4LYDA

Crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
276
structure length
268
Chain Sequence
MFEQFESKFIDCDGIRTHYIEMGEGDPLVLVHGGGAGADGRSNFADNFPIFARHMRVIAYDMVGFGQTDAPDPAGFAYTQAARTDHLISFIKALGLSKICLIGNAMGGTTACGAALKAPELIDRLVLMGAAVNISPDDMVANRYDGSEEGMRKIIAALTHSYQPTDDIVHYRHEASLRPTTTAAYKATMGWAKQNGLYYSPEQLASLTMPVLVLGGKNDVMVPVRKVIDQILAIPQAIGHVFPNCGHWVMIEYPEEFCTQTLHFFGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Lid Domain of the MCP Hydrolase DxnB2 Contributes to the Reactivity toward Recalcitrant PCB Metabolites.
pubmed doi rcsb
source organism Sphingomonas wittichii
molecule tags Hydrolase
molecule keywords MCP Hydrolase
total genus 89
structure length 268
sequence length 276
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lydA00
4C87A 5AKZA 4FLMA 5CT4A 3SX4A 3WKBA 5K5EA 1F6WA 4CG2A 4KRXA 5CRIA 1EH5A 2Q0XA 3H04A 2HHAA 4PF1A 4Y9SA 5AOBA 1XRNA 2J4FA 2VTVA 2VAXA 4YX9A 3W9BA 2PSFA 5AK5A 4HXGA 1XZDA 2C0QA 4OPMA 4AMYA 2QR5A 1G42A 4Y2TA 3WK5A 1VXOA 1ZJ4A 3D3NA 2QZPA 1H22A 4W1RA 5JAHA 4J0GA 3H2JA 1EDEA 4Y2RA 1CEXA 2WG1A 3WKCA 3QMMA 2Y6UA 3PE6A 5K3AA 4EZIA 2WQZA 1UOPA 3WIOA 3DKKA 4AB1A 1OXMA 3AZOA 1HLGA 3SWWA 3QYJA 5ALLA 2QT9A 4CCYA 5FKJA 3LLCA 1LPNA 2Z5GA 3N2ZB 1LPSA 5JATA 1IUNA 5CH8A 4BATA 2WTNA 5EIHA 3O4IA 3I6ZA 4ZXFA 3BIWA 2J4CA 3I6MA 1W52X 4O08A 3H18A 1QTIA 2Y1KA 5CW2A 5HF8A 1GPNA 2C5FA 3HC7A 3D2AA 3VVMA 3FYUB 2ZJ6A 3WA6A 1CUIA 2VQ6A 3W9UA 1CV2A 4MJ3A 3WWCA 3FWHA 1EA5A 3F96A 3QBJA 4M0FA 2VAVA 1LBSA 2JGLA 7YASA 1UWCA 4H7JA 5IVIA 5YASA 4GBGA 1HPLA 2ZYSA 4PSCA 2IITA 2W6CX 2WUEA 2XQFA 1LPOA 1M33A 3D7RA 1A8SA 5AK6A 4KE7A 1MX5A 2ZYHA 3CN7A 1MAHA 1XRLA 1H2YA 4AN1A 3WZLA 1GQSA 5LKAA 1MTZA 4LKOA 3I2KA 4N8SA 3D0KA 1SC9A 1ZOIA 3I2GA 2R8BA 1QFMA 1LGYA 1VLQA 1AMNA 2GYVA 4QDXA 3WWPA 1YAHA 4ARAA 5ALEA 4Q3KA 5DYWA 5FOQA 5HK9A 2Z3ZA 5AJHA 1MPXA 3OC0A 1UT6A 3WL5A 3M83A 1OCEA 3VJKA 4P08A 2XUFA 2CZQA 3FYUA 4KE8A 3HXKA 5HF9A 1IVYA 1TIBA 5A7HA 2IX9A 3A70A 4UBNA 2V9ZA 1XROA 3A6ZA 1GKKA 1WPXA 2QVBA 4EY8A 2XQGA 4YPVA 3IUJA 4EA6A 3Q8WA 4X91A 4UBKA 1XZEA 3JW8A 1UKAA 4DTCA 5JAUA 3YASA 5BWBA 1NU8A 1C7IA 4W1SA 3MVEA 3D2BA 4B83A 3SK0A 3WK6A 3G02A 2XUOA 1R88A 2WIKA 2JF0A 1MJ5A 1R4ZA 3H1BA 4C88A 1BN7A 3BJRA 3FNBA 3PUIA 4N5IX 3FYUC 3ZLTA 1DQZA 2C0PA 4UHEA 1ZIXA 4EY7A 1CUBA 5ESRA 2CB9A 1EB8A 1ZI6A 5JD6A 3I1IA 2JGFA 3E1GA 2XI4A 2NW6A 3A2LA 2WM2A 3EQ9A 3F8SA 5CXUA 1GQRA 3AILA 4OB7A 4XIIA 1MX9A 2V96A 2UZ0A 5AI8A 2PSHA 5FRDA 3KDAA 1BCRA 5ALHA 4C4YA 5E4JA 5D6OA 1CFJA 4QDOA 2GZSA 4DIUA 1MU0A 2BUCA 4X92A 3WA7A 2WILA 2QM0A 3QPDA 5A7GA 1UK6A 2HRQA 1CUYA 3G9XA 3E3AA 4BP8A 1WHSA 4X6XA 2XUJA 5FV4A 4QZVA 5A2GA 2I3ZA 3WYNA 1GPLA 1Y7IA 5J3JA 2HIHA 1QTRA 1ZD5A 1CUCA 3BWXA 4JYMA 3ZV7A 4A16A 2Y2UA 4B81A 3O4GA 1UXOA 5FUMA 2J3QA 5D7BA 4BDTA 2PVSA 1R50A 2BJHA 1QIFA 4BCCA 4H7KA 1L7AA 3HACA 3ANTA 4UHCA 2WHPA 3GZJA 5LLSA 3PFCA 4BAGA 1GKLA 4E11A 2HRRA 1E8NA 3WK8A 3LS2A 5E4YA 1JJBA 1E8DA 4UBJA 1VA4A 4OYYA 5JARA 5JADA 1QIMA 4OCZA 1XKTA 2ACEA 2WFLA 3EF3A 5AO9A 1AKNA 1P0IA 1G4HA 4IH9A 4K6GA 1F0NA 1JJFA 5FP0A 4LXGA 3KXPA 2XMCA 3G9ZA 2HA2A 4K2AA 2VA9A 1XQWA 4LHEA 1VA5A 2VT7A 4ITVA 1FSSA 3GELA 4ZGBA 2Y2VA 5AKYA 4WJLA 3QH4A 2WUGA 2AXEA 3BIXA 3D2CA 4HAIA 2VJAA 4G9GA 5JZ9A 2VJBA 4KJXA 1QFSA 1CLEA 2RI6A 3WQHA 1QE3A 1XQVA 3BDVA 3I1YA 4GWLA 1N5RA 2LIPA 3LIIA 5AI5A 2VSQA 4X93A 4BB0A 5DYYA 1QONA 2HL6A 4QLAA 3AIMA 4UFNA 4QDTA 3FSGA 3DQZA 3WKAA 4ZI5A 1WHTA 2QJRA 1ZD2P 2B9VA 3IURA 3UUEA 5ALVA 1B6GA 1O6FA 5ALUA 4AN0A 4DLNA 2WFLB 2D5LA 3G0IA 1YS1X 1K8QA 4DNFA 4OD0A 2ZJ7A 3O9VA 3ZLVA 1E8MA 4BTLA 4G5XA 1IZ7A 1VE6A 3BDIA 4BP9A 4IH1A 5DWDA 4H7EA 2CUTA 3PF9A 1K63A 4AX4A 1BU8A 4AZ0A 2CJPA 1X2EA 2FJ0A 2JGMA 4G4GA 3A2NA 4HVTA 1SCQA 1WB5A 3BE8A 1JMKC 1N8SA 3H2GA 1CUXA 1MN6A 4Y2JA 5FPPA 2P8SA 2ZYIA 2XMGA 4W63A 4AZ3A 1F0PA 1AURA 3G8YA 3JWEA 4MWTA 5LIPA 5AKKA 2PL5A 1Y37A 1LPAB 1HQDA 1SFRA 1CUHA 1ZD3A 2AJLI 5AI6A 4UFPA 1DTEA 5JAPA 1KEZA 5K3FB 4LYEA 4EUSA 4H7DA 3CCCA 2WU4A 4TGLA 3F97A 4CI9A 3FYTA 3IVMA 2X5XA 2ES4A 3VXKA 4B84A 1LNSA 1LPPA 4KAAA 1XZGA 2QRUA 3OM8A 5KWJA 5K3CA 1BROA 3DYVA 5LZ8A 2DHEA 4Q82A 4C4XA 4X90A 5D3KA 1NX9A 1EDBA 1DWOA 1QOZA 5HZGA 4MEBA 3Q0TA 4DM7A 2DHCA 4N8DA 3WI7A 1CRLA 3C87A 1QIKA 5AOAA 1EDDA 2PU7A 3G7NA 3STVA 3H2KA 5ALRA 4ZV9A 4B7ZA 3DD5A 1A88A 1RWQA 3FOBA 1LZKA 3WK4A 4X95A 3IUQA 5C8XA 2QOEA 4PSUA 3BJMA 4KYVA 3HABA 5AKLA 2WSLA 1F8UA 4CCWA 1K6EA 1XLUA 3IB3A 2HU7A 1WCYA 4WCVA 2DSNA 1K4YA 2B61A 2G5PA 3L1JA 2YXPX 2ECFA 4HXEB 5AK4A 3ZWQA 4WDQA 5ISMA 3WKDA 3DLTA 5E2IA 1IUOA 3H1AA 4BCDA 2Z8ZA 4U2GA 2PU5A 1H23A 5CT5A 4FLEA 1X2BA 5ALIA 3I2JA 4UBLA 5A62A 1VXRA 5AOCA 4BC0A 4N5HX 2OGTA 5DNWA 1CQZA 1T2NA 5K3DA 4Q3LA 3WWDA 5AP9A 2WJ3A 1XZAA 5I8PA 2IIVA 3AFIA 2FX5A 2I78A 3D5EA 1THTA 3K6KA 1CUWA 2I03A 4Y2SA 3GA7A 4G8BA 4ZWNA 2QXTA 2CEKA 2XLBA 3W2TA 4FKBA 3AZQA 4GECA 4UFOA 4E15A 4C6HA 1XZHA 1BS9A 4IH4A 3PF8A 2E3JA 1P0MA 2O7VA 1XZCA 1EHYA 1CUAA 1CUJA 5EHQA 2V98A 2OXEA 2HFJA 3ESAA 2XMSA 2DFPA 2WG0A 3C6XA 5DYTA 3C6YA 5CURA 3QPAA 4G4JA 4GDMA 2Z3WA 3AIOA 1Q83A 2AJ8A 1MNQA 3W06A 1XQYA 1QJ4A 4BCBA 1DX6A 4Y2QA 4I4CA 3EBLA 3DL4A 2OQIA 3V1LA 4OSEA 4Y2PA 4ARBA 1CUVA 3TEJA 1XZJA 1Q0RA 3WWOA 1QIHA 1L7QA 5C81A 5AM5A 4XX1A 2YH2A 4F5ZA 4H7HA 4A23A 4QE3A 1AZWA 3R3WA 4EHBA 1ZGCA 2I3DA 1TCBA 2XQKA 4QWMA 3FAKA 1W75A 3HI4A 3ZPXA 4EBBA 4J03A 3MGAA 1JKMA 5EHXA 5BOVA 2GBIA 4OU4A 4FLFA 5ALKA 5ALTA 4FWBA 1ODSA 3C8DA 3CXUA 4E14A 3VJLA 4W1QA 1JU4A 3DOHA 4FMPA 2OPHA 3G9TA 3RK4A 1J06A 4OB6A 2G4LA 3F67A 3FVRA 3GBSA 1KU0A 5CBKA 2HA7A 3BXPA 5DJ5A 3H0CA 2OGSA 1E5TA 4RPCA 5KWIA 1DX4A 1ACLA 4M0MA 1ZI8A 1XLVA 1YS2X 4RNCA 4BE9A 1AX9A 1RP1A 4JEIA 4UHDA 3WL6A 3B3QA 3PICA 1ETHA 4QDZA 1VE7A 4CIBA 3C8HA 1WB6A 1QIIA 3DEAA 4J0CA 4Q1VA 3G0GA 4FDMA 3K2IA 5A7FA 2GBGA 4MWSA 4ETWA 3TGLA 4WFIA 5LKRA 5ALOA 2QXUA 1U8EA 3G9UA 5AH0A 3WK9A 2PM8A 4Z49A 4KEAA 5HCUA 5H3HA 4H7FA 5KREA 1TQHA 4F21A 5AI4A 3AUKA 5ALGA 1D07A 5AM0A 2O7RA 4Q3OA 5KBYA 1QIEA 2PBLA 3VDXA 4QDUA 3STXA 1EB9A 1USWA 1FFBA 4WFKA 1N1MA 2OCLA 4MQLA 3QITA 4UHFA 5AK3A 4CG3A 1JJIA 4J3JA 4X94A 4G4IA 5LZ9A 1C7JA 3WKEA 4CFSA 3M81A 1THGA 5LZ4A 3EQ7A 2PPLA 1W1IA 2OG1A 2WU3A 4H0CA 1JMYA 5JYCA 1U2EA 3B12A 1CUFA 5AKEA 1H2WA 1UFOA 1XRRA 3IA2A 3WL7A 2ZSIA 1S8OA 1DU4A 1XZMA 5ALFA 4B85A 2CMFA 1IMJA 3X3HA 1JT2A 1P0QA 2BAGA 3OOSA 3WMRA 1R9NA 3BL8A 1HL7A 2ROQA 3R40A 1YR2A 5K3BA 1CUZA 1SCKA 2RHWA 1G66A 2J3DA 3OTQA 4K6KA 5ALSA 2PX6A 3SC2A 4M0EA 4WY5A 2EEPA 4LXHA 2XE4A 1FFDA 2XMDA 3STTA 2O2GA 3ESDA 4OU5A 4I3FA 5JIBA 4PQEA 1GGVA 4MYSA 2EDAA 2ORYA 4G1FA 1EVQA 3H19A 1PJAA 2XUGA 2OCIA 2JEYA 2PUJA 1C4XA 3KWJA 4U2CA 3WL8A 2VT6A 1MT3A 2PSDA 3QMWA 3GROA 4DSZA 2JBWA 4GEGA 1OILA 3WIBA 3NUZA 1K5PA 4W1PA 3L1HA 5A6VA 3DJYA 1O6GA 4J0HA 2HM7A 1SOMA 4X71A 2WHPB 1RYYA 5EFZA 1VZ3A 3R0VA 2XB6A 2JGIA 4J0JA 1R3DA 3I28A 3WJ2A 3DDUA 1ZI9A 4OB8A 2XDWA 2JGJA 3WK7A 5AIBA 1U4NA 3OURA 5AKHA 3C5VA 3ESCA 4UUQA 1R9MA 1WM1A 4G8CA 4FFVA 4BRZA 5HQ3A 1EK2A 4DMHA 4Y2UA 3O9MA 4BVKA 5CXXA 4LYDA 4WFJA 4BBZA 3C70A 1CUDA 2GZRA 2WIFA 5T4HA 1ODCA 1JU3A 3LP5A 1ZIYA 1TK3A 4FNMA 4QNNA 1CR6A 5FPQA 4UBIA 1N5MA 3E4DA 5AKGA 1MAAA 5HFNA 1HBJA 3NGMA 4NVRA 3R3UA 4Y7DA 3ZI7A 2HA0A 4U2EA 4ROTA 3WZMA 3DOIA 2BFNA 1FFAA 2OCKA 1XRMA 3ICWA 3RARA 3K9BA 2RAUA 3R3XA 5ALZA 5AKIA 1YB6A 4JNCA 3G0DA 2JGEA 4BC1A 2QUBA 3VJMA 1ZJ5A 1DINA 2D0DA 1P0PA 1QIGA 4W9RA 2XUKA 2V97A 5AM1A 5T4EA 4KRYA 3ED1A 3QZUA 5HKBA 3C45A 3M3DA 1DT5A 2XQJA 1VZ2A 4DMCA 1QO9A 3BF7A 3E0XA 4RE5A 4GLBA 1BEEA 4KACA 2DQZA 2K2QB 5LP1A 1A8QA 1J2EA 5HQ3B 4MXDA 4HRYA 1AGYA 4Y2YA 2O2HA 3IIIA 4KAJA 4DNQA 4AO8A 1CUUA 4F60A 2GBCA 2B20A 1X70A 1UK8A 1UOOA 1YA8A 4K5QA 3VKFA 4FOLA 1CUSA 1BRTA 2AJBA 3V1NA 2BUBA 2ZVDA 1HKHA 1YSCA 3C5WP 3G0BA 2WIGA 3S2ZA 2VATA 4BZWA 5AI9A 3ILSA 3RM3A 4B9AA 1VKHA 1J1IA 5ALXA 1E3QA 4EY5A 1WPRA 4PW0A 3GUUA 2QS9A 2GYWA 5EIEA 5DLPA 4FFWA 2FJPA 4GHWA 1BEZA 3HEAA 4PNZA 3HRHA 4FTWA 1ORWA 5CH5A 1XFDA 3TRDA 1NU6A 2O2IA 4CCYB 2WHRA 3O0DA 4KE9A 3HJUA 5K3FA 4V2IA 2G63A 3FCXA 3KOOA 4L3WA 5DTIA 5ALJA 3WWEA 2XQIA 3HZOA 5AM2A 3D59A 2JIDA 3NWOA 1XZBA 4CG1A 4B9EA 1WOMA 5EHNA 1KU6A 1PFQA 3H2HA 3N0TA 2PSJA 1TCAA 3LCRA 3U1TA 2JEZA 4WY8A 2GBFA 3EIOA 3GFFA 3DCNA 2XUPA 4BZZA 1ZICA 2RIPA 2G5TA 4BAUA 2XUIA 5IVDA 5IVKA 4AO7A 3IULA 1DWPA 5AHXA 4X85A 2HA6A 2QUAA 5BWCA 1UZAA 3S8YA 3DYIA 2DHDA 5JASA 3L1IA 2HU5A 1LPMA 1A7UA 3V1MA 4L72A 1CUEA 4NS4A 5DNUA 2ZJFA 2VF2A 3JYHA 4S0XA 4B0PA 4MEAA 1XKLA 4ZREA 1MX1A 1ZGBA 3I2HA 5T4FA 3D4LA 2C58A 4HTAA 5AKXA 4K6HA 3QPCA 1MO2A 2JGKA 4B6GA 4DNPA 1EX9A 3C6ZA 1T4MA 1Z68A 1GZ7A 3O95A 4PV7A 4L9AA 4DMFA 5HKAA 5IKXA 2OAEA 4X6YA 2QMQA 3STYA 3CN9A 2YASA 4PSDA 3NOXA 2QTBA 5IVHA 5K3EA 4KE6A 2C5GA 5AKJA 5ALMA 2Y6VA 4LXIA 4RGYA 1EXWA 4C4ZA 4B82A 1LPBB 3I6YA 3FBWA 3DL7A 1R1DA 4QLOA 5JD5A 2PUHA 4BDSA 3KWFA 4U2BA 5F4ZA 4Y2VA 1Q0ZA 4HS9A 3RLIA 1FJ2A 3B5EA 1CQWA 3AIKA 4YASA 1XLWA 2W22A 5CT6A 4B80A 2RHTA 3WYDA 3ZLUA 1ZD4A 5LYYA 1AC5A 1E66A 1GPKA 3FCYA 1W6RA 2PKYX 4C01A 5ALNA 2VEOA 1PV1A 5CH3A 1AQLA 3PUHA 3DNMA 1YCDA 1IUPA 2XMBA 5I9IA 4X97A 4YK7A 5HFAA 5C8ZA 5FLKA 1EK1A 5ALWA 4Q34A 5LZ2A 5EIAA 3KSRA 4FBMA 4INZA 5AI0A 3IUNA 1EINA 2XMRA 4X00A 1QZ3A 4UHBA 3ICVA 1SCIA 3IBTA 2CKMA 2XUHA 4E46A 3T52A 1DT3A 4WDRA 1UOQA 4X7BA 1LLFA 2GYUA 4DNOA 2BGNA 4DSAA 4J0DA 3PFBA 2WG2A 1JFRA 5ALQA 4JH0A 2VJDA 2OGZA 4UBOA 4TPKA 4MQMA 2WJ6A 3U0VA 4KAFA 3R3ZA 5DNVA 4DGQA 4QEKA 2RONA 1VJ5A 1B41A 4AO6A 3FLEA 4QA9A 3I2FA 2AJCA 3FLAA 5CT8A 3P2MA 4MYDA 1XRQA 1CPYA 4NZZA 4JYPA 1GT6A 4BYMA 1BN6A 4DYHA 5C8VA 4IQ4A 5JD4A 4BVLA 4C89A 3G0CA 3O4JA 4H18A 2BKLA 2ACKA 3AZPA 2R11A 3FSGD 4B0OA 3OPMA 1GXSA 1Q84A 1XRPA 1CUGA 2HA4A 3PDCA 2WTMA 4BVJA 3V9AA 1L7RA 5AIAA 3OG9A 2DQYA 1TAHA 3MUOA 1UKBA 1UK7A 2XT0A 5HF5A 4I19A 3DKRA 3T4UA 4HXFB 2OCGA 4Y2XA 3IUMA 4BAZA 5AM3A 2XMZA 5D3ZA 5IH7A 4XWGA 4N8EA 1UKCA 5JAOA 6YASA 2BCEA 2ZYRA 4H77A 1LBTA 5AM4A 1YB7A 2RGUA 4BRSA 1CVLA 3STUA 4KR0A 1YAJA 5BV7A 2WFMA 4BE4A 2WLSA 1QIDA 1HDEA 2VJCA 4UPDA 2C7BA 4U2FA 2WHQA 4L0CA 2H1IA 2OAGA 2BUAA 2BGRA 1TKRA 2X8BA 1BE0A 1DWQA 1QGED 4FNGA 1CIJA 3IDAA 1J07A 3W05A 3QMVA 4RE6A 3UMJA 4AMZA 1Y7HA 3F9CA 1VOTA 4J7AA 3QM1A 2HU8A 2WKWA 4GXNA 4IO0A 2XUQA 5CTAA 4PO3X 5SYNA 1QLWA 3R3VA 4OUKX 4P93A 2HADA 4FHZA 4EY4A 4GW3A 2HA3A 4UBMA 2EDCA 5ALYA 2WIJA 1ORVA 5EHZA 4QWWA 1ODTC 2WUFA 2HDWA 4ZRDA 1EI9A 4EY6A 5ALDA 3V48A 3TJMA 1XZIA 3W04A 3AJAA 1XZKA 5JANA 5JZBA 3C43A 3AINA 3H2IA 3C6BA 5CT9A 1E89A 3I2IA 4G9EA 5HF6A 5JZSA 5DTJA 3H17A 3CCBA 3A2MA 4H35A 4OYLA 1ACJA 4GI1A 2YYSA 1G5FA 4HRXA 1TCCA 3UUFA 3EQ8A 4P92A 2C4HA 1H2ZA 2WIDA 2WJ4A 2H9YA 3WLAA 1W4LA 2H7YA 4A5SA 2DCMA 5I7UA 4DMKA 1BCSA 5SYMA 3BF8A 3KD2A 2XLCA 3HSSA 1FFCA 4XVCA 1ISPA 1LZLA 1U65A 2H7XA 4X3CA 3PI6A 1YA4A 3HLKA 4HZGA 3FVTA 2QKYA 3ANSA 5JALA 4AXBA 1MNAA 2WUDA 3QVMA 1UK9A 4D9JA 3DS8A 3HYSA 3M82A 1YASA 5LZ5A 2XUAA 1W76A 4G8DA 4UHHA 1DQYA 5EGNA 4AQDA 2ONCA 4U2DA 5AICA 4P9NA 5ALPA 1TRHA 5T4BA 1EVEA 4JUIA 1WB4A 2FUKA 1AUOA 2ZSHA 4H7IA 5C7YA 2DR0A 2H7CA 3ESBA 3R41A 2X76A 3LIPA 4X6UA 4ZV7A 1FFEA 3O4HA 3VISA 4CIAA 1IZ8A 2CBGA 2HA5A 5EI5A 1XQXA 4F0JA 4IHAA 3RKSA 1H2XA 5HK8A 4J0IA 2XUDA 4NMWA 5FDFA 1QO7A 2AJDA 4BTVA 1JI3A 2OLEA 3STWA 2B4KA 2PSEA 3FLBA 3V1KA 5FXMA 3VVLA 2WFZA 5CMLA 5LZ7A 4LIPD 5A71A 4Q05A 4TVKA 3MUNA 3R3YA 1XZFA 3F98A 4XJVA 1A8UA 4J0KA 1I6WA 2XMQA 2HFKA 1QIJA 4FBLA 3WJ1A 2Z8XA 2QJWA 5E4TA 1XZLA 4EB0A 2OQVA
chains in the Genus database with same CATH superfamily
2CFOA 5G2OA 5L53A 1E79A 3LTEA 2G7ZA 1TPZA 4WD3A 1PR0A 1DXOA 3P2EA 2E1RA 3E1KA 3SX4A 3WKBA 4EA8A 3EULA 5CA0B 1L4MA 2PAFA 4PZEA 2I7XA 1QB7A 1SO8A 4P4GA 3ORFA 4XRGA 5K8JB 3L0CA 3OZSA 1Z6AA 1U98A 1UFQA 3A6EA 4G07A 4BUZA 4L85A 4A03A 3DBVO 4OAOA 1I13A 1KARA 3KT3A 3SZUA 1MW9X 4C3VA 2VJYA 1TZBA 4KRXA 4GSLA 5CJ2A 2J0SA 4PRKA 16PKA 4ZZ2A 2PD4A 2VSFA 1NNSA 5BQPA 4A8JB 1L8XA 1CVRA 1ILWA 2JAXA 2H2DA 2HHAA 2I99A 5KQMA 1BU5A 1M2VB 5C31A 4DJTA 4OF4A 3SE0A 4ZOEA 4JJAA 1I5EA 3GEMA 4EX6A 1Y8QB 1AF4A 1KAMA 1VHDA 2FRXA 4H1UA 4HX9A 4NXNB 1O96A 1Z2EA 2H6EA 2HZBA 2AFHB 3LBIA 1C4KA 3OCUA 2VTVA 5EGSA 2CN1A 3K9NA 4YEDA 2AN3A 2QLJA 3EPJA 1H8HD 3DONA 3F6BX 3E6AA 1ZRMA 4MMXB 4Q19A 1OVMA 4EPVA 1TJNA 4MR7A 3WGMA 4F1WA 1ODFA 3NNDA 3NPMA 5FOVA 1NG9A 3P0IA 3TQTA 1DXYA 1VYHA 3BICA 4AMYA 1XJCA 2VCEA 3AESB 4Y2TA 3WK5A 1A5BB 3HYNA 4RPJA 1MVLA 1P29A 1VXOA 2Z09A 3D6JA 1JHMA 1ZJ4A 3M5CA 4ZT3A 1Z15A 3D3NA 1GU0A 4WOPA 2PMBA 1H22A 3NJRA 3IO3A 1V95A 3A06A 4AJOA 5JAHA 3H2JA 3KEOA 4Y2RA 1F1BA 5T5QA 4DA4A 1RDFA 1PGOA 3LC0A 5NULA 1TMYA 3DEHA 3OICA 2BP7B 3BCSA 4QGHA 4XVQA 3AR3A 1YI8A 2WNHA 4KO3S 2B2NA 2GHIA 1IY0A 3I04M 4TYMA 2QAGB 1ZR4A 3R5XA 2WG1A 2EKBA 5KHLB 2FG7C 4RDCA 2GLXA 5LFAA 1NMZA 1FQWA 3PC2A 1XMQB 4BEJA 4L57A 3VH4A 3SKVA 1UZMA 3A10A 4WE3A 5JLAA 4BMZA 4MOWA 4H6XA 4OA5A 3PEFA 1JG6A 2CMKA 2VNJA 2BGUA 2Q2QA 1ONPA 2R1UA 4UZEA 5TX7A 4EZIA 2PKCA 2VZLA 5BVGA 5AT1A 4BBJA 4RVSA 2C4VA 3K6RA 3U7GA 4HB2A 3DV0A 5IBPA 2G77B 1RRCA 1E0DA 4GGPA 3N53A 4G01B 4Y6GB 1NTOA 4KXYA 1DI0A 1OXMA 5I7EA 3U3MA 3AZOA 2Z1DA 5IZCC 2C8LA 3SWWA 1RXWA 2BZGA 3LT0A 5UKDA 4COKA 5SYAA 2FPLA 1Y6QA 3ITNA 1N2SA 1Z2PX 4OXQA 3AHFA 3THXB 2YOHA 2OHXA 4RIGA 1ZCBA 3AL0C 3N86A 2B83A 1EAMA 2DTDA 4TMTA 4DCPA 1CJSA 3THYB 3F4BA 4FFRA 4P22A 2P9JA 1V45E 5DLDA 3R9KA 3K0EA 1YQWA 1WRBA 1IONA 2Q2VA 3X2EA 5B6PA 5J4KA 1UQRA 3ZDFA 5C0OE 5HBGA 3IO5A 1EZ4A 4O4IB 3NTVA 2C00A 1JS1X 3EQ2A 4EYQA 1E4OA 5BV2P 3GLGA 2FLWA 1ISSA 3MWLA 1XE3A 2BTOA 3P9YA 4RTMA 4PO9A 5FA5A 4D9CA 2IE0A 2YRWA 3IMGA 4JR0A 4IGIA 1VHLA 1D4FA 1FFHA 1NP7A 1MIOA 2EEZA 3SFVA 1CXZA 3ZCTA 3UYLA 4V1CA 2HLDA 3ZX5A 1ZMBA 1W52X 4O08A 1PR1A 3H18A 3THWB 4TWRA 4CMBA 5JJKA 1Z13A 3Q3VA 5CW2A 4EECA 1OZHA 2G67A 3ED5A 4YXFA 2PFKA 4FW8A 1GPNA 4DDUA 4F2PA 2C5FA 2VHTA 5IXJA 2C4MA 3KWMA 4CV3A 1PD1A 3FYUB 1RIFA 2Q5HA 3BD7A 3FNQA 4I9UA 5DCYA 4D6PA 4XEUA 1KRXA 3WA6A 1CUIA 2ODBA 2VQ6A 2YBEA 5KX5B 4IDNA 4ZT5A 4JS0A 3R8CA 2IS6A 4WOCA 3BMCB 1Q3TA 4MJ3A 1TYAE 1Z73A 1XPOA 1DC5A 4RTKA 1EK5A 2YJZA 1WDTA 3NHMA 2DZDA 2HHLA 4PXSA 1FDVA 1KL7A 1Z0IA 3A0RB 3ZNNA 1NBME 1UMBA 2C61A 2FK7A 3A37A 3GGOA 3OPYA 3THSA 1V4BA 4IX1A 2XVZA 1UWCA 2AWOA 4H7JA 3H65A 4Q3EA 3EAFA 4LDJA 4RELA 4D3DA 3EPHA 1E63A 1CZOA 3Q10A 3MJRA 4WGFA 1R5BA 1SB8A 2IXFA 2YC2C 2A84A 3A9UA 3D0RA 2ERYA 3E2PA 2GQ0A 1RJ9A 2W6CX 3KT0A 4PN7A 5J5VA 1EBFA 4Y1RA 1KYZA 1Y3DE 2FHPA 2QM3A 1L4LA 2Z5VA 2PGNA 1J22A 2P4EA 4RPHA 4ZCQA 1WBDA 2J48A 1NVDA 3L4EA 1CS4C 1U0BB 4IYJA 5DCUA 3DBLA 1T24A 1L4EA 2B5VA 2BKUA 2JGDA 3AV0B 3EXEB 4HEJA 2HK7A 1OFHA 1L5HB 2F17A 2P9HA 2QYTA 3VGPA 1T4GA 5I4IA 4AWXA 1N2IA 2ZYHA 3I9V1 5EMLA 4BNLA 4EW6A 5FR1A 4PYLA 4J43A 2HBYA 3KJHA 1H2YA 1DC6A 3IMEA 3RTBA 4ZZ1A 5JW6A 1I2AA 4Y0NA 4TWAA 1XYGA 2A57A 3Q8MA 5LA6F 1MTZA 1JFLA 4BMYA 1JSCA 1J8YF 3ISVA 1WP4A 3F6EX 4RKRA 3HN6A 1ZOIA 1KK0A 1QDLB 2RGCA 1PI3A 2X4DA 2ZUBA 2XGMA 1W73A 4BX0A 3CWCA 4C2AA 5EZYB 5FWYB 4C2TA 4AQ7A 2A7QA 5KQRA 2C7QA 2BE7A 1IJFA 5CA1F 2NVBA 3A1SA 2PYDA 1LGYA 2X8AA 1X1QA 4TLCA 1AMNA 2N42A 3GG2A 2LP4Y 4GXRA 4ARAA 1PFYA 2NMVA 2NZUG 4L16A 5LP6A 5F9FA 3ADDA 2QP3A 1JHXA 1NATA 4RKEA 3MLEA 3IMCA 1NJFA 2XWSA 1U0JA 1AO0A 1T0HB 1AUQA 1MEEA 4ID3A 5A5DA 3IQZA 1OB5A 1BCRB 4V39A 4I1IA 4TVSA 4X8HA 2B69A 3EW7A 5HK9A 5FAXA 2FMXA 5BMVB 3O38A 1NPYA 4Q9DA 1HE4A 4GMXA 3GLGB 1U7UA 3Q7SA 2DUWA 3HGMA 4QPDA 4QOGA 3LFHA 4ZAWA 2EKDA 1IPFA 3CE9A 1X92A 1YZNA 3D1JA 8ABPA 3U7FB 3KL2A 3T3GA 2BGJA 4FYYA 5JFTA 1M2HA 3GFOA 3P9CA 4P2BA 3JD2A 4K9OA 3FD8A 1GUYA 4Y7CA 4XYBA 2IVFA 3HDQA 3PRKE 1MOPA 4JUCA 4C3ZA 1HMYA 3AHDA 4LDAA 5BWNA 3LQQA 4L8LA 1B7GO 3H9EO 3OJXA 1FLAA 1ZVMA 2FW7A 2KPOA 2CZQA 4XLTA 4REQA 1IK4A 1A5AB 2ZUUA 1JIXA 4KE8A 1R4MA 2DTXA 1IVYA 1H5NA 1R6VA 1Y1QA 1VGRA 1Y42X 2JATA 3IS3A 1WULS 4IILA 2XB8A 2PIAA 3A70A 3LPCA 4MV5A 4UBNA 3OZ7A 3AVTA 1RWWA 4PLWA 3TFOA 1T3ZA 1XROA 2IBMA 4CKEB 4PRZA 4GMDA 2QVBA 2WJVA 4BLSA 4MS3A 1CP2A 4NU5A 1WAMA 2VAMA 2NU8B 2QRVA 4X24A 4WVLA 5DBEX 5JVDF 5LA6B 3KIPA 1FYWA 1J99A 3X1JA 4GOJA 4BO1A 5KTSA 3UAXA 3UXEA 1NQWA 3EC7A 3SXUB 3TNYA 2IYZA 2QPLA 2YNMC 4RTSA 4DTCA 1AK1A 1PW5A 1TYDE 4HZUA 3ZK8A 4A73A 1JA1A 3ER8A 2VSYA 1RJ9B 2CNWD 4BRWA 4C7JA 2B2CA 1NU8A 2WTBA 2D8MA 4JVOA 6REQA 2NIPA 3G89A 3MVEA 4W1SA 5JROA 1QBGA 5CFMA 1F20A 3LDAA 3W3ZB 4GRAA 4RV4A 5CDFA 3I9LA 3WK6A 4AIRA 3EOAI 1VJCA 4HVAA 4CG0A 5E9AA 2A1IA 2G9RA 4PAWA 3CNNA 3H1BA 2HIMA 1NQAO 3FNBA 1F8FA 3Q3CA 5D01A 5KJEA 1TZ2A 3NDBB 4GBJA 3V8EA 4AF7A 1E2MA 1L7DA 5BMOA 2B4TO 4ID9A 1KQ3A 1JTFA 1Q6ZA 2OXRA 2WMDA 2VTEA 3ZS9A 3HSKA 4J0FA 1E9AA 3FWNA 2I6GA 3N39C 4DG5A 3TM4A 1F2TB 1AA9A 2CB9A 4POOA 3DZGA 4JFAA 2CCKA 4RQBA 4HWKA 2QUHA 3M4YA 5JD6A 2JGFA 3E1GA 1LS1A 4LDZA 3IR7A 1V26A 2N1MA 2W4QA 2ZAYA 3SZMA 1HYQA 3C4VA 3V33A 1LQUA 4A6DA 5C5EA 2V45A 1MOSA 2NZYA 2BHSA 1SBTA 2FX2A 3LPLA 2ZR9A 1N7GA 1GUFA 3K9WA 1NMYA 3UV3A 2O5VA 3PQ6A 1GSIA 3F8SA 3EIWA 5CXUA 1U8AA 2R68A 5JNVA 2H2GA 1GQRA 2X86A 1FW6A 1V7QA 2AG1A 3IX7A 2QQFA 1QDUA 3H9JA 4C4AA 5KQLA 2XZDA 2FUNB 3ZVLA 2J32A 3B6KA 2AIRA 2ASEA 5JHGB 3O2NA 3F0TA 1G6Q1 2QQ0A 4U7WA 4YHBA 1UBHS 4MW5A 1HETA 1WKVA 1POXA 4HH4A 2Y1DA 2GZSA 5E8JA 2GAJA 3DLAA 1XXHE 5F35A 4E2FA 5BR4A 1SKYB 2XNKA 3G2QA 3DMGA 3IMKA 1Q7CA 3K5IA 3LGSA 4LC0A 1KEPA 4BGDA 4KWEA 2XCTB 1MGPA 2RBKA 1J21A 1M75A 3A36A 2AQ8A 2GD1O 3EMKA 4I55F 5E6SB 3HK2A 5INTA 4FUTA 2HQSA 4FD2A 4MPRA 5IXYA 1YJCA 3UA4A 4IR7A 3BHJA 3EEYA 1MV8A 3D3EA 3G2JA 1FU4A 1BG6A 1E2GA 1U6KA 3B13B 1GKYA 3KFVA 1QORA 3G9XA 3ONFA 2O1EA 4LC1A 4LQDA 1RTKA 2BPOA 4X8OA 1E18A 4YQYA 4DRZA 4EVQA 1OI3A 3CWQA 2ZUCA 3A6FA 1ZN2A 2P6PA 3N0RA 4UATA 1W9HA 4XIYA 4PNEA 1FYVA 1L3CA 3M2TA 3HKBB 3ZCSA 4IHQA 2R4TA 2FYTA 3NCHA 3KDSE 4MGKR 3SS8A 2XH8A 5K20A 1UDCA 1YQ9A 3OTWA 5J2UB 3ROTA 4OFZA 4U4AA 3VAYA 1MAUA 3L6RA 4PZCA 1W2HA 1J8MF 2HIHA 3BH6A 1QTRA 1LSUA 1CUCA 1EUZA 1N6LA 1DBVO 3BWXA 3GN2A 4FR2A 2Y2UA 3ZV7A 3I72A 3ZW8A 4WINA 1VG9B 3T7RA 5FUMA 1VP9A 3K1TA 2J3QA 1N2CE 3A3PA 2ZI5A 3KO8A 3OIFA 1WXXA 2PVSA 4H59A 1R50A 4MO9A 2CCJA 4P38A 3VR0A 4YCLA 2QU7A 3NR2A 4I1UA 4RHEA 2BJHA 2FZVA 3P0JA 4E2WA 4I2NA 4J3NA 1A9RA 1LX7A 1OWOA 4QEDA 4QBKA 1HDZA 2H4HA 5K0FA 1NOIA 4QEZA 4W7SA 5LLSA 3TZ6A 5ABPA 3PFCA 4BAGA 4YQEA 3VH2A 2PXCA 3O8OB 2JL1A 1O97C 1E61A 1UMDA 1KQNA 3EOZA 1XMOB 1E8DA 5JWHA 3E9YA 2ZIAA 4BQSA 1VA4A 4S1NA 2R86A 3HCOA 1TU4A 4OYYA 4YYEA 3L7LA 3CUEF 4H3VA 1YFJA 4DDMA 3V8BA 1JTVA 4D9FA 1XZNA 1NLUA 3M89A 5ARBA 4OCZA 3P2JA 2OWEA 1XKTA 3GLTA 2VYQA 3JYQA 4YXWA 5CYGA 3KQHA 2JHCA 5MHTA 2ACEA 4EKIA 3OHSX 2PV7A 4XD7D 4JA0A 2O7NA 3UOGA 1PJBA 4R0MA 1SXHA 2BBSA 2OBYA 1ZD1A 2OV3A 3MWJA 5K51A 4ARVA 1XOIA 3O82A 3PYMA 5EAIA 2CK3A 1I6KA 5IC5A 4IIBA 2IOHA 4JEHA 4EHAA 2OVFA 1P0IA 2XWQA 5IFLA 5LD2C 3U7IA 1CQIB 1LA2A 3K0CA 4S24A 3GIDA 4O5OA 3JALB 4EHIA 3DDSA 2V6FA 2R44A 2DMRA 2JIZA 3NIGB 4FP9A 1ZEJA 3ODPA 4GKBA 1NQ5A 2C9MA 3MINB 4O4LF 1VPDA 2XMCA 4I5DA 1Q22A 4ZO6A 4K2AA 5F2EA 5KNDH 3W5DA 4WN3A 1SKMA 1M0WA 2VA9A 1KY5A 1OJ7A 1VA5A 2ENUA 3MCVA 4NMLA 3VYTB 1PQYA 3JQEA 1E3WA 4CM5A 4R71A 3DJFA 4D4JA 1OE0A 5A6SA 3AVXA 4DA8A 4DZZA 1GTJ1 1EM8A 3DAPA 3E48A 1OFTA 3GELA 3VC3A 4ZGBA 3LBHA 3RV4A 4P81A 5C34B 2JD2A 3BIXA 3U3KA 4UVEA 2L19A 2YXBA 3MXTA 4ECEA 3TZHA 4N0QA 4M7RA 1JWLA 4Z3OA 3BIFA 1WQ3A 2EHJA 4RY2A 3ZD7A 1HDIA 2Q6IA 3IPYA 3PJDA 3Q41A 1R5NA 4TN5A 2YZKA 3OY7A 1QSGA 4BX9A 4IV8A 5K3OA 1NWCA 3NBFA 3EIXA 3SIXA 1DC8A 2DPHA 2G9ZA 4XDGA 3F74A 3INRA 3PHGA 4I4NA 1UKYA 1PD0A 4WZAE 4HUJA 1AKMA 1Z0ZA 1NE7A 4AY4A 3W90A 1O87A 1HOXA 1R8QA 1UXHA 1L6RA 1GG8A 2FPGA 4P4SA 4TSKA 5B1SA 3WQHA 1S7GA 4DR6B 2Y93A 5LPNA 4YRJA 2BEJA 3D4PA 4TMXA 3IVRA 3DV9A 1AB5A 2N47A 3GH3A 4C7OB 1TDJA 3EUEA 3LECA 4GWLA 2H85A 4GMGA 3VX4A 3O2SB 2Z5FA 3IXLA 5HYVA 5LMNB 3AWIA 3CR3C 1N5RA 4LXYA 4Y3UA 1P39A 5GMOA 2I1LA 3T35A 1DO2A 4YQFA 2RGYA 3CHYA 1PHPA 4QGGA 1TT7A 2WTXA 4L6IA 2BBTA 2X2OA 3BMQB 3NHLA 2G06A 5HNKA 4DQKA 1T8UA 4BU1A 4MVCA 4XJXA 5K0SA 4BB0A 1KVQA 4MW0A 1DO0A 5DYYA 5IF3A 4BX2A 5CA1A 5JH7F 5IWAB 1LD3A 4EGJA 5HTOA 3FDFA 5I9SA 1ORRA 2GESA 3AIMA 1XF9A 2LR0A 3CBGA 1QH8B 1Z6PA 5C3MA 3H6HA 4Y1GA 4UFNA 2N0SA 4I4LA 4HNTA 5L7WA 5B37A 1XHLA 1VIYA 2X3FA 3W4IA 1KO8A 2ZRJA 1P1KA 4QTUB 5DHAA 4NJOA 1GDDA 4BECA 1BXGB 4UULA 5CVTA 2VDVE 3JVEA 2ORIA 2GLTA 2QJRA 2RIRA 3CEHA 3IURA 3KS9A 1LLDA 1NI3A 1S2OA 2FCRA 5BSKA 1UP6A 4EPRA 2MSDB 4HNAB 1TXGA 1RBQA 1M6HA 3ER6A 3GX1A 1OWPA 4TKVB 4KHPB 2P9ZA 2Z2KA 2XXAB 4R2JA 3G0IA 1P3JA 2FE1A 2OBLA 4HZIA 3MHPA 1KKMA 5MN4A 1BQ4A 2OPBA 4G0PA 3NEAA 4XGQA 3TW0A 3OF5A 1E0SA 3I9JA 4CQMB 3WXMA 4EAAA 3RJTA 3ZLVA 5I7VA 4I66A 1RRPA 1V8OA 4HNRA 1QC5B 4G5XA 1RYMA 2VG8A 3B9PA 5F12A 2C2XA 4LRYA 3WB9A 3D1VA 4S05A 4IDEA 1VGQA 1VE5A 5DSXA 5HZHA 2SNIE 1IXRC 5CXSA 5ESXA 2OR3A 5E6UA 1YOBA 3RJZA 2HO4A 4OHUA 2PRSA 2RHCA 3F4LA 4KSYA 1V5GA 1O5OA 2IE8A 3PZRA 5DWDA 1K3TA 5FUYA 1GGNA 1JZSA 3AF3A 3HR8A 1K63A 4X3PA 1BU8A 5LN1A 3OQVA 2JLQA 1RVV1 4L8WB 2J0UA 5EKXA 3ENNA 4KIGA 4QQFA 5KQPA 5EYPA 1X2EA 1DB3A 3FOCA 5F1PA 3ZIUA 3V34A 1NF3A 4RVOA 2SHKA 2Q7DA 1RC1A 4UXJA 2QVXX 1M8FA 3S1LA 1VCHA 3OTIA 4R1TA 3U3DA 1RPZA 1B0ZA 3A2NA 1C0PA 1YHYA 4HVTA 5FAKA 1SCQA 2OBXA 2AZTA 5K6RA 5LXTB 1S2DA 1N8SA 4XM2A 1BMFD 2R3SA 4WMLA 3H2GA 4PX3A 1V48A 1MN6A 3CEJA 2D5AA 4DEYA 1FL9A 3MBIA 1A98A 3KFXA 4KQEA 2GD6A 3KJIA 2RB5A 4UNIA 5FPYA 1KS2A 2C31A 3B1XA 4N5DA 1A9TA 4C7XA 4AKEA 1RHUA 2M1ZA 5KOJA 4K86A 2NUTB 4MWTA 2C88A 3O9ZA 1B4DA 5AKKA 1EIZA 1YWGO 3H9BA 1SVKA 3OCZA 1Z18A 4XB6B 5KWVA 5L8VA 4H1TA 1P75A 3WRVA 1SFRA 2ISQA 4DIMA 3M5WA 1JDUA 4PGGA 4YRQA 3TDKA 3N9IA 5JDCC 4MVWA 2H1CA 2WYVA 1QE5A 3VVCA 1EAYA 1FDRA 1RBMA 4PPGA 3W6NA 2AJLI 3MYYA 4UFPA 2QW1A 1XCGB 4B6SA 1KEZA 1MRZA 3A6KA 3ZJTA 4M54A 3S2SA 4EUSA 3CCCA 2WU4A 1JVBA 4I36A 3IELA 2R25B 3F97A 2H2AA 2ZI3A 1YQGA 2C83A 2RFLA 4M49A 2X5XA 2P79A 3J81A 1V2GA 4LJ8A 3CJRA 4NQRA 4LYYA 3KUDA 3LHSA 4F06A 4ZO7A 2IYUA 1ZP6A 4OVKA 4Q7KA 1H42A 1IBSA 2J8ZA 2IPXA 3OWXA 1X42A 4FGUA 4E7OA 1T6YA 2F3QA 3N2LA 3OM8A 3W77A 5I7RA 1W0JA 3V2IA 1R9GA 3G68A 4F84A 5JSQA 2VHVA 1Z88A 4LJSA 5AFSA 3G2IA 2DHEA 5EIXA 3UJHA 3ZZ1A 1TVKA 2H17A 2KX7A 1K8XB 3EF0A 3I76A 3NWEA 4YRFA 1QAOA 2HTFA 4G5HA 1CNMA 4TT3A 5JQGF 2Q5LA 4MVJM 4HDMB 4LF4B 4L2IA 4URFA 2G08A 5L95A 1EDBA 3GO4A 3DXYA 4ZVLA 5LDDC 1WMFA 3B7PA 2J5QA 2QUKA 4CF3A 1D6NA 2P6RA 1E2KA 1V4VA 3JQGB 4HDRA 1L3BA 3IV7A 3CVWA 3QKSA 4S1PA 4N8DA 4OI1A 4BL5A 1XNHA 3GEEA 2R6GA 3IAS1 5C7OO 3UJBA 3C87A 4L7VA 1SPXA 4JWKA 2RG1A 1X1EA 3OCVA 1O4WA 5E6RB 4A9AA 5KOHB 2IYSA 2VVTA 5DT9A 3G7NA 2G0AA 3IHKA 3QXJA 1NBIA 4GOND 1AU9A 2YN2A 4UXIA 3STVA 4YAEA 1RHQA 5CR9A 3THRA 4B7ZA 2ZRBA 1DAGA 2Q1SA 4WOBA 4ZQGA 1SPBS 5CD9A 4OOFA 2HNBA 1LZKA 3WWYA 2QU8A 4KFRA 4YJ2F 3BTSA 3ROEA 2NX2A 5K01A 1TLTA 5FB3A 3HB1A 4EKNB 4ENRA 1R4NB 5LXTA 3DE0X 4YHHB 1F7UA 4GR9A 1TT5A 1OMOA 3DFUA 3V7WA 2QRKA 1C14A 1R0BA 1YKSA 2XYGA 3E8MA 1WR8A 1X6VA 1F8UA 2WSLA 4HLCA 5AKLA 4ED9A 1QK4A 3E7PA 1AUVA 1XLUA 1M1YE 4KLNA 1HZJA 3LRTA 5FBWB 2I62A 1WCYA 3DOJA 4FHFA 4EF6A 3UBMA 1MO5A 5FO0A 4KV7A 3RC9A 1Y5MA 4EUKA 1YZTA 1BDBA 1VJ1A 4QBTA 4ILKA 1BE1A 5KNDD 2KYRA 2ZRKA 3R5HA 1JEEA 2G88A 1PJLA 1TMOA 4EUHA 3L1JA 1UZUA 2BKEA 3AY0A 3FHTA 3BFJA 1Q15A 2RD2A 1SMKA 1EGQA 4G23A 3V55A 3ZWQA 2HDOA 3MJEA 2QAGC 1ADJA 2BMWA 5I4CA 2BFPA 1T91A 5E2IA 5BP7A 1XCMA 1IUOA 3O8QA 1RYNA 3ZX4A 2JLAA 3QA3E 2PG3A 4U2GA 2O2JA 1V5EA 2GKSA 4BQQA 3CSDA 5IWCA 3HXOA 4B32A 1OIWA 4IZ6A 2ZIEA 2CV1A 1RIIA 1T35A 1T3SA 3IGFA 4RJLA 4QOHA 3VJRA 2V59A 4KK4A 3RFTA 1YQUA 5A62A 4YCAA 5BN3B 1SUCA 3OHPA 4BC0A 4BWFB 5IJXA 3QUCA 2C5AA 4CN8A 3UHAA 3GEPA 5FOWA 2CZCA 3BVPA 3H5LA 2UUPA 1GZ5A 3OAAD 1P4SA 4N03A 3PP8A 1G5PA 1T6NA 2G1KA 1N6NA 3WISA 5EJ5A 4M89A 3X2SA 1OASA 2ZUVA 3QLVC 2IGBA 2Y1XA 2NZVG 5JJIA 3DTYA 2R62A 2WJ3A 3FCOA 3I01A 4REMA 1NW3A 1MIHA 1U1IA 4KWTA 5FUWA 1QGYA 3USZA 4FB4A 5I8PA 1BKDR 2B35A 3A1DA 5D85A 5CB4B 3AFIA 2FX5A 1P91A 4UDYX 2I78A 3ADPA 3WTCA 3ZE0B 1M7GA 4D3FA 1THTA 2ZYAA 3Q2OA 1OI7A 1XDUA 4AMUA 4F6RA 2WJZB 1CEYA 1DE0A 2I03A 1SUAA 1FF9A 1IM2A 3AO0B 1UODA 4P84A 1UDWA 3F7TA 4A8JC 4QYWA 1D7OA 4ZWNA 3UWMA 2QXTA 1M0SA 3K0BA 2W6ZA 5FA6A 1XNJA 3AFHA 3G8AA 2ODQA 2GN8A 1U7WA 4ERXA 1Z6ZA 3DV0B 4K9QA 1T25A 2CFTA 1E79D 3WXBA 1G3UA 3HZHA 3LBAA 1WW2A 4EYOA 2FZEA 3PWSA 4QUDA 4GECA 1A4XA 3NZEA 4NIMA 4E15A 2GTIA 2YQ5A 1LB1B 2ZRHA 1FTWA 4ND8B 4UDOA 3SSNA 1XZHA 3ZXUB 1OW3B 4C6TA 4MV4A 3F1KA 1H9AA 4QPCA 1HDOA 5GV7A 2OXEA 3TUIC 4OI2A 2QRJA 2ZITA 2HFJA 2I65A 2II6A 4L4XA 1TL7C 3THYA 1P0CA 1UPAA 3BA1A 3ESAA 4C08A 1EK0A 1YS9A 3O90A 3QOYA 3C6YA 3L05A 3HJAA 3LT5A 2IKSA 1OA1A 4HO1X 5CURA 5DYTA 4AJ9A 4ER7A 2AG5A 2ET6A 2OV6A 2PYIA 1S1CA 3GHYA 4IUDS 2FMUA 2AH5A 2VH2A 1MNQA 3BGDA 3OAAA 1I01A 2GCNA 5E9JA 3RRNA 5AUPB 3HE3A 1FFYA 4DIBA 2J7KA 2RK3A 4JBIA 1U1EA 4M9SA 1MIOB 2Q41A 2NTVA 4I4CA 1GNTA 1HYGA 2C95A 2OFXA 3OETA 5LBTA 3U1BA 4FS8A 1B43A 1D4OA 2V6BA 1TCUA 3N3AC 4KG7A 1I9GA 2CLKB 4HDKA 4NZNA 4OI4A 4R5HA 1NRXA 4IMJB 2A0FA 2P2YA 3O21A 2PX0A 4L5AA 4QATA 3HGQA 4XM0A 4Y2PA 4ARBA 3ZZUA 1OSNA 5M2QA 1Q0RA 2ZROA 3LQYA 2VKTA 3WWOA 1YL6A 1QIHA 3L7CA 2UUBB 4IDQA 2DULA 4TLEA 2MSWA 1YHNA 1VPWA 4YGXB 3DDCA 5LOVB 1PYGA 5CDUA 3RIMA 2I8AA 2YH2A 4DBLC 4YLGA 1QMGA 3OJFA 4H7HA 3FSJX 3CF0A 3FPKA 4MIYA 3QE3A 5B3KA 1HNWB 1AZWA 3R3WA 4IDPA 4KUHA 3BK7A 2JI8A 2Q3JA 4XJSA 4LGVA 4RACA 1R0LA 2ZR0A 5JDIA 5DXJA 3V2HA 5DM70 1W75A 2ZS9A 3ESZA 2Y8EA 2W70A 1E60A 1YBVA 4HBZA 1U4OA 1PZHA 1XAJA 2P65A 1RW4A 1GA6A 2YN0A 2EJBA 3MGAA 4QJBA 1UQUA 3FNHA 3C8MA 2QTMA 5GADl 4LV8B 3IEKA 3ZHBA 3FCEA 5A06A 2W71A 1U1CA 3O84A 5AWFC 1YBMA 5REQA 4FLFA 2DBQA 3P9PA 4RADA 5ALKA 3B1YA 1KI2A 2FRDA 2R00A 2VWHA 2ECPA 3AF5A 4MW1A 4UU0A 5JXWA 4PLVA 1Z62A 2P67A 4E14A 1WX1A 3BB1A 2C7PA 2D1SA 5EQJB 4HHEA 1GT91 3VJLA 4AS3A 4C0XA 1JU4A 1YXMA 1YIOA 2AG8A 4J0QA 4Q1FA 4DLLA 4N3BA 7YASA 5J5AA 4IUYA 4YDSA 4LOKA 3IDFA 4ETIA 3DKIA 3TOZA 3G9TA 4PPNA 1WNTA 2C04A 1Z5GA 4CLHA 3PFKA 4B7CA 3FVRA 1HNXB 2YUTA 1GJRA 2MSEB 3I62A 4F3TA 3FB4A 3WHLA 1KU0A 4PHTA 4JBYA 2OT3B 5DJ5A 4FDVA 3RADC 5LQSA 1J2JA 1EG2A 2NPOA 3MT7A 4RPCA 5KWIA 2Y0PA 4RH3A 1DX4A 4XH9B 1BFDA 4G0VA 4UTZA 2CXQA 1J5EB 1THZA 4FYWA 2F2TA 2V7XA 2VS1A 3ACCA 2CKDA 4RKFA 1L5KA 3W7VA 1YS2X 1XLTA 2EXXA 2QZSA 4QOJA 3TK1A 4RNCA 1AX9A 4Q02A 2A3RA 4KR7A 1KI4A 3HJNA 5FLEX 4JEIA 5SZIA 5M04A 4DJDC 4NJEB 4IXDA 1KI8A 1IY1A 4RL6A 5GJBA 3B3QA 3QWHA 4Q1DA 3WLTA 2ZBVA 2I1QA 2BFOA 3KALA 1CRPA 5TGDA 2F1IA 1QIIA 5CM2Z 2EFGA 4PCUA 4RDHA 1TZKA 1MC1A 4KIWA 2ZIUB 3I5YA 3IJ5A 5IJAA 1QYDA 2FKAA 4IKPA 5A05A 4F96A 4XLLA 3UF0A 3G0GA 1ZW6A 1NJ8A 3LUDA 4GM0A 4KYUA 1QYWA 5A7FA 5AW6A 1UBNA 2IX3A 2AOTB 1K68A 3GJSA 4MWSA 4PGAA 3FUTA 4C5CA 4BEBA 4EUEA 5JQGB 4EDHA 4X65B 3AJDA 4AJNA 5C5CA 5LKRA 2PR2A 4DLVA 5TSDA 2XB2A 1I1NA 4B8WA 3E5MA 3GC6A 1U8EA 2ZT8A 3VH3A 2NTNA 4FJ1A 4IF4A 1CJMA 4UZFA 4ZQEA 2NUPB 1TZMA 1YIAA 2GEUA 3K0HA 4C0HA 3MT8A 1A9ZA 2PO5A 2EWWA 2PV0A 5F4BA 2X9LA 1HUQA 4EOGA 2KMLA 3ONVA 2C8VA 2VQ3A 5HCUA 4MKIA 2GPTA 4PFJA 4XR9A 4QTTB 3ZDXB 5LNK1 5EQTA 1SKAA 5KREA 1Z17A 2B8EA 1ZM2A 3VSEA 4B6QA 1TQHA 1VBNA 3A27A 5AI4A 1RZ3A 1WUIS 4OGKA 2YXDA 1D07A 1Y6ZA 3KCQA 1GAQA 1H0SA 1USUA 2Q0SA 3D3WA 3PUVA 1G5TA 3CKLA 4XTCS 3M7IA 2YYAA 5HFJA 5WRFA 3TZEA 3VDXA 4WXMA 1XZ8A 2NLOA 5DOVA 2IDKA 3STXA 5BRJA 1J2YA 2WF7A 1JV2B 1FFBA 3M6UA 3AVOA 2OCLA 1W59A 4V2UA 3QVSA 5DW3A 1JDNA 4YECA 1TAGA 4GG1A 4PFKA 3B48A 2BCGY 3B3FA 4AF8A 3UXHA 3KB1A 2W4MA 1Z4IA 1ZJZA 1E2PA 5T64A 2HWXA 1EGVB 3EN0A 2X9GA 3GNSA 3PHIA 1TM5E 3QGMA 1UWVA 4YCSA 2VXCA 4JOSA 5COQA 3WGJA 4BMPB 3PKZA 5FORA 1YDWA 2RGNA 2ZJ0A 1K6XA 3L6EA 4P5DA 2GRUA 3I01M 1P44A 4JGGA 4LC9A 1VJGA 3IBSA 2V03A 2VBGA 4H0CA 1JMYA 4CL2A 1U2EA 3I92A 2CE7A 3MJCA 3PSAA 4FYPA 1UFOA 1GYPA 4RMHA 3RIYA 4G1UC 1FC0A 3IA2A 1NSYA 3FFAA 4G1BA 4ILEA 1G8HA 3EISA 3WL7A 1KPGA 3VOSA 4ALNA 4CQJA 4KMRA 3JRWA 3KM0A 2I7TA 1AXGA 2VZ9A 4RM2A 5HRUA 4RD3A 2FSIA 5MN6A 3REOA 4J76A 3BAZA 5J59A 3RJ5A 1JT2A 2O4UX 5K0JA 3QQ5A 4MCHA 2BFCB 5TB5A 1V5IA 1EDOA 2CK3D 2GETA 1M2KA 3AU8A 4OKIA 3SSOA 1PG0A 3USCS 1RXIA 3V8MA 1PFKA 3KSAC 1YR2A 4K9DA 4OTZA 4W82A 3NC0C 2A9FA 3BKWA 1VJDA 1CUZA 1NKVA 3EIFA 4PGHA 2ZIGA 1M8KA 2PMCA 2NZXA 4IDGA 1ZA1A 5MDHA 2CVPA 1G66A 1Z39A 3NDRA 1EXDA 1Z0SA 1LFAA 3TGWA 1EJ0A 1Y5NA 1AGNA 3DE2X 3LFTA 1UPBA 2CLHB 4GXQA 1NUPA 2AOTA 3H0EA 2PJZA 2OHOA 3ZBUA 1TFUA 2I29A 4R40A 5ALSA 1C7QA 5CG1A 1DDIA 1LBQA 3DEYX 3PCXA 1ORTA 1Z4MA 2VNIA 3LQRA 4TLBA 4TT8A 5CLGA 4EMUA 1UMCB 4Q9AA 2OXIA 2X2EA 3KG2A 2I76A 2O2GA 3AFGA 3Q2IA 4OU5A 5JIBA 4EELA 1VGVA 5HW0A 1RI3A 4JQYA 1Q19A 2O7QA 2X7XA 1Y6RA 5IAEA 4S35A 4UDNA 3DZBA 2Q4OA 5BWMA 5HIKA 2ATEA 3MLAA 1JF8A 4XAQA 5DISB 2WQ6A 2OCIA 2OTCA 2AOUA 2PBZA 2PUJA 3SG0A 4NRDA 5IKXA 4JYZA 1OLOA 2DPXA 1MR3F 4U2CA 4RXMA 3UWOA 4K9MA 1NN0A 1P6XA 2Q4TA 3QYPA 4HQ0A 1MT3A 3L0OA 3IESA 3QMWA 4DPLA 4F56A 3CZCA 4R16A 1N2JA 3R9IA 4F4IA 1QLJA 2PTGA 5KU1A 2O59A 4FHGA 3W1EA 4OATA 3PFIA 3PG5A 5CB0A 1OILA 4JLBA 2I71A 1CF9A 1U5BA 4CKZA 1K5PA 3BUSA 2C5SA 2A7XA 2M6RA 2EHDA 2FFBA 5I5GA 1CDZA 1JVNA 1XT6A 2EKZA 4G0XA 5A6VA 2E37A 3H8WA 3SDZA 5IYZF 4FMDB 3NBKA 1VHTA 2FPWA 3TR0A 1W4CA 5B1EA 1P5RA 3DG9A 5EFZA 4NDNE 1USKA 3RYCA 2HIAA 2JK1A 2XA2A 3B85A 3U80A 4J1SA 4OX9Y 4IRXA 4LWOA 1BJRE 2X0JA 2X77A 2L2QA 1Q92A 3ROXA 1DQPA 1IDOA 1VG8A 2I6XA 5F51A 1DMRA 2J59A 1A1SA 1JHRA 1XVUA 4NFHA 4ENPA 6CHYA 2AXNA 2OFFA 3TLZA 5KJFA 4DC9A 1A76A 2IXBA 1N3BA 3UTDA 2ZWVA 1L4UA 3OH8A 3WJ2A 3WLJA 3ZLBA 4DIDA 4DZTA 3KBBA 4KN5A 1HSZA 1UPCA 2DBVO 1QHFA 5AIBA 3CS3A 1U4NA 2EQAA 1P72A 5AKHA 4BVHA 3DV2A 1QR6A 3CUUA 2IHVA 4QU0A 4YALA 5HRCA 1H85A 5FI5A 4EEKA 3GLIA 1IMOA 2HZ7A 2KI5A 6PFKA 3JQBA 5LQDA 4J49A 3UENA 2KB0A 4BNJA 1WM1A 2PBRA 2C2MA 4R0NA 4UEQA 4EWLA 4Y2UA 2Q49A 3T1VA 4X66B 3WMGA 1LRJA 4TS4A 1YF3A 1L7BA 3GPLA 2FPRA 2GGSA 4PY2A 3BFXA 1TZCA 1JHUA 5JBIA 5EC8A 4CCSA 4I5FA 3G9QA 3L84A 4RWEA 1EUCB 3MINA 2GZRA 3KVRA 1KBQA 1DADA 2WIFA 3MPOA 3NM4A 1Y4DE 2DP4E 4DN6A 3ZWNA 5ECDA 3H5VA 1AS2A 3LP5A 2LE0A 3ZVKA 1T9GR 2XW6A 1ZIYA 4CLRA 2VPXA 4TUYF 2J6IA 3AVUA 1TK3A 2CYCA 4KYTA 1XAHA 2FXVA 3KHKA 3NTOA 1QG2A 4S2EA 4WVFA 5SY4A 4AXXA 3I34X 3O2QB 1PLKA 2P9YA 2PX2A 3DT8A 3GBPA 3RD5A 3UJDA 5H4GA 4MYUA 2XF2A 5BQ3A 4UTVA 1AHPA 3N0VA 5EWLA 1U2GC 1HFWA 5HWSA 3GLFB 1FSPA 4L4UA 1QGDA 3E4DA 5AKGA 1MAAA 4AY2A 3IDQA 1HE1C 1K7SN 4CKBB 3NHSA 1NM5A 1OYYA 2B0JA 2A3NA 1E7QA 2O05A 3R3UA 5DGIA 2I4RA 2QTAA 3T7TA 1E4EA 1WXHA 4RIHA 3ZI7A 4YO7A 2DG2A 3O3CA 4RZUA 3VUEA 3T1HB 2WNIA 1W4AA 4GF5A 1YFKA 4HKTA 1WUJS 1ZZGA 4ALMA 5IBCA 1F7VA 2FW6A 3LKZA 2Y0CA 3EDOA 3RS8A 2QD4A 2YS7A 1M1ZA 2H2WA 4R3NA 1Z6GA 3ON5A 4YIKA 2PA3A 3T3IA 1U8ZA 3UNXA 3WZMA 3DOIA 3OI7A 1SIWA 2BGTA 3ZY5A 1K6IA 4GOMD 3D1LA 2RAPA 3H84A 1MXFA 3I42A 1XRMA 3T7EA 1ZGHA 4NEGA 4RTRA 3ICWA 1OHHA 3WLFA 3T3OA 1CZHA 2GZAA 1YQDA 3QYFA 2M6SA 3RARA 2O0KA 3EXG2 4B3FX 5IFKA 2L0XA 2RAUA 2HJWA 2PLNA 3IQIX 4CF4A 9MHTA 1YZ3A 5D3QA 4FDUA 1P80A 4XYGA 4CM9A 1IBMB 4LF7B 1AGRA 1ZJYA 1A0OA 4F3RA 4MTLA 4XCQA 4M9UA 1K0UA 4RTJA 1CNFA 4JNCA 1NW7A 2HQOA 4LZAA 2H0AA 2P4HX 3CLTD 4X6LA 5F1YA 2DB3A 4IMIB 3T6KA 1ZJ5A 5CNKA 4QXQA 1P0PA 4UC0A 1XAGA 3AJ9A 1QIGA 5LMCA 4O63O 5JO0A 4ONEA 5AM1A 521PA 1PZEA 2XCUA 5EKDA 5SZHB 1U9ZA 3F2IA 1GG5A 1IN8A 3G6WA 5HKBA 3VYSB 2ZJ3A 3PVSA 4TL7A 1EJBA 3I9NA 4FNOA 3V2GA 2ZP1A 3E9ZA 4OJKA 4PTYA 3M3DA 3DVRX 1DT5A 2XQJA 1VZ2A 4JC4A 4MUFA 4RYLA 2QGZA 4DMCA 3RIHA 4W9NC 1RBZA 5B55A 5L6MB 1MJNA 4Y1EA 1PSZA 2O8BA 3LVFO 3BF7A 4Y6OA 4OQZA 1BEEA 1X7GA 4H15A 2APJA 4TKVA 1LFDB 3LDFA 1R6TA 1L5ZA 1P2DA 4ARIA 4XWWA 5IC4A 4RPGA 4IVNA 4YMLA 3N8IA 4RU1A 4MXDA 3K70C 1J24A 2F4NA 3M1IA 3EUAA 3IHWA 4Q01A 1QTNA 4Y2YA 3ZZNA 1DQRA 3IIIA 2QLMA 3O5AA 4B1FA 4CMEA 2HYIC 4B4OA 3RREA 2XEXA 1KJJA 4AYWA 2XOKD 5FQOA 4Z3KA 3LUPA 3JYOA 1ZESA 2BEKA 4BKUA 3PD1A 4IFTA 2YDXA 1E7YA 1X70A 4X7MA 2LCFA 1UK8A 1ODJA 3ORHA 4CLRB 4K5QA 1GUZA 4O4LA 3FTNA 3H13A 1CUSA 4PZPA 2EU8A 4MQBA 3UJNA 2ZBFA 2IYAA 2WICA 1V7CA 1TLFA 2EQBA 1RPNA 2CUKA 4H3SA 5BORA 5GZ6A 1GNRA 1T2FA 3QU5A 4D4HA 2ZXUA 3G0BA 2F8SA 2FZLA 4QQNA 1NN5A 2WIGA 1RQXA 4M38A 4R7GA 4HV4A 1I6LA 1I7NA 2C3YA 1CJCA 4CQLA 4LHVA 1ZRSA 1FS5A 4JIMA 1TAUA 2AE1A 2OILA 1JIUA 3RM3A 3GRUA 2G83A 3H83A 1PR3A 4B9AA 3BM5A 3CNEA 4FINA 4B3RB 1ULTA 1J1IA 3DAGA 2EJCA 5EHIA 3TUZC 3FTEA 4PW0A 4QASA 2WV9A 3GUUA 3R7DA 1JAZA 3ZY6A 4KQFA 5FOUA 2AC4A 5EQDA 2VDQB 3RRMA 3VPAA 3L8MA 2O14A 3L6UA 4CTKA 4P4LA 3MWKA 4KXNA 2P8JA 1VLMA 3EPPA 2BEWA 3S44A 4O2AB 4JP1A 4AMVA 4H0NA 2HY7A 2LUOA 3PPXA 3HRHA 1EGMB 1Y33E 1KXJA 2IZ0A 4LRXA 3TRDA 3Q3IA 3JATB 2Q50A 1T5OA 3VU3A 2FW1A 4BO9A 2XWJI 1A9QA 4KTVE 3VAZA 3SQXA 4ZQHA 1YZYA 2GCPA 3FPAA 4LX0A 1W87A 4N01A 4EJ2A 1GQYA 1G21B 1LQ2A 1VTKA 5K1ZA 3IPAA 3HXQA 4LDNA 1DP4A 4G81A 5HXAA 2HSWA 2ZIWB 3IIJA 4UPVA 5KIAA 1ESDA 5HVNA 3DKPA 1CK4A 1QZUA 2Y66A 4UEWA 3ZJ4A 2BBWA 4B3TB 1M2EA 1LWOA 1BE6A 2HMUA 2WT8A 3JQBC 2PQ0A 4GYYA 4IFEA 4C7MA 1WCWA 1UC4B 5AM2A 2OZVA 5TPZA 4FCCA 4UJ5A 2P78A 2DR3A 5KB3A 4EO9A 5EE9A 1MUUA 3FMOB 3QPUA 3D54D 5LQRA 4GX0A 2JCSA 1WOMA 4BMOB 5I5EA 5KYWA 3HBNA 1OKKA 1I30A 3JAWA 4P83A 1PFQA 4M9RA 2HO5A 3R76A 4PCVA 1O95A 1JPUA 3OSUA 3Q2KA 1KH1A 3ZGXA 2PCJA 1PT6A 2O5RA 5BN4A 3ET5A 3ESQA 2PSJA 3OEEA 3LCRA 1TD1A 2ZZNA 2WYWA 4RDIA 2YHUA 2JEZA 3U1TA 4WY8A 2HN9A 3SHTA 4A36A 1FRVA 1K89A 3ND6A 5ENDA 1PVVA 1Q74A 4QRIA 4P4TA 3NEJA 5HUQA 3GFFA 1UWKA 2KLHA 2XUPA 3GRFA 1UDAA 1Z06A 1EVLA 3BK2A 4KW7A 4FDLA 4MRRA 5AHOA 4BAUA 2ZRIA 1H69A 1OFUX 1ZC3A 3BMCA 1T8PA 1TECE 3DF9A 3ZW9A 4G97A 2I80A 5LMZA 1SN7A 1E9VA 2VPIA 3A3KA 3HMKA 2HA6A 2QYHA 1FUYB 1OT3A 2BDTA 2J6BA 3BN3A 2AXPA 1GZSA 1QF7A 4EGAA 1M2FA 1J00A 1LNQA 2QDXA 4DQVA 5U4QA 3KKOA 2GAFA 1YHZA 1I94B 2DHDA 2HU5A 5GOTA 1FS6A 2IEGA 2WOOA 1A7UA 3PNVA 4DTIA 5LQCA 1KOGA 1CUEA 1T2VA 4NS4A 2QN3A 4N9QA 5JYEA 2C7GA 4R5MA 1CB7A 5DNUA 1Y1TA 5LVAA 2VF2A 4URXR 1M74A 4B0PA 4MEAA 1E2HA 3T4PA 2JFFA 1SHKA 3RS9A 4B33A 1GU7A 2XA9A 3LWBA 5I9MA 3SVTA 2O52A 2MHCA 2Z2YA 2Z8YM 4KH1A 3I2HA 4CIVA 1QHXA 4DBZA 2ESRA 1DOHA 2YN4A 4HTAA 2A0XA 2EGHA 5ER6A 1F48A 4GSKA 1NW9B 4DUZB 3DFIA 2IH5A 1T1EA 2VHYA 2W6JD 1ISMA 4IWXA 1IBRA 4KX5A 3WLSA 1EP9A 4PIVA 3BULA 4ZI3A 1EX9A 3C6ZA 4JOCA 1PZNA 4KAXA 3T54A 1C7EA 2P7IA 1KZ7B 4KI7A 5EXXA 4DV3B 4LGCA 4ZT2A 2PGJA 1LS6A 4HEA6 3IC5A 3QE2A 2Q99A 4NAVA 3K16A 4D0RA 3II6X 3MWEB 2YASA 5F7JA 3VDNB 2DERA 3NM6B 3GLKA 5DB4A 1ULSA 4CQLB 1PEAA 5AD1A 2QTBA 3PE4A 4D96A 3ZTWA 4AJ1A 4ZYVA 1EFDN 2VF8A 1HG1A 4I55B 4X8LA 1RJWA 4E0BA 5DX8A 4KE6A 1KQGA 4UMDA 3IP8A 3R3JA 4LRTB 4PZZA 3E27A 4J4BA 3GJ3A 4JBLA 1WO8A 1OBFO 5IM4F 2WSSA 3T95A 1EXWA 3O93A 1EVJA 2VDWB 1P5HA 3KTDA 3OZTA 4KVZA 1CQXA 4B82A 3NP9A 5FFFA 3UJAA 2PUAA 1R1DA 2ZJ2A 4IIJA 1V47A 3G2PA 4JEMA 2XKKA 3ESRA 4WV3A 3KQUA 1Y3AA 4U2BA 3UICA 1B93A 3EE6A 4DDWA 1YE8A 1AKWA 1Y89A 4HEA1 1LJLA 2JI9A 3CA8A 4YAIA 2A5YB 3NAGA 3AERB 4X61A 3UZUA 4AZTA 3AI7A 5HOEA 3QKRA 3B5EA 3PX2A 1D2EA 4L5YA 1CQWA 2LW7A 4PAGA 1G5HA 3UWKA 1E3EA 4F4UA 4YASA 2EFDB 5H9VA 3FGOA 1AB6A 4GZLA 3JQ7A 1G0NA 4B80A 2Q62A 3GLGE 2P68A 2CMHA 4U7HA 3WYDA 2OBBA 2AWNA 4Z2YA 2PE5A 1TEHA 1ZD4A 2RI0A 5EWJB 1NLZA 3RG8A 2VXYA 1YRYE 1PT5A 2R60A 5AYVA 4Q4CA 3UATA 4DB2A 1TUBB 1RQLA 1W6RA 1I1QB 3B1FA 3MQ4A 3I2YX 2B0CA 2NADA 3BMXA 2D0IA 5CLHA 3FKQA 2QQ5A 3GCZA 2CLIB 4J07A 3ABZA 4MQ6A 2W2LA 4M1EA 5ALNA 1JLRA 1RLOA 2VEOA 1Z5NA 1PV1A 1SCUB 1FTNA 1D2AA 2FR8A 1ZMRA 2WAOA 3PUHA 4FK8A 5DNDA 4ZVPA 5HTKA 4I6JA 3TECE 2AKYA 3EFOB 3LRXA 4G0QA 2L82A 3G1TA 3I04A 3L8YA 4C0SA 4CTOA 5FLKA 1HLFA 2C8KA 2XKBA 3CEMA 3E7WA 4BWGA 4TN1A 4Q34A 3RBZA 4ZZIA 5EIAA 2UUAB 4B3MB 2C5HA 1SU8A 3FPSA 3H7IA 4P7JA 3MG9A 2IPOA 2FOIA 4PBSA 4N41A 3UGTA 1QRDA 3HU3A 4XFKA 4I1VA 1FDOA 2J9GA 5CDYA 4LHZA 2FETA 4KOEC 3ZKWA 3QEMA 4G2TA 3ENZA 1JEOA 4X00A 3K9LA 1TU0A 5T57A 3C6QA 5DX1A 4O2BF 2IVZA 4DLPA 3F9RA 1ZW1A 1L4YA 3UJ6A 2V0CA 4DF3A 2I2XB 1VL0A 2WJPA 4LDQA 1GLGA 1DT3A 1V7PC 3HHPA 4LY6A 3T52A 3GGCA 4EZEA 5B1YA 2G5CA 1P1BA 3EVDA 4NNOA 3V8RA 3TO5A 3FWKA 1KYQA 2GCEA 2JJQA 4QICA 3UYKA 4DNOA 1OH8A 2I5PO 1I32A 1VHJA 3OE5A 4RD0A 3VTZA 2FPSA 4J0DA 2WG2A 5BWLA 1XZQA 2WKSA 2ZWAA 3V3TA 3DDNA 4D4MA 1V35A 2JJ2A 4NLLA 4UBOA 2LWIA 4W8GA 1W85B 2AN4A 1K5DA 1D5CA 2BFDB 4JB3A 4IVQA 1VI5A 1UDBA 2PEZA 1JH8A 3NCTA 4I55A 1ZNYA 4BV2A 4A1OA 4FGSA 2NQ8A 2ZE6A 1ZM3A 2ZSFA 4ND7A 5K0BA 1G2OA 3D3KA 3PE3A 4WNAA 3WQRA 1E99A 3DBHA 1RE0A 3QLTA 5DHQA 4QEKA 1Q1BA 4AUKA 2EERA 1PZFA 4GBED 1KI7A 1DAFA 3PNOA 4MGHA 4NOKA 1QYRA 3VO9A 5JNWA 2CMDA 1ZAKA 5DTQA 3S1AB 1O6CA 1P33A 4IIJB 1L4HA 4LRUA 1XDWA 1L5YA 4MV9A 3EZXA 2JAWA 4HGRA 1IATA 1JR3A 1QO0A 3G2KA 1JEQA 1F9EA 1HH4A 1DTWA 2AI2A 4YPFA 2JKVA 4KPYA 1G64A 4DUPA 2ZLBA 3CTPA 4GZ3A 5D51S 2E4AA 2Q27A 1OYVA 1H4SA 5DKFA 5FUBA 3T7IA 3WLMA 4TZ6A 4YI5A 5H3LA 3N2GA 1JIQA 1KA9H 1O8BA 3P2MA 1YK1A 4LJ7A 4MYDA 4BLVA 1O89A 3GQBB 4XVUA 4NDAA 3CTMA 1ZWLA 3LW8A 4KRFA 3KLMX 5IDYA 1DRWA 1NVGA 1U8YA 3PIRA 3Q9UA 5SICE 2B4QA 2P69A 3GEGA 4GP6A 4MYHA 3UQYS 3UGQA 3E5RA 5IMSA 1Z3CA 2GO1A 3QTBA 2ODEA 3W8DA 1SZJG 2R00C 4BYMA 2PWAA 4BO5A 4ZI2A 3D5QA 4WZBB 5ERXA 4ZYLA 3WGHA 1PJ2A 2CC2A 3EEIA 4J9VA 5BN5A 4XQEA 5JD4A 3PPWA 2EIHA 3SMVA 2IXEA 3ETEA 2WKQA 2VUSA 3K2QA 1P4JA 3SXJA 4EL0A 5CCEA 1SBZA 3JARB 5L51A 1K1EA 1G5RA 1SCNE 1RM0A 5LC1A 1MB4A 3ASYA 1WKBA 2ACKA 2JLRA 4XJTA 4TV9B 2DECA 4DLAA 2X1HA 4OGGA 3SHWA 1PJ3A 1Q91A 1OY1A 2P75A 4R6WA 3ZU6A 1B6TA 2FUEA 3BXOA 4ZVNA 1QRSA 4N0PA 1R10A 2VWQA 4GC9A 3VBEA 4BKOA 1NXWA 3RYIA 3NIWA 4B7UA 4L28A 3I8XA 3LCJA 5KTKA 4B3GA 3QTLA 4OGFA 1V11B 2DFLA 4LQ4A 1HOTA 2Z2IA 3G6KA 1C81A 3ZKWB 4BVJA 2B5OA 4LW8A 4FE7A 2WTUA 2CGEA 2OO3A 1AMOA 2E6UX 1RPAA 2AMYA 4M3NA 3TRFA 4L27A 4V0RA 1XD8A 4HNGA 4JLDA 3OG9A 4MJXA 4YUXA 2DQYA 1TAHA 4ZRNA 2W2VA 3EPKA 1WKCA 3ORSA 4CYMA 4ZZ3A 3OQNA 3G8CA 5HF5A 1W36D 1G8KA 4R1LA 2LXNA 1E3MA 1C5KA 4ZJZA 1BGXT 1PQ4A 2I6TA 3T4UA 2VDNB 4RUKA 3UAGA 1P7ZA 4M60A 4TXHA 5JCPA 3ORYA 4BAZA 5JYDA 4D3ZA 1LU9A 2ZWOA 1I7PA 1UOEA 1UKCA 4ND3A 2HAEA 4X20B 4FSHA 2SCUA 1QYCA 1RZRD 3PX7A 3DUWA 3HKDA 1YR9A 2BCEA 2NUPA 3FPJA 2AQIA 2ZYRA 5CUQA 4KBGA 3MOIA 2Z43A 1R00A 4AZVA 3TOCA 3EA4A 1SVOA 3R3HA 1OXVA 2JFYA 2OOSA 2GF0A 2RHLA 3CU5A 4H77A 5JTUA 4RHTA 2RMKA 1BFUA 1FP4A 1YZKA 3ETJA 5DO9A 1E9SA 4TKLA 5JE8A 2IH2A 3DE6X 1YKFA 1OC4A 4KO4S 1E1NA 1EVIA 1ODIA 3CT6A 2Q0QA 4PBRA 5FWDA 2BFMA 2WLSA 1QIDA 3WLLA 1JDBC 1TQDA 1R4AA 3VI3B 4BMXA 4D3YA 1T6XA 4G5GA 2MYTA 4NMHA 1DDGA 4K9KA 3KQPA 1J2RA 4KCGA 1MJGA 2BGRA 2BUAA 1RQ7A 2NAFA 5H7XA 1XJ5A 1JSLA 1X7WB 3BMNA 3LNCA 2FZCA 4MV6A 5CVUA 3WP1B 4BIIA 5A4JA 3QY9A 2PMEA 3B53X 3EGVA 1SUPA 3EZYA 3G2LA 4EYEA 5L4LA 4EX7A 1QCCA 2GAIA 3L9WA 3UXYA 1J07A 1PG2A 3QJYA 4CKXA 4DCCA 5KNBH 3WV5A 1NGSA 4XQGA 4RE6A 4U7TB 3F9CA 3K1AB 1EUDA 2XTAA 1U7XA 4RDXA 1SOVA 2PO7A 1NVUQ 1R6DA 1UJ4A 4HYYA 1T0JB 3BHMA 4LVOA 2WKWA 5DGHA 4D4LA 4TT3D 4F85A 3GUCA 5E1BA 2YZ2A 1PK7A 3QW2A 4NU0A 4CUJA 4D8VA 4WBNA 2WJWA 5CTAA 4D98A 2KW5A 2RGEA 2WEKA 4OUKX 4D3SA 3DL2A 3CLSC 3KKLA 4A0GA 3F4KA 4LSGA 4LYHA 2HADA 3IKMB 3S0JA 4BB9A 4TV9A 4YP0A 1MFPA 1RR6A 3EWAA 4RABA 2EGGA 2XD9A 2RH4A 5FOSA 1CRZA 2COKA 2A9JA 4OLFA 2BSXA 3AVQA 4C03A 1II0A 1LKZA 1TB4A 3GLUA 4Q1EA 4RJ2A 4JQCA 3V00A 3CW8X 3DB2A 4CJXA 1HE5A 1C3OA 2XBMA 1DIHA 4FIZA 3LYHA 5IZ4A 3HZZA 1FQJA 2EDCA 2ZRPA 2O7SA 1R0CA 3V4FA 3WJ7A 2OGWA 1J0DA 2Q7OE 2QNRA 2WIJA 1XMSA 1Y5RA 3RTCA 2AOXA 1GRCA 4HNUA 2GF2A 2I4NA 3L8ZA 1GIAA 1L4GA 1XELA 3CZ5A 3TCNA 1ODTC 2ZBQA 1LW6E 1S6YA 1CY4A 2HDWA 1EI9A 1KK2A 2RHOA 4II2A 5IULC 4M1SA 2BZ0A 2IDZA 3VR5H 5G02A 3O1IC 3AJAA 4D0GA 1P77A 1ZH8A 1X0XA 2DPMA 2CWWA 3OFKA 1CQJB 1Q1ZA 5JZBA 2AKEA 1AA6A 4RSGA 3L6DA 2O1SA 2W0MA 2YOGA 3CMCO 1J1ZA 4ND2A 2AI1A 4U0KA 1D2RA 2IY7A 3NHWA 1TTHA 2ODTX 3LKDA 3UWPA 1UT5A 1QRUA 2XNDA 4B46A 1SGWA 4NBSA 4L78A 5JCOC 3HI6A 5DTJA 2FSUA 1J70A 2D5CA 3P9ZA 3S4YA 3A2MA 2A4MA 3AEYA 4IWNA 3ZCRA 2GSDA 5JMTA 3VHRA 5JNTA 1KGSA 3D7NA 3JQ6A 1ACJA 3K5HA 1T34A 4MYRA 3CBQA 3NBMA 5EPOA 4Z9FA 2QG9A 3FUXA 4UQPA 5E6UB 3FHLA 3FRIA 3TRKA 1BFKA 3B89A 3EQ8A 2C4HA 4KQXA 4P92A 1XQ1A 3HP1A 3U40A 1LLCA 5JCJD 2CLOB 4MP8A 1SKYE 2LV8A 5E1MA 1FDTA 2QN7A 2QPAA 3IDOA 1FY2A 2QN9A 2NUAB 4A5SA 1U1FA 4LWQA 1UAAA 5JMPA 2V3WA 1UBFA 2RBGA 4D41A 1BCSA 4AZ0B 5SYMA 2F90A 2X8JB 1R16A 3CB4A 3FSEA 4JB2A 5A3QA 5JR3A 3NHJA 2NO4A 4GQBA 4TLLB 1Q14A 2VHWA 1T4CB 4LYGA 2XLCA 3DLCA 2IV2X 3RGGA 3K9GA 3HB0A 3OZEA 3ROFA 1LF5A 3W5BA 2GPJA 4MUNA 1NR1A 4XVCA 2AN9A 1T0UA 2ID4A 2ODNA 1N4AA 2B3DA 2FW9A 1DUSA 1GR1A 1GEGA 3E2MA 1ZLYA 3IKLA 2VUTA 3VPHA 3ZWOA 5F7OA 3AHEA 3ND8A 3TQRA 4CM4B 1GTG1 3PI6A 4HZGA 3HLKA 5LLTA 1P9NA 5E38A 1OFVA 4FR0A 4HGOA 3PYLA 3ANSA 2JLXA 5JALA 3RUAA 3EUFA 3DZDA 3NKLA 3HEBA 3IE0A 1GDHA 3R7LA 5EIFA 3DE4X 4M76B 2TMDA 1B8NA 3U48A 3WNZA 3BIOA 4DA6A 4OH1A 3ZOZA 3H1TA 4EPXA 4TL8A 5IF9A 1S1MA 3M82A 3I5XA 1ZG3A 1B8VA 2G5GX 2BJWA 1AS0A 3P0HA 3WB0A 4WAUA 1PK9A 1BWRA 1UT8A 1DQYA 4MS1A 2E89A 3V80A 2Q45A 3MIIA 2IHBA 3EGIA 1V1RA 4KODA 4U2DA 3TNLA 2FX3A 3AMVA 2JS7A 1SBHA 4Y6SA 4P9NA 4DE5A 3Q3HA 2Q21A 2BRUA 4Q3BA 2DT5A 2PUTA 4TWBA 3ZTTA 2CJWA 1JW9B 1LC3A 1SZCA 5TARA 4CZ2A 4DCGA 3MS4A 2MCFA 2H7CA 5TXGA 5JDCA 3WLPA 1FUEA 3IEUA 1H05A 2X0RA 5CJJA 4JC8A 1F1JA 2R8OA 1QGAA 2EZTA 3WNDA 4L4SA 4WK2B 2IPNA 1FFEA 3I58A 3O4HA 1J5XA 1U99A 1YUNA 1IZ8A 2CBGA 2VNKA 3QFTA 4M6WA 2I3AA 3VISA 4QODA 3KZMA 4Z7OB 1DAOA 2OZEA 3MAAC 2IA5A 3U56A 1XVAA 4GXTA 3UAOA 3DYBA 2ECOA 4GOXA 4XQ9A 4XVHA 3LKVA 5TQ2A 1OTXA 2ZZMA 3WC4A 4IIJF 4LY9A 4QC2A 4RVCA 2PMDA 5EJAA 1KOFA 1GRQA 3KQLA 1T5TA 4UU1A 4PCLA 4X1IB 1TKAA 4DMUB 4EB6A 2A30A 2MSKA 3DOEA 1IN5A 1NC1A 3GL9A 3H16A 1QGOA 4GX1A 4PHHA