4LY3A

Crystal structure of wlard, a sugar 3n-formyl transferase in the presence of dtpd-qui3n, dtdp-qui3nfo, and thf
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
271
structure length
271
Chain Sequence
b'HMIKICIAGKNNIAVNSLQFILKNYFEADQIVVIPNKNDKGIDSWQKSLLKFALDNNIKIVTLDEIYNIEQIIFFSLEFDQIIKIENFKSDRLFNIHFSALPKYKGVFTSITPILNNELESGVTLHRIDNGIDTGNIIDQHCFPIDINDTARDLYFNYLKYGESIFKKNIQTIINNSYKDLKQTNINSSYFSRKDINLVHKINFKKTSFEIHNQIRAFIFQEYQLPIINNSKIIKSILANEFIGYNVFEEFENYFIISGIDGFKIIAQKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a sugar N-formyltransferase from Campylobacter jejuni.
pubmed doi rcsb
molecule keywords WlaRD a sugar 3N formyltransferase
source organism Campylobacter jejuni subsp. jejuni
molecule tags Transferase
total genus 88
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ly3A00
4LXQA 1Z7EA 4LY3A 4LXXA 4LXUA 4LY0A 4WKGA 4LXTA 4LXYA
chains in the Genus database with same CATH superfamily
1BYIA 2RGDA 1JLLB 1L2TA 4RL6A 4IIDA 5A5GA 3SGLA 3K4HA 2BMAA 1W46A 1ESCA 3WBBA 2JIBA 3IXLA 3QFTA 4BVGA 5IJ0A 5L7TA 1FTYA 5FEUA 2LWIA 1P7YA 2P35A 1J5EB 3S99A 2YZ7A 1RPNA 4BVBA 2DFKB 4YRZA 1NJSA 1JIUA 5ILGA 4CG0A 3C3JA 1JYEA 5IKEA 2RHBA 4WMLA 4EB8A 1WABA 1AKYA 1OX6A 1Z0IA 2YC4C 2ATIA 3ETDA 3HNRA 3MUNA 5D3QA 2I65A 2VK2A 2JGKA 4P3YA 4IIJA 1L1QA 3M3HA 3TWOA 1XEXB 5HCNA 4C43A 3L6OO 3GNSA 1QKJA 3PDWA 3GLGB 4D25A 4J0EA 4BO2A 1J4AA 5LBTA 4CF7A 1QKIA 3IOCA 3M1IA 3O8OB 4C06A 5L4NA 1D8AA 4R05A 4RPCA 5HEKA 4L51A 4WFJA 4QUKA 4M1QA 1IAVA 3EIOA 1JL3A 4CM1A 1KI1A 3EFHA 3KQQA 5ALDA 1R00A 5LP6C 5CVJA 1XMQB 2Q0HA 4YV7A 1NN1A 3WJ7A 1ZN8A 2HPHA 2B8NA 2CK3A 2JFYA 1C8LA 1IHPA 2JRCA 4DJAA 4PX3A 1KJNA 3E61A 4ITRC 4YMUA 4MTCA 4G2TA 3SSOA 5IBPA 3ETJA 3IDZA 5JH7B 1M9NA 3KOXA 4LVOA 3TGPA 1XQXA 1W36B 1GAEO 2ZAOA 3K8QA 3PQEA 2Y3IA 2H92A 1UJMA 1WA5A 4BCCA 3OC6A 1LLFA 4QJBA 2Z2YA 4OOFA 3OECA 3U48A 3GROA 3UKJA 2V98A 2F7SA 5F4ZA 2ZWAA 3DJYA 4M86A 4TMZA 3BMOA 2I3ZA 2X5NA 2V6BA 3OEEA 4Q15A 1BA2A 2OVFA 1TT7A 2M1ZA 2VNKA 4RD1A 2HK6A 1XU9A 4TLBA 5J47A 1NNEA 1UOPA 3HDVA 3G23A 3B7GA 4DDKA 5E8RA 2ZB4A 3UQZA 3HCRA 3PNPA 4IJKA 3FF4A 1FMJA 3CEAA 1SHLA 1W8DA 2CUZA 3MMPA 2EKBA 3TN7A 3H5LA 1UBTS 4I6GA 3DQZA 2JIOA 4J0DA 5IYZA 521PA 1Q0QA 3GO4A 4L5YA 4L08A 4JYZA 1GL9B 3GFSA 1DBQA 3W9UA 2FW7A 2PAAA 3UMSA 1F8FA 5C80A 2FQXA 1G60A 2AB0A 3DEFA 5F1PA 5ADUS 1IHDA 3HUTA 1NGSA 1PN3A 3QE4A 4BMCA 2AKAB 3U3DA 3X0DA 1IUKA 3WNCA 3NBMA 3VBEA 4DCOA 1GNVA 4KK4A 1JFSA 4B3TB 3G68A 4LJRA 4EF6A 5ISMA 3SIXA 2J07A 1EZZA 3WGJA 2NW6A 4M1EA 4Y7CA 1G7RA 3D7KA 2O2JA 5HRAA 4OMFG 1JAXA 4XIYA 3S2YA 1W47A 2EZ9A 2PVPA 3R0VA 4C0WA 1RLUA 3BWXA 2XJ4A 1OX4B 4IDQA 3IKTA 4P3KA 2PUCA 3G0DA 4GMXA 1CB7A 1F8UA 4X97A 4GYKA 1J2JA 1EIZA 5AKHA 2I4IA 4HPXB 3WE7A 3C7AA 3MLBA 5CVTA 3AQ4A 4Z51A 1XE3A 3CNLA 5EYPA 3SG0A 4DSTA 3I1FA 4YP1A 3QEKA 3ROQA 1JVBA 3CCBA 1MTOA 2B1JA 1KDYA 4PCUA 4Y2QA 5LQAA 5IKXA 3CCCA 4JBNA 4R8VA 1BJRE 2EYQA 3CZMA 2AW5A 3E58A 4PWZA 5FNVA 3VR4H 1C14A 4BLWA 1O9HA 2XNJA 4MR9B 1JLMA 1RDFA 1L7BA 1MF7A 4CF3A 3R5TA 2FWRA 5IDYA 5KQPA 2JNWA 3AOGA 1YA4A 4DCTA 3KUUA 2CNWD 3A31A 3AF1A 4DMKA 2DPHA 1TE2A 3K2QA 1Y7HA 2FE1A 1UZNA 5H68A 2O1SA 5LA6B 4HEHA 3FJ1A 4OQDA 3Q7PA 3RSFA 3ZS8A 1R4ZA 2EBHX 4X61A 3DZGA 1FFSA 1SJ9A 4RXTA 3OQIB 3H5AA 3TBFA 2QMHA 3B6ZA 2ODAA 3RVSA 3SSMA 5EZYA 4YRTA 2DHDA 2QRHA 2GAFA 3TL6A 3ESRA 4BNKA 5DNCA 5DBIA 1N6HA 2JH8A 1BS1A 3AI1A 5EMLA 4IH1A 3ELBA 1E96A 1SVOA 3LT1A 3QFHA 5IF3A 1FSPA 1BFUA 1K7SN 3P9KA 3Q9UA 1XXHE 2CMHA 4KW7A 2ZROA 4AC9A 9LDBA 3FFAA 3QUTA 1SRQA 1QV6A 3G17A 5LYJA 4PX2A 4IIBA 1W2GA 2OR3A 2XJ9A 3S2SA 4IIUA 4Z4CA 1EXVA 3A6KA 1DC6A 3L8EA 1OY1A 2GM5A 4XWGA 1ZNXA 1ENOA 2ZB3A 1ETHA 5I3CA 1INLA 2EWWA 3INYA 4AQDA 2VJKA 2WKPA 1LSOA 3ZNNA 4BAUA 5JAUA 3HCOA 3EX7C 2CSXA 3AHDA 1VJRA 3I9OA 1KTIA 5C7LO 3I30X 2A9OA 4M7WA 2ZP1A 3BXXA 4GM4A 1U7PA 1T9KA 2W11A 2AC7A 4HRAA 4IH9A 2XRFA 1FDRA 1NU8A 4HDMB 4QE3A 3TOSA 3CVXA 2YY5A 1H0RA 1DDGA 4AJ4A 3K3PA 4AS3A 5IVKA 3FTFA 3LECA 2FPUA 4HUJA 2GN8A 4KQ2A 4UUBA 4AJNA 1NF3A 1VMIA 1PLLA 2JK0A 3B1KA 5GZ1A 2L82A 3I62A 5FUBA 5KYVA 2LDXA 4XPIA 4FMCF 1B43A 2P0YA 3KAJA 5AVWA 1COWD 2PGJA 2V7EA 3I1YA 1P62B 3HBFA 4GRDA 5K3SA 4DA0A 3NFYA 2CHVA 4QTTB 2HLDA 3P71T 4KXUA 4N8SA 4F1JA 2E85A 1O5OA 3C3CA 5HCUA 3U6BA 5EHIA 1FXWA 1ISRA 3K53A 1Q2UA 4G23A 4YACA 1QOPB 2QY6A 2Z2IA 2WIFA 1SO8A 2O1XA 4JUAA 3DONA 1RBQA 3PXXA 4JI8B 1TEZA 2BKUA 5TGTA 1L7XA 4MAAA 4E14A 3KP1A 4MDHA 4A91A 2W6ID 3BWMA 3N87A 5EHNA 2PNFA 2GILA 5IVDA 1SN7A 3ECAA 2HRZA 2OC9A 2WPDA 5A5FA 4YYZA 2FSHA 4G1VA 5IKOA 1TCBA 1N2ZA 3ZKWA 4REMA 3GEMA 4UAUA 5K3DA 3MWDA 5EP1A 5HBRA 3WB2A 5ALVA 3ADDA 5A5VA 1ZD8A 3ET4A 3WMRA 1W1UA 1KQOA 1KFKB 1T5LA 2ZRKA 1Q3TA 4YJGB 3ZOZA 2IUEA 4KFCA 1U98A 4GE0A 3C8ZA 3ROMA 4C6TB 4TLAA 4OQXA 3CVYA 2VP3A 1KDPA 1ZUHA 3PUIA 2DPGA 1O9BA 4LI0A 4DIUA 4UVDA 2N42A 3H2JA 1YOBA 2PMFA 3C6BA 1QH1B 2HBRA 4PVDA 1O97C 3UW3A 4AMUA 2ZQ5A 5FJJA 3GVHA 3OC0A 2AJDA 3EFEA 2GO1A 3E3LA 3GL9A 3N28A 4OXRA 4QEKA 3NWEA 4DA4A 2QW8A 4HVLA 4G56A 4S35A 1R50A 2GAAA 4Q5IA 5ENZA 5F12A 4CTNA 4M0EA 5I7UA 2HDNB 4X1IA 4V0KA 2CB9A 4OHOA 3WRWA 1HFEL 2BR3A 2PZJA 5FRDA 2E82A 4OI1A 4LFAB 3IX7A 5JPDA 1IM5A 3WL6A 2E4ZA 3B5EA 2VZ9A 1CDZA 1OZFA 1G6HA 2GERA 4M1TA 5CDYA 2X2OA 5LD2C 2ZGVA 4OBEA 3MCUA 4QJ4A 1JEQB 4RD4A 4KO3S 1UC5B 3WGOA 3ZQJA 3TOVA 1FFHA 2N75A 3FPSA 3JQRA 1VHQA 1L1EA 4GC9A 1GWNA 4K3VA 4MZDA 3E3NA 1YR7A 1FU4A 1FUUA 3QVWA 4XD2A 5KNCH 4KBFA 3ETNA 1RJEA 4H27A 1WLYA 3GZJA 3IDAA 5BUCA 4FD3A 6LDHA 3E9MA 4D0SA 2JHCA 1NVWQ 2ATEA 3Q6NA 4YCMA 5FDFA 3OE5A 5G2OA 4BU0A 4DT1A 4OP3A 2AQIA 3ZXYA 2B2NA 1LCIA 4CR6A 1ZMOA 1DPFA 1YS7A 2WWFA 1N9GB 5DXAA 5DHPA 3BWDD 1V47A 4F5EA 5C35A 2X2FA 2A57A 3E1KA 5EE5B 2Y4NA 4I99A 1Q7GA 3AI7A 3GRKA 3QOYA 4KGVA 4OO3A 3UWSA 3IEVA 2I2BA 4JDPA 4RKWA 3KHKA 1J49A 4C7XA 2EKQA 1G5TA 1XRNA 4K6KA 1HH4A 5EL0A 3UGKA 2A9PA 3NVDA 2AD1A 2IHJA 1BEUB 2NGRA 5CR9A 2D8AA 3ZC3A 2VAXA 1RQXA 2UZ0A 1S3IA 3GDOA 3NANA 2B21A 3F7NA 1SUIA 4XSVA 2PU5A 3EEIA 3BCUA 1U1FA 1JKJB 3FSJX 4YRSA 1IYZA 1XKLA 2BEVB 4PO1A 1DJNA 3FNBA 5CB6A 1AO0A 1JH9A 2AL7A 1JIXA 2A1UB 4TN5A 1GCUA 1QQ6A 1ADYA 1KZ4A 1U0RA 3BF8A 1QRRA 4KMRA 4Q1FA 3V8EA 5HR5A 2ACEA 1LSUA 1O03A 1GQ2A 1JPUA 5JMTA 2ST1A 4JOCA 2YCLA 1Z7EA 2ZYUX 3PI6A 4EUSA 2RC5A 2XDAA 1T2NA 3T9DA 3WKEA 3TFOA 3QUAA 3IMGA 1M1UA 5KHAA 1YOVA 4OD0A 5G0WA 4IEIA 1X38A 2GM3A 2QXTA 2B4QA 5FLYA 1G8MA 3N1UA 2XGGA 2PZAA 3C74A 3KG2A 1E32A 1Q22A 4Y1GA 4A2PA 2ZS7A 3SVTA 2PSDA 4G8BA 3DNFA 1UBKS 2OSBA 4NH0A 3P2IA 5JD3A 4FBMA 1LVHA 2VHWA 4QOSA 3VFDA 1PZGA 4GYJA 1GTZA 1RMYA 3A36A 3C6XA 4Q16A 5SY4A 4DC1A 2VCEA 1GAJA 4OU4A 1DOHA 2PA0A 3F96A 4QXQA 2VDVE 3HJBA 3MQFA 3KWJA 4ZOAA 1SUDA 2JFFA 4YJ3A 3OMWA 3SZLA 3T7TA 1Q7EA 4BGEA 4EBBA 3P0FA 3K9CA 4D0GA 2AJLI 4DUYB 3UJDA 1YB7A 1M6EX 3IUNA 2ZVJA 5FKJA 1JJAA 1SM4A 4HD8A 4KDFA 3IOEA 3CSDA 3V8QA 2V65A 3HDYA 3NATA 3O4IA 1NE7A 4QLOA 4Q6BA 3GH3A 4LHWA 3U39A 3VNUA 3RB8A 3R3JA 3WL3A 5WRFA 4RA6B 4PEVA 1ECBA 4X84A 2PRZA 3MLEA 4QQRA 4M1KA 5AKEA 4E2FA 2HT1A 4A9AA 4U2CA 1O8BA 3OJCA 4XIIA 5ILOA 4DJDC 2YL2A 1X7ZB 4BNLA 4JJ6A 4PXAA 5BSUA 5DYGA 4DB2A 3WKCA 1XAJA 1X14A 2OCLA 2OXRA 2PJUA 1SBYA 3DD5A 1MO5A 4S24A 4RZXA 4ZAZA 4WLUA 4HBGA 3TI9A 1JLLA 1P3JA 3FWHA 4XH9B 1AC5A 5KYWB 4RSRA 4L6AA 1C1XA 1GPDG 2QRNA 4WESB 2O2DA 4QWWA 3VAYA 5HE8A 1T5SA 3BXEA 3LBYA 2IUTA 3SZOA 1A7JA 2DJ5A 1NMEA 1S3GA 1C2YA 3DLIA 121PA 1FUYB 4TXJA 4CMAA 1SIBE 2PZBA 3WRXC 4YCJA 2AFIB 1KEVA 1V45E 5ARCA 5LQMA 3SYLA 3EIEA 1CXZA 1U3DA 4TV8B 2OO5A 2DR0A 1NNUA 4MUMA 2R1TA 2WUWE 4CT4B 2KB0A 2WHPB 4EJSC 5IXJA 1K7XB 1Q0HA 1I6KA 2J9ZB 3IBTA 1VOTA 2GN2A 1U3CA 3STVA 3T8YA 3G2KA 2ZXEA 2O1WA 4CM9D 3WYDA 3VKUA 1CIJA 3B82A 3W5AA 4BNFA 2SCUA 1Z15A 3JQQA 3NIGB 4QPPA 5LR6A 2Q1TA 2GTHA 3SLRA 4DCPA 3A9TA 5E6UA 4PBSA 5EVJA 1CY2A 3NHWA 3R6DA 1SPXA 4E46A 3QSYA 4N7JA 3QLVC 1NY5A 2Z8ZA 3AUTA 2JCSA 3IKJA 3FOEC 1DO0A 1UMDA 2UZ4A 4CIWA 4E22A 3M4JA 3PR3A 1S89A 1V8PA 1TC1A 2PIAA 3NOXA 3RG2A 2OB1A 3AQIA 3FDXA 4ER5A 3PJRA 4NBKA 2DFLA 3P94A 1FFXB 3KSBC 1QYVA 1ZNWA 2HY7A 1NI4B 1UOEA 4MHSA 5KAMA 4S2EA 4DQVA 3AVXA 1T8YA 2BV3A 4ARIA 1RWBA 1E5QA 4QJIA 2YIDA 1J0DA 3O3CA 3GHYA 4PC6A 2XECA 3IP1A 1E9VA 4TQAA 5DYTA 4U3JB 1PZMA 1EM6A 3KYCA 2VP6A 1MO6A 5FA8A 3N5KA 2ONJA 3TOCA 2D1QA 3F6CA 2H0RA 4JGIA 4GC5A 1EVQA 3UJ9A 2QMZA 1YO6A 2G82A 4KKXB 4MPRA 3BICA 3GCGA 4ADSG 3PFWO 2YJ6A 1FYEA 4LF5B 1U9IA 3LW8A 4NICA 3VO8A 3NHKA 1YS2X 4M38A 5B4VA 1AV7A 2IHUA 2V9PA 3ABOB 4MJXA 3UJBA 1NUSA 5AXDA 3DZKA 3GHHA 2A84A 3VYWA 4RADA 3OZWA 4QYWA 3WK9A 3N07A 3E7XA 1K98A 3FOFC 4RHCA 3TZQA 3T41A 4BTVA 4TLEA 2AOUB 2PRIA 1IZZA 2WSLA 3KXLA 3QWBA 3NDRA 4IG4A 1KI4A 2AHOA 4OLJA 1TRHA 5JSKA 2C9YA 2DM6A 3HWRA 4GOOD 1MAHA 2W2XA 4IAOA 3AW9A 4IG9A 1HPLA 4Z4FA 1UM9A 3FM9A 4FMDF 1WW8A 2NVUA 3GVPA 1QF7A 1R0YA 1SVWA 3X43A 4DQUA 4O2BA 3JQ9A 2ZDHA 5HQTA 3UJ7A 1OZHA 2PGXA 4FGKA 2GPJA 2OXCA 1H4TA 1AA6A 1NULA 1OI3A 3FMFA 1EE1A 4BZQA 1JHYA 3QHQA 3CR8A 3CY6A 5M3BA 1VLZA 4UBOA 5BNZA 2V7QD 2XZTA 1ZUIA 3DQQA 3O4VA 4DSAA 1KTVA 4XW2A 1W93A 1HKUA 3TTUA 4YV2A 4MQ6A 1PR3A 3QLUC 1M10A 4ZU3A 5JVDB 3HRHA 3L6UA 1QP4A 2F17A 2HOQA 5C4IA 3RSQA 4PNEA 1DEXA 2AQKA 2R60A 2Z95A 4G5OA 4A1OA 1M2GA 4CQMD 3K8ZA 2IIPA 2I4LA 4KXXA 5G4LA 4UBNA 4W5NA 1I9GA 4JJAA 4LJSA 4RJLA 5K6AC 2ZI7A 4Q6WA 2JH3A 1DAKA 2YWFA 2HWKA 3TMKA 1R0ZA 4AIRA 1P7WA 4NENA 3HN2A 2K87A 5TQ0A 4ZO8A 3AK4A 3CPEA 3MUFA 4QBGB 3IVAA 4I0WB 1FK8A 1BU5A 4FOLA 4R1PA 2X0KA 3C45A 5BW8A 2Q28A 2WJIA 1WPRA 2B8WA 4ND4A 1AQIA 1Y7LA 3PP8A 1CTQA 3PVZA 3ZK7A 2Y8EA 3H6GA 5LA6A 4AF6A 4D46A 3CXRA 1SXJC 5K4AA 5KNDA 3I2JA 2R0QC 3OQIA 1Y9JA 1VJGA 4U8GA 3RHZA 3O4JA 3ZJ5A 4CDRA 4D8UA 4HYYA 4TWJA 4KACA 1QOQB 3KCNA 3AHGA 4DIDA 3DXFA 3ITEA 2XNHA 2BZ0A 3ZU3A 3UA3A 1N1MA 2GK3A 1DMRA 4X7PA 3TRDA 4ZVTA 5LL6P 1Z7GA 1FDVA 4PLCA 1BXGA 3DOFA 4G5HA 4OHBA 4BV9A 2CN1A 1L5VA 1OT3A 2FK8A 3MTJA 5I47A 2IYTA 1UZMA 2OOSA 4CKCA 2MSCB 5KTKA 3A1DA 4JLAA 4ZN6A 2O5VA 1CULC 4QPZA 1X80B 4JQCA 1UT8A 2ALJA 3BKWA 4M3NA 4NYIQ 5IARA 5I9IA 2GESA 2UUOA 3NTVA 1Z2CA 4XGRA 4E1BA 3LVBA 5B58C 1EGMB 2EGGA 1LVUA 3EY4A 1E2GA 2IYXA 3DSRA 4P9NA 2J0SA 1DO8A 1XALA 1YSCA 1ZOPA 2P9YA 3HRKA 3LRPA 3OWOA 2VR1A 3KU1A 3GDFA 5FQOA 3TZLA 3BIFA 1B2RA 4LG1A 1ZH4A 1UK7A 4EEKA 3A1TA 4HWTA 3BSSA 4KE9A 2IOYA 4NCIA 4FTWA 4HDMA 4CFSA 2CLSA 2XI4A 4R4JA 1NX6A 1CUIA 2B34A 3H42B 1L9XA 2NWQA 2QRKA 1KHTA 2QTVB 2GM9A 2O3TA 3MJ4A 1Q84A 2BDTA 1F2TB 3MWEB 4X91A 4CMKA 4UPVA 4D26A 1MDBA 3SXPA 1PAUA 1XTQA 1X7WB 4DIFA 2BUAA 2OCAA 4FVTA 4IFBA 4MS1A 3T1TA 3KQOA 4EYKA 1UWLA 4FMBB 2CGEA 3CEMA 2C5GA 3OHMA 5LCXA 3QBDA 1TVEA 1O1YA 5I7SA 1KRHA 4YB8A 5I7FA 3IAEA 4J43A 1E1RA 2P5SA 4LX8A 1I13A 1R5NA 4CLHA 2JLWA 2FPKA 4RFSA 3ZHBA 1KJWA 1F8YA 1QHEA 16PKA 2PR2A 3Q98A 4LW8A 2WLTA 4QHSA 1XTPA 3FRIA 3C3YA 4MPJA 2QRMA 4OPMA 1P7ZA 3L06A 1PNRA 1ZESA 4UPEA 2H4HA 2JBHA 1L5NA 1LDMA 1ZGHA 4KQWA 4B3FX 4LRWA 2HREA 5F7JA 4UHEA 5EOVA 3PQ2A 5CM8B 5EP4A 3I04A 1E6UA 3U16A 1KRXA 2RB4A 4ND3A 3TM5A 4CNBA 2YWBA 3GUUA 4NBVA 4HWSA 1QFYA 2VWPA 3P27A 1JDZA 1JAIA 1IXSB 3MWYW 2PFKA 3MMXA 4BZZA 2UYGA 3LPCA 1QQBA 1Y1SA 1POWA 1UMBA 1OFTA 5ILQA 1RRVA 1HMYA 3GY0A 3VJKA 4CEHA 3FPEA 3UHAA 5A6SA 2E4VA 2GXQA 1XLTC 2H4XA 2QZ4A 2Y27A 5F35A 4A7PA 4CN9A 4KMMA 2P6RA 4JK3A 4N03A 3K0EA 1XUOA 3A2MA 1QFSA 5F1OA 3P2OA 4IGIA 4X90A 1JNXX 1YIAA 1LW7A 1QIKA 3JQDA 5E3IA 1ACMA 1GNRA 2J3LA 1O6BA 3KPWA 4ZCTA 3VUEA 4NEGA 1E61A 2PS1A 4QOFA 5H9VA 1BCSA 2XNSA 1I4TD 3H2HA 1XD9A 3OIVA 4FFVA 4D79A 3D8HA 2Y9MB 2I71A 3L7CA 4FI3C 5KI6A 1II9A 1OE0A 2HJRA 4W5QA 2JKYA 4MRAA 2BF7A 4G0OA 4U39A 4W5HA 5EWMA 4EECA 4ZYVA 2GEFA 1G98A 1JEQA 3D6HA 2TSYB 4XFDA 1FVOA 2IPLA 1J70A 1MX5A 1VMEA 2P9ZA 3KX2A 4XGNA 3TZCA 1BHJA 3ZGLA 5BY2A 3HBNA 3EZ6A 5D85A 5JBIA 2H4WA 4M8NE 3KOYA 1OOEA 3UMYA 2FMFA 3RSHA 1UDCA 1A5BB 1DWQA 1PD0A 1VKHA 2FPLA 2QN8A 4JUIA 4XOUA 3A0RB 3SEAA 3WV5A 3HB7A 5D3ZA 4B3MB 4HXFB 1OAOC 1Z68A 2J6HA 3O47A 5BVGB 3Q0IA 2XA2A 1JEOA 2J32A 1N9GA 3K31A 1J1IA 3PICA 2ZATA 1AKVA 1JR6A 3IT1A 4GKBA 4YCCA 4FEAA 3PFCA 1NVUQ 4FKMA 4LY0A 3TW0A 5JQGB 2A33A 3CNOA 2XUQA 4IUDS 4K26A 1FNMA 1JEYB 3FI0A 2CL5A 3IQZA 2DQZA 3NGLA 5HIAA 2ODBA 1DC4A 3CH7A 1KY4A 3EEYA 4LCJA 3I45A 4RV4A 3HVKA 3I2GA 4Q7MB 1E8NA 3QIAA 5AXBA 4KTTE 1OFVA 1YB4A 2VAWA 3ETHA 3TIFA 1KYWA 4W5RA 4ER6A 1HLFA 2BEVA 2CFCA 2OBFA 1YD7A 2YQ4A 1OWPA 3BEOA 2A1UA 4IO0A 2NT4A 1NJFA 4NBRA 4U7WA 3LBIA 5JMPA 1BDHA 1NOIA 1QP7A 3X1KA 1Z62A 2WTMA 2ZI9A 4FFMA 1XJWA 1NMYA 4BMDA 3V9AA 1WDMA 1CZUA 1H42A 2E37A 1U28A 4OQNA 3K7EA 5COBA 3WYBA 3TTYA 4ZAFA 3DCJA 3F6PA 1D2HA 2Y92A 4QARA 2AMFA 2WYVA 3CF4A 3RS3A 3TSCA 3UOGA 3C16C 3DBVO 3TRHA 1GN8A 1FXSA 2HMUA 4UQPA 4B8YA 3T15A 1VMAA 4RQBA 4BVAA 2V55B 2CXHA 1SU7A 5JTTA 1N6KA 4AMGA 3JQPA 2UXDB 2O7VA 1XXLA 1RRCA 4JC5A 3NYRA 3IIJA 4PSAA 4TTAA 4TXLA 4EG8A 1ESZA 3KQSA 1JR3E 2ZTLA 3COYA 5DISB 4BB9A 1J0EA 2R66A 1A9SA 3DKRA 3OBIA 3PT5A 3VAZA 4ARVA 4EPYA 3M7IA 2XNDD 1DT5A 2VUIB 2DLDA 2Z9CA 1H94A 3FNFA 1IJBA 4E7OA 2NNLD 2UYCA 4D5GA 5EMKA 1WUKS 5AW3A 1E0SA 4RMNA 4NXNB 3RVBA 4TVSA 1GOTA 4EZIA 3KUCA 3HM9A 5J2UB 3KKLA 2Y9PB 2PKXA 1V6AA 1LDNA 3PPWA 3TNFA 4G0ZA 3GLGE 3X1ZA 4MRPA 2O6LA 2O0MA 1G6KA 5HFNA 5K2OA 1CEQA 4WERA 1DAHA 1U7XA 4BNUA 4YUZA 2V1UA 4LXYA 1CW2B 4RA6A 2UVQA 1JFFA 4ZQHA 1BZYA 3IODA 1KGSA 1VKRA 4FHDA 3R8CA 2JGJA 1RQ2A 4L4ZA 2VYVD 2H5JA 1CYEA 2EJBA 1MZVA 1SCBA 2NV0A 3SR0A 2I1VB 4DZTA 4O5OA 4CGZA 1XZIA 2HXSA 3L82B 1IY9A 2P1ZA 3E7DA 1AKNA 4HNQA 4QUHA 4JYAB 4G0VA 2WYHA 1IXZA 2CT8A 5K0FA 1BXZA 4INOA 4EG7A 1KP3A 2XB4A 2XMCA 3H7IA 4CIXA 4LBYA 1JWLA 2IUYA 1ZVVA 4WBNA 4UXIA 1SNYA 1P60A 1X0VA 2RC6A 1TM2A 2YJ4A 1KO4A 1Z08A 4B3SB 3FJYA 4ZAWA 2XODA 1F06A 5HBGA 3K20A 3ZGZA 5JANA 2J9XB 1CUGA 2IZ7A 4L1KA 4KJXA 4LDQA 1PF7E 2AOTA 4DCJA 2E4UA 3GVXA 1SD5A 1UC4B 5FCDA 3B1VA 1DC5A 1RZ3A 3OI7A 4MB0A 5DJ5A 4EJ6A 1QF9A 3K0AB 3SY8A 2V9CA 2ZJ5A 4WE3A 3NDPA 2HNKA 2DJIA 3RM3A 4DMFA 4DWWA 4BNMA 3GCZA 5DP1A 2AC2A 5AVTA 4TSKA 3L93A 1RFLA 3R4VA 2PUVA 3IQEA 5JNWA 1IVNA 5CIQA 2PRJA 2X15A 4AG6A 2DBVO 5KJ1A 4ZZ1A 2JH9A 2MOKA 4QU8A 1V1RA 5B6JA 1YZQA 2WSIA 3A11A 4FOPA 4JUBA 5DMXA 1YCGA 2PRSA 1H2AS 4UMVA 1SELA 4H1UA 4UC0A 2QN1A 2B4RO 2B7CA 5IULC 2JFNA 2PKYX 4GWKA 4XJXA 1UJNA 1VIMA 5TPWB 4C4XA 4M83A 1KOJA 4WUTA 3VR6H 1N2GA 4O4JA 2HUNA 3HXLA 3VV3A 2VTBB 1FFXA 4WOKA 1FJHA 1YC5A 3NMUF 3IT2A 4ZI7F 2C4WA 5LP6B 2V6FA 4CIYA 3V4SA 1OX5A 1CJVC 1MAVA 5D8DA 3H9CA 3H1EA 1KIFA 1SKQA 3DZBA 2EXXA 3E8SA 2DBQA 2ZBGA 4KYUA 2Q21A 3MEQA 4TKZA 5CYPA 3ENKA 1NWCA 2ADOA 2AFRA 1S3FA 4YJDA 3THWA 3G5AA 5FHQA 3B7WA 3QVSA 3GWGA 3UOWA 4PR3A 1FXUA 1JG3A 2RK6A 4Y3UA 5C51B 2R86A 5JZMA 3H65A 3PC8C 4BVKA 2W42A 4BP9A 4KQKA 1WD5A 4XB6B 3H2IA 1DNPA 2R7LA 1FE8A 1DPGA 3B48A 4A0RA 3FTCA 3IKVA 4K81B 4Z1MD 3ZIUA 3MT9A 2GEUA 4HGPA 3V7UA 4B85A 1EX6A 1RPAA 2W70A 1P2UA 3RT9A 4RK0A 2CLCX 3EXHC 3RLIA 3QK7A 3SHTA 2Q5FA 3L0CA 4M36A 4TS3A 2TMYA 4YQYA 3TAHA 2C8JA 1NYRA 3I4FA 1SCKA 1LFAA 3G89A 1ZLXA 3L0DA 3MGBA 2OORA 3B5IA 5AVRA 5LU9A 1M1YA 4IDFA 2XCSB 3I39X 3FZQA 3WYEA 1PIWA 3U7FB 1JG6A 3L4BC 2J0EA 3E7FA 3KPYA 1O08A 3SZUA 4CL8A 4OUDB 4G4SO 3D7LA 5K09A 3MJDA 2JG3A 1U9ZA 4TTTS 2HDWA 2TMKA 2YY7A 3UEOA 5ESRA 3W4KA 4YJ2B 1BS9A 2RGWA 4BQPA 3Q5DA 2FETA 4TUYB 4KC0A 3HB1A 1CDEA 1L5ZA 4HMQA 4LZJA 1HYBA 4KQMA 5HFAA 5AVQA 5U1PA 3ZD8A 2PYIA 5IZCC 2HBZA 1M1XB 1X1CA 5DCLA 5F9MA 2FWBA 1F8GA 4FSDA 4LNHA 1IQRA 5F2NA 1TEVA 3GBVA 4I08A 3G2HA 3OPYB 1P8AA 3O1IC 2RHTA 3CHYA 5EJIA 3AB8A 5FJIA 4UE6A 1KEUA 4CMJA 3EPHA 1CUSA 2OHJA 5ALQA 4EATA 1KAMA 4R1NA 5FR2A 3Q8XB 2YV2A 3C3KA 1EX1A 3E1SA 1V7ZA 2F67A 3QU7A 5AOCA 1T43A 1WHTB 3L1VA 421PA 3FYUA 2VZ8A 2VSYA 1SK8A 4B75A 5ENVA 2SNIE 3FTNA 3P9QA 3WSWA 1OILA 1HOXA 5K2MA 3THXB 3I52A 3TG8A 3I0ZA 2R87A 2HMSA 5REQB 1Y5NA 1V9LA 1KJ9A 3K9GA 3KYDA 3NDJA 4JAVC 1KC1A 2V6JA 2H1OA 3R77A 2AFVA 5CVVA 1DZIA 4EA6A 5ALGA 4AIIA 1S8NA 1FP4B 5FBQB 1Y8CA 4E2WA 1YFJA 2QTZA 3REQB 1ANKA 4E51A 2VKTA 3VTAA 5AIBA 3DE4X 5D5HA 1XF1A 1MX1A 4X1KB 2GZHA 3MCAA 4RD0A 1WMEA 4RVFA 4U2BA 2G07A 2EZTA 4AXXA 1GSOA 2JAXA 3TEFA 4RHEA 5JW6A 1MABA 1JEEA 2LR0A 4BO8A 4A8JC 9ABPA 1TM7E 1W5EA 2GVNA 3WR5A 4KQFA 4WSOA 3ZV4A 1YQUA 3CFYA 3OQPA 4HYQA 5LLDA 3JQ6A 3JTEA 4FYYA 3FYDA 1VZ3A 2O06A 2FQ1A 2RONA 2Y1LA 4YI5A 3I5MA 3TXXA 3UUFA 4LSWA 4XQ9A 1THGA 3ZWNA 5J23A 3RR2A 5IC6A 4HJXA 3BG5A 3D8NA 4DBLC 1IY0A 4IHKA 3OZIA 2RHJA 4ETWA 4KXLA 4BVHA 1J5XA 1QK4A 3K5HA 3A2KA 2ORVA 4ND5A 4EB6B 5L3SA 4MUJA 2E6KA 1RI3A 1F2TA 1RYYA 2W6OA 2YHSA 4J1QA 2AOWA 4LOLA 4QICA 5CP8A 3AV0B 1L4MA 4MYCA 2VJAA 4A3SA 3L4JA 3EC7A 3M5DA 3BMCA 5HK9A 3F9IA 2RJNA 4KBGA 5JCPA 3D8UA 1MW8X 1YBFA 4N5LA 3EMVA 1UJ2A 3I76A 5FADA 1HNZB 4V0MA 3LHDA 5AI5A 1J0CA 3AKZA 1ZBQA 1AUXA 3QX8A 2PQ6A 5M04A 1I4DD 4JGBA 3ZTWA 4NX2A 1YKGA 1SXIA 4R2LA 4PCAA 2EJTA 4WZZA 1TO6A 1ZFNA 5JADA 5FTMA 1JDSA 1N2CE 1A97A 1W9MA 1YGPA 3AB7A 3WKDA 4BQRA 1FFAA 1ZG3A 1PFWA 2C0QA 3P9XA 4IIYA 1Z38A 4KEAA 2W2PA 5ETJA 2BHNA 4E09A 2PWBA 1KKMA 4X41A 2AV6A 1EFKA 1P0FA 2YJ5A 1QPGA 2GCGA 1M1ZA 1SG0A 1RTKA 2JFHA 2BDEA 3HVIA 4QPNA 5LZ8A 3VZSA 5L9AA 4CKWA 4CMIA 1E2IA 3W78A 5JT1A 4TMVA 2KE5A 5AJTA 1K86A 2I87A 8GPBA 3FVRA 1HEUA 3IQIX 4HBZA 4DXAA 3OT1A 1NVVR 4JNKA 4IXTA 4TYQA 1IBCA 4FQ5A 4PG5A 5DNWA 4RPHA 3JVEA 1AKRA 1ORRA 3PDHA 2AS0A 1ZA1A 3P2YA 3ZD6A 1CVLA 2DETA 2A7QA 3CA8A 2P9FA 4J0GA 1ODKA 3A6DA 2GCNA 1DRVA 3EFBA 2YS7A 3WFJA 4EHJA 1XMXA 2YJGA 2OV3A 3VGPA 3EYAA 1RI5A 2IPOA 4EUKA 2FFBA 4AP5A 1KDZA 5SZJA 5EE1A 1Z0SA 4UARA 3LWNA 4M22A 3ADCA 1RJDA 3VTZA 1L5FA 3FW1A 3O26A 4CXMA 4UTXA 2DY0A 2R1VA 1C80A 4DR5B 1HZZA 5B7NA 3M0EA 1DQNA 1Q91A 1J7JA 1TDJA 1X92A 2HZ7A 2J48A 3L8FA 3GUYA 1E3JA 3EQZA 3N2ZB 3QOWA 4S3MA 5CVEA 3PA6A 2H1FA 1XJ0A 4MVCA 3JD2A 4QHYA 1RM0A 2P9GA 3I2FA 1QK3A 3W9YA 3PGA1 5LD2B 1XG5A 3MPUA 3ESXA 4JCCA 5GPBA 4FQ8A 4JXXA 2B4TO 3OJ0A 1P44A 2EJWA 4G81A 3JYHA 1T13A 1B16A 2AT1A 1JKMA 5JDIA 4YCAA 1IBKB 1H5NA 3WLMA 4BFZA 3CCFA 1L8QA 4WKPA 4DCCA 2CNKA 3EUEA 4KQ1A 1DMSA 1QTNA 1PGPA 2WZBA 2OBMA 2ZUSA 4KR6A 5DHSA 4MUIA 4YALA 1OU0A 2FXVA 3F3YA 1M2JA 3EDRA 3G6KA 4NE9A 5IC4A 2ZCJA 3ICQB 5JQGA 3EGDA 1JEYA 3FOCA 2ZSEA 2QE7A 4OLHA 3IBYA 4K5QA 1JVSA 2Q2WA 2R6DA 5LXTB 2HBQA 3NAZA 4ZOLA 3EPJA 4PAWA 2YXDA 5FWYA 4HTFA 1MRSA 2IVFA 1XTJA 3WY9A 1JZSA 1Q1ZA 1TW2A 1DKMA 3I3OA 1JQAA 3EQ2A 3QUCA 4CR8A 5LQKA 1E2LA 4LQLA 3EAGA 4QRDA 4W5OA 4E13A 3O5AA 1W7AA 3WQHA 3HO1A 5FOSA 3G2LA 3EB9A 1QMGA 2YUIA 2WKRA 1ESNA 3AZOA 3RVQA 3HR8A 4GIBA 1AB5A 4WTOA 2ZUEA 1OKKD 2RBGA 3GWZA 4M9SA 1CQJB 4Z6KA 4IF6A 1Q1BA 1I5EA 2WR8A 1A8SA 2NTJA 2VJCA 2GJAA 1LPAB 2PA3A 3HA2A 4HWPA 4MLZA 3EWSA 5AFSA 5BVHB 1AV6A 1PGNA 2F43B 1UZUA 3WIDA 1RAFA 1QZZA 1UDXA 3E84A 1EP9A 4F85A 2Q3DA 2XKKA 1NLZA 1TU0A 2OHIA 2WIGA 1E3WB 1GTVA 2AMLA 2H85A 3DEAA 5KX5F 3GG2A 2QGFA 3I53A 2FQYA 2AFIE 4UNRA 1NVGA 4FONA 1Y8RA 3S29A 1XROA 2RDMA 1RP1A 3CLSD 3IB3A 3K9WA 3V1MA 3I6IA 2HNAA 1XVIA 5A3RA 2OM6A 4AROA 1FDIA 3ND8A 2BMJA 1QOZA 1XEAA 4LXTA 3S2FA 4KSCA 1SOVA 2XQGA 5FWDA 1RAHA 4XQEA 4OU5A 1NNLA 1QZTA 1FFDA 1IBLB 2UUAB 4JOSA 2Z5GA 3Q9NA 3H17A 2PH7A 4RHUA 4I1SA 5DWQA 4C1BA 1H6AA 2FSFA 1G2QA 1NSFA 3DBHB 3OZGA 3BIJA 1SEPA 1X7GA 5AVXA 4PGFA 3SBXA 3B1WA 2VPQA 4RTRA 1CUFA 4YRMA 3GJ0A 1HG1A 4PYKA 4C14A 2YBDA 2AMVA 3UWKA 4B6EA 3SVZA 2G1AA 1XQYA 2SECE 2B78A 4Y1EA 4LMBA 1J8FA 1WBJB 4FK8A 4V0OA 3R6TA 3I4CA 2GPAA 3KOOA 2CMDA 1D2AA 2FF7A 4KAFA 5FI0B 3LX5A 4QVKA 4WXRA 5AR1A 4Y67A 4BKOA 3M4XA 4K9RA 3AJRA 4KRGA 5LQDA 5IDQA 2QLBA 3T1VA 1VKJA 3MILA 1HR0B 3ZXIA 3A3OA 1HE4A 2VLIA 4JFAA 3NP7A 4LY9A 3I37X 3I1JA 2ZM6B 1TQ4A 2ZRJA 2OTCA 3RKUA 3ADBA 1Q5PA 3D4LA 3F8SA 2CHQA 3GCWA 4GXQA 2GB4A 4JSRA 4HDKB 3RI3A 1T9ZA 1Y5MA 4C6HA 2J3EA 3DKIA 4TMYA 1SY7A 4Y8VA 1W8IA 2DOKA 3WL4A 4GBED 4INZA 4ACBA 1B7GO 3V8VA 3H5TA 1N1EA 4LXQA 4YO7A 5C5DA 2IEGA 1PL0A 3I5YA 1Q11A 3C6ZA 1T3ZA 2XUHA 3EVDA 3HRIA 2JJYA 2ZR9A 3PIDA 4XUDA 4DABA 3U4CA 3AFMA 5F1YA 1XCBA 5DTQA 3MM4A 3QP9A 3Q1LA 2J8ZA 2WWRA 3D6VA 4UXJA 2MMGA 2PSEA 4JA0A 4UVGA 3KPVA 3TX6A 1I80A 4DNFA 4DNOA 3GNTA 1T4CA 4FYWA 4M49A 4K0KB 3M6VA 1B8PA 3LP5A 5F2EA 2IHZA 3L0SA 4K9LA 4DUGD 1B4DA 2CNLA 1HUQA 2SICE 4YEDA 1A69A 2X3FA 3OM0A 5K45A 2ZS9A 1N32B 4P0PB 3HPQA 2EX1A 2HF2A 2PX4A 4ZQCB 1WCWA 5CX1A 1RQGA 3I9LA 1OQAA 5JECA 3M6UA 1A7AA 2CDAA 2RHOA 5D6OA 1OYYA 4NNJA 5HKBA 1MRZA 1Q1GA 1R8QA 1U7ZA 2ZJ7A 1FTGA 2OBXA 3QELB 4BEJA 1OTYA 2PR7A 3I72A 3AEUB 4GXRA 3T5DA 5ITZB 1P0QA 3CR3C 4MW5A 1HT1E 3NVMB 4FFOA 5GJWC 5AJZA 3TR0A 3K0KA 3HK2A 1U1GA 1P4AA 3SOZA 1MJGM 2ZBPA 1ECGA 4FCVA 1DHRA 2WD8A 3VNSA 4EMSA 4X62B 2DKOA 3IDFA 4R31A 1E5XA 5A03A 4AJ1A 4GHWA 3T3OA 3T5AA 3ASYA 1DL5A 1Q20A 3C3AA 4HWKA 3X2FA 2HL6A 4HYEA 2M98A 4UHFA 1VL8A 3PR1A 1IONA 4DDHA 1Z4QA 3H9BA 1Z5GA 3L0PA 1T4BA 2NT3A 4YAFA 5FPQA 3ZW8A 4DLWA 3RS5A 1ZU4A 2JBAB 3RC7A 5HZMA 5KVCA 1LTHR 1DRUA 4TSFD 1UKCA 1U2QA 2C82A 5B4UA 3H19A 2ACVA 3K05A 3I9NA 4LJAA 4QO8A 3EGWA 1TM3E 4GR9A 5G0UA 2V6MA 1PX0A 4U1RA 1UC9A 5BW6B 3UWDA 1K1EA 3GRVA 4TLCA 3T9CA 4RY0A 4TUYA 4YRPA 5NULA 1RWWA 3HL4A 3R6WA 3R09A 4BFYA 3A4VA 2GAIA 5CFNA 1JG7A 1N5OX 1QTQA 4UEJA 3VU9A 4BVJA 1K0UA 4MXDA 1MNAA 4X60A 4S1TA 3ZU6A 1C1YA 1E6CA 1YK0A 2PWZA 5G4KA 3UGTA 2G4CA 2AQHA 3L41A 1IUNA 4G07A 1I7PA 4B6RA 3UJ6A 4F5YA 2QBYB 1SG9A 1TTPB 4K8OA 4R2KA 3KWMA 4F1WA 1TM1E 2RG7A 4WY8A 2Q41A 5C3MA 3K94A 5BN5A 5BWMA 3J81A 1V39A 5HM6A 2ZKLA 4CMBA 1S5PA 2GCIA 5AQ1A 4B35A 1RXYA 2QZZA 5C1DA 4II3A 1J09A 1M2NA 1IWOA 1NVKA 4RL4A 3UXMA 4B46A 4AKTA 2N1MA 5HIJA 1IAQA 2WTXA 1Z34A 3H3XA 5DHRA 3OFJA 3PC2A 3AVVA 2IA5A 4PHHA 5B2FA 2A0KA 4FILA 3MJHA 2V9ZA 4MWTA 4WIAA 3FRHA 1OXUA 3SQDA 3ZI0A 4TTSA 1RZRD 4PRYA 4OHZA 1QMPA 3PEUA 3OFNA 3NEJA 4AJLA 2QLMA 3IL2A 4RWEA 2ZUTA 3IEKA 3QVTA 1W59A 1Z18A 3WXMA 2A35A 1OLXB 2ZJBA 3T3GA 1GPLA 3KXKA 5LDDC 4R16A 4EA9A 2A58A 3AB3A 1SXJB 2FZWA 1EVYA 4IJVA 4AX8A 4HGRA 2QNIA 3TSOA 3OQNA 2GFQA 4X1KA 3BIOA 3GDWA 4IUYA 4O8CA 1W48A 1DAEA 2W6ZA 2GHRA 3MS2A 3ZVMA 3O03A 4R7TA 1IZ8A 1G4HA 3N8HA 2OUIA 4FCCA 4K6CA 1CD5A 4LY3A 1G16A 2Q4TA 5TARA 3AONB 3D1LA 3WJ1A 3ZE6A 2ZITA 3FPGA 4HV4A 4YGXB 4N6NA 2JHAA 3FY4A 3NT4A 2V6GA 4H3HB 4U7HA 4Y0NA 4BNZA 2IS1A 1M6VB 3L4SO 5KNBA 1BDJA 4X8HA 3WLIA 3ZPXA 1YF3A 2GI4A 4OCZA 3DOIA 1P0CA 3FGOA 4Q7LA 4WK6A 4X93A 3ADOA 2HT6A 3V7WA 1ZDMA 1MVLA 3IR7A 3PUHA 3RRYA 3BKXA 2UZ1B 3LHFA 2NSJA 1GP2A 3L7BA 3PVSA 1URPA 3ROXA 2HJGA 3ELDA 1Y0BA 3NTLA 1YVPA 1T1RA 2HYDA 4PX5A 1Y8QA 1Z0AA 2D7CA 3A25A 3DFFA 2MSLA 2RGNC 3ETCA 4X1OA 1F60A 2WIKA 2PZEA 2IQ5A 4XSHA 1D04A 2JGEA 3EVNA 1A5SB 4JBYA 2I4RA 3PNYA 3F4LA 5KNLA 1OROA 4BN0A 1E1YA 1AU9A 4LGCA 4O1MA 4X6YA 1RAAA 3P2JA 1V2GA 1A72A 4OIMA 4QDTA 4LAFA 4AY5A 1B8VA 1KI8A 2QRVA 3QPBA 1DGQA 1QRAA 2C2BA 3DZFA 5CBKA 3K0BA 2V7TA 5BT8A 5KINB 1QR6A 2HXYA 2R1ZA 1XC7A 1WB5A 1C3OB 3IUQA 4C05A 1QFXA 1FQWA 3HYTA 1EZ1A 3GFRA 5BQ3A 5J5CA 4ZCMA 1R0BA 2WMDA 3VNBA 1A8QA 4Y6QA 3P20A 3RS7A 1ZBDA 1NVDA 2C95A 3DMDA 2ZJAA 3G2JA 3TKYA 2DB3A 5CA0F 4R83A 4MTLA 3GJZA 4NE7A 3A6LA 1JFRA 1KO5A 3D6NB 3JQFA 3MIZA 3Q41A 3L6CA 4C3OB 4ZICA 2WVGA 1LXCA 1MOSA 1ZH6A 1N3IA 1KI6A 4PM4A 3A37A 1EZ4A 3OCWA 4FDUA 4B7XA 1SKYB 2QJRA 1OC2A 2XGOA 5K3FA 5BMOA 1POXA 2PL1A 4IWXA 1LLDA 1Z73A 1NF8A 1O58A 2DT8A 3AJ8A 4RXUA 3SN6A 3UW1A 4UU8A 1XP5A 4GKKB 5JTUA 1J33A 2O2XA 1WJGA 1XTSA 1LD3A 2QD5A 3HJGA 3OHSX 4FLEA 1HL3A 4S0ZA 3VPHA 3WLJA 3K5PA 1V1MB 3KKKA 2ZTMA 3DD1A 2R79A 1GFZA 1TD1A 2O05A 1JKIA 3FZEA 3HSKA 4LBWA 1UP4A 2PANA 4JUFA 1N5RA 1PWXA 4J0CA 3VR5D 1ZITA 3PLNA 1E60A 1NHWA 5KSYA 3PV0A 3BIWA 4PLFA 3AM3A 3AEYA 3W5DA 1XL1A 4UD2A 1KDTA 4MYUA 1A2BA 2IL1A 1N1GA 2VJDA 3PFFA 1GQSA 2Z83A 3C3DA 4I1IA 2OENG 3DWIA 1EX7A 2VNHA 4JJEA 4U6NA 4QDZA 1VI2A 3H7AA 5JQWA 3OO1A 1OBCA 1YL6A 2F4NA 4NOKA 4NQRA 1WV0A 2M6SA 3EHEA 3V3TA 4EH1A 3Q7EA 3K71B 3HZRA 2GZSA 3PUXA 1E20A 1DAGA 1LV8A 1S8FA 1SBZA 3P9ZA 3IAAA 4JQSA 4XASA 5TQVA 3V4LA 1SCNE 4D80A 1XNHA 2GUGA 1U2RA 1USVA 2QIOA 4WY5A 3K2IA 3X1WA 3AM1A 2AX3A 5T4FA 4ZQFA 3ZG6A 3QEBZ 3NBUA 1DINA 1UBFA 4KPGA 1JIVA 1P1FA 3UATA 5AKIA 5J58A 5CHEA 2VT7A 3DT6A 4I55F 5T6MA 3ZZNA 5CK4A 4IUBS 4ZEOA 3EIFA 3DBIA 2XKJE 3ROEA 2ENWA 3ZWWA 3FROA 2CCGA 3JASB 5FOXA 5HDQA 2OECA 2VK8A 1DWOA 3P9SA 3P19A 2P0AA 4P0TA 4YRLA 5LB4A 5FOWA 4MWSA 4YI3A 3KNZA 2YNMD 2E9SA 4V02A 5CU7A 1HA3A 2B61A 3TPCA 4PS0A 5IAJA 1LWOA 2CBGA 3JD0A 4XXHA 4IQ8A 1EP3B 3LQ4A 4JCOA 2C4VA 4DBVO 1GSHA 4Q4JB 1IHXA 4FB4A 2MSEB 4GMGA 3EG5A 4ZEXA 1SU4A 3GD5A 4ZOBA 3V00A 3ZCTA 5CMLA 4EI7A 2VDMB 3UOAB 5HFJA 3FX2A 3SU8A 2OQIA 3P2EA 2XA9A 1N6IA 3C1UA 3HGQA 4ILEA 4XFJA 3IPLA 1YZVA 2HD4A 1N4DA 1T1GA 3W2TA 5CLIA 3TBHA 3SX0A 3VR0A 3SQOA 1SEVA 5HKKD 3ZE8A 2HX1A 4YCSA 2BTQB 3OZEA 4PC1A 5H81A 4N0PA 4IYRA 3ANLA 3A4TA 2O8NA 4RK4A 1IXYA 3AHCA 4ZYXA 1YXMA 1IUOA 1E4YA 4XFKA 4IXDA 4IM7A 1QP0A 3CUUA 3BHNA 5KX5B 1Z8DA 2VXYA 5KZMB 1NVMB 5JSQA 1O87A 5ENDA 2CXTA 4AY2A 1PV4A 2FZKA 3B36A 4FFBB 3HXQA 2B8TA 1UJ6A 5H02A 3PWZA 1KFCB 1VXOA 3KEGA 1CS0B 3ME5A 4TXMA 4F5ZA 5IFLA 4R5MA 5ICSA 4H0FA 4GKJB 1TIKA 1XVUA 3M6XA 3R5JA 1ZIDA 3C41J 2ZCUA 4JR1A 5DBHX 4RK5A 1GEGA 4IQ0A 2BRUA 1E9EA 4RTJA 2OY0A 3A3YA 2XYVA 2HLNA 3OA2A 3QY9A 4IOJA 2AI3A 4OJYA 3USZA 3I4LA 3IXMA 2ZANA 2IHKA 4DLAA 4A0GA 1QJ4A 2BN4A 4BX0A 2H59A 1DXOA 4D9KA 1DO2A 4O4IB 1QVRA 1P74A 9MHTA 4FINA 1Q7TA 3P7MA 4X63A 2WJHA 1EESA 3AJAA 3WISA 4GU5A 4Z8YA 4RVUA 5CBPA 1J2YA 5JEDA 4XAQA 4GOJA 2G72A 5JBNA 5LLSA 2GHQA 2W93A 3U9TA 4V2IA 1UIRA 1P2GA 2CJWA 2IUFA 3N39C 5LQSA 5A6VA 1G4AE 3EWNA 4N41A 2VZEA 3ICOA 4LVUA 1WXIA 2PM8A 3U0BA 1W29A 3PL1A 5F64A 3R9XA 4ASUA 1SUAA 4Z7OB 4GI5A 4HDKA 1GQRA 1SFRA 1JKXA 1Z3CA 4WNAA 3WWYA 2JCYA 4NVRA 1FZQA 1IL0A 1PI3A 3S4YA 2OZEA 1MXFA 4RIIA 4E5SA 2JGAA 1N0IA 3MWKA 1SC4A 3PD7A 4DLUA 4RKRA 5I7AA 2FDXA 3DMYA 2JIMA 3DL2A 3NKFA 4OYYA 4MYTA 1TL7C 1HFWA 4Y0AA 4EJSA 2RH8A 1CRLA 2DH5A 2IV7A 1P5HA 3RAGA 4ZZIA 1GARA 2MCFA 1C30B 1T3LA 1YULA 2FFAA 3LT5A 3DR3A 4N3NA 5TS3A 5C8YA 2D5LA 1EGVB 3ZDYB 3E18A 2AG8A 3SDBA 3W3AD 3AEKB 3ND5A 5DLQC 4WI1A 1N5LA 1P2SA 4ZJPA 4HO1X 3HU1A 4YMSA 3QLVA 4Q47A 3RS2A 4D45A 4IXNA 4ZT6A 1P4JA 3O8QB 2CXQA 4RMIA 5TF4A 4EUNA 5JLJA 2CD9A 3OU2A 5EKTA 4D0LB 1X2BA 5D00A 3VVLA 1PZXA 5CDFE 3VJMA 3DE7X 3A14A 4HDOB 5A05A 1CX9B 2R1UA 4LZOA 4PZUA 4L9RA 1OB5A 3AFIA 3WOVA 4IOMA 5JPIA 1BKSB 1UKEA 1FSZA 5ITZA 5JIBA 2W2MA 3SLKA 6Q21A 1HK7A 2BHRA 1GZ6A 4X71A 3UAWA 1RNLA 1X7DA 1NC1A 1YDHA 2UUCB 3H86A 1TF7A 1Y3CE 4WOJA 3THXA 2ID7A 1WEKA 4DIMA 1P1HA 3K4PA 2C1ZA 1J21A 3MF4A 5C5EA 4D3SA 1GL7A 3M5PA 4QUBA 1OYOA 3OZBA 2XGSA 3FMOB 3CRW1 1XWIA 4P5DA 4W9NA 1CK4A 2CDRA 5E6RB 1EEXB 1B0UA 3LQFA 1EG7A 1I0ZA 5AJXA 5GQSA 1UPFA 1EFRA 1TNDA 2JBWA 2IYAA 4MV4A 5BSTA 3UXHA 4F11A 3GGPA 3TZHA 1PG5A 4NTZA 4Z4GA 3EXHB 5L3QA 5BMVB 3ZVLA 4ZHQF 1W0KD 2FRDC 1TECE 3HA3A 5LQJA 1QGED 2B1IA 3GNLA 2GXSA 1BO6A 2IJGX 2C5AA 3E8MA 1EHIA 3JQ8A 4YMIA 5K0JA 3EWIA 1JU9A 3P9PA 3AXSA 4FLFA 1QDLB 5C5IA 4IDBA 4K88A 5GV8A 3IP3A 1AUVA 5DDIP 4POOA 4GYWA 5BSHA 4EMTA 4KPUB 3SS7X 1HTBA 2XBLA 3QFRA 2HMAA 3DXZA 4ESEA 5CDTA 2HJWA 5DGHA 4MS4B 4IBOA 4HT3B 2JZOA 1JBEA 1E8MA 1VL5A 2EEZA 3ENNA 4Z0NA 8ATCA 5A06A 1XTTA 3DDCA 4LPKA 4DLLA 1KBOA 4PGGA 1Q92A 2AZMA 1AHNA 4RABA 1B26A 2OLKA 2R4UA 3QW4B 3SZ3A 3A0UA 3QLUA 2XCIA 2PO5A 3QBJA 4ZAGA 2XWPA 4F8EA 3JD1A 4XVQA 2ERYA 5CNIA 2Q4OA 3H8JA 1SCUA 5I9MA 5JOQA 5DLDA 2WKSA 4KPYA 1VFNA 2JZCA 2P78A 2QG6A 2XY4A 3NASA 4H7HA 2Q2OA 4PZCA 4G4SP 1N5DA 4AZ3B 4ME6A 1EJ0A 5JJCA 5B37A 2G1PA 4RZHA 1ZPDA 2F2TA 4HRXA 3CPJB 2PUJA 1I4EB 3N6VA 4ZVNA 4ZI3A 4JYPA 1J1UA 1NQTA 2G9UA 1DU4A 1UMCA 4NNPA 4F4UA 4QX6A 3JX9A 1TZKA 2XMQA 1PJ3A 4GUAA 3UAOA 1CF9A 1ENPA 4LOJA 4CL0A 2D2IA 2WY2D 3SXUB 4H17A 1UC8A 2Q9CA 3F78A 4BECA 1OFIA 1YVDA 1DIGA 5GADl 3N8GA 5LKAA 1SXJA 2I34A 3R8XA 5KWEA 2ORED 1OBOA 4W8OA 1OYVA 1DG9A 1RCTE 4OMDA 2Z2JA 3V8PA 4BUJA 4YCLA 2Q8NA 2FW6A 2MIIA 3RK4A 4AZVA 3IJRA 2AOVA 5E7QA 5KSPA 3TB4A 1D4FA 4XWOA 4MQ4A 4MYSA 4IJMA 5CLFA 4BFSA 2LGJA 4S05A 2CLKB 2G08A 2AN4A 3A2NA 5HQJA 3CVUA 5CFLA 2B82A 2QMUA 4JWKA 1N5MA 3H18A 4BO0A 4I2VA 4QGHA 3ICCA 3Q8WA 2BHLA 1H69A 2BONA 2BZGA 3DE5X 3HH8A 3IBGA 3WKBA 2FX5A 5EIBD 3L6RA 3QI7A 5BSWA 2H1LA 4A8JB 1LK5A 4LIPD 3C6YA 1PT5A 5ARBA 3P0EA 3WOHA 2ZR0A 2R6ZA 1ZQ9A 1L4UA 5FOQA 4AU1A 1UF9A 1NYTA 2GH1A 1EUCB 1LRJA 3DV0A 2ZIWB 4H08A 1RRGA 4Z3KA 1S6YA 1WY7A 1O94C 2EERA 5CXUA 2O2GA 3ZD7A 3MERA 4MIEA 3ZE1B 1WMFA 1NKVA 1FS4A 2JHFA 1G9XA 2IW1A 2ARKA 1KMMA 3O38A 3UK1A 1TRKA 2NUTA 2N3ZA 1V26A 4PTYA 2FEKA 4HMOA 2XYRA 1P2TA 3FGNA 1G8GA 1NLMA 3DMTC 1D0IA 3N0WA 1WPGA 3PDUA 1HDCA 1E4EA 2DUJA 4FJ2A 2IZ5A 4X95A 1AX9A 1MTZA 4FFSA 3GFGA 2YXPX 1NXVA 1SBIA 3ENQA 2HK8A 3NEAA 2G67A 4NBLA 3UWMA 1UXOA 3E5RA 4F2HA 2JLYA 1GPH1 2NU7B 4I6EA 3I2IA 2HV9A 1VLQA 2XA1A 3ETEA 3GGGA 3AP1A 1G8KA 2WJ4A 2GYVA 3SM9A 3RRNA 4BE9A 1N92A 3A6EA 3ZCRA 1U4OA 1Z7BA 4NS1A 2YHUA 2QVXX 2EGHA 1ZD3A 4A15A 1ZLYA 2NTNA 4DEVA 3MJCA 4O4LB 3EK2A 4ETNA 1NPTO 3TMAA 2J5BA 3JRXA 3GJ8A 2QRJA 3LF2A 2YUTA 3QM1A 5FYDA 3H87A 3HA7A 5HA5A 3WHKA 1Q6YA 3DDWA 1QP8A 4IF4A 5HW0A 1E0AA 1SC1A 2JLZA 1QIIA 2BVNA 4Z0PA 5BN1A 1EVZA 2I2CA 2JZNA 4DNXA 4OP2A 4PLZA 1WL8A 1RJ9A 4NYJR 1US8A 1OMOA 1HDIA 3GA0A 1JTFA 4DIKA 4YMTA 1FLDA 1VE1A 3FG9A 3FSGA 4WACA 1S2OA 3H4TA 2NP6A 3PXAA 3AF2A 1YR2A 1VE5A 3E8XA 5IJAA 1FP7A 1B8UA 2E1PA 1M34A 1V1MA 2VRCD 3PWKA 1EDOA 3E5HA 3QA3E 4R3WA 4XGIA 4ZP1A 1H4QA 5IDXA 1NXSA 1JW9B 2UUPA 3THYB 2LUOA 3GARA 1WLSA 2P7IA 3EIXA 5AW4A 1VYUA 1PR4A 4E2XA 2PQ0A 1EH5A 5KOIA 2WU8A 1ADBA 1RBMA 5JATA 5L53A 1P1KA 2TRSB 5G41A 5KCZA 4B5LA 4BEBA 1QGYA 2FWAA 3MBIA 3DHYA 3LC1O 5I51A 5HRUA 5ALOA 4JBLA 3V7NA 2ATXA 4QZVA 5KU1A 4PZLA 1XCOA 1N8NA 3U44A 2WTNA 4UM7A 2C54A 1JHQA 3AHFA 1YR8A 4H31A 2O14A 4H0NA 2X7HA 2D2XA 3Q3GE 1OIWA 1N7GA 2GBCA 2V58A 3Q4GA 1CUEA 1SCAA 2QTHA 1E6EA 1A76A 4FXPA 4NHOA 1VYVA 5LOVF 3R4CA 5F23A 1L8LA 1QKKA 2OMEA 4ZALA 4GW3A 1PJZA 1OAOA 2BM9A 4ZGWA 1ZM3A 3MB5A 3F71A 4P86A 4RORA 1DTSA 1XRPA 2F1RA 2MSWA 3KB8A 4LF8B 3ONDA 3PG5A 4P93A 3W6NA 3VR4A 2YW9A 4FC7A 4IIGA 3IEUA 4TWIA 1G1AA 1GRCA 4D82A 3MAJA 4EI9A 3NUGA 3CNEA 3CPSA 2O52A 2O4UX 1XJCA 1E58A 1V3VA 5KWIA 3N59A 4XR4A 4HX9A 4K9KA 3ZV5A 1BX3A 4Q4DA 4PLTA 1Z5ZA 2I67A 2GNOA 2RHGB 4FOSA 1FX0A 2XOEA 1PGOA 4JIMA 5THKA 4WADA 2WD7B 5HJ2A 3SOPA 4TKUB 4KSBA 1QSGA 3H5VA 1ZONA 1RAGA 3WP1B 1NM5A 4JJGA 3UWPA 1K5GA 5F7ZA 3DQPA 3LKZA 3E82A 3QKUA 2ZQZA 5FL3A 3OCZA 4C04A 3GT3A 1FMLA 1GYPA 1JT2A 3UMFA 2IYWA 2QG9A 1AH2A 4EHLA 2VBFA 2HPAA 3VHXB 2XMZA 5EXSA 1Y34E 1XQ6A 2VYFA 3CJTA 3O2JA 3UN1A 5KYYA 4DADA 1YUMA 1ECFA 4B43A 1KK3A 1N3YA 4QDUA 3PPXA 3JQAB 4IMRA 2RHRA 3R5HA 4W9RA 5B3LA 4WNCA 2K4MA 2BTQA 4B8ZA 4U4AA 4A10A 1KOLA 1BE1A 2RMKA 2HRBA 4LYAA 1EVJA 4TMFA 4WN9B 3PI7A 4PYRA 1YNOA 3W7VA 2WFAA 1UBNA 4E7PA 3SK0A 5AWFC 1DKOA 1IOLA 1TKRA 4FYIA 2PE5A 2WDZA 4OOEA 2WQ7A 3LHSA 2FX2A 3MOSA 4B6QA 1CS0A 3BSFA 3QJ5A 4KR0A 1W5SA 3W04A 2FF5A 5B7GA 2HI0A 4G84A 4C0KA 5INTA 4TVBA 2JLAA 4IHAA 4Y1RA 1R7RA 4D0RA 1X7YA 1Z4LA 1GCIA 5K3BA 1D9XA 3RS9A 1R12A 1EDZA 1L4FA 3EQ8A 3HKCA 2PSHA 5K51A 5DEIA 4HDNB 2YJZA 2G7ZA 3KYJB 4BWFB 4UDYX 5KWSA 3REOA 2Y05A 1BMFD 2WM9B 4Q9DA 3H2BA 4QQFA 1V5WA 2P8JA 3VPDA 3FMPB 2BJVA 3NHBA 3DYVA 3LQQA 4NMHA 4RD2A 4WZAA 3FDZB 5BT9A 1GKKA 2CYAA 2WF7A 3UUGA 3KQTA 4MINA 2FR1A 1LPPA 1C3VA 1F3OA 1PNOA 1C0PA 5IANA 1RPJA 3O93A 3QYPA 3ZN2A 3LDFA 4KYTA 5C37A 4GI3A 4O3FA 3EZ9A 2ZE7A 1C9JA 5B57C 1IN5A 3K09C 2Q1UA 4RSMA 3UXYA 4UMDA 3ZCQA 1ZD5A 5C53B 1WXQA 2GYWA 3ZUPA 3DB1A 4RZIA 5EMMA 2HEIA 5M2QA 3KLNA 1ZGCA 2GFIA 4PHGA 4YCNA 2NMVA 5BN4B 2X14A 1OH7A 1NRIA 2WILA 4W99A 2CUKA 3EPRA 4MB6A 2Q62A 3F6BX 2BFFA 3ONFA 5CG2A 3L7MA 1OZ0A 2ECFA 4KU4A 3LUKA 3PEWA 1DTEA 2BYTA 5FBKA 2XCOA 1QRTA 1DAIA 1Z5NA 2GR9A 2H1HA 2Y1CA 2ZJZA 3G85A 3ILHA 4BMXA 4QTXA 3VH4A 4X44A 4Z49A 2BFEA 1I3KA 4WVLA 1XU7A 4RPKA 3WGIA 4B4DA 3W0LB 2KSQA 1D4AA 1XT6A 2X5OA 4LF7B 1GYQA 3PNKA 3DKKA 1XWWA 3KRTA 1SWVA 3EA4A 4BBJA 1DX6A 4Q66C 4TXNA 3UPTA 1BXRA 3HKDA 4AJEA 2DUNA 3C3PA 4FS8A 1WQ4A 4CCWA 1ORTA 4REOA 1Z0JA 2JI6A 1QU3A 4XX0B 4TTIA 2NYAA 3DHNA 3NEYA 4E1VA 4CKBB 4DDTA 4N3GA 4K2AA 3RASA 3FYHA 1PS8A 3QXJA 5KNCA 1EYZA 3VVCA 5JUWA 2KMLA 4CE6A 3FPLA 3JALA 3VKWA 1VPLA 5JNSA 3BE4A 5ICMA 3ZUGA 4D43A 2BFAA 2EARA 5GGXA 3UICA 3NAMA 1MFPA 2CNNA 3V4PB 5AO9A 4ZDIA 2FCRA 5CA1A 4KWEA 2G25A 4C30A 1BW9B 1ZL2A 3D43A 4DR4B 4O0MA 3B8HA 4ZCPA 5A7FA 1TX4B 2ZYVX 5DRYA 1NT2A 4WCVA 3D81A 1FYWA 2HHAA 1JILA 4E21A 1KQ3A 1V11B 3LT2A 5E6SB 1TIBA 3HJCA 1SZJG 1N7IA 3PC8A 1EFTA 1SQ6A 2B94A 1GUFA 7REQA 1R18A 4Z0HO 3CLHA 5BNTA 2JS7A 3ZBUA 4ECEA 3DUWA 1HMPA 3KUKA 1M7GA 2J4CA 3IBFA 4ZWNA 3ZJ4A 4ZTUB 3DDOA 1J8MF 4YRGA 3QG1A 3F8TA 1J90A 4RQAA 3H84A 5KYXA 2NSHA 5JPCA 4EEXA 4NU5A 3OJOA 1T8TA 2QX7A 4JB8A 4BRSA 5A0TA 1ZWKA 1BA3A 3E03A 1JLRA 3EUWA 4LHVA 4BRZA 4EHNA 4YQFA 1ZH8A 3UB4A 2GZDA 2QLJA 2NO7A 1Y4UA 1CEYA 1Y3FE 4RF3A 4H59A 4CCSA 3RD5A 4D96A 4GPIB 3OM8A 2C2ZA 1ORDA 3P9CA 4BP8A 4NYMQ 1NFQA 4RETA 1Z8FA 2MDTA 1T5TA 3V6MA 1UOOA 3AERB 3AG5A 2VA8A 2MR5A 4QUAA 4QIHA 1XRLA 1KYZA 5SY9A 3M2TA 1D1SA 3FWKA 2OSVA 1D2CA 2OYRA 2CK3D 3RK1A 3TW6A 2V4MA 4BATA 4PRZA 3KJEA 2ZKIA 3BJIC 2GJKA 2Q3FA 2I4NA 1VG8A 2E18A 2CLFB 4MR7A 2N46A 3K32A 4Z54A 3CVOA 3D6AA 3OX1A 3V34A 2A7XA 2PXAA 3A4IA 2ASVA 2UVPA 3F7MA 9LDTA 1VCHA 1AM4D 1O5IA 3BEDA 1XQWA 1GFSA 1LI7A 1P4HA 3OEED 1ZUD1 3EQ6A 4MGHA 4DC9A 4CZ2A 4TYWA 2P2DA 1N33B 3QVGB 2A9FA 1Z88A 4P53A 1WW2A 3R3YA 3WLFA 5GOZA 3P26A 3FAKA 4LJ5A 4ZVLA 1FMTA 2NYUA 4FZVA 2VHXA 1OBFO 2QL9A 3H3JA 3M1LA 5HRCA 3DAPA 1XVLA 2HU2A 3FFXA 1QDUA 3CLUD 4M0KA 2BGNA 1K8XB 2PIDA 3H5RA 4RY2A 4WRRA 3TI7A 4D4JA 3T35A 4JKYA 5AQEA 1I6MA 5BP7A 1C3LA 1T1SA 4AKIA 2NACA 4IINA 3QY0A 4N6GA 1DAPA 1PFKA 2LNDA 4PGMA 4RTLA 1PQ4A 1U4NA 4B3CA 3K70C 3TRIA 1U8AA 4QU9A 3WQRA 2Z2ZA 5KHLB 4F06A 3P97A 1NBMA 2NUBA 1E66A 2X7XA 4GFDA 4JBHA 4MVJE 3UG7A 1DTWB 3H5NA 4FGSA 3ZWOA 4WXEA 4PZAA 4CLDA 1R64A 4JI5B 4FSXA 5FTWA 3DYBA 4BN4A 3KB2A 4A8JA 4LZNA 4M9UA 1OJLA 4BN5A 2PGDA 2WSSA 2BR4A 3GLSA 2J4DA 3W7AA 3FXAA 5J5VA 4HQFA 4PC7A 5DCUA 2WM8A 3V97A 4ND2A 3BL8A 1SKYE 1USWA 2HPVA 4AMVA 1PVOA 4LUCA 1EUCA 2ZTHA 3AOEA 3Q11A 4UXHA 1A9OA 2W8BB 5JXGA 5FFMA 2WYUA 3N8IA 1ZM4A 1Q3KA 3NHUA 4I8IA 3MBKA 4JNCA 5DV9A 2C2WA 2HWYA 3OCVA 2CLIB 2HNBA 3PHLA 4NV1A 4D9FA 3USCS 1GKYA 4CG1A 5HYVA 5FA6A 2ZZKA 1M0EA 2PUAA 1EJ6A 3MJVA 5JWRA 3IMCA 4EGAA 1PR2A 2BLNA 2O7SA 3PGVA 1HNNA 1KHHA 5IX8A 2HWUA 3E48A 5AK5A 1N78A 2EL7A 2ZW9A 3RJTA 3MN1A 4FMCB 4NMXB 2O5EA 4NQZA 5A9SB 2SKCA 4D8VA 2COEA 3PKZA 1IDN1 1K7CA 7GPBA 1RABA 3WIBA 3OURA 4AF8A 5DGXA 1U0EA 2VHCA 3Q9LA 1RI2A 3IXQA 1RWOA 1G66A 3L8HA 1RM3A 1DKPA 1VCOA 4FGWA 3RJ9A 1NNSA 5BYBA 3RFCA 1H0SA 3SYTA 2Z6AA 5CTAA 1L5SA 3F5QA 4INJA 1MG5A 3PEVA 2I7VA 2W2NA 2RAPA 2P4SA 4PLPA 4WQMA 3UHOA 4CM6A 3ITKA 1D7OA 2YBEA 3Q7RA 4IPTA 3WRYA 1VSQA 1KMHB 4HQRA 3W77A 1WZIA 4WKCA 2VNJA 4AYXA 5FWAA 3JD3A 1V8ZA 4TL8A 1GVNB 3SHWA 2QQ0A 4HY3A 5TSDA 4JP1A 3C14C 2OV2A 1A9PA 1H93A 1G21A 2OKGA 2Z5LA 1UAGA 4OLFA 1A9ZA 4OYRA 5JAPA 4FR5A 4NU6A 1RCFA 2VJYA 4CL3A 4EHFA 4OHUA 6PFKA 5L6LB 2FLWA 4NMWA 3HPRA 4LZAA 4AYWA 4HSGA 3FCUB 4ABTA 2PUGA 4GMKA 1NMXA 4I4LA 4OFWA 4FIDA 1P80A 4M55A 5JCXA 3LCMA 2PLFA 1ZI6A 2POQX 2VATA 3NUZA 4J0KA 4O2AF 4Z7QB 1MIOB 6REQB 3E9RA 1G5IA 4P58A 4CLOA 4ALLA 3GEBA 1THMA 1RRPA 2CLOB 3FD8A 3NTQA 1G2OA 4KN9S 3JWPA 4PVCA 2GLTA 3HA5A 2BEWB 4WLEA 2FUKA 2JAQA 2C2MA 4P4TA 4RIEA 4EARA 4I19A 2P65A 3LCVB 4CF4A 1DRWA 3JAWA 4W8GA 3AIOA 4NE2A 3RQIA 4AN4A 3JTMA 2L42A 3DNPA 4BNDA 2P2YA 1Y6ZA 4TYNA 4R6XA 3F90A 2IXAA 2O20A 1NV8A 1NW7A 3TQFA 4MULA 5ADVA 2HLDD 1WVIA 2I3AA 5FULA 3WIVA 1YQ9A 2XR1A 3T06B 2R96A 4D3XA 3GA5A 2OXFA 2FZEA 2DECA 4HCJA 1QK5A 1XDDA 3DC2A 1QE5A 3HQ4O 4OB7A 3K9BA 3OOEA 3KV1A 4I4NA 3TRJA 3VPXA 1P6XA 3WLLA 4F46A 2ZQYA 1PT7A 1PSWA 4OJMX 3RPEA 3B2QA 1VCIA 4L2IB 4HUQB 1PEYA 4M8KA 2FG5A 1N9ZA 1U9CA 3OLZA 4U7PB 3UJNA 2WPDD 3SSAA 5A3VA 5KTNA 5HKOA 2JFVA 4L5CA 2IHTA 1AGRA 1U8FO 2DVMA 4LHYA 5D3MB 4HX5A 1GHTA 1Y6QA 1GTG1 3G5MA 3DNMA 3U19A 3U4QB 1JSXA 2QZ9A 1H22A 3D7NA 1ZRMA 3LRTA 2KYRA 1A82A 1DIRA 2DBRA 2R44A 2Y2VA 4IX1A 3U1TA 5AI4A 1IN7A 1XKTA 3CO0S 1FPQA 4BIMA 3FNEA 1J39A 4DCNA 3AY6A 3OZRA 2GCOB 4FDLA 4LOHA 3WMXA 3MT7A 4WXYB 4AT1A 1LRKA 4DG9A 5HOEA 3CX6A 4RTQA 5TMEA 5DWDA 5E1OA 2E1RA 3MTIA 4DQLA 5D5QA 2PZFA 1GU0A 2JI7A 1ZJYA 3DE3X 3QPDA 2QJWA 1QVAA 2QQ5A 1RAIA 3C6KA 1QNFA 4NFYA 1E9FA 4Q3CA 3PHIA 1UEIA 1ZVMA 3VHXA 4I4TF 4P36A 2XTNA 2FZLA 4LBZA 3IE1A 2ZBEA 1FFYA 2P91A 5B12A 4CQLB 1GG5A 1MO4A 1ACLA 5IJ9B 2XPCA 2OYCA 1D0SA 3CUWA 4ZVUA 2OFFA 3V4RA 5AW6A 4RTNA 3EBOA 1IVSA 4RHFA 6YASA 2H1WA 5DU2A 2IYRA 3KK0A 4ARCA 3N58A 1WM1A 3L1HA 1W4BA 4EVQA 4G5FA 1FSSA 1L7DA 1U0BB 5KYKA 2HA2A 1E2BA 3L18A 1PNVA 2VDWB 1IBRA 4BQIA 2YZGA 5CRIA 5AW1A 2ZI3A 4HGNA 3BGVA 1R6AA 1UBSB 2MSDB 4N8EA 2MINA 4YRFA 3A9SA 3EXFA 4LX0A 1VIVA 1PEDA 3RIXA 3PHJA 3NBXX 3GEEA 4MQ5A 1N7JA 5FWXB 2BFDB 1JHMA 3W5BA 1T6YA 5LZ5A 3CKLA 4QXOA 3TR6A 1JAYA 1VL2A 3DFUA 1N5KA 2C4UA 3JAKA 1QGUB 2W6JA 4CLXA 4YUAA 3GJQA 3WO1A 1E18A 1U0LA 2OC4A 4OHWA 3UBTA 5BUZA 3M4NA 1BG6A 2GAOA 1JLSA 3TLBA 3TW4A 1O0SA 5ITVA 5FPHA 2BGTA 4JP8A 2OBYA 3NHFA 4F4CA 3IOMA 3OTQA 4BRWA 1SVMA 3PJDA 2QB5A 5J3JA 4L07A 1RXUA 2YJTD 2Q3EA 2J6CA 3DWFA 4B74A 4CCYA 4D02A 4X92A 1HX7A 3AFGA 5COQA 1TJ3A 1X1SA 1GA6A 2PZGA 3AW8A 2WB4A 1GLVA 2BFBB 3W6ZA 5IH7A 3QEAZ 2G5PA 4R1TA 4JI2B 3MGKA 2VDJA 1F9EA 1M2KA 3L1UA 4N18A 3U3ZA 4P98A 3EEOA 3U3KA 2QVCA 3QWAA 1LI5A 1XKQA 3SP1A 4GPBA 1XFAA 4NL4H 1SQGA 5JCOC 2YS6A 5ALLA 1E1LA 4MARA 3O8BA 4TL9A 4IJ5A 3ITNA 3A4LA 3L0YA 4DANA 3F6SA 5LFAA 2G9QA 2J7PA 3CR7A 4IH4A 4LC9A 3GDHA 4BO9A 4P4SB 2W58A 1COZA 4IFIA 3QMMA 3BDVA 4Q1VA 1E2HA 3EOZA 4X65B 1X86B 5KTOA 3EARA 2GN6A 4M76B 2FEWB 1UKZA 2FX3A 5IT5A 3O90A 1KU0A 5DN6A 3P1JA 3LL4A 1ZL0A 5M7EA 4BBPA 2Y93A 5FL7A 3N2YA 4DSUA 3DH0A 1DP4A 3LUCA 3CEHA 4XEHA 3ORQA 5G1PA 1TUBA 1WRBA 3DP7A 4G2NA 2FY8A 2KLHA 2L19A 4J0QA 1GIAA 2YMMA 4KYIB 4PZDA 1J6UA 3IAFA 3LPLA 2FJUA 5AW8A 4LDJA 5I4BA 4HL6A 5AUQA 2D1YA 1WXFA 2ZRPA 3ND9A 4CEJB 1GGEA 1NP7A 2XBUA 1IZ7A 3GK3A 3A1SA 4HS4A 4UATA 1HEYA 4UUMA 2WKWA 3BXOA 1U90A 2PX2A 3KZCA 3SYRA 1RIIA 4L95C 4C76A 1WQ1R 1SG6A 3LK6A 4FDTA 4JJKA 1I1QB 2PMCA 4BLPA 3SWWA 1E6LA 3BJRA 3GOQA 3JVVA 4UOZA 3AM5A 4L76A 2G4LA 2JI9A 4EKGA 3UK6A 5IJZA 4OF4A 4RTPA 1PVDA 3ED5A 3ENVA 2R8PA 2AFHB 1PTKA 2V03A 3I6BA 1CE8A 2I99A 4J94A 4MEJA 5F21A 4Q4CA 1G18A 1GRNA 1JPJA 4C7OA 3WIUA 4RTMA 4WK4B 5G3ZA 3NNDA 3ROPA 5JR3A 3RU2A 2C4NA 2VI5A 2KLBA 1DIOB 2CXSA 2FDCA 3LP8A 2F8MA 1Z07A 4MCHA 3TG2A 1L5LA 4J76A 1XHFA 2Q2VA 4ZTBA 5J63A 2YV3A 3K6JA 4FMDB 1K4KA 1QYWA 3JQBC 5B36A 2HLHA 2Q5LA 2RGCA 3GQBB 3G2IA 1IRXA 2AH5A 2F64A 4AZWA 1NSTA 3RRFA 4EBFA 1UK9A 1NG9A 1DFIA 1MX3A 2HSEA 2X8JA 4XB2A 5ICCA 3MJRA 3GPCA 3ZCXA 3T9BA 5D7NA 1UXKA 2K2WA 5B1DA 3LBNA 5JC1A 3EH2A 2Q6LA 4LJLA 4BJHB 5I7VA 2DPYA 8AT1A 1KYXA 3IMEA 2DCMA 3AFHA 1SU6A 4HH4A 4D92A 3M82A 2BGLA 2Q45A 4N82A 5D1NA 1DXQA 1ZXBA 2O3SA 1MUUA 2O48X 3HFGA 2OA0A 2OM2A 3C6QA 5T4HA 5EPEA 4C89A 4ZXFA 1G8PA 5ABPA 2ZTVA 1JEAA 1P73A 3NWJA 1MQAA 2NG1A 4G5XA 5K0NA 5K3AA 3X1MA 4AN0A 4TV9F 1VCMA 4LNUB 2PTGA 3IUYA 5JAOA 1J8VA 3HUEA 4DS3A 4ZK2A 4H4CA 2BEUB 2Q27A 3GZ4A 3RRMA 2D5CA 1RRKA 1O9GA 2IYZA 2VO1A 5JO0A 3GRZA 4YJKA 1Z2AA 3FUVA 1X39A 4F60A 2WYOA 1SCDA 1Z5PA 4FS3A 5H82A 2FK7A 4N7RA 1GPBA 1I6WA 4MVJD 1AMNA 3FZNA 3RVDA 1NTRA 1C8VB 1WHSB 3PLRA 2C7BA 2PUHA 4JLSA 5DCWA 5T64A 4J9UE 1AN9A 4JT8A 4OM7A 4DV2B 4ID9A 4J1SA 5LXTF 2Q4BA 4B7ZA 1WIWA 1GPNA 3PXUA 4C4ZA 1HLGA 1F2UA 1Z13A 1NVXQ 1CZLA 1TJNA 2HA4A 4DRXA 2FI1A 2C88A 3KL2A 1QS0A 2Y2UA 4YA6A 5DYWA 1AZWA 2VXOA 1NPYA 4E4YA 2ZVQX 4KGZA 3GLFB 3EXG1 1EDEA 1K6JA 1ZN7A 1ISJA 2A59A 2WJ3A 3H97A 1SCQA 4C0SA 3WP0A 4NESA 3GPIA 1J2UA 1YNSA 3Q3IA 4UDNA 1RWXA 1XZCA 3OZUA 2X2EA 4MQUA 1U0OC 5A4JA 2C61A 3D6FA 4G4JA 4EA7A 4UUAA 2FVXA 3AIMA 3VSDA 4KVZA 1ISGA 2HK7A 5DX8A 1EHCA 2QN2A 3SX4A 3H16A 4CODB 2RARA 2A0XA 1YRWA 1W5AA 3N7UA 2Z4SA 2OHFA 2OHOA 3VOAA 1PU2A 3KQMA 4HNAB 3QVUA 3EF3A 2RKOA 1BFDA 3SKYA 5ADWA 2AQ8A 1IB0A 3U3XA 3BUSA 2C7QA 3H0EA 2QP9X 2H11A 1GT91 1HKHA 2IEBA 1Z4OA 2AR0A 4JU8A 1NW3A 3DV2A 4IKPA 4ZQEA 3TCXB 3F6YA 1IPHA 1GRVA 2QUZA 4OQ4A 4LZZA 3G2PA 4XSGA 2BJWA 1HZJA 1LPMA 1RS0A 1TQ2A 2YMLA 5I4IA 3VGJA 1ZK2A 1YS9A 3BFXA 3I2YX 5JNUA 1IXRC 1RVDA 4JH0A 2RGNA 4MMYB 1I3OA 2I3BA 3ACBA 3H8WA 2Y1XA 2IHYA 2AMJA 3CB4A 5FQNA 3VR6A 2IH5A 4LY6A 3IHKA 5D84A 1J9EA 5KNDD 2IIBA 1FXWF 1ZIXA 2R4TA 2F3TA 4G86A 3ROKA 3EY9A 1MW9X 1FJGB 3GJ6A 2HTEA 3MTAA 4L6IA 3R9WA 1CQPA 4LWQA 3Q2OA 3H1FA 3R41A 2YVLA 3S3TA 2REOA 3PWSA 4L78A 2G70A 1Y42X 3PUKA 1ZU5A 1L3CA 4X6UA 1NF2A 1II8B 3D8RA 1FS6A 4GNKA 3U62A 1S2DA 3O8DA 1XEFA 4U5QA 2VPYA 3QUBA 3RSGA 4GI1A 3VNRA 1BVUA 1F8XA 1VDMA 1XKXA 4O29A 4Q9IA 5KKAA 4ZVVA 2FPPA 4KTVE 4HH1A 4J9VA 4OMUA 3QPWA 3SNHA 4NJMB 1PJAA 3PR2B 2JFWA 1C9YA 2IXEA 2JAWA 5F5LA 2XDQA 3GLIA 2W4QA 3DEJA 3HE3A 4X54A 1MCZA 4N3BA 2EVWX 5E4JA 3N2KB 2OAQ1 1QZUA 4DKJA 4MUYA 4EO4A 1H1LA 5SYNA 4K6HA 5TC4A 5KJFA 5T4EA 2Q5CA 5MF6A 2JJ2A 4TM8A 3ORSA 4O08A 2QL5A 2OFOA 3I64A 3RIGA 3LY8A 1II0A 2GGSA 3OTGA 5F4BA 3RTBA 1OLUA 3RT1A 5JS8A 2ZRBA 2FZ4A 4RVGA 3LY7A 3IP6A 3DPUA 1AGNA 3NIDB 3CLSC 1G5PA 2LVBA 5EMNA 2BEJA 1U3GA 3C3MA 4L85A 4MA5A 1MHTA 5A9TA 1A2OA 3RYIA 5DZSA 3ZQUA 1BE8A 3S0JA 2FFRA 1E1RD 2QX4A 3Q9SA 2VJMA 5B2EA 5B3JC 1GZ7A 1W36C 3NUQA 2IYFA 2J08A 2X8WA 2O8DA 1E64A 5C31A 5DK6A 1O5TA 5KREA 2GK6A 2FN3A 3D3JA 4XQCA 5F3WB 1N25A 1P3Y1 2PSJA 1KSJA 2GKSA 1SXHA 4Q4HB 4KYVA 1LFDB 3TEJA 5HS4A 2OHXA 2ZRGA 1YMVA 2J3HA 4DIBA 2X5KO 3BPSA 3IV7A 4KO2S 2AXNA 5HJEA 3ODGA 5DT9A 1NWHA 4E5UA 2BE9A 4MNTA 5LN1A 2Z2XA 4FWTA 4A5SA 4C2AA 1KS9A 3HNOA 1ATZA