 5CDUA 4K40A 3ZHUA 4CCYB 2W2MA 2BFBB 1NBMA 3LC1O 3I04M 4IFIA 4BO8A 3O82A 1KEVA 2VNIA 3B1KA 3FDJA 1O94A 3PD0A 5A9SA 5FH9A 1VECA 4RLFA 2UDPA 4QODA 3UM9A 1OROA 4BTLA 1Y4UA 1W94A 2W37A 3KKZA 3OPYA 4KUEA 4P22A 4ZAVA 4AXXA 4NBSA 5FB3A 4OO3A 3QQ5A 1T3LA 3WLSA 3P2MA 4LRTB 4UM9B 4UTVA 1CQJA 3C6XA 3IQXA 4E08A 2RGXA 4EFMA 1DELA 4RA6B 3M33A 4WW0A 2VSQA 3AVPA 1LQ2A 5BSUA 4WLOA 2BCGY 2IP4A 1LQTA 5LN1A 1OPRA 2G5CA 1L5WA 3CKLA 1DPFA 1MP0A 1KQOA 1SBCA 2F9LA 2PYDA 3RVNA 3V4LA 4Z5XA 3BJMA 8ADHA 4LK3A 2JGMA 3UAWA 2GAFA 3VU8A 1MA0A 1QIMA 2YV2A 1NAHA 3E15A 3F6SA 2QUBA 1W5EA 3A9SA 4P7BA 3FE2A 4RH3A 2ZIVB 2GZ3A 4AJ1A 5KVVA 3JAMA 1T2EA 1SQ0A 3ZGXA 1JAZA 2FWAA 3DVAB 4KO3S 2QSYA 2I76A 3KLNA 2PSSA 5GM1A 4MICA 4KU4A 3UJ9A 5D7BA 3DF9A 3X1XA 4ESVA 2CJWB 1ISFA 2JGJA 2YIJA 4ZVOA 3DNMA 1OIWA 5E0KB 4W8HA 5C1DA 1V7ZA 2AFIA 3FPHA 3DEYX 3UC5A 1ZVVA 4Z4IA 3EVTA 1QPGA 1CJVC 1HEYA 3A6ZA 1DJMA 1FVFA 1H5QA 1S9HA 4RZXA 3OKPA 4O0LA 1MQ8B 4MVWA 4Y9SA 1P5ZB 4Z7NB 1UM8A 1XJWA 3OQIA 4A2PA 2YJ3A 1JHDA 1RRMA 2D00A 2GA9A 2NV6A 4UUAA 1PQ4A 4BMOB 5KNBH 2CV1A 1M7HA 1WMDA 5FTKA 2HU5A 3PXUA 1KI2A 4ADSG 5IFKA 4PFSA 3ITDA 1I7PA 1RPJA 4Q3KA 1TYAE 1N6LA 3OIDA 2CUKA 4NBLA 1DO8A 4GKKB 1DXOA 1KZGB 4JT2A 5J4VA 2H59A 3BH7A 1U2GA 4KGVA 1D8TA 2VXBA 4R8LA 3SQXA 3E35A 2C2GA 1FFHA 2ZYWX 3RYHA 3B3FA 2A5FA 5GONB 5I7WA 5AW2A 5CTJA 3S55A 4OI0A 4E11A 4GX5A 3N2GA 5HDQA 5BUCA 2IHKA 3AR9A 1O97C 3EGEA 3FX2A 2CB9A 4YBZA 2EW2A 4IDFA 5JJCA 3KOOA 4QKQA 4ALJA 4ITRC 1EB8A 2JAPA 4LSWA 3W3AA 4YT4A 1XVAA 2V59A 4WA7A 3SZMA 3W8RA 4FHEA 4KLCA 5DN9A 3TSZA 3STUA 3RHSA 4EJ6A 5TF0A 5CBKA 1LH0A 3PLAE 1XTPA 4FJ2A 1XRJA 4BBPA 2Q0SA 1C8LA 3FPAA 4IXDA 4MVJH 2WU3A 1NI4B 3G7UA 1O0BA 3VU9A 4HTFA 3UYKA 4QAJA 5EKXA 4KAJA 1UBCA 3WQBA 2W42A 1JNYA 3ZTYA 3D81A 1KFKB 3PSAA 3R2JA 4S0XA 1XMOB 3CRMA 3TR0A 2OL4A 5LQSA 2V7QD 3ZHYA 3GLQA 3B20A 2GBPA 5CLIA 4B3DA 3MTJA 4OQEA 4V1CA 2ZRCA 3JVUA 1V3VA 4Y9TA 3I52A 4F7WA 1UPAA 1JDUA 2R60A 2QTBA 3BXXA 5KHAA 4F5EA 2K2WA 4Y0AA 3K9GA 4ER5A 4U2CA 4Y2RA 4K26A 4UNRA 1WCWA 4P34A 4RQTA 1IY0A 4K6KA 4TVBA 4KBYA 2JG3A 4EABA 2C00A 1P74A 3KTDA 1GRRA 3GFRA 2EJUA 3MT7A 4P8RA 5PNTA 4KQWA 2O07A 4PTYA 5CLFA 5K6AC 1REQA 3DXYA 3GLVA 3UWOA 3ZDCA 3NXSA 2VSFA 2Y9MB 1D6SA 4BVHA 5I7UA 1JR2A 1UFQA 3HWSA 3G2OA 2B94A 3N76A 2EDAA 2AFHE 1DKLA 2VOEA 3MOGA 2IE0A 2OY0A 4PANA 3W5JA 2OCXA 3KL2A 4GPTA 2IWRA 5A2QA 3CW8X 1HQCA 4X84A 3II6X 3I9KA 3CWCA 3IP6A 3K5PA 1Y3AA 1KDZA 3GLFA 4XX0A 2Q5EA 1O9HA 1EUDB 4L02A 4QD3A 4W5TA 1NQTA 3X1YA 1E7WA 3FWZA 4RGBA 1JILA 3VU0A 5JSZA 3S1AB 4J0GA 4DLAA 1TLTA 3D64A 5CA0F 4D1YA 3OHMA 5K0SA 1JXAA 4YCDA 1DAPA 1QCCA 2O2DA 4H6VA 3SIXA 1ZGAA 3ZE7A 2D1FA 5ERXA 2QL5A 3QKIA 3TDMA 5KYGA 1TJ3A 3ANNA 4D9IA 3RRFA 4Z2YA 4U39A 3FAZA 1XFAA 5AW8A 4DLXA 1CB7A 1COZA 4F2HA 1NW7A 4XD7D 4ZZ1A 5L51A 5K3EA 2Z56A 2JZOA 4JI4B 2D0PB 4LI3X 3F71A 3T54A 1SN7A 4OAQA 2O8DB 1Q95A 3BB1A 3WJ2A 2JDID 3PC3A 1YIOA 5AK0A 3KAJA 4AWXA 2FZVA 3NCHA 2VHYA 1W5FA 4FFDA 2QLLA 4EW6A 4WBXC 1ZGZA 2CSXA 3DDWA 4HEHA 4W5WA 1N75A 1JU4A 2C0QA 1JU3A 2VHCA 3L1JA 1XF1A 2CMDA 4QPCA 4U2EA 3TEMA 4RELA 1WXFA 2C95A 2ANBA 1UQUA 5DWQA 2QRVB 1DKNA 4HKTA 2ZIGA 4MR8B 3LQ4A 4N65A 3QF7A 1Y7TA 4MI3A 2H0QA 5DTQA 1BJTA 1WZIA 4AY2A 1UC9A 1GHTA 2WHXA 2YHIB 4PC7A 4PCVA 4Y6PA 3RSCA 9LDBA 4A5OA 4NR0A 4U7DA 3V1KA 4DS3A 1GGJA 3C6MA 1E7RA 3EHEA 3UAZA 1SCIA 2IX9A 2SCUB 3ULKA 3VR4H 3NIWA 2GBIA 1NT2A 4GPBA 2C94A 4UVEA 1RKVA 3LS2A 4YMTA 2OCDA 5BR1A 3D9QX 1JIVA 2BGIA 4PV7A 5TR9A 1I1NA 3T4EA 4AKTA 2WC1A 3BA1A 3LUCA 2EKDA 4DM7A 3CLRC 2XWQA 3OAAD 3ST7A 4C7JA 2AC2A 4C3UA 1UFOA 2MR6A 3P94A 3CLSC 1GDHA 2XNDA 3CIFA 3Q2OA 4LZNA 2QW0X 3AI3A 3COVA 2B0CA 4BO6A 1Z15A 4F9GA 1GAJA 1HFEL 3OJ0A 4EO4A 3B1VA 4FSXA 1FUYB 4IYRA 4KQ6A 4OBBA 4BRWA 4YUXA 3JZMA 4DZZA 2PE5A 7REQB 2SKDA 4UMFA 5CA0A 3LIPA 3U9LA 3ENWA 5E7JA 4EO7A 4Y2GA 1ZUD1 4AP6A 2Y2VA 3V3KA 5J4HA 2GESA 3N8HA 2PZKA 4I08A 2XMBA 3QVGB 1NKTA 2FEMA 4C89A 1CF4A 4ITVA 5D1NA 1QSGA 2ZU0C 4WZAA 4DUGA 3EG9B 2QRGA 5E4JA 2ZJ1A 3GH3A 1MO4A 3M4YA 4TV9B 4D25A 4CM5A 3PQ4A 4FMBB 2GUWA 3Q0IA 4K9DA 4O0MA 2ZTHA 2HADA 1J1UA 2IFTA 4GPAA 1Y63A 1DCKA 3C0KA 4P32A 4L0DA 3MS4A 4OLAA 2O8EA 1Z4LA 3WNVA 4CM6A 2AKEA 2QV7A 1I7LA 3VJRA 5A0TA 1D4ZA 2DWQA 4B5LA 3OWHA 1JAYA 2ZBQA 4IJKA 4IHAA 3VC3A 1EFCA 5KNBD 2GNOA 3GZJA 1CRPA 1QYCA 3K5HA 4S1VA 5DE3A 5EL0A 2Q8QA 1A9RA 1C9MA 2PSJA 2VHZA 1JEQB 1IWOA 1OU4A 1T0BA 1HE3A 2DHRA 5LB4A 1ZSVA 3WRVA 4GC5A 4BCBA 2CBGA 1BEEA 1N5KA 4DABA 2WWVD 2A0YA 1JH8A 2YWDA 4KQGA 4KSBA 5DHQA 4YJ3F 1YBFA 2Y1KA 3OCYA 4ARBA 2VDRB 1HSOA 1QP0A 1KYYA 3I0NA 2AE1A 2Q5JA 1GTRA 4ZICA 2ZI7A 1E6EA 1YK1A 4PXAA 5HK9A 5KTNA 1OTXA 3S2ZA 4XWKA 1DAMA 2AJTA 2CBXA 4R2JA 3HY3A 3VGJA 2R6JA 4PWZA 4R01A 1P18A 1YHNA 1SVNA 1Z75A 1ZH6A 2ODNA 3D7KA 2C7PA 4CMCA 3A4VA 3GQVA 1N25A 3IBCA 3QH4A 3QFRA 4GXNA 3SNHA 3RU2A 2ZGVA 5ULLA 4ON9A 1RXVA 4KSYA 3DKPA 3HHPA 3R7WB 1JKIA 8ABPA 1SOAA 5DNAA 5AUNB 5KNDA 1VKOA 2ZS9A 5G3ZA 5JIBA 3BG5A 1DKUA 3S5JA 4QFDA 1PG2A 3NUGA 3ZH9B 1WA5A 5KTYA 4JUBA 1I3NA 1M2VA 4FCTA 5EJ5A 4FFOA 1YVUA 3Q4GA 1NRJB 1PZEA 1SXHA 2YYYA 2AJBA 3GFQA 3PX3A 1QVVA 3PPYA 1AHPA 1K6IA 1MB4A 5CURA 3G0BA 3V00A 1TZJA 5GZ6A 4L4XA 4QJ5A 3WNCA 4DSNA 5KAMA 3QELA 1RAHA 4KE6A 3VHLB 1UJ2A 3N8IA 3USZA 4OB7A 3K0CA 3G2QA 1C7EA 1YDGA 5SY6A 4MQEB 1X1AA 3QVTA 2R6FA 4MIKA 1XC7A 1WNFA 1JIKA 1LCIA 1M2FA 2WV7A 3H1PA 1QZTA 4FYHA 2JJ2D 3L9XA 6ABPA 4IL5A 3DLHA 3OEEA 2PMBA 3ZZ0A 3BWBA 4EHJA 1H1TA 4L8LA 1PG5A 4CV2A 4LJ7A 4CV3A 3DEAA 4NATA 4M1MA 2W90A 1DCMA 3STXA 5INTA 1X92A 2X40A 2C7BA 1W47A 3BC1A 1L8QA 1W1UA 2D54A 3E8XA 3ZCVA 2IPMA 4X1YB 1PEKE 3KSMA 5JMPA 3TNLA 2Q2NA 1E6UA 2RGCA 3ZEIA 4YJ3A 3C4QA 3AIIA 3B6IA 1ZC4A 2IOHA 3N05A 2UVQA 2ECOA 1AGPA 4PG5A 4TTSA 5EKSA 1PJAA 1HEIA 1XQXA 2YOGA 3VKWA 2C9BA 2JCVA 1F8GA 1CUEA 3EZ6A 4C0KA 1BYUA 1RCTE 4V0KA 4WAUA 5DYGA 5DULA 3U19A 4C0QC 1C3VA 2P90A 1ZKMA 4FZVA 1YOVB 5F1KA 5A4FS 1UJ5A 4OX9Y 3JXEA 4GZ3A 3ZPXA 2WIFA 1CR4A 1JHRA 1AN0A 4JDPA 4DMRA 5FTLA 4QU9A 1M1ZA 2IHNA 3CH4B 3AILA 5ALKA 1GKYA 1NVFA 2H1SA 4NBVA 3V4ZA 2L69A 4BNZA 4DV6B 1DG1G 4GUDA 3FIUA 5EWJB 1TOAA 2O4CA 2QN7A 4DLWA 1ONBA 1AS0A 1GZ7A 3NAQA 4TLEA 4MV5A 1R2QA 4Y1GA 2F9MA 3SQOA 3IAAA 2XUGA 5DGDA 1FFWA 1OFUX 2I8CA 1G3IA 1XYVA 3AL2A 2XUKA 3NS7A 4E5SA 2ECPA 3NWEA 2P0AA 3CNLA 2OB2A 4ILKA 1J06A 4DSOA 1E7YA 4JBYA 4LYJA 4OP1A 1FTWA 1A97A 4CIAA 1XMXA 3W8DA 5HS4A 1FA9A 2P27A 1SOWA 1W85B 2B8EA 3PI7A 2BEKA 1NW3A 4LSGA 3TW8A 4NARA 2IZ6A 4KRFA 3RU7A 1TT5B 3GZTB 4HN9A 5GQSA 1LI4A 1J8DA 5AVRA 4OHOA 3VC1A 1DVRA 2CXXA 4NIMA 4PZ0A 4TQUS 4ACBA 4C5AA 5TS2A 2BRUC 2BBSA 3TLCA 2ZIAA 3BXHA 3SIRA 2JAXA 1RPAA 1JL3A 1SPBS 2OVFA 1NUHA 3TUIC 1YZFA 1RTKA 5KMGA 2C9ZA 4QXRA 2IHTA 1XJQA 3BHJA 3SC2B 1GZSA 1KNQA 4Z3KA 4FGUA 1XZBA 1NZJA 1FJ2A 3I9JA 3IBYA 1SFRA 5H81A 3BIXA 1E6CA 3BICA 5DOZA 4DRXB 4LWQA 1IH8A 2FMFA 4HZIA 4AG3A 5BWNA 3B9QA 4J4HA 4UEWA 1WXDA 2FR8C 2NXWA 4PQEA 4RJIA 4EB0A 3EDYA 1A1VA 5CM9C 2X9QA 2X58A 1HDRA 1VA4A 2EFHB 2C3OA 1VL8A 1YL7A 2J4FA 1H85A 2JD1A 1X1SA 3QYAA 3CWZA 5TB5A 4C87A 2C9DA 2LWIA 2OGWA 2R6R1 3LGSA 4PX9A 2PA3A 4I5IA 4KI7A 4O2AB 4W6ZA 3VYUB 1BVHA 8GPBA 1GG2A 5KKNB 1N2IA 1S3SA 3SBXA 1UMDB 1VA5A 2H5EA 2ZETA 4XSHA 4Z4CA 3NNNA 4MR9B 2J6CA 4E32A 4GDFA 3DE0X 4JVOA 5ILQA 5EZYB 4RIFA 1MO6A 4KDRA 3M1IA 4BLRA 4P4LA 3SEAA 4FQ8A 1PZFA 2FPIB 2H0RA 5U9CA 4PYJA 2ZIEA 1B26A 1G98A 3A25A 4XGKA 4BMCA 2IK8A 4RK6A 1NX6A 2P0YA 3IP1A 3EQZA 4II3A 5E9QA 5HRAA 4AY6A 1TVKA 4B3RB 3EWIA 1X7WA 3ECSA 2AHRA 3HJNA 1X8KA 2JBAB 2ODQA 4MYDA 3RYIA 2V7TA 1Z37A 4D43A 3I6BA 4GT1A 5TQJA 2WMOB 1YL5A 2O48X 2J08A 2QD4A 1TU3A 3JAWA 2OE2A 2HWYA 5CVUA 5DVZA 3VTAA 4PG7A 4TXLA 1QRRA 4V0NA 2GF9A 1CUSA 2QZSA 3QV2A 2VQ6A 4H0FA 2WIDA 4K86A 2OPHA 3WGUA 3B2EA 3ABQB 5BORA 3RARA 1IL0A 4L6IA 3NHBA 2QUIA 4DLUA 4CQLB 5H80A 5C1OA 1XUOA 2OESA 1QFSA 1E3WA 5AW5A 4B71A 3F1KA 4HBZA 1QE0A 5C5CA 3BWYA 1SCUA 2ZIFA 1C2TA 3USES 4F3NA 4JR2A 4UHHA 1EYZA 1PK8A 4X8OA 3A70A 2XCLA 5HTOA 5H3LA 5AVQA 3Q11A 3K0AB 5JUWA 3PUYA 1KSHA 2JJMA 3EGDA 4M88A 1L7PA 1JVNA 1TQ4A 4IRMA 5BURA 4AUMA 4J16C 1F5SA 4JIMA 3I2GA 3VX4A 4OJNA 2GDZA 1PN3A 2ZSFA 4P3OA 5GV8A 2ZR9A 3TQQA 4R16A 1SEVA 3K05A 2REQB 2C98A 2OOSA 3KC2A 4QUGA 1IATA 3SG0A 3AKCA 4JVNA 1WCV1 1V35A 1CZOA 4FGSA 5HBGA 2I6UA 2XGGA 4ZEWA 4YAGA 4L95C 3D8BA 3PE4A 2I4LA 3M8KA 2VDOB 1MUUA 2PMKA 3AESA 3JU3A 2ADMA 2B2NA 2A7XA 3NM4A 4HAUA 4M8NE 1Z6ZA 3H0KA 1DJOA 4TTAA 2PU7A 1MVNA 1OQAA 1FL9A 1YIAA 1EEXB 1PF7E 2Y3IA 3TIFA 4LGCA 1I7SB 3OLWA 3JRWA 1XJ5A 2P11A 4NMXB 4WADA 3CCBA 5JPDA 1C7ZA 2VRCA 2CNDA 5REQA 5K05A 2YWFA 2E7ZA 2O7RA 2YWGA 4I6GA 4LVNA 2XNKA 3ITKA 2YV5A 4TKUA 1T1EA 3OUUA 4I5GA 4B4DA 3FFAA 4J0QA 4II2A 3AUFA 1RPTA 3RB8A 3WLRA 1NJ2A 4BQQA 3I2FA 2MINA 4WBNB 2B4QA 4G0YA 5I4KA 1XVIA 3BKWA 1KH2A 2CCJA 2RAVA 1NYRA 3A7EA 3KJQA 4MV9A 4UZSA 3G8CA 5DSTA 4EHIA 5CITA 4RTNA 3GIWA 4LRSB 1T25A 1PL8A 3AOEC 4YP6A 4I5DA 5FWDA 4MVJF 2ZREA 5K3CA 5JO0A 3QNMA 1J0AA 1QU2A 4FYJA 1SG6A 1HL3A 3B2NA 4LYDA 4Q1BA 2HEIA 1KPHA 3IPYA 1CUUA 1AHNA 1DAHA 3COYA 3D1LA 5LQMA 1SXIA 3THYB 3AVYA 3AR4A 5AVYA 2MIIA 1JR3D 2W2KA 3BDAA 4IO0A 4U6NA 5DYIA 1YRHA 4ZDKA 2ZRHA 4JLKA 3VV3A 4D8VA 4DWWA 1E9BA 2C77A 4UFPA 5BN5A 3UJNA 1DJQA 1P7WA 1WP4A 2HUNA 4BRZA 4EG6A 4MS3B 4UTRA 2QX4A 4ZZ2A 2EAUA 2W5UA 4E3ZA 3A1UA 3UWMA 1EFPB 2Q46A 2VR1A 4FD2A 3RJZA 1B76A 1L8XA 4G2NA 1T9HA 4NSNA 5CM8B 5I7FA 4KR0A 3BCSA 5K4GA 1S2GA 1F5NA 2E4YA 2OM6A 2DU8A 4EUEA 2Q4TA 2FQ1A 2MHCA 4LYEA 2CHFA 2DSTA 2DH5A 1ZOIA 2CFIA 3G2IA 3HDYA 2QG4A 3JQ6A 5ANRB 2J3EA 2VUHB 3C14C 4MWBA 1WS6A 5JLAA 1MOSA 3GDFA 4ZI7B 2E1RA 4DA7A 2Y9PB 3ITEA 1Y9ZA 4IWYA 4UD6A 1BH2A 3DL4A 2JIOA 1R9GA 4DR7B 1CDOA 2VYND 4EG4A 4O29A 4X5OA 1WCIA 5H4HA 1RRCA 1QQAA 2VNJA 1GZ5A 4CM7A 4U6QA 1E2KA 2GF0A 3OQ1A 1JLKA 1Q0UA 4A92A 3SOPA 4YDRA 3VNVA 5A3QA 2PL3A 4UHDA 3HZZA 2RHGB 3IKLA 1X42A 2ILVA 2ZSIA 3HPQA 2WFLB 4JHXA 2H4ZA 1L5VA 4H6WA 1F6WA 1VE6A 4S1NA 1ECJA 3PEYA 2WFMA 4X54A 3GXBA 2CGEA 4AO6A 4DV0B 5DTEA 3BZBA 2OO7A 4KMRA 1VKHA 2CD7A 3LL7A 3BGIA 3P2OA 3IS3A 1TC1A 1AQLA 1FNMA 2AG6A 3QEMA 3TSCA 5HM6A 4NULA 3A1TA 4NPAA 5T5QA 3TLBA 2QEQA 4BEJA 1E66A 4Y7CA 2J48A 3P4XA 4UPEA 3E4CA 1YA4A 3L6CA 2G09A 4MVJA 3D54D 3FXAA 1CUGA 3TJMA 9GPBA 1ABBA 3NX4A 3ELDA 1GLVA 4GMHA 4H31A 1X7XA 4X8HA 1I6WA 3I8XA 1JXMA 2ETVA 3H9GA 4GP9A 4BP3A 2FJ0A 2QD1A 4JVLA 5HRCA 4KR7A 1OXXK 3EGWA 2W00A 1C0EA 2RG1A 3ND8A 2WU1A 1OILA 3D0KA 3PENA 1Z5ZA 1QTIA 4MVJG 4BGEA 2GYVA 2PUWA 4AICA 3VNBA 4EA8A 1Z5VA 4ZVPA 4HPXB 1VBMA 2HO4A 5GIPE 1OIXA 1DAGA 1UDWA 3RSHA 3ER9A 4QYSA 4BWGA 1PGJA 1SUDA 2CW5A 2AVDA 1ODSA 3N7UA 4OHVA 5LJLA 5TMPA 1H0SA 1ISJA 1Q7EA 2YOFA 2FWPA 4FOSA 4JHLA 4N3AA 2P30A 4WHMA 4X92A 4QPNA 3QBEA 1QRAA 4Q9IA 1RYFA 2BR4A 3QTBA 5DGCA 4V0QA 3THWA 5F23A 2NWQA 5HGXA 2A6PA 2Q3EA 3DEHA 3KG2A 4R0NA 1NYLA 1SB8A 3M5WA 4EG5A 5B2EA 5L3SB 2Z2KA 3LA6A 2FDCA 4RX1A 3V9AA 4XAQA 1DARA 3C3DA 3FTNA 4R98A 3W04A 4EUNA 1GNVA 1Q6ZA 4IOMA 2Z57A 3DMTA 1VJGA 4YR7A 5K8TA 4M98A 2BI4A 1YS9A 2WSMA 2WUEA 5EJMA 1HL7A 3L46A 3UHAA 2JGFA 2CLEB 4C22A 3AB7A 4PYMA 2NXNA 3CURA 3H9QA 5A4MS 1RQNA 2FW1A 3G82C 2GEVA 4OX9B 1DBPA 1RKQA 1M1YB 3DUFB 1NFRA 1PJTA 2EKBA 2H51A 2X76A 3H2ZA 1N5MA 4FXPA 3I62A 4KAXA 1TCBA 1TQ6A 4LCEA 3ICEA 3W8FA 3FSGA 3DBLA 4LSMA 2B9EA 3D3KA 5EIAA 2D1TA 3LPLA 4EI7A 3T7RA 3CCCA 1OH7A 3ZYZA 5DTIA 3N0RA 5HHTA 2DQYA 4Y1RA 3RUDA 1GGKA 4DJ5X 2X9NA 4EKEA 1Z63A 3A6LA 1QZXA 3ADKA 5DYYA 3K9NA 2D5CA 5HFNA 3EAGA 1QP7A 4JVMA 3QJYA 4QJ3A 1IY8A 2OG1A 1UPBA 4IVQA 4AZ3B 1H42A 2TECE 4WUVA 2FZLA 4O25A 3QVUA 1ORIA 1T5IA 2MSKA 4KQFA 4BCCA 1R66A 4H7PA 5L3ZA 2NU7B 4EMTA 1SQGA 5LZ9A 3NT5A 1CIVA 5I8PA 2HPZA 2BGKA 3PV0A 4LYHA 2PS9A 4DQDA 1E2GA 4UQOA 3U7FB 3EXEA 1XYGA 1A5BB 5BQ3A 4UVDA 2CFOA 3JQ8A 3L02A