4LYDA

Crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
276
structure length
268
Chain Sequence
b'MFEQFESKFIDCDGIRTHYIEMGEGDPLVLVHGGGAGADGRSNFADNFPIFARHMRVIAYDMVGFGQTDAPDPAGFAYTQAARTDHLISFIKALGLSKICLIGNAMGGTTACGAALKAPELIDRLVLMGAAVNISPDDMVANRYDGSEEGMRKIIAALTHSYQPTDDIVHYRHEASLRPTTTAAYKATMGWAKQNGLYYSPEQLASLTMPVLVLGGKNDVMVPVRKVIDQILAIPQAIGHVFPNCGHWVMIEYPEEFCTQTLHFFGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MCP Hydrolase
publication title The Lid Domain of the MCP Hydrolase DxnB2 Contributes to the Reactivity toward Recalcitrant PCB Metabolites.
pubmed doi rcsb
source organism Sphingomonas wittichii
molecule tags Hydrolase
total genus 89
structure length 268
sequence length 276
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lydA00
4DMHA 4YPVA 5AKYA 3DYVA 4J3JA 4Q05A 5JATA 5T4BA 2X76A 4FMPA 2XUDA 2XMDA 1XROA 1GXSA 3FLBA 1UOOA 4IH1A 3HABA 4FBLA 4HXFB 4QWMA 2XUKA 5AM4A 4AQDA 2XMRA 3PE6A 1Y7HA 3PF9A 5C81A 3STYA 1BCSA 1LPNA 5ALUA 1ZJ4A 2YASA 1XFDA 3WL8A 2XMQA 2VTVA 5DNVA 3S2ZA 1L7AA 1BEZA 3F8SA 3WL5A 4O08A 2OG1A 1MAAA 5FDFA 1WHTA 1ZGCA 1Q83A 1MPXA 4HRYA 3DKRA 3AIOA 5LLSA 1XLWA 1LZKA 4WJLA 3ZWQA 4AMZA 3KD2A 5AKIA 1TCCA 1UXOA 4UHCA 1K63A 4X92A 3DYIA 1LPOA 3U0VA 1UKAA 1G42A 4K6HA 3C45A 1E66A 2NW6A 5ALNA 2VA9A 3V1LA 4LYEA 5A62A 3KSRA 2WTNA 1JU3A 2B9VA 1R4ZA 1AZWA 5AIBA 1WOMA 1LPAB 1VXOA 5CH3A 1WPRA 4AO7A 4PSDA 1DX4A 3WYNA 3VXKA 2HADA 4E11A 5E2IA 2V97A 3A6ZA 4B85A 1UOQA 3LIIA 5C8ZA 3WWCA 1ZD2P 5ISMA 4L3WA 1MAHA 5EIAA 2D5LA 1VZ2A 2WHPB 3R41A 4I4CA 4X95A 4C4XA 3O4GA 3AZOA 5AM1A 1BU8A 2VSQA 4PNZA 5T4EA 3EBLA 4J0DA 1LPPA 5JD6A 4FLFA 1UK9A 3ZPXA 2WJ3A 1UK8A 4Q1VA 1B41A 2WHPA 4N8EA 4JUIA 1R1DA 2XUGA 1S8OA 3BXPA 4P9NA 3DOIA 2VAXA 1DX6A 5I9IA 5FP0A 5DJ5A 3R3YA 4WCVA 1CUCA 4J7AA 3KDAA 4EHBA 2HA6A 1WCYA 3GELA 5EHNA 5DTIA 4G4IA 4Y2RA 1QIJA 4WDQA 5JAUA 3D2BA 3WL6A 4X90A 3ED1A 2WIJA 1X2BA 4FOLA 4X6UA 2ROQA 5BWCA 4CCYB 3S8YA 2ONCA 5J3JA 1CUYA 3I2KA 1DWQA 3FVTA 4BP8A 3R3UA 4IQ4A 3FSGD 3WK6A 1OXMA 5IVIA 4U2GA 4HTAA 2C0QA 4LKOA 5AO9A 4PSCA 4AN1A 3DQZA 3IUQA 1FSSA 4G1FA 2RI6A 5LKRA 1KU6A 2CJPA 2VT7A 2WUGA 3R3WA 3U1TA 1JMKC 4UFNA 5ALPA 2RAUA 3R3VA 4MEAA 1Z68A 1ISPA 1GGVA 3W9BA 1I6WA 5EHZA 3I2FA 4DNFA 1QFSA 3FCYA 2XT0A 2QJRA 1ZGBA 3EQ7A 1U8EA 4BVKA 3QZUA 3C70A 3VISA 1JT2A 2WKWA 3VJMA 2XUAA 5A7GA 1CUWA 5I7UA 4ZRDA 3V48A 4B82A 5BV7A 2PSDA 2WUDA 3CCBA 4DMKA 1D07A 1FFBA 4QNNA 5DWDA 4X7BA 4G9GA 4X85A 2VT6A 4OB8A 1GT6A 1P0PA 4RGYA 4W1QA 1GPNA 3DLTA 2C7BA 3BE8A 4V2IA 3R3ZA 5ALSA 4FNGA 4E46A 2JGFA 3DNMA 3G02A 4C01A 4EB0A 4K5QA 4QDTA 1J1IA 1ORVA 1T4MA 1MNAA 1E8DA 1QZ3A 3H1BA 1QIIA 4B83A 1O6FA 4H7IA 4E15A 5CT5A 4BCDA 1Y7IA 4UBLA 3IDAA 1EVQA 3WIBA 3WKDA 5DYYA 1K8QA 3LCRA 4AB1A 5JD5A 2Z8XA 3R40A 4H7HA 3AZQA 1YR2A 1QGED 4H7EA 3C43A 2ZYIA 4K2AA 1C7IA 3FVRA 4H7KA 5AI8A 1ZOIA 3H2IA 4BC1A 5A7FA 1J2EA 3STUA 5A2GA 4Y2JA 4P93A 3G0BA 2XMBA 3OM8A 1W4LA 2W22A 2DHEA 4BE9A 2K2QB 2WLSA 2Q0XA 2XMCA 3CN9A 4FNMA 4BTVA 2HU8A 1QIGA 5IH7A 5AP9A 3F98A 4MYSA 2ZYHA 5D3KA 4C88A 4H7DA 4AZ0A 4JEIA 1JFRA 5ALRA 4FLMA 3LP5A 1AX9A 4DNQA 1ZJ5A 3DL7A 1QE3A 2WFMA 2VJDA 2H1IA 1XQWA 3A2LA 3RARA 4BDSA 3ESBA 2QZPA 3EQ9A 2VATA 2CZQA 3I2IA 2HFKA 1TIBA 4X91A 2ZYSA 4RE6A 1MNQA 1LLFA 4W1RA 4X97A 2CB9A 3AINA 4F0JA 1EHYA 2YH2A 2HRRA 1A8QA 3PUHA 3WK4A 4Y2XA 2B4KA 4J0KA 4H7FA 3QYJA 1CIJA 3C8HA 3FOBA 3WMRA 3IULA 5HK9A 3QPDA 1XLVA 5D7BA 1H2YA 3D2AA 5AOCA 4NZZA 4KAJA 5KBYA 2JGMA 3F9CA 1K4YA 1FJ2A 5CH5A 2ZJ7A 4BZWA 2XQIA 5ALDA 1GZ7A 3H19A 2OGTA 2JEYA 4HRXA 4MEBA 2LIPA 2RIPA 3E0XA 1SC9A 3G7NA 4QE3A 3IBTA 1LPSA 2ZJFA 7YASA 3I6MA 3AUKA 4BP9A 2Y1KA 4XVCA 1MX1A 1QLWA 3WL7A 1CUAA 2OCIA 2DCMA 1IZ8A 1XKTA 3AILA 1CVLA 2OGSA 2XLCA 4H0CA 3WK8A 3DD5A 5ALHA 4B9AA 1CUHA 2VAVA 2CBGA 2XUIA 4OD0A 1R3DA 1DQYA 1ORWA 1EH5A 2PL5A 5HK8A 3QBJA 4KE9A 4QLAA 3IUJA 1XRPA 4GXNA 5ESRA 1XQVA 3TGLA 5AKKA 1HLGA 2W6CX 4OYLA 4Y2TA 2OAEA 1QOZA 3L1IA 5E4YA 3W06A 1N5MA 4NMWA 5JYCA 2EEPA 1XZMA 1UK6A 2R11A 2DQYA 1ACJA 2WHRA 4JYMA 4BBZA 2BGNA 2QXTA 1OCEA 2GYVA 2OGZA 3DKKA 3FLAA 5LZ4A 3BF8A 3HC7A 1CUDA 3PUIA 2H7XA 4LXGA 3NOXA 4INZA 3WA6A 4WFKA 4Q82A 3PI6A 4EY8A 4UHFA 5JARA 2VJAA 2O7RA 2VJCA 5JAOA 4JNCA 2J4CA 3ILSA 1XZCA 1GPKA 2BGRA 3HXKA 1XZLA 1VE7A 2XMGA 4XWGA 3N0TA 3O95A 5HQ3B 2H7CA 1OILA 2Z8ZA 3M3DA 3TEJA 3ZLVA 4HS9A 4Y2UA 3RKSA 2ACKA 5EIHA 4K6KA 1A88A 3L1JA 5AK6A 5AKLA 4BAUA 4BYMA 1DT5A 4I3FA 3GFFA 3ZV7A 4MWTA 1IUNA 4BZZA 2FX5A 1X2EA 3WJ1A 3AZPA 5CH8A 1XLUA 5AKGA 1A7UA 4C87A 1EDBA 1IVYA 4KYVA 4B0OA 2XDWA 1A8UA 4AMYA 4QDZA 2V98A 2XUQA 1DT3A 4LYDA 2O2GA 4F5ZA 3GBSA 5ALFA 5EGNA 2V96A 4G9EA 4PV7A 2WM2A 3OPMA 2HDWA 3STVA 5JAHA 4PO3X 4ZWNA 1CUIA 2O7VA 1DU4A 2QXUA 1VA4A 2PUHA 4ARAA 3K2IA 3FSGA 4ZV7A 5T4FA 4Q34A 4EY6A 4UBJA 5JASA 3FYUC 2ACEA 2HHAA 2OCGA 3B5EA 5K3EA 3PICA 4H18A 2WU3A 5ALQA 4LXIA 1QIFA 1SOMA 1EA5A 4YASA 4A23A 1PJAA 3WK9A 5K3BA 5JAPA 3WWPA 4KR0A 5AM3A 2ZYRA 2PBLA 3KWFA 4KJXA 4UFOA 2HA7A 3V1KA 3H2GA 3ZI7A 3ANTA 1THGA 4BVJA 2XMZA 3MGAA 5HCUA 1ZIYA 2HRQA 2Z3ZA 5CW2A 5K3DA 3WI7A 1MX5A 3SX4A 2Z3WA 4XJVA 1UFOA 3SC2A 2QUAA 3O4JA 3JYHA 4U2BA 1UWCA 5ALXA 3WWEA 4UBIA 4PW0A 4MWSA 1EDDA 1TAHA 5DNUA 4L0CA 3R0VA 3EIOA 1CUVA 2DR0A 4HAIA 1PFQA 2GYWA 1BN6A 1J07A 3F96A 3E4DA 2GBIA 4BATA 4CFSA 1Q0RA 4IO0A 3KWJA 5T4HA 1QO9A 2I3ZA 3QVMA 1EK1A 2WSLA 1XZIA 4BC0A 2PUJA 4CIBA 2ZSHA 3I28A 4C4ZA 2HFJA 2GBCA 4B0PA 2XQJA 3GA7A 3H18A 2QR5A 3VKFA 4GBGA 1QIMA 4OCZA 1C4XA 3RLIA 1YS1X 4BDTA 4B81A 2CUTA 4WFJA 5A7HA 2Z5GA 1KEZA 3D59A 4YK7A 1N8SA 3GROA 1WPXA 3QM1A 2AJLI 1UK7A 4C4YA 5HFAA 4W1SA 3WK7A 4CCYA 4BAZA 3DDUA 5YASA 5CMLA 3O4HA 3I2GA 2BCEA 3GZJA 5CXUA 2C5FA 1AC5A 1SCIA 3I2HA 1TK3A 3B12A 1BS9A 1ZI8A 2WIKA 4X6YA 4C6HA 3IUNA 4W63A 2C0PA 5DLPA 5HF8A 4DYHA 4Z49A 3E1GA 5BWBA 5AM0A 2B20A 3NGMA 3C6BA 1R9NA 3D4LA 4X71A 3DCNA 3FYUB 1AMNA 1YB6A 1U2EA 2C5GA 2PPLA 4KRXA 4OU5A 3AIKA 5CT4A 5JZ9A 3VDXA 1EB9A 2HL6A 3PF8A 3FCXA 4NVRA 3V1MA 3Q0TA 4CIAA 3F97A 4OU4A 3N2ZB 3FYTA 5AKZA 1EX9A 5IVDA 2J4FA 5LZ8A 2AJBA 4EZIA 1XRRA 5A71A 3OURA 3V1NA 4XIIA 4DSZA 3VVLA 1ZIXA 1XZKA 1HL7A 1BEEA 1FFAA 3D2CA 4F60A 1CUSA 2QS9A 5ALMA 3G9ZA 2QVBA 4H35A 5FOQA 2JGJA 4LXHA 2WHQA 5AI0A 1E8MA 5CBKA 2BAGA 1ETHA 4AX4A 5CXXA 1ODTC 4FFWA 4QDOA 2XB6A 1ODCA 1U65A 1MO2A 4UBMA 4ETWA 3DL4A 2QUBA 3STXA 2XUFA 3OTQA 4ZI5A 1L7QA 4KAAA 5FV4A 5JADA 3O0DA 3D5EA 3NUZA 4N5HX 5AK4A 4BRSA 3G8YA 2J3DA 1RYYA 4ZGBA 5D3ZA 4M0MA 1W76A 3M83A 2HIHA 1YS2X 2QM0A 4IH4A 2I3DA 3T52A 1USWA 3I6YA 1YAJA 4UBOA 1XZJA 1AKNA 5CURA 2JEZA 1MTZA 3FBWA 1CUGA 2RONA 4TVKA 3BL8A 1JI3A 1UKCA 1XRLA 1QIEA 4EY5A 4U2CA 3K9BA 1G4HA 4Y2VA 4GEGA 4AN0A 4P92A 3QITA 1DWPA 2ORYA 4U2FA 5AI6A 4WDRA 3NWOA 5FPQA 4Y2YA 1ZI6A 3WKBA 1P0MA 2GYUA 3BJMA 1CUUA 4UHEA 2DFPA 4KE7A 1ZICA 3W04A 3WWDA 3BDIA 1WB4A 1H2WA 5FKJA 1X70A 4IHAA 5FLKA 5FUMA 4OUKX 2VEOA 3VVMA 1CFJA 5CT8A 3VJLA 5ALKA 5JANA 1Y37A 2G5TA 2G4LA 4FLEA 5AHXA 3X3HA 1FFEA 3WKCA 2PU7A 1WB6A 1W6RA 1J06A 1YA8A 4G8BA 3Q8WA 4OSEA 1ZI9A 3HEAA 2XQGA 3RM3A 1VA5A 1H2ZA 1XZDA 5CT6A 2QKYA 4QDXA 4GECA 2HU5A 4B84A 1AGYA 2ZVDA 1XZHA 5C8VA 1TKRA 4G8DA 2PSJA 2Y6UA 4PSUA 1BN7A 2WUEA 3FWHA 4BE4A 3H1AA 5FRDA 1KU0A 5FXMA 3LS2A 4BTLA 4DMCA 4KAFA 4Q3LA 3AIMA 1QTRA 2JGEA 1MN6A 4G4JA 1CUJA 4D9JA 3EQ8A 2OCKA 1TCBA 1GKKA 4Q3OA 1FFCA 1XKLA 4GDMA 5LYYA 1Q84A 1EK2A 1O6GA 2H9YA 3PFBA 1YSCA 4FFVA 4PQEA 2HA5A 2JGIA 4UBNA 4AO8A 5AI4A 4RPCA 5ALYA 2H7YA 1Q0ZA 4HVTA 3WZMA 1GQRA 4UHDA 2BUAA 4FBMA 5E4TA 2XE4A 4BCBA 2PX6A 3ZLTA 1AUOA 1WHSA 1HQDA 3HRHA 3HI4A 3G9TA 1EB8A 3QMMA 5AKEA 3WKEA 4W1PA 2JGKA 3R3XA 2Y2UA 3YASA 1ODSA 5DNWA 4A5SA 4Y2QA 1CLEA 5AOBA 3QMVA 3CN7A 1CEXA 1JKMA 3H0CA 2G63A 2YYSA 2XUHA 1WM1A 4EY7A 3L1HA 1SCQA 3BIWA 2CEKA 2QTBA 2GZRA 4L9AA 2V9ZA 4FWBA 3B3QA 5CRIA 1W1IA 3HJUA 1YB7A 1HKHA 1XRQA 3IIIA 4OYYA 1CV2A 1WB5A 5AI5A 5FPPA 5K3CA 4BAGA 1LNSA 1QJ4A 2XMSA 3K6KA 3G0GA 3E3AA 1XZAA 5KWIA 1BRTA 2EDCA 5I8PA 4TGLA 4XX1A 4CG3A 3WYDA 2DHCA 5KWJA 3V9AA 3MUOA 2BUBA 4M0FA 1JJIA 1CUEA 2HM7A 3AFIA 3G9UA 2BJHA 2XUPA 4P08A 3BJRA 4GLBA 3FLEA 4UPDA 4A16A 5ALTA 3OG9A 1EDEA 5DTJA 3ICVA 2WQZA 5LP1A 2VJBA 5ALLA 3FNBA 4F21A 1EINA 3GUUA 1UKBA 1VKHA 2PU5A 4ZV9A 4WY8A 5LZ7A 1H23A 1UT6A 1VE6A 5SYNA 5HQ3A 4U2DA 3H2KA 5ALEA 4CI9A 1BE0A 2I78A 4J0CA 4Y9SA 3M81A 2QRUA 4X94A 2RHWA 2X5XA 2WFLB 2O2IA 1CRLA 3MUNA 1JMYA 4OB6A 4BCCA 2HA3A 2AJCA 1JJFA 3IVMA 5K3AA 2JBWA 5AJHA 4X93A 3BWXA 1BROA 1JJBA 3C6XA 2GZSA 4UFPA 3ANSA 2WG2A 5ALOA 1XZBA 5E4JA 1IZ7A 4MJ3A 2JIDA 4QWWA 5HKBA 5AM2A 2WFLA 4J0HA 4MXDA 4B80A 1N5RA 3CXUA 4AO6A 4HXEB 2IITA 5LZ9A 1H22A 3JWEA 5JIBA 1UOPA 2AJDA 5HF9A 5EHXA 3G9XA 4W9RA 1IUPA 4ZREA 3I2JA 3AJAA 4K6GA 4U2EA 4LIPD 1QIKA 1H2XA 3D3NA 3OOSA 5SYMA 2J3QA 2OXEA 2ZSIA 1VZ3A 4J0IA 2PM8A 2WG1A 2IIVA 1DQZA 2OQVA 1NU6A 2R8BA 4J03A 2PKYX 3C5WP 1IMJA 4LHEA 4FKBA 1QTIA 2E3JA 4CG1A 2HU7A 1YA4A 3C87A 2WJ6A 2JF0A 3I1IA 1R88A 1NX9A 1RP1A 4MYDA 1RWQA 4G4GA 3F67A 1DINA 2VQ6A 3I1YA 3WJ2A 2WG0A 4EUSA 1XQXA 4AZ3A 4PF1A 4UHHA 1EXWA 4ARBA 3PFCA 3W2TA 3A2NA 5EHQA 2AJ8A 3H17A 3QH4A 3O9VA 5C7YA 2IX9A 1G66A 1E89A 3IB3A 3HZOA 4HXGA 1AQLA 2WU4A 4WFIA 1QONA 1DWOA 3W05A 4JH0A 1SFRA 4QEKA 3CCCA 1CUZA 1P0QA 4KRYA 3IA2A 2BFNA 5C8XA 3H2HA 5AI9A 1YCDA 5AK3A 3O9MA 3LLCA 1CUBA 4KACA 5KREA 1XZEA 2FJPA 2HA2A 3LIPA 3DJYA 3UUEA 1ACLA 3STTA 5DYWA 1HDEA 1K5PA 3RK4A 4B7ZA 4EA6A 1TQHA 3C6YA 2WUFA 3A2MA 3MVEA 4DNOA 1FFDA 4DSAA 5ALZA 3EF3A 4IH9A 5LZ2A 4MQMA 2OQIA 3HACA 1F0PA 6YASA 4I19A 3T4UA 2BKLA 2QMQA 3KOOA 5EFZA 2HA4A 1LBTA 3C5VA 3HSSA 5IVKA 4FTWA 3A70A 5HKAA 5AH0A 1E5TA 2ZJ6A 3C6ZA 3I6ZA 1F6WA 2VF2A 4DM7A 5H3HA 2CKMA 1LZLA 4EBBA 3FYUA 4DMFA 3JW8A 3WLAA 2OCLA 4QZVA 1T2NA 5AM5A 5AK5A 5HZGA 1L7RA 4UHBA 4H77A 3HLKA 3W9UA 2WJ4A 2XLBA 5EIEA 2FJ0A 3TJMA 1VOTA 1E8NA 2HA0A 2OLEA 3BF7A 4RNCA 2PSHA 2XQFA 4Y2PA 2PSEA 4FHZA 4OPMA 3G0IA 5LIPA 2Y2VA 2XUOA 5DYTA 2Y6VA 4B9EA 2GBGA 3QMWA 1LGYA 5K3FB 3UMJA 2OAGA 3WIOA 4QDUA 1NU8A 5LZ5A 2QJWA 1F8UA 3ICWA 1QFMA 1XZFA 2AXEA 4H7JA 3OC0A 4N8DA 5JZBA 2DHDA 2C4HA 3VJKA 5IVHA 1R9MA 1HPLA 4UUQA 4DNPA 4J0JA 1HBJA 4BVLA 2FUKA 4WY5A 2EDAA 5D6OA 3WA7A 5AKJA 2PVSA 3QPCA 5K3FA 1JU4A 3FAKA 4Q3KA 4GHWA 5CT9A 5AKHA 1CR6A 5K5EA 3PDCA 4CG2A 2XQKA 3ESDA 4X00A 5LKAA 5A6VA 3IUMA 1F0NA 5JALA 1CPYA 2G5PA 3KXPA 3HYSA 2CMFA 3WK5A 3D0KA 2WFZA 2ES4A 1E3QA 1N1MA 3IURA 1DTEA 1XQYA 4GW3A 5ALGA 2O2HA 1TCAA 1QO7A 1QIDA 4MQLA 1XRNA 5ALJA 3STWA 1GKLA 3QPAA 2YXPX 2XI4A 5AICA 5HFNA 4KE8A 3C8DA 3UUFA 5ALWA 1M33A 1XRMA 2D0DA 1XZGA 2ECFA 3SWWA 1MX9A 1IUOA 2DSNA 4EY4A 4C89A 2B61A 1YAHA 3ZLUA 1R50A 1EI9A 4CCWA 1P0IA 4DIUA 4BB0A 1VJ5A 4J0GA 4S0XA 1C7JA 5ALVA 5JZSA 2X8BA 3DOHA 5AKXA 5IKXA 2I03A 4M0EA 1BCRA 3G0DA 1G5FA 1LPMA 1THTA 5BOVA 4X6XA 4HZGA 1TRHA 3TRDA 2QT9A 1MT3A 3BDVA 4YX9A 3D7RA 2WTMA 3WZLA 4N8SA 5HF6A 4OB7A 2XUJA 5JD4A 4G8CA 3O4IA 1AURA 5F4ZA 1ZD4A 4BRZA 4KE6A 4NS4A 2C58A 3G0CA 1VXRA 1ZD5A 1U4NA 2GBFA 1MJ5A 4L72A 1QIHA 1B6GA 1PV1A 4ROTA 4RE5A 5HF5A 4E14A 1MU0A 2OPHA 1W52X 2PSFA 3BIXA 4QA9A 2BUCA 4QLOA 4GWLA 3SK0A 5CTAA 4DGQA 4X3CA 1ZD3A 2P8SA 4Y2SA 5EI5A 3WWOA 2WILA 2RGUA 4B6GA 1EVEA 5ALIA 1CQZA 1K6EA 4FDMA 3H2JA 1LBSA 2WIDA 3ESAA 3WQHA 1W75A 4AXBA 2WIGA 2UZ0A 1CUXA 4DLNA 1SCKA 4N5IX 3H04A 4Y7DA 1GPLA 2JGLA 1A8SA 1CUFA 4UBKA 4DTCA 1VLQA 2RHTA 3DS8A 3P2MA 5AIAA 1LPBB 1UZAA 3DEAA 5AOAA 1CQWA 3ESCA 4TPKA 2DQZA 1GQSA 4ITVA 4G5XA 4GI1A 3WKAA 3M82A 4ZXFA 4JYPA 1YASA 4KEAA 2QOEA 2WIFA
chains in the Genus database with same CATH superfamily
4DUZB 2CVPA 4KO2S 3FWPA 2JLQA 5L3QA 2IBTA 3Q72A 1L1EA 2B4AA 4UAJA 1TD1A 2PX0A 3WWYA 4RD2A 2J5RA 4GPEA 4D6XA 1A3CA 1FF9A 5HNKA 4YPVA 4E3ZA 3EW9A 4Z7JA 1ZMBA 5KIAA 1JA0A 3DYVA 4JWTA 3PG5A 4NARA 1BCSB 3DE5X 3IUBA 4M9RA 5A06A 1TMYA 1BXGB 3R76A 2GILA 4FJ0A 1P5HA 2VJMB 3TQRA 2BHSA 3A3NA 4JU8A 5CDHA 3KDSE 1NP7A 3UJ6A 1YL5A 1IEQA 1Y7PA 2JRCA 2WIAA 1UBTS 3GJ4A 4M9SA 3AVPA 4OIFA 3L4BC 3AM3A 4GRAA 1SU4A 1EQ2A 2WSMA 2HJ9A 4PQRA 3W3AA 3GMIA 4PYKA 1UOOA 1E1RD 3D6NB 5F76A 4KXVA 5EQTA 1WHTB 5T5QA 2VTEA 2BW0A 2BFEB 3BOSA 1TO1E 3GRUA 3DFZA 3Q87B 4CZ2A 2F1HA 1W46A 3UHPA 3ZDXB 2P6UA 4QWMA 1ISJA 1CRZA 3OAAA 4HGPA 4IEIA 4IW3B 5CK5A 2VO1A 1M1XB 3HFRA 2WJAA 1UBUS 1V43A 3BH7A 3ZV3A 3PF9A 5EE3A 3K0AB 1Z4NA 3D5TA 1PFGA 4GKJB 1W34A 1LPNA 4RD1A 1E9RA 1P2SA 1BU5A 1XK6A 3T35A 3WBBA 3ZTTA 4R8KA 4R05A 5BR1A 4Z6KA 1BX3A 1PVVA 4OLBA 4RKEA 4WVFA 5EHIA 3NHRA 3PNQA 1C81A 2YWGA 3PQ5A 2XMQA 3OLWA 1DUIA 4K1XA 3O7MA 4JZYA 4UMEA 1JHVA 1IU9A 5BMOA 4OEHA 5LYJB 4G0UA 3M9WA 3KG2A 4HH0A 5K1ZA 4E7PA 2C9BA 1BEZA 3AJEA 1IWOA 3C5CA 3LY5A 4XYGA 4FILA 4F3TA 3LBFA 2Y0BA 4C14A 2E2WA 2E4XA 4YJ3B 3WL5A 3VR4D 1B8OA 5FDFA 3AYZB 4G5FA 4QYWA 4E31A 4ZVVA 4BQFA 3IR6A 5DN6D 2R0QC 1L8OA 1EGQA 2Q2WA 3ZQJA 1A98A 1DTWB 1UJNA 3JD3A 2P5SA 1OOEA 2EBWA 2IA5A 3KX2A 1PGQA 3MMXA 1FSFA 1OT3A 3B1JA 4XFJA 5IUKC 3V5NA 4YMSA 5AKIA 4AMZA 1C3LA 2P9QA 3THYB 1L8QA 1PR9A 1P2GA 3FCAA 1F4PA 4ND2A 3TD2A 3F73A 3MGBA 1FSZA 4MVYA 3ENZA 3IEPA 3E8MA 3H11B 4JEHA 5BYJA 4X92A 2X8LA 5JEDA 4NPCA 3DYIA 3RROA 1NUSA 2ALJA 2GTIA 2ZXEA 1IEWA 1S3IA 2UUOA 2D59A 2DP4E 3QVJA 4LC0A 2KMLA 1G42A 2UUBB 2Q50A 2F8LA 3NOOA 4FP9A 2BPOA 3ZS9A 5ALNA 2WYVA 3IL2A 1KERA 5H3LA 1X9GA 2CDAA 4I1RA 4D26A 4GKBA 5A62A 4DLXA 2AG0A 4NCBA 1NKTA 2H1WA 5KJFA 2BGMA 1X14A 4V03A 2FSVC 3DWFA 1SBNE 2B9VA 3AI3A 4KX5A 4A0GA 3QG1A 4ZU6X 3UTCA 3KKEA 4C5AA 3G6WA 4ESVA 4FWTA 1SK9A 1XA0A 3DO6A 3RT9A 1YBAA 2Z2YA 1W36B 2QPLA 4J1TA 3UCXA 4GQAA 4QJ5A 2H5EA 3GHHA 1AMOA 1EM8A 2VYCA 3PWKA 1EE1A 1SIWA 2BI4A 3VYRB 1J1UA 4LRYA 5DTMA 4AO7A 4V39A 4PSDA 1W0KD 4PX9A 5K0CA 3LLUA 3EEOA 3OZDA 3HNPA 2QRMA 1Z22A 1CDDA 2BFBA 1LJUA 1IIRA 1DJOA 2QT0A 2X7XA 1CR1A 4CQMB 5IJ0B 1MXFA 3ZNPA 4W9NA 3CWQA 5ESXA 1UOQA 2GCIA 1G19A 2XD9A 2J0UB 3LIIA 2PS0A 4U02A 1YKGA 2R1ZA 5ICCA 1SVMA 3AF3A 3UCEA 1KI2A 1WXFA 1S01A 1SELA 4D3YA 2D5LA 1ZVQA 1PK8A 2ENWA 3MMNA 3DM5A 5BQ5A 4UUMA 1UOEA 3AHJA 1MGOA 4AJHA 4NEQA 3NO4A 3W3AD 4KXYA 3O4GA 5EZ6B 4KRGA 3AZOA 3KZCA 1U99A 3I09A 3ZEIA 4I5DA 2CLOB 1PFUA 3OCZA 4QLAA 2C2XA 3VDQA 3ZHXA 4B8YA 1S4QA 2NZ2A 3T3DA 2AD5A 3H0KA 3NIFB 4EHNA 3M6LA 2NQTA 4NYMR 4TTPA 4TRNA 1XVUA 1EFRA 3OAAD 2DBRA 1V9LA 3T5PA 1NVVR 2HQSA 1ONPA 3L7OA 5BW8A 4J0DA 3CLTD 2B5VA 2GBLC 3QUCA 4QYIB 4BFSA 1FFXB 1LPPA 4BEWA 1XNJA 2PGLA 4YJ2A 2Z98A 5JD6A 4DV7B 5AYVA 1PGPA 4ADSG 1LRJA 1YQXA 2UYOA 1Z8FA 5A03A 1SVOA 1QFJA 2BM9A 1UJCA 4KR3A 2C3YA 1YNOA 5JR3A 2IUUA 1QU3A 3HN7A 2WJ3A 5E6UB 1J8FA 4AUEA 5J58A 3I45A 3U81A 4FYIA 1P6UA 2WHPA 4WERA 1R1DA 4IMJB 2XUGA 5SY4A 4P4GA 4Q15A 2OCPA 1S8OA 1U9IC 1ZUNA 5J5CA 1WVMA 3PVSA 3BXPA 4P9NA 4R7GA 1RYBA 1NUQA 5LB2A 3UWKA 2VAXA 5I9IA 1P74A 2CL7X 2DKNA 4JWKA 1FVOA 1I7NA 2OORA 4QAQA 2VPTA 2PGNA 3NPMA 5DJ5A 2X0EA 3WLOA 3X43A 2AGVA 3ZCRA 2X40A 3R3YA 2GTHA 2KLHA 3SC3A 4E4TA 1ZIPA 2R84A 3V6LA 4AL4A 2PKQO 3AG5A 4OV6B 4J7AA 1GAQA 4KFTA 1I14A 4ZTBA 2PKRA 4TL6A 1C8LA 1SXJE 4EHBA 4RA6B 1TVCA 2HA6A 2QL7A 1J5PA 5EJGA 2H7VA 3C3DA 5ETJA 3SXJA 3MHTA 2GAOA 4Y6SA 5U9CA 5EHNA 2NO1A 3NEYA 2RFLA 4Y2RA 2WF9A 2X4GA 1QIJA 4WDQA 3H1TA 2HJSA 3G2IA 4LY6A 5CA1A 4L28A 4R7ZA 4DJTA 5HX7A 1CJMA 5JAUA 1KYTA 3DVLA 3JAKA 2I1WA 4X90A 5HW0A 1P6XA 4M1YA 1UZMA 3H13A 3EDQA 4U1RA 2C00A 3AV3A 3GN2A 3WOVA 1WV0A 1RI5A 1PUXA 4R9RA 5D6NA 1A5AB 5BWCA 1BG6A 3KTFA 1V6SA 2AQ8A 2WWYA 2DY1A 1K3FA 1QVVA 2DWOA 2MU1A 1TJYA 2AHOA 2I34A 3TUIC 3X1DA 2ONCA 3PQ2A 4J1QA 4IOMA 5J3JA 4Z8XA 1QAMA 1J42A 3PA6A 3L6DA 4IZOA 4F6CA 2GK3A 2OOKA 4RPLA 1DWQA 4OXRA 3ELWA 3DTVD 2YHAA 1JSZA 1T29A 3BG5A 4JXXA 2BEVA 1ZL0A 4FFDA 2DFVA 2GPNA 4R83A 4FDVA 1HQCA 3L7MA 3IAS6 1ODIA 4N7MA 1E5XA 5KYXA 2OUKA 3LWNA 2C2MA 1DG9A 2FFQA 3M7IA 3GCWA 4IAOA 2C0QA 4E5UA 1U3GA 4EA7A 1SU6A 2FG7C 3FWZA 2AB0A 5AO9A 5LLTA 3VC2A 1NASA 3AHIA 2R6AA 4KWHA 2PZGA 1LXCA 2J85A 4JVLA 4MWCA 4LBWA 2YY7A 3RRJA 4MVXA 4QM7A 2VH5R 1H6BA 1F2UB 4FYKA 3AY0A 5F3DA 3ZY6A 1O89A 5CU7A 1YMQA 4X1IA 3GRFA 1GYRA 2BRUC 3C24A 5DOVA 4B7CA 5FYDA 2WY2D 5B2FA 2HSJA 3AUTA 5J4VA 2QAGC 4TWRA 4YO8A 2P67A 1RPAA 4P0QB 5JV5A 3ZX4A 2EATA 3O31A 3ZWVA 2GM4A 4OL9A 4P33A 3NASA 5BSMA 5CFRA 3UT5A 2HJRA 4QC2A 5ELXA 3FZNA 3R3VA 3D1JA 5IJXA 3NYQA 3M1YA 3GFPA 2PX5A 2AYZA 3UQYS 3R24A 3O8QB 2ZKIA 3RRFA 1ISPA 3I9V1 1I10A 1SPXA 2VEDA 1AF7A 2GM9A 4EP1A 3NDIA 4QXOA 3SEQA 4MGIR 3VPGA 3ZOZA 1QQTA 3BMCA 1C4KA 1OBCA 2NSDA 2YV4A 2YVLA 4KLAA 4F91B 4D2IA 3ZU3A 1X74A 2C2BA 4HZIA 4CV2A 3I2FA 4ZQIA 2FWPA 4IHJA 3OWOA 1E2GA 1GITA 3OQ1A 1U4OA 5EPEA 3F6YA 4DNFA 3OJFA 2VQ3A 1KNXA 3QVGA 3VJRA 1FUUA 3ZXUB 4QFDA 1KYQA 1Y9JA 4LF5B 3FFXA 1ZGBA 3ML1A 3PQDA 1E18A 5DGIA 4N0PA 4ZFNA 4X8MA 2IV7A 5E6RA 5HM8A 2C3UA 4UEQA 4DOMA 2GNPA 5E8RA 3NOQA 1KMIY 1HEIA 4RK6A 1R6VA 3C3KA 1JWAB 3NT5A 2YXDA 5JVDF 4OAOA 3TIFA 1JJ7A 3GLUA 1SCUA 4NENA 4TV8F 5ERYA 1Z2NX 3KT0A 2GXQA 1NFQA 1RHQA 1VFPA 3GFBA 4C0BA 4QKQA 3MTIA 3PE3A 4C76A 4B82A 2IH2A 2PSDA 2WUDA 3UENA 5LWHA 1O9GA 3FA2A 4Y9DA 2IYRA 3C48A 3K9LA 3OQBA 4QNNA 2C5AA 3F1LA 1BO6A 1E64A 2IYUA 3T3EA 3WGGA 4C0QC 4URWR 1LWNA 4PZDA 3NHZA 4PHCA 1PHPA 3VZDA 5HUQA 2QEQA 2F1OA 4L95C 4G9GA 5F23A 1L4LA 3OCCA 3MINB 1FRFS 4WNAB 1V4NA 3QNMA 4MUEA 4X24A 3G1WA 1D4FA 2XF2A 5CX4A 4A73A 1OIWA 1KIFA 4MO9A 3ZWNA 5DYIA 4RZ2A 3MD0A 3QW2A 4V2IA 1ZLYA 2A3RA 3DT9A 3R3ZA 1TM2A 1V48A 2W2KB 4N01A 1YGPA 1H2FA 2QMZA 2IEYA 1C0IA 2B82A 4KQXA 4B8WA 4P3PA 2DPYA 3EVCA 4QDTA 4DDKA 3B7WA 1NI5A 1T3SA 4KQ6A 3ZWYA 2QUZA 4NX2A 4B17A 1IBMB 3AF5A 1L4MA 2XB2A 3PD0A 3FF4A 5L7TA 1YDEA 4IGEA 5D01A 1A5BB 1OLXB 1Z39A 1GNTA 3C1AA 3F74A 1QZ3A 3AB3A 3I58A 4M1QA 5D3MB 4HBZA 1KAOA 3ORHA 5GINE 2CVQA 2ZRDA 3CTPA 4AS3A 5E38A 1S5PA 4ZV4A 1WTAA 3GQVA 4PLPA 5C80A 2PLWA 2XDQB 2V6IA 5FB3A 3V46A 4X61A 5BV1A 7ADHA 2D06A 2F1JA 1YIOA 2BSXA 2ZRQA 3BX1A 1NDQA 1K7XB 3QXHA 2R1TB 4ND8B 4BCDA 1XAIA 4ZQHA 2HZBA 1Y7IA 2P4EA 4PPFA 1T24A 4QQFA 4E03A 4E30A 5B3AA 3WIBA 3WKDA 4HYTA 1K8QA 3QWBA 1KY3A 3PNMA 4AB1A 2PV0A 1XD2A 3HYLA 1UINA 1C9DB 1O08A 3REGA 3WQQA 2FFHA 2XITA 3X2SA 4XDHA 1DBSA 1KYIA 1TYAE 4DLKA 1R8SA 5A3QA 1QGED 1ZK2A 1IN8A 1BXZA 1WXHA 3LHFA 4WLFA 4CKWB 4AQ7A 2FP3A 2L69A 3A7EA 3TDNA 3WNQA 2AFIA 1GRRA 1Z0ZA 3KSZO 4YS6A 3P0EA 5A05A 1FRZA 4H7KA 4QJIA 5JS1A 5AI8A 3IMKA 4IV5A 1JHPA 4OOEA 3PL1A 3H2IA 1JDPA 1N1DA 1TU4A 3M1AA 5F1KA 3D8HA 5JH7A 4DE5A 1WW2A 3F2IA 4EVQA 2AN3A 2QYSA 4Y9TA 4MUIA 1TYEB 2NMVA 1IXRC 5BUCA 4P81A 4YQYA 5L45A 4R1UA 3SF8A 2PX2A 2GCPA 2ZANA 5IAGA 3C14C 5BSGA 1DIHA 3PUXA 5LIRA 1RJ9B 4EQ6B 3UC5A 2RI1A 1U2GC 1G5PA 1UPAA 3PRJA 3D6TB 1WAMA 3LX6A 3V4OA 4C4PA 2Z5FA 1Q44A 4NNJA 5B1DA 1ML3A 3D4NA 2WUWE 3DEKA 2REXB 4LE2A 4BFVA 5IH7A 1LC0A 1BNCA 5LQKA 2NLOA 5AP9A 5TVKA 4RK5A 5D3KA 4LMBA 3OUUA 2IHZA 3DVQX 3PU6A 2DPXA 3G8CA 3VBCA 1WR8A 1N5JA 2FMIA 3NHLA 4R8SA 5DM2A 1IHOA 1NNSA 2BY4A 1E6UA 1ZVMA 2XKBA 1UPTA 1EUZA 3LP5A 3ZTYA 3QPWA 1U7OA 1XCBA 2D0PB 3GVHA 4V1CI 3D8TA 3DDSA 2PZJA 4FNAA 2PZMA 3DL7A 2O7SA 4OJQA 3ZJVA 4UMFA 4A26A 1GGJA 1N3YA 3GRZA 4WECA 5JFTA 3GK3A 2I4LA 4XQ0A 2WI8A 1XQWA 4M86A 4HWKA 3SYLA 1CY7A 2C94A 4K9RA 1Y8CA 3ESBA 1E7MA 3U31A 1QQAA 3AW9A 3I53A 2VATA 3K73O 2AOXA 2CZQA 1CC1S 5B37A 2QNIA 3X1YA 3FD8A 3PXDA 4L27A 2HFKA 2QIOA 5H0IA 1PR5A 1TIBA 3MUFA 2FG6C 5EQFA 3DKVA 1VE3A 3DUWA 2O8DB 1C8BA 2ZYSA 3QUTA 1KDTA 1TAGA 4NBSA 1JAXA 5IRCD 2WTUA 1V5EA 1JG1A 3L8FA 1PG2A 1LLFA 5IFLA 1QF7A 2DBVO 2C61A 1VJTA 3N28A 4XGKA 4X97A 4Q7MB 3AINA 3EVDA 3U44B 3O2NA 4XARA 4CL3A 1ISHA 1V11A 1NVKA 1H5UA 1PX2A 3EIQA 4WZZA 1FXWA 3BHIA 1PZNA 3UK6A 4FOOA 1Y5LA 2QM7A 2FN7A 2HRRA 4M1MA 3DFKA 4Q4LA 1NTOA 3HMKA 4J4BA 1V8FA 2ORWA 3WTBA 2R1VB 4UC0A 3T6KA 1CJVC 4RD3A 3H8VA 3VPCA 4RVDA 1BWPA 3ZZUA 1N2CE 1XN4A 4EJ0A 4PHFA 3ZWWA 1UKYA 2NZYA 3QYJA 4G0MA 4TTTS 5CVTA 1QX4A 4EA8A 3ZK9A 4N3AA 1VM6A 4NEGA 3VR1A 4YRKA 1AB5A 1MHTA 2ET6A 3K1TA 4MLZA 5AQ1A 3C8HA 3FOBA 3Q98A 1EUDA 3WMRA 2CNDA 1ZIDA 1Q7CA 2QTHA 3TBKA 3ETHA 5EQDA 2Q4RA 1JQAA 4PZYA 5HK9A 1B23P 1AKYA 3MK31 2REQA 5TARA 2AS0A 4DMGA 4F3KA 3VU0A 1UFRA 3JAWB 2WJJA 3ZCUA 1PJTA 3I62A 3H0EA 1Y81A 3NDJA 5D5HA 3ABZA 3BWDD 3I72A 3OSUA 1HFKA 4U3JB 3KU1A 4B33A 2EL9A 4DEXA 2GHQA 2CLDX 5TF4A 4RTMA 3F9CA 4BKUA 2PKEA 3FDFA 3GZNA 2VHWA 5IARA 1DEXA 5B4UA 2BC9A 3V97A 3T3PB 4BZWA 2E4ZA 4B9AA 3EFEA 2ARKA 3LD9A 2F8SA 3IV7A 5ALDA 1GZ7A 2C4UA 1BW9B 3JQ7A 3LT4A 4LCJA 4DPKA 4NNPA 2OGTA 2C2KA 2C57A 2RIPA 1YCFA 1EG7A 1L5MA 3GLFE 1RKUA 5KDLA 1KC1A 4RESA 1SUPA 3P0JA 3IAUA 3T99A 3LDAA 4O1HA 1JVNA 4ME6A 4QE3A 7AT1A 2NU6B 3IBTA 5BSRA 4TV9A 1SM4A 3GT4A 4D8YA 1LPSA 1JDNA 5JBQA 3NI2A 1NQ5A 1Y5RA 2WV7A 2RAPA 5K4AA 1G20A 3I6MA 3PNOA 2JIPA 3AUKA 5LMZA 3A27A 5KVSA 2JI6A 1U7XA 2P5UA 4BVFA 4XVCA 3W79A 1R0ZA 3N76A 4GLFA 1M67A 2Z8YA 5KNCA 3KTAB 1WSBA 3FPJA 3L46A 3U39A 2O1EA 5E1MA 3B13B 3O3OB 2OGSA 1Z2PX 3BCUA 4DDTA 1W0CA 3DD5A 4QREA 5ALHA 4XSVA 1A9XB 1QM5A 1J25A 1NP3A 1CUHA 1UBSB 2VJYA 1VSBA 3NIWA 4KQ1A 3NTVA 1AH2A 4YEDA 2XUIA 3LK7A 3KNZA 4GKAA 4QSMA 4WKPA 4CBVA 1DQYA 2A6PA 2VDWA 1RKBA 1RJDA 3D1LA 3M6WA 3VYUB 4URFA 3W8DA 1EH5A 4WZBB 9ABPA 1CD5A 2LV8A 3F6EX 2Z57A 1R3UA 2B7CA 2Z1MA 2ZQ5A 3WDMA 5A3JA 2F1RA 2PL5A 4H3VA 5EYPB 4DA0A 1KP3A 4KE9A 1HUQA 1PYOA 2CL5A 2HMWA 3IUJA 4OQLA 1UMDB 1XFAA 2GCNA 3AP2A 4DCOA 2OESA 2Q4TA 4B3CA 2W70A 3X0DA 3OQJA 4LCEA 5ESRA 1L4HA 2XH8A 3EIWA 4RAQA 1B6RA 4RXTA 2VS1A 1PNOA 3DV0A 4DIEA 1DIBA 3CLHA 1QOZA 1OF1A 5I7RA 3U4QA 1N5MA 5DDIP 5JMOA 3E1SA 4K1LA 1C2TA 4BO0A 1HE5A 5IKOA 5JYCA 3KSAC 3OZIA 3EGOA 1ZJ6A 2ZDGA 1Z34A 1ORIA 1XZMA 1SVLA 4II7A 3H6HA 3QE2A 4CN8A 4MSUA 4GPD1 2X7JA 4A8PA 5IJWA 1ACJA 4KYIB 4RHUA 3K1YA 4NE9A 2JLRA 4P22A 4TMFA 3H9GA 3GPDG 5TXGA 1BHSA 2ZWPA 4V0SA 1NVUQ 3BD7A 4BBZA 2QXTA 1OCEA 1YACA 821PA 1NSTA 4GIBA 3B1KA 4BB9A 4DV3B 1D1QA 2NU7B 2JFZA 3LP8A 1CUDA 5BW5A 3DAHA 3KTOA 1CXZA 1P2FA 3PUIA 5FEMA 5HFJA 3L8DA 3VPAA 3NOXA 1YFKA 4B7XA 1IEXA 1G291 1PP4A 2J3HA 2EKPA 4NKRA 2QGNA 3C1OA 3HO6A 3JWJA 4WFKA 5AVZA 1HDOA 4Z3KA 5J43A 4DRXA 4UDYX 1H5NA 3UXEA 2QE7A 4P6VF 4ZQCB 2VYND 1EXNA 3UW1A 4YUXA 2O7RA 1SXJC 2HDOA 1PAUA 1JPNA 1QVZA 3R23A 2RHJA 1H6AA 2FSUA 3NUQA 4GM4A 1RABA 3L6RA 4RX1A 5F5XA 4MR8B 5HCNA 3C8ZA 2VJCA 2PMFA 3L01A 4KG7A 1JYSA 1NVWQ 3FNQA 3TR0A 1XI2A 1XC7A 1YRBA 3MWEA 3ZJYA 4MO2A 1CR4A 3I05A 5EZ5A 1O97D 1Q0QA 2ZUSA 4BHTA 2H9AA 1B2LA 2OILA 2PH7A 2BGRA 4H1UA 3TBHA 3ROEA 4OH1A 2H07A 4AJLA 5CDGA 3NRCA 3V34A 2XMGA 4EHKA 1ZK1A 3N0TA 3L8CA 2B6HA 2PXCA 1B3RA 2VRBA 3PXUA 4RJ2A 3IBYA 1U28C 4ED9A 4EKYA 5HZKA 2ZZNA 2ZM5A 1KVRA 2OPBA 1ZN2A 3WV5A 4LGVA 3RVDA 5IBPA 1X87A 4S04A 5B1EA 3Q3HA 3DEZA 4HS9A 1KVTA 4HX5A 3ZLVA 4HH1A 3OEHD 1ARZA 4D0NA 3X2FA 5IULC 1VRVA 2R8XA 5K0SA 3RKSA 4EG4A 1FTWA 4CLOB 4MV0A 1A5TA 2QE6A 3PHIA 4K6KA 4UEJA 2XE6A 2TECE 3L1JA 4K6FA 1ORRA 4XR4A 4YAGA 5AKLA 2I6QA 3IEUA 2KM1A 4BAUA 4IVRA 1P18A 1UBNA 2WJHA 3L02A 4LZOA 4QUDA 4BYMA 1DT5A 4EELA 5BVGB 4I3FA 4MK4A 3GFSA 4I55A 3K4HA 4O3FA 3HY3A 3IR5A 3UWOA 3EK2A 1EFAA 3WLJA 2YOHA 4XASA 2ZYAA 4A0HA 3OU7A 2QTZA 3FBTA 2I76A 1PYDA 2Y9MB 1RXSA 3HUEA 1ZMXA 2L82A 1XCOA 4FEEA 4RHCA 4RIGA 4I0WB 4EO7A 3T3OA 1VHLA 5EZYB 2HCRA 1RZ3A 3HI6A 3JQQA 3WJ1A 3AZPA 4MRVA 4N40A 5B6PA 1GTG1 5CH8A 4L9RA 4B35A 2Z6VA 3AUSA 1X15A 2G71A 4OM7A 5B1IA 5T64A 1A7UA 1N9GA 4JKOA 5JLAA 1EJ2A 1XCMA 3IJEB 4XEUA 1GAJA 5GONB 4KXNA 4KYVA 5BW4A 2ZSUA 4CIWA 4AMYA 1U3DA 3NFRA 3KYDA 4EHHA 3VQTA 4LYDA 2O2GA 2WEKA 3FRHA 3RFFA 1WCV1 4UNSA 4YLYA 5JMWA 2AWOA 2J3MA 3CV3A 4H17A 1U94A 2EAUA 2PGDA 3M70A 1FA9A 1SULA 2IXTA 4TS9A 2CBXA 2PMEA 2DBZA 2E5WA 2V7QA 1P1JA 5EKTA 2D4AA 3STVA 2OD2A 3AQIA 3MJFA 1YK0A 3CIOA 1BVYF 4YMWA 3VVCA 4INAA 2XOEA 2PUHA 5HS6A 2Y1GA 5EE9A 2BZSA 3BMNB 1XO1A 5HE9A 1I1OA 3RYTC 4B34A 3WGVA 3DEHA 4E21A 3ZDAA 4LUCA 2J3IA 4X7MA 4TTQA 3TCNA 4EGJA 4DQVA 2ACEA 2Y05A 2IXEA 2OCGA 3TTYA 2VTKA 3QYPA 1O77A 1JXAA 4G0NA 2QN1A 4MGYR 4QOGA 4X20B 1TZMA 1Y8QA 2WU3A 3O2QB 2JVIA 4RLQA 5ALQA 5F78A 5FUQA 1PGOA 5I3CA 5HKKA 3KLPX 1KTIA 4UQLA 4DLSA 4WACA 1MABB 1EA5A 1U2RA 4U7PB 4BMVA 1MW9X 3HCWA 4J6FA 3SM9A 3WK9A 2NUAA 1SUCA 2C2ZA 2Z0MA 5H4GA 1C1DB 3FB4A 1FTQA 2ON6A 4K9LA 2Z43A 5HILA 1UPFA 2VT2A 1VLJA 3R9IA 3V2IA 4CQLB 5AM3A 1OBOA 2VDLB 2ZYRA 1J8QA 2PBLA 3KWFA 4UNRA 4KJXA 4M7RA 3D3EA 5DP1A 5T6BA 4FB5A 3A28A 2HA7A 2CYAA 3RTCA 3E9CA 5IAOA 4HJRA 2IS1A 4N3CA 4YJHB 4EI9A 3V1KA 3ZI7A 4D4KA 3SAJA 3ANTA 1TJ4A 4NBNA 3SEFA 2CNKA 5HCUA 1VSQA 1ZIYA 2IW3A 4ZOCA 1F4VA 3TE6A 3HJRA 4EKEA 1MB0A 3B85A 4BPRA 3ADBA 1WTCA 4BB6A 3LT2A 5A3VA 1S2OA 3WI7A 5G0SA 3OQPA 1MX5A 3GCDA 3A4TA 4TS1A 4O4HB 4WKCA 4K88A 5FPYA 121PA 5HS4A 3DBRA 3RABA 4L85A 5I9LA 2EHDA 1E69A 3HKBA 4GRDA 4CGZA 1R4AA 3RPEA 1DAMA 3SC2A 5IM4A 3E3MA 2A0WA 2XKAA 4ROSA 2V0GA 4U2BA 2GPJA 2WAXA 4JQSA 3SSOA 4BPBA 2XCLA 4RVGA 3DWGA 4EFDA 3TDKA 5ALXA 1LD3A 5FWYA 1GKYA 3GOHA 4DTIA 3TM4A 3VNRA 2P6PA 3L8ZA 4F2PA 3UOWA 2JGRA 5ENVA 1XQ9A 2DLCX 2FCAA 1RRCA 1OFIA 1ZNWA 2HWUA 3UAOA 3NTOA 4JL6A 1LB1B 5IHPA 5IG2A 2VBGA 1QZUA 1KVSA 1SXJB 3GFGA 5TEWA 1CUVA 2UUPA 1N77A 3FHJA 2JIQA 4XA8A 2F59A 4HATA 2FW8A 3AB8A 1D9XA 4L5JA 2PJRA 4JA2A 3IYLW 2HMVA 4Q48A 1HYQA 4EK9A 2HNBA 4YRZA 1KFKB 2RGBA 1Q0RA 1N2EA 4IO0A 1K2WA 2BBSA 2G4CA 1KPIA 1R0YA 1XMVA 4FT2A 3T5DA 2QTAA 3TW8A 1UBEA 1WUJS 2OO5C 3QVMA 2WSBA 2D1TA 3QLUA 4ZEMA 5JSZB 4ER5A 4GM0A 3EZLA 3HK2A 5LFAA 2V7QD 4CMBA 2H1FA 3MW8A 4F4FA 3FVQA 1E4EA 2APJA 1N0HA 2ZSHA 2QX8A 4Z2YA 3UXMA 4DV4B 5FH9A 4RH1A 2VPYA 1I2CA 2JLXA 2VXOA 3PD1A 4FE3A 2BKXA 3Q41A 1P8JA 1WF3A 3FY4A 3R6WA 3VR4H 4A1FA 4ZJZA 3Q6MA 3IDOA 4P83A 5JLJA 1F48A 3ILHA 1QIMA 1C4XA 2SBTA 4QPCA 4C6RA 2XHZA 1YS1X 3KBOA 1DC6A 2PMWB 3W5IA 2WVGA 1DBRA 4LV5B 1IIBA 4CR7A 1SHJA 1T8WA 2ADMA 4NMHA 1U3TA 3N1UA 4OI0A 4R1MA 1VL8A 4HZUA 2DMRA 1Z0FA 1NXVA 4I08A 3T94A 5HKKD 1ODKA 4M55A 3S2UA 2AJLI 1UK7A 2JAXA 4M6WB 4F6RB 1XJQA 1EGHA 5CNIA 3BHMA 4CCYA 1DRJA 1I4DD 2AVNA 1WULS 5C5IA 5LDHA 3M6XA 3PR1A 1N6KA 3RS4A 1R0SA 3NGXA 4JBWA 4GLOA 2B2CA 2C7VA 1TCUA 1KEPA 5K99A 3Q85A 4Y0VA 2OBLA 3LLVA 5CA0B 3VHLB 3GZJA 1NM5A 2HD4A 1N6PA 5PNTA 4EYEA 3PIIA 2GEUA 3MQFA 4GS5A 1SCIA 1VGQA 4BX2A 3I2HA 3HSYA 3GJZA 1F60A 3V9PA 1CZUA 1JEJA 1G98A 1MGPA 1ZHHA 1P29A 1T10A 1ACMA 3EFOA 3MB8A 4HQNA 3V8PA 4EKIA 2RB4A 4QGGA 2FUG1 4QEZA 4IIJA 2PKWA 2EFGA 4QICA 1EXMA 4DAEA 1ECPA 2VT3A 3IQEA 1I51A 2P2NA 4TYMA 2ZR0A 2V7BA 4A8JA 4M99A 5AIBA 2KB0A 4CIYA 3E1GA 5BWBA 3AC0A 5AM0A 4FS8A 2GSDA 2YINC 3AKEA 4G0XA 2JCYA 2Y99A 3AY3A 2XIJA 3TIGA 3E70C 3V7WA 3C3CA 3HUDA 2ST1A 1GADO 2H5IA 1ICEA 4JLUA 2YHBA 1TLFA 1DKUA 1RZRD 2G72A 5KOHB 4CKEA 1WV1A 4MW6A 2XGMA 1YR7A 1U2EA 2C5GA 1B15A 3T54A 4EABA 2C9ZA 1QH8B 1BQ3A 2D1RA 3HBJA 4KRXA 4MVJA 5AW8A 1A7KA 3EC1A 4YALA 4Z0PA 4BEBA 1KAHA 2ZRGA 5JZ9A 1K0UA 3V1MA 1Q0UA 1NRIA 3TRKA 3ZE8A 1W4BA 3HP4A 3MHPA 1V1MA 4OU4A 3H9EO 1KZYC 1I2BA 2H29A 2D5AA 3KCNA 5JXHA 1FP1D 3FYTA 4NDAA 4Q3CA 4QFMA 4WESA 3W3AH 3DDCA 2ZE7A 4EPVA 2JC3A 5AKZA 1FZTA 4OUDA 1EX9A 1HE4A 3NV7A 1QRTA 1XXLA 4XDYA 5IVDA 3KHTA 3VU9A 4X8OA 2O8CB 4EZIA 1C7QA 1F51E 1YZNA 2MDTA 3B89A 3E35A 4O4IF 5I8WA 4M9XA 2G40A 3P2OA 1BTOA 1CJUC 4L3OA 4TMVA 1YCHA 2BKVA 3ND7A 4WNIA 2AMVA 4RM3A 4XIIA 3OO1A 2F3PA 2VI5A 2VRNA 4MDEA 1HL7A 2GS9A 4DJEC 1FFAA 2J6HA 5HXAA 2ZUTA 4F60A 1Y3FE 1FU7A 2V5VA 2FRXA 1D3AA 3DBLB 3HCEA 2GPSA 4UNIA 2J31A 3VR6H 2QVBA 4L4RA 3U3JA 4BJ1A 3C7TA 5GM1A 3CRQA 4JB0A 1I7SB 5C4IA 4YQZA 5DB4A 3TDMA 2C8LA 3E9DA 4D99A 1T5IA 1BH6A 1P3JA 1RC0A 3K9HA 1BMTA 4LXHA 3UMBA 1Z73A 1UPBA 5KSZA 1HT2E 4KLNA 5HGJA 5K20A 3FFBA 3ICCA 3G68A 1ETHA 4U00A 2VDJA 1N2ZA 2HRBA 4Z3DA 1QO0A 3HA3A 3N2GB 2AN4A 2WT8A 4V0NA 4I5EA 3LGAA 1ODTC 1ADYA 2QQ5A 3B78A 3QFRA 4QELA 1NVFA 3MD9A 3N2KB 2XB6A 1PT7A 3GLHA 4N76A 4G56A 1ODCA 4MWEA 2FVXA 3UMFA 2AKAB 4JHLA 3OZWA 1HETA 3HJAA 4TN1A 4E2YA 3DL4A 1C2YA 2BBOA 4QXAA 5TE9A 3STXA 1QBKC 3U7HB 4CUKA 2I2BA 2D4HA 3E7FA 3HZZA 4MROA 4OGGA 4B4OA 1GZVA 2PTHA 1GSHA 5FUVA 4PINA 1FQOA 3L0OA 2AFIE 1A97A 3WLTA 3MAJA 4GL4A 2VYQA 4EEKA 1JAYA 2A58A 1BJRE 4GQBA 1UUFA 1J70A 2BDTA 3O0DA 4M9UA 3W9SA 2OBMA 1QK4A 2Q3MA 5HBRA 2C5LA 4JR1A 2PD4A 2M6SA 3IMEA 1RSZA 2FETA 2HPZA 1G64A 1R0RE 1RYYA 4ZGBA 4M0MA 1SCDA 1W76A 4MIOA 5CYGA 5HVNA 2HIHA 3OFKA 4ND6A 1RKVA 2R6HA 2PL1A 3LPNA 1R4MB 4QU0A 2OV8A 3OOEA 1Z45A 2JA2A 2XJ4A 4PZZA 2NPOA 1D2CA 2JIBA 4XDGA 2OKCA 4Y1RA 2O8CA 3TS1A 2FUNB 2D2XA 2OZVA 2VR1A 2WF6A 3QEMA 4IVPA 4X3PA 6ADHA 3HB4X 3HVUA 2CVFA 1NE2A 3DWIA 5A3SA 1AKNA 5B1YA 5CURA 2O0KA 3DMDA 3H1GA 4NCHA 1X7GA 1XVVA 1CUGA 3OMWA 1ZUD1 1N8NA 2RONA 3R7AA 1TAUA 4BFUA 4FMDF 4FGWA 4RXMA 3CVOA 3TZHA 2OBYA 3CVWA 3NNDA 5K45A 1DZIA 2VA8A 4H31A 1MQ9A 3L6CA 3HGQA 2Q29A 3QTTA 3SSMA 4KFRA 4EY5A 2RGEA 2J67A 2RHDA 3CY6A 4MVJD 5DBHX 3MLAA 1VL5A 2CXRA 2HXSA 4ND3A 4URZR 4HNVA 2NYAA 3BQ9A 5BQXA 2G88A 3DW3X 3IRVA 3V1TC 3QITA 1TZCA 2R5WA 1HURA 2WHYA 5EWJA 3ZE9A 4OQMA 4DCTA 3JVUA 1KZ9A 1VC2A 3L05A 4JDUA 3M34A 1YXMA 2LPMA 1ITZA 5K05A 2ORYA 4TWAA 2PDAA 1HNWB 3QTBA 2NP6A 2COKA 4D41A 3FMIA 2JJMA 4R3NA 3EUAA 1TF2A 3GP5A 3GVPA 2Z30A 2GN0A 2VP6A 3MOSA 5FPQA 4PLFA 2VDUE 1UZNA 4Y2YA 3DE3X 5BQFA 1ZI6A 1KPGA 2GFIA 4L50A 3FJ1A 1H3EA 4V0OA 2PGOA 5AT1A 5AJTA 4HAUA 5IP5A 4ZCSA 3IAAA 5FNVF 3BJMA 3V8RA 1CUUA 3CXRA 4E5MA 1QWSA 2GWRA 2E89A 2X86A 3CMCO 3WLSA 1ABFA 2ZYGA 4E4RA 5C0OE 2UZ3A 3G2NA 3ND9A 3W04A 5GVSA 1JW9B 2V5UA 3IERA 2XXAB 1KKLA 1RIIA 1J0EA 2HK6A 4TTIA 4MLDA 1H2WA 3U3OA 3PGKA 5I9NA 4JJFA 2NADA 5FLKA 5E3IA 4AMVA 1W4ZA 2HK9A 2W8ZA 1PK9A 4HYQA 3WRWA 4QU8A 2VEOA 2Q07A 3VVMA 3SXPA 4C0AC 3QHAA 1I2MA 1CFJA 5CT8A 3OF2A 2YIVX 3GQBB 1RACA 1QANA 1QK5A 2X0IA 4WN9A 1WY7A 1ZM9A 1QO0D 2AX4A 3DMPA 4YA6A 4RO0A 4CDRA 4NV1A 1FZQA 1T2CA 5AHXA 4DRYA 3VTKA 5IXYA 5JANA 1KMHA 4FU0A 2YMMA 1DQPA 3PFNA 2GHIA 3O1LA 2GAAA 1XCPA 4MS1A 5FR2A 3D8UA 4FHDA 2VWQA 1W6RA 2D2VA 4RK0A 4X8HA 3VHQA 2HBQA 1JHZA 4X1KB 1YA8A 1ZONA 3IBCA 3IOYA 3Q8WA 2NUTB 4B48A 4BO6A 1B73A 3LF2A 1D8AA 3FETA 1Z38A 3A4NA 4ENPA 2XQGA 1DAOA 3T1YB 2FQYA 1PJRA 3HZRA 1DCMA 5DWVA 4P4UA 3RNLA 5KHLB 4ZGGA 2NU9A 3C7AA 1FQJA 2QKYA 2XW6A 3GIDA 5CT6A 2ZM6B 2X9LA 5D51S 4HPJB 4QHYA 1AGYA 3FZQA 1XJWA 3F6SA 1RXWA 3F90A 2ZVDA 5B64A 3K09A 3P4YA 2WWXA 1EVYA 4G8DA 2ZVPX 1RAFA 1P5FA 4TLAA 4X60A 1MQAA 5FWXA 1Z5GA 4RA9A 1Q19A 4MMZB 5MGBA 2QX4A 4RKQA 5FA8A 3Q9UA 3W4KA 3CJRA 4N82A 3C3MA 1TUBA 1VHJA 4MOWA 4D02A 3EXG2 1G8GA 5L3ZA 2JLYA 2DH5A 3QNWA 3ROZA 4CF5A 2PMBA 1UXHA 1SBTA 4YGXB 4Z54A 3WSWA 5F98A 2AYXA 1CWUA 1NZJA 3INRA 1QYCA 1ADJA 3LS2A 3D54D 5HRCA 2IOHA 5E3HA 2RAVA 1WG8A 4DG5A 4Q3LA 1QTRA 2HLPA 1UJ4A 4JVOA 1E98A 1MN6A 1WETA 3HXLA 1R0KA 4J1TC 2C29D 3S2SA 2W9XA 4GPIB 1AD2A 1G20E 4MPJA 1TCBA 3FN4A 1GKKA 4Q3OA 1PGNA 1XKLA 3GLFB 4K9OA 5F2NA 4D4GA 1WHSB 3ZY5A 2LE0A 2D5IA 4FMBB 1BE1A 1QYRA 3V4VB 1VPVA 1C1YA 4YAKA 3Q5EA 4NMLA 4TN5A 2V8BA 1EWRA 3JVDA 4EHDA 3FOZA 2HNAA 4E7OA 3RS0A 3PFBA 1GQQA 4GX2A 2YWEA 3U4AA 4FFVA 3MWFA 4DA7A 3EDOA 2BHNA 3DVSX 1WMEA 1D0VA 1SK8A 4RPCA 1HSOA 5FIUA 3ZGNA 3KB8A 1OPXA 2O7QA 4EM6A 1Q0ZA 4COOA 1FSGA 3K0FA 3KEOA 2W5UA 3I04A 4YPFA 3RWOA 4QOEA 4WLEA 5LJIA 3MJRA 4DANA 4YYZA 1BGXT 3DVAB 2G8NA 5BNFA 3T61A 3VSAA 3JX9A 2PX6A 2W2XA 5CP8A 1H6CA 3JU3A 4KR7A 4MA4A 2YVQA 1XL0A 4YP0A 4NDNE 3BHJA 1Z17A 5E1BA 4YAOA 3HB5X 3M8KA 1OFHA 4W8OA 4CLDA 2E37A 4EOGA 1Y3BE 2HSGA 4WT7A 3QOYA 1QGZA 5I4CA 3MQ4A 4QBKA 1E6WA 2JD0A 1KH2A 2I2AA 3ZW7A 4QVKA 4DPMA 3EWIA 4D3ZA 5C1OA 1Y3DE 2MSNA 4LNUA 5AKEA 5JXJA 3C3EA 1PG0A 2ORVA 1I4LD 1UWKA 1Y9ZA 3NV9A 4MQFA 5AK0A 1EFVA 1J21A 3GJ8A 4N0EA 2JGKA 3WIEA 4CTOA 1L5ZA 1ODSA 2FPGB 5C52B 2O2YA 3MJVA 4A5SA 1J24A 2R6DA 1GG9A 2ZTMA 4UEKA 3AXTA 4MYRA 2XVZA 1T1IA 2P1ZA 2RB5A 4FC7A 1GWNA 3SHOA 2ZVJA 1C3OB 4XSGA 1SBCA 3CT6A 4NBLA 4AUNA 1JV2B 1U8XX 2AF4C 4G1MB 5GGYA 4DZRA 1FDWA 4HEA6 3H0CA 1TYBE 2X14A 5IN4A 2MSWA 2X0RA 2EGHA 2YYSA 3G2LA 4MV8A 4EO4A 5IBRA 4GMDA 1W581 3ACBA 3TLEA 1CRQA 1CE8B 4B73A 3JZDA 1RCTE 2WU0A 4PAMA 4N03A 3ET5A 5FA5A 4NLLA 3CF4A 2QTBA 1TMKA 2GZRA 3PFGA 4GE0A 4L51A 4TUYA 3WYCA 3R2JA 2F17A 4F5YA 2PQ6A 4M8IA 2YHUA 5T6MA 3ST7A 2O14A 3RO7A 3DAFA 4BP1A 5EGSA 1X1CA 3B3QA 5CRIA 2VK2A 3L7YA 4D8XA 5K8IA 3HJUA 4NFYA 4KQJA 1I4WA 3OPYI 5H1YA 4PLYA 1F3OA 5EEGA 2V0NA 1N57A 2BL4A 1XRQA 1WZEA 3ZCSA 4YNBA 2I2WA 3P97A 5DLQC 4WOCA 5K3CA 4RVUA 3M6FA 4Z9BA 3FPFA 4DRZA 5KZMB 1G7SA 4HLDA 4KPEC 2JLWA 1G55A 1JF8A 2XMSA 4KTVE 1H6DA 1LDNA 2RCNA 2ZSFA 3H4VA 3IAS1 3GI1A 2XOXA 3HR4A 3H9QA 3ZDRA 1NF9A 3UAYA 1UANA 2R5FA 3C5HA 4YWHA 2GEKA 2Q99A 1XZAA 3EAQA 2AUTA 5F2OA 4HNGA 2JATA 3T7KA 4XD7D 5GOZA 1DPGA 4EJ6A 5I8PA 4EB6A 2BTOA 3DFUA 4MCAA 4XX1A 4ASUD 2DHCA 2B6NA 1NXOA 1R6BX 3RVRA 1JKIA 1NLMA 4ARZA 5A5EA 4ER3A 1YVEI 2YOGA 2XUPA 1ZAYA 4NXMB 3RRZA 5BNIA 2C9YA 3BXHA 3GH3A 4RENA 3ORFA 4DG8A 5AVJA 5G3ZA 4RIEA 5CB4A 3WDLA 3MWLA 1E4VA 2AH5A 2EFEB 2POCA 4MW0A 4U7WA 4UPDA 5T57A 5IUNC 4JBNA 2PZKA 2UXDB 3I5YA 3DA8A 4L7QA 5DBOA 3ZZMA 3FIJA 3NTUA 1ULTA 2NTNA 1EDEA 1X7XA 1MC8A 2RKOA 4MV1A 4NECA 3ICVA 4NU6A 5LP1A 3SQDA 4GX5A 3U2QA 4AJ9A 4F21A 2OGUA 3MAGA 3P7MA 1MO5A 3DFIA 3GUUA 3A10A 3Q9NA 1VKOA 2AOTB 1IL0A 3IHKA 4DZTA 3VYVA 2F6RA 1N6LA 1CTQA 4ZV9A 3RQSA 3PEVA 3E6AA 2ISCA 3GWGA 2C7OA 2OP0A 2NZXA 1H23A 2NAPA 3E22B 2LP4Y 3EEBA 1OMOA 5G4LA 5JG7A 3WRVA 1AOXA 3E23A 3H2KA 1PQWA 1SCAA 3DKIA 1FE8A 3PNBA 2ZBDA 2NO0A 3RIGA 1RHKA 4K8OA 1I2ZA 3LJKA 4MWOA 3ZU4A 5KC8A 3OCVA 1CYDA 1WKCA 4TXNA 4LECA 1DVRA 4F6LA 1J9EA 1JNYA 2Q6OA 2QRUA 2DC1A 2V8OA 3NAGA 4LBYA 2RHWA 4M1TA 5KTMA 1GEEA 4HWTA 2OAQ1 2AXPA 1VP9A 1WLSA 1CRLA 1YQGA 3GT7A 3GYBA 1REQA 3GEPA 1YR6A 3ONEA 2FSFA 3L93A 1SCJA 1EM8B 1LLDA 2DZDA 2F8MA 5AVSA 1B3BA 2GARA 1E62A 5C31A 2VSXA 4ETMA 2AZMA 3TL3A 4XWOA 4LDRA 2QTRA 3NJ4A 2YQ4A 3KEMA 1QRDA 4Y30A 3CUUA 1ZH8A 2ZSAA 1D2AA 3L6OO 2JBWA 4QU5A 3Q3EA 4KSYA 3ZIDA 4ZVQA 3AXSA 2MT9A 5AW3A 3CUWA 3E9YA 1BROA 3N2YA 3AR5A 2VP2A 3C6XA 4NJMA 3VPFA 4UFPA 4OJNA 1E2MA 2VNAA 1KE1A 1G3QA 1T5SA 2Q3BA 1C8KA 2WG2A 2Q3FA 4F4UA 5DH9A 1PQYA 1M8FA 1D2HA 1KHTA 3EYWA 5CGZA 1CB7A 3ZY3A 1Z35A 4OFZA 2YV1A 4JIMA 4Z5XA 1NVBA 1Z5PA 4QWWA 2OXRA 5AM2A 4Q1BA 4XPIB 3THOA 3D1VA 4WFQA 4UCXA 2PWZA 3CXUA 4KW7A 1U7HA 2AQIA 2IBMA 1NP6A 3HO8A 2QN8A 5EXXA 1H22A 3A9RA 5EJ6A 3QEKA 4NL4H 2OCXA 4IMIB 3IP9A 3V4LA 1Z47A 2E4YA 5AJUA 1PZGA 2QQGA 4EO9A 5JIBA 3JQFA 4PSAA 3A6PC 4I2VA 1UOPA 5I7WA 1JQ5A 2X13A 5GM2A 2IY7A 1M6VA 1ZM2A 5FBQB 1XZQA 1X1SA 1ZKDA 3ADOA 4WGGA 4BQNA 1E96A 4A7PA 4W9RA 4KO8A 2HPAA 4YFYA 2W6PA 5KKCA 4HNUA 3C39A 4A82A 3RBVA 2OZEA 3GCZA 4K6GA 4R3UC 1K3TA 1KYVA 2W0SA 3GLGA 2FQ1A 4U2EA 1PE0A 4LIPD 4F45A 1ZUNB 3RS9A 4NQZA 4E07A 5CDUA 1CR2A 1VKRA 2C8VA 3DDZX 1QUFA 1SZDA 3GIWA 1U0FA 5CPBA 1DQSA 2FJUA 1OI2A 2QTFA 4MS4A 3UF0A 2OXEA 1XP5A 3PUWA 3WWZA 1CBUA 1VZ3A 3EXEA 4TRRA 1VMAA 2IIVA 1GPH1 3L5OA 3RK0A 1NU6A 5J4YA 4XGRA 1NMEA 3IESA 4MUAA 3BAZA 3C5WP 2ZBGA 3CURA 4TQ9A 1IMJA 4R40A 4DWVA 3GJSA 3PNPA 4KRFA 1DPFA 1DBVO 3QXSA 5DZSA 4TM7A 4L5CA 2ZJ2A 1AY0A 4E6EA 3W6ZA 4JR0A 4J3NA 3C87A 1QCYA 2XCQA 1PWYE 1R88A 3JAKB 2FY8A 3WADA 2CXPA 2WSSA 1DO8A 3NPAA 2BGWA 3RSCA 3I4CA 1RWQA 3NORA 1QAOA 2IL1A 1DOZA 2ECQA 2EZTA 3CKMA 4IIVA 4MINA 4C7VA 1FX0A 1ICIA 1Z13A 1E2PA 4NWIA 3REQB 1Q77A 1W9MA 1U3CA 1L7PA 4D46A 3SFVA 3VC7A 4I46A 5CDFA 4GI3A 3D4OA 3VZRA 4YWJA 3WAJA 2N1MA 4Q7EA 3BICA 1XUOA 2IUTA 5B7PA 1NXWA 4YV2A 1IC6A 2LVBA 3N0VA 1A7JA 1M76A 2FLWA 1I30A 2OK7A 4M1EA 3T0IA 3AK4A 4V0LA 1R5JA 3VTFA 1LUAA 4US0R 4QUEA 3EX7C 1C1XB 1U1CA 2F43A 4WGFA 1AQNA 2B8WA 1MH9A 2ZSJA 1AT1A 3AERA 1R0LA 2WP8J 4YC7A 2BLNA 2Z58A 3RDPA 5CNMA 5KYXB 2PFGA 3BMOA 4FHGA 1YB4A 1C3VA 2FZKA 4OI1A 1WUIS 2BBWA 3R4CA 3R3SA 3IVGA 4O2AF 4EH1A 1ECFA 3REOA 1X86B 2H6EA 5KNCH 4TZKA 5EMJA 3OD1A 4JT4A 1KF0A 2CL0X 4GFDA 4YGYA 5H5JA 4MAAA 4JH0A 1RWXA 1K4KA 1CY2A 1SFRA 1C5KA 2MIIA 5EXSA 3SD7A 2X2FA 3FKSA 3NRBA 1O6BA 5EUQB 5EJ5A 1JBEA 3ZDBA 3HU2A 2CL6X 3THXA 1GZSA 3SR4A 5CM2Z 2ZI6A 4P80A 3KQKA 2D2IA 1V7ZA 3GFQA 4MQ4A 3ZUPA 3L7NA 1GFZA 2ZUFA 3I8OA 3ZUGA 5AK3A 3VAAA 4D92A 5KTOA 2VTDA 1V4BA 2VWPA 1CS4C 3GMTA 4MEJA 4YACA 3KJQA 1H93A 3Q11A 3LLCA 1HDIA 1L5YA 1LNQA 4IILA 4HDRB 4KACA 2ZTSA 1QYIA 3GCXA 1EK0A 1T5LA 1MC1A 3LIPA 1LF5A 3DQQA 4URYR 1L8XA 5CVJA 1T2UA 2EQAA 4IKEA 4GOMD 1TPZA 1P5ZB 3FIUA 1PS9A 1I80A 1XYYA 2VAPA 3BMCB 2R2AA 5IC6A 1R9JA 3WMXA 1J4AA 2B21A 2JIOA 2AFRA 4NR0A 3G17A 4HWPA 3RKUA 3REFA 4OIMA 2H1VA 1OAKA 2Q8PA 4K3VA 1JXQA 5DGDA 4BWVA 5KU7A 1VKZA 3GNLA 4EA6A 5E6RB 1DCFA 1C9NA 4YMLA 1HZZA 1ZMTA 2H63A 1GCOA 3WRXC 4MVJE 4DIFA 5F7JA 3VU3A 2UUCB 3K05A 2BF7A 4GGPA 3CRRA 3U3XA 1FNDA 1YBVA 1SU8A 1SG6A 3LXXA 3SVTA 2IH5A 1U0GA 1GDTA 4DSAA 3GWZA 4OYRA 1KZ1A 2W6NA 2R00A 4PBTA 3TTTA 1YFZA 1OI4A 2VQSA 2PZFA 4OHFA 4MMYB 3TKYA 2V58A 5B6JA 1FVFA 1PI3A 4NH0A 4CM1A 5JAIA 1F0PA 3GNQA 3ICOA 3VZBA 5C1PA 2IZ6A 2EG9A 1BFKA 1XZ8A 1EGAA 2IYXA 3SZOA 3A1DA 4DSNA 4O33A 3AEQA 1II9A 2WYWA 3EWNA 1Z37A 1QMGA 2WSSD 3C5VA 1JIQA 3CZMA 4O02B 3U7RA 3L2OB 4DT1B 5DHQA 4YIKA 3AEUB 3A70A 3U7FB 5K9ZA 1E5TA 4HFMA 1KXZA 2IYYA 2QG9A 2YZ7A 3A04A 2A30A 3C6ZA 4MWBA 1Q17A 4JLKA 1F6WA 4NYJR 2B4TO 3KYJB 4PGAA 4RIHA 3T95A 2FYTA 2F9MA 4D4HA 2HLHA 3R5KA 3CPEA 3EDYA 5CLFA 2FOLA 2C2OA 4O0MA 1H1LA 3NLLA 3OD5A 4O5AA 1E7QA 1L1RA 2ZW9A 1JQLB 1IN5A 1P3Y1 1ZXBA 1O6CA 3OZRA 1OBFO 4KGXA 4IJQA 4FCWA 4F86A 4TKUA 4Z4IA 3HY6A 4RCVA 4B6JA 4ZO4A 4YP1A 2AFHA 3RVPA 4F3YA 1QORA 4YRDA 5AK5A 5CK4A 1S2GA 2FPRA 4H77A 1JIJA 2Y0PA 3BCRA 4UHBA 1A9SA 3W9UA 1VSTA 3K4PA 1DC3A 2P40A 4BFCA 1X8LA 4DCSA 2PE5A 2XLBA 2J9FA 4O4JB 1VHTA 4OSPA 3T7TA 1QDEA 2H1HA 3QBTA 1LV7A 5DU2A 3RV4A 2G1KA 3TJMA 2QD4A 4ECEA 1E8NA 1UM9A 1RC8A 1PK7A 3HVHA 2WU8A 3I3SR 1JMVA 2A8YA 3EZ6A 5B3JA 1JTVA 5REQB 2G9NA 4EVIA 3PQFA 3FKSD 1PLKA 2PSEA 3LZCA 1FRNA 2C8JA 5KNBD 4TVBA 3G0IA 2NZVG 3UT6A 1O0CA 3UMCA 2B5WA 2PA3A 3MMZA 3J81A 2P77A 3CZPA 1KH3A 5LA6B 1A5SB 3ROMA 3JYLA 4JROA 4NCJA 4TSFA 1P4HA 3SKYA 3V4ZA 1GO2A 3GGCA 2A9FA 2VUTA 3FPSA 2G3YA 5DYTA 5K6AC 2J6IA 3UHFA 3JQ9A 5E7IA 2AFIB 2I2CA 3ANMA 4R5MA 5BPHA 3WIOA 3AM5A 2OAGA 2Q7DA 1QKIA 1NU8A 2G07A 2QJWA 1F8UA 3ICWA 3PX3A 1C29B 5HIMA 3RUCA 4CWAA 4D0LB 4P0TA 1XZFA 3MXTA 4H7JA 2TYSB 4GW3A 1QHHA 4HG2A 1BDBA 4MKHA 1N6RA 3LBHA 4N8DA 2QJOA 3KUKA 1T4CA 2AW5A 3QF4A 3KV1A 2E5FA 4P36A 2PCJA 5LOVA 1D2NA 4PG4A 4FE4A 4PIVA 4ABTA 5E6SA 2YJGA 5U4QA 2NXWA 4HNAA 2Q5FA 1NZFA 4B6QA 2RHBA 5IVHA 1E9AA 3KWLA 3DEYX 4Q12A 1R9MA 3ELBA 4ML3A 1A04A 5J2TF 1J39A 1JSRA 2EZ4A 2QG6A 4DNPA 3DOEA 3UAZA 3UG6A 3G79A 4G89A 5CAEB 2WD7A 4MP3A 2ZSKA 5CLJA 2OEPA 3C3JA 5BN3A 4JJGA 3C3PA 1X1RA 2AZDA 2JLVA 3BH0A 4KAXA 3QPCA 1UBMS 1T0HB 3T9AA 1EBFA 4Q4HA 1F12A 2PTGA 1E92A 5EKXA 1HRDA 2CNBA 3BK2A 5AKHA 4RFLA 4IS3A 1CR6A 3BXFA 1PV2A 3D0OA 4P0PB 2OFOA 3N8GA 5ES3A 2CE7A 2QM8A 4RVSA 2Q5IA 2HMTA 2HQ1A 3WGHA 2PJZA 3I73A 4X00A 4RQUA 1RMQA 1F0NA 4D9EA 5JALA 2Y4OA 3IHTA 5JS8A 2P9GA 2QR3A 4FGZA 1E63A 4Z7QB 3AL0C 3HYSA 3WK5A 5KJ1A 1QOQB 4MPRA 4F93B 2W6ZA 4DBLE 1OYWA 2X0DA 4J6EA 3BK1A 3E15A 4F84A 3UH0A 3NTQA 1E3QA 3Q2KA 4OHPA 3S3TA 2P90A 1I0LA 1Y34E 1NL3A 4REMA 3ABOB 3ROQA 4CFZA 4EG7A 3H4TA 2ODTX 3N86A 3IEXA 5TY0A 4MQLA 3STWA 2QP9X 4MKRA 5FOXA 1EWQA 4JP5A 1KI6A 4OQPA 3SY8A 4XI9A 2P65A 3AR9A 2YXPX 1QTNA 3TW4A 2X2OA 4BNWA 5A5FA 4JVNA 3PC8A 3QK7A 4LHSA 4QUAA 4HFRA 1MX3A 3UMRA 5BN1A 3LI2A 4WLVA 2D0OB 4YRIA 5ALWA 1EVIA 1M33A 3F1KA 3P5BA 2JKZA 4M89A 3X2EA 4E5VA 4NZ9A 3N2LA 4EJFA 4BEJA 2XKKA 3KZOA 4A1OA 2FE4A 4R2JA 1V11B 4ZN6A 1CNEA 3SWWA 5CYPA 4NOJA 1R10A 4PAOA 2JG3A 4FGLA 1KYXA 3OZUA 4IBOA 1CR0A 4JUDX 4OA5A 4MW4A 2C9MA 5C18A 4PC6A 4MI3A 4WXMA 2O7NA 4XYMA 3OE7D 2C4KA 3NBQA 1QGUB 3RASA 2JJ1A 1NUHA 2FSGA 1P0IA 4L9SA 4BB0A 1VJ5A 5KX5A 4LZLA 2FR8A 2PJUA 3RREA 3ZNQA 5ALVA 5JZSA 1TE2A 2G5GX 3B1YA 5BN4B 4RAOA 3ZIUA 4I8XA 4Q18A 1FTGA 1QZZA 2Q9CA 4L22A 3HUFA 3MBKA 4PBSA 2WYOA 4TSRA 5IMSA 4TSFD 1W5AA 2FAXA 2GRUA 4Z99A 2OCYC 3ZX5A 4M0EA 1BCRA 3G0DA 1C3EA 1Z6XA 2FNAA 2REQB 3UHJA 4CT5A 1CNMA 1X80B 4R3WA 1KQPA 4PSKA 3TM5A 5F9MA 3IEMA 4YRJA 1NI4A 1NMXA 1JDJA 2IHUA 2XVAA 3O74A 1FUEA 2VHQA 3CNLA 1XALA 2IUSA 2Y27A 3R5SA 4U6NA 3TRDA 4F38A 2WB2A 1MT3A 1LSUA 3EE6A 3GZNB 1UR5A 3FRIA 4Z0TA 2ZBVA 1AGPA 1T8TA 2ZRHA 2RJNA 4OB7A 3B1ZA 4EENA 1I01A 1JFVA 3OZ7A 2PT5A 4RS4A 4YP5A 3X1ZA 3CPHA 1O95A 3JQ7B 5DK6A 4DEVA 5F4ZA 1J8DA 4G85A 2DPLA 1Q7EA 4WBNB 5CB0A 1J20A 1SKYE 3WGZA 4ENVA 3KSBC 2NXCA 4M21A 1SHZA 2ZI5A 4KE6A 4LZNA 2PUBA 1VXRA 4WLOA 4YROA 3UG7A 5BORA 4AJJA 3U40A 4E51A 2GVZC 5DI3A 3TTSA 1A4RA 5DBIA 4TV9B 1ZD5A 1SHTX 1AHNA 3PGA1 4BGEA 4DY4A 1U4NA 16PKA 2GBFA 2XTNA 2ZT7A 3D3QA 3HU3A 3K1AB 5IW8A 1QF9A 3CLRC 4KYTA 1G20B 1VGVA 5KSPA 3W6NA 5JECA 1QC5A 1E6LA 1QIHA 4RLFA 1E4OA 4ROTA 2FSIA 2YZ2A 4N3BA 3U7IA 1JX6A 1SCNE 1E2QA 2RJOA 2YWCA 1FQKA 2VDRB 1RMTA 4E14A 1OA0A 4FR0A 5K3OA 4QUIA 3KE9A 4UXJA 4CODB 1TJPB 2H3HA 4F11A 4H60A 5HE8A 2IUYA 3MS7A 4BVBA 2BMVA 2G0AA 1EP3B 1V7PC 1ECJA 1TB4A 4H3KB 1ZDMA 5EJ4A 2AMYA 1TNDA 2BUCA 4GWLA 3SFZA 3TXYA 4LI3X 4BV3A 3VKVA 2RH8A 4DGQA 4GBJA 4X3CA 1IVNA 3WMWA 4CU5A 4CI0B 3WWOA 2VDWB 3TOZA 2D62A 1KC3A 4BJHB 1XNRB 2JCGA 1P5RA 2G6BA 3A1EA 1FFYA 1K75A 5KCZA 3L49A 4KQIA 1EVEA 2X22A 5ALIA 4DXDA 5JDIA 3B1WA 5H81A 3LQ1A 4M0LA 3SHQA 1NW3A 4CMIA 4TLEA 1QQ5A 3MS4A 1JHYA 1DAPA 3GVIA 2BISA 1KHHA 3U4QB 3QEJA 3IEKA 4TT3A 1VYVA 2FHSA 2R8YA 4HMOA 1A0OA 1Y8RA 4BU0A 2QMYA 4QUBA 3VA7A 3KYCA 3L6BA 3T34A 5KQGA 1XVLA 1C41A 2YIJA 3B6IA 3QHPA 2YKGA 2A0UA 1II8B 1L7BA 3KKQA 4BZPA 4IGKA 4AXBA 5KEIA 2C7QA 1FSPA 1NUAA 3AP1A 1CUXA 4X44A 4OLAA 2MINA 4JBGA 1SCKA 4XPZA 4W4TA 4N5IX 3H04A 1EQAA 1E7SA 3NONA 2JGLA 4C29A 2H2FA 3MT9A 1B1AA 3NMUF 1IDOA 2QVLA 1V3TA 5E9AA 3I0MA 4UQPA 2GXAA 3GEGA 3ANLA 1IBKB 2Q4EA 4FR2A 2MMCA 1O8BA 4DTCA 2O20A 4FQ8A 2RHTA 3GBPA 1ONBA 3P2MA 1Z5OA 4RTNA 2DQSA 3CEHA 4OJTA 3JTEA 4N5NA