4LYEA

Crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with substrate hopda
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
276
structure length
276
Chain Sequence
b'MFEQFESKFIDCDGIRTHYIEMGEGDPLVLVHGGGAGADGRSNFADNFPIFARHMRVIAYDMVGFGQTDAPDPAGFAYTQAARTDHLISFIKALGLSKICLIGNAMGGTTACGAALKAPELIDRLVLMGAAVNISPDDMVANRDDLAAVMSYDGSEEGMRKIIAALTHSYQPTDDIVHYRHEASLRPTTTAAYKATMGWAKQNGLYYSPEQLASLTMPVLVLGGKNDVMVPVRKVIDQILAIPQAIGHVFPNCGHWVMIEYPEEFCTQTLHFFGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MCP Hydrolase
publication title A substrate-assisted mechanism of nucleophile activation in a ser-his-asp containing C-C bond hydrolase.
pubmed doi rcsb
source organism Sphingomonas wittichii
molecule tags Hydrolase
total genus 99
structure length 276
sequence length 276
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lyeA00
4CIBA 2WIKA 4L3WA 1L7AA 4U2GA 1UKAA 1XKLA 4UHEA 5I7UA 4TGLA 1GZ7A 3HABA 3O4IA 2JIDA 5FPPA 5A7FA 1ZI9A 4W63A 2CBGA 2Q0XA 3R0VA 4QDZA 1W4LA 2WG2A 3FYUC 3B12A 3H2HA 4N8DA 1YA8A 4DGQA 2HU7A 3I2IA 1MX5A 2WIJA 4A16A 1HLGA 2ZYRA 4MWTA 4X85A 2H7CA 4KE7A 3D7RA 1LPPA 3FNBA 3R40A 5AKXA 3D2CA 4ROTA 1JKMA 1YASA 4FNMA 4WDQA 1GQSA 1LZKA 2VAXA 4NS4A 3A2MA 1CUFA 2HFKA 1KU0A 4C6HA 1CPYA 2X76A 4G5XA 3WK6A 3BE8A 5AOCA 4G1FA 4B83A 4LKOA 1CVLA 3DS8A 4PQEA 3WKCA 4GLBA 1XZGA 3DCNA 3WIOA 4YPVA 1UOPA 3BIXA 1ZGCA 5JYCA 3F8SA 1BCRA 1MO2A 2I03A 5C7YA 2WFMA 4UHDA 1EA5A 4AO7A 1LNSA 3DL7A 1BE0A 1CUGA 2RGUA 5ALJA 5JALA 1XZBA 1YAHA 1H2XA 4BCCA 2VEOA 2XDWA 3UUFA 1CV2A 2VJBA 2V9ZA 4OUKX 3V48A 1J2EA 3DOIA 3QPCA 1CUWA 2OCLA 4XWGA 1EDDA 5IVDA 1UK9A 4X92A 5K5EA 4LIPD 2DHDA 3WL7A 1Z68A 4WY8A 1P0MA 4IQ4A 4F60A 1H2WA 4W1QA 4C87A 1XRRA 3QZUA 4B0PA 4KE8A 3BDIA 3K2IA 3C6XA 1E8MA 1XZCA 3DQZA 4CG2A 1H2ZA 1S8OA 1ZJ4A 1R50A 4FOLA 2XMBA 3D5EA 1XQVA 3W05A 3TGLA 5JAOA 1XRLA 4CIAA 4UBOA 2IITA 4UHCA 4XVCA 3DDUA 4KE6A 3S8YA 1XKTA 4AXBA 1DWPA 4EY5A 1H2YA 2FJPA 5HZGA 5C8XA 3CN7A 4QDXA 2IIVA 3G9XA 1R3DA 1A8SA 2Y1KA 4PO3X 3DLTA 1QIEA 4W9RA 3FYUA 1UXOA 1UK7A 4G8BA 5AM2A 3G7NA 3MGAA 1MNQA 3C6ZA 4XIIA 2XUJA 1QOZA 1AKNA 5AI4A 3KWFA 3B3QA 3ESAA 3F97A 3MUOA 3IURA 4PSCA 2J4FA 1WPXA 5JASA 3HI4A 2RAUA 5CH3A 1HL7A 4OB8A 1AC5A 5AK6A 1P0IA 1THTA 5EGNA 5JD5A 4FWBA 4JEIA 3CXUA 2PKYX 4J0IA 2QS9A 2YH2A 2PU5A 2XMRA 1DQZA 3R41A 4ITVA 1H22A 5AOBA 5ALOA 2XQIA 1VZ2A 5A62A 3BF7A 3DD5A 4HRYA 4XX1A 5K3CA 2WU4A 3AILA 5EHXA 1YB7A 3K9BA 4JUIA 2B20A 5JZBA 4X90A 5E4YA 4PSDA 4KAFA 4H35A 4DYHA 4IHAA 5HFNA 4J0JA 3IB3A 2HA3A 4ARBA 4OB6A 4W1RA 4N8EA 4IO0A 3VVLA 4K2AA 4A5SA 3FAKA 1WB5A 4B82A 3WI7A 1QFSA 4UPDA 5A7HA 1ZD4A 3PICA 3A2NA 3EBLA 3C5WP 4RNCA 3I6ZA 4CCWA 5DYWA 2C58A 3RKSA 5CBKA 2VATA 4X6UA 1WOMA 4MWSA 3MUNA 1UKBA 4AQDA 4B9EA 5ISMA 1JFRA 2PPLA 2HIHA 3W9BA 5AOAA 4OSEA 3GFFA 4B9AA 2PSFA 1SFRA 1QONA 4OYYA 2XUKA 3RM3A 2WQZA 1LGYA 4B85A 5CT8A 4UHBA 3AJAA 2YASA 3A2LA 2C7BA 4ZI5A 4B7ZA 2P8SA 4JYPA 5AH0A 3W06A 1R88A 4KE9A 2YXPX 3G8YA 4AO6A 2VJDA 4JYMA 1ZI6A 4K6GA 4G8CA 5FOQA 4BB0A 2V97A 4KJXA 2CMFA 3FLEA 4FFWA 5T4HA 3M83A 1W75A 1A8QA 5IH7A 4P08A 3WA7A 5D7BA 4Y7DA 3D2AA 4C4YA 4Q3LA 3V1KA 4E46A 3AUKA 3H18A 5HKBA 3UUEA 1XQXA 1JMYA 5JD4A 3I2KA 2OXEA 4FDMA 2O7VA 3F96A 3R3UA 5D3KA 3DEAA 5JIBA 1RP1A 3K6KA 3AIKA 2PBLA 2CEKA 3NGMA 1DU4A 1E8NA 4QLOA 3EQ9A 1UOQA 4KEAA 4NZZA 2NW6A 3FYTA 2JGIA 3WL5A 3EQ7A 3Q0TA 5EIAA 3FSGD 4Y2YA 1EXWA 3F98A 2XQJA 5FKJA 5K3FA 5T4EA 1F0PA 2WHPB 2ZJ6A 5DNUA 3A70A 2WKWA 4X94A 2ZVDA 1UZAA 3IVMA 4RE5A 1VOTA 2RONA 1LBSA 1ZD2P 2WUGA 2XLBA 3AFIA 1TQHA 4LXGA 1MAAA 3IUJA 1SCIA 4BE4A 5DNWA 1SC9A 2PSJA 4G4IA 2HA4A 2FX5A 3E4DA 2OQIA 2WILA 1LPMA 5KWJA 5CXUA 1K6EA 4YK7A 3LCRA 2GZRA 5LKAA 2QJRA 3RLIA 4BVJA 3STXA 1FFCA 2HRQA 3V1LA 3WWOA 3FYUB 1AMNA 4P92A 3HZOA 1FJ2A 3AIOA 3G0GA 4MXDA 5LKRA 5LP1A 1QGED 4I3FA 4IH1A 5ALRA 4C89A 3CN9A 3GZJA 3I1IA 3M81A 5DJ5A 2EDCA 1EH5A 4C88A 2RI6A 3WKAA 3D59A 4LHEA 1DINA 2B4KA 3R3ZA 5ALUA 2XUOA 2VJCA 2Z8XA 4MYSA 4JNCA 2BGRA 2O2GA 4UBNA 5C81A 1JJFA 3X3HA 4DNQA 3W9UA 1IZ7A 2HL6A 4HXFB 3QMWA 1LPOA 2HU8A 2AJBA 3I6YA 2X8BA 3TRDA 3OPMA 1EK2A 4BDSA 1U65A 4PNZA 3JWEA 2VJAA 1AGYA 2PSDA 1WCYA 3DKKA 4GEGA 2DR0A 4ZWNA 4PW0A 3VKFA 4ZV9A 2D0DA 5AI8A 2WU3A 4HAIA 1F6WA 3T52A 4XJVA 4IH9A 5AI0A 5JADA 1DX4A 3FBWA 4HXEB 1M33A 4ETWA 4JH0A 5K3BA 5CURA 2VF2A 3R3YA 4YX9A 5CT5A 5HF5A 3C43A 3G9UA 3VJMA 4PSUA 3WK4A 4DSAA 5HF9A 4WY5A 4Y2XA 1MAHA 4MQLA 2O2HA 3KDAA 4P9NA 1AZWA 1HPLA 4FHZA 1N8SA 4L9AA 2ZYHA 2X5XA 2O7RA 3BL8A 3PE6A 2HU5A 3WWDA 2XMQA 1NX9A 4ZXFA 5HK9A 4S0XA 4F5ZA 5DYTA 1JT2A 2BGNA 3FWHA 5AO9A 5E4TA 1O6FA 3FLBA 2JGLA 2G4LA 5LZ8A 1Q83A 1E5TA 1CQWA 4GHWA 4Q3KA 2K2QB 1GPLA 3ZV7A 3D0KA 3VXKA 4N8SA 5LZ7A 3ZWQA 4H7KA 4EBBA 3F67A 3PF8A 4FLMA 2XUDA 3W2TA 2RIPA 2WLSA 2ACEA 2ES4A 3I2JA 5HKAA 1E89A 1XLVA 4FTWA 4LXHA 5EHNA 3D3NA 2JGFA 1QZ3A 2ACKA 1YCDA 1RYYA 2C4HA 2OAEA 1QIDA 3FCXA 5KBYA 4HZGA 3IULA 2Y2VA 5AI5A 3QPDA 2WJ4A 1DTEA 2ZJFA 2VQ6A 2ZSIA 5ALIA 4IH4A 2GYUA 5EHQA 1UK6A 1DX6A 1FFAA 3G9TA 3H2JA 4NMWA 5F4ZA 5HF6A 4BAUA 4EA6A 3STTA 2H1IA 4H7JA 5HFAA 1QIMA 2GBGA 1NU6A 2Z5GA 3OM8A 5FXMA 4WCVA 4E11A 5K3FB 4EY6A 4OCZA 1AUOA 2HA5A 1Q84A 3C5VA 1CUIA 5JARA 2QKYA 2C5FA 4H7DA 5AM1A 3DYVA 2JGMA 1A88A 3WJ1A 1ISPA 1IVYA 2WFLA 5AK4A 1ZD3A 1KU6A 4TPKA 3DKRA 3LS2A 2OAGA 3KD2A 1XZJA 1Y7IA 4GDMA 3Q8WA 5AKZA 2J3DA 2OG1A 1BROA 1ZI8A 2Y6VA 4W1SA 1MNAA 3A6ZA 3MVEA 5ALZA 4KAJA 1AQLA 1EINA 5JAUA 4UBIA 3SK0A 4QWMA 3QITA 4MYDA 4UBJA 4UBMA 4QA9A 2CKMA 3PUHA 1XRPA 1UKCA 4AN0A 3PFCA 1E8DA 1CR6A 5E2IA 1RWQA 3N2ZB 2JGEA 2WHQA 1GKLA 2FUKA 2LIPA 2Z3WA 3AZPA 4BAGA 1IUNA 2WTMA 3GUUA 4OPMA 1J06A 4H0CA 1Y37A 3C8DA 3H04A 3JW8A 3PI6A 2HA6A 4BC1A 1WPRA 4C4XA 3WQHA 5H3HA 3ZLTA 2H7XA 1UK8A 5AHXA 4X7BA 1LZLA 1X2EA 4Q34A 1ZD5A 4J0CA 4BP8A 4K5QA 2BAGA 5AKHA 5A7GA 1XZLA 5ALKA 3C6YA 1IZ8A 4H7HA 1EHYA 3FCYA 2H9YA 1CUAA 1F0NA 5EHZA 2ZYIA 2XUHA 1HQDA 2UZ0A 4G9GA 1MX1A 1BN7A 1C4XA 5ALFA 2GZSA 3HACA 4K6HA 5DWDA 1TRHA 5LIPA 1JU3A 5YASA 2I3DA 2VTVA 2XQKA 1LPSA 2Z3ZA 2WG0A 1IUOA 2WHRA 2OGZA 2HDWA 5DYYA 4LYDA 5LZ4A 3VVMA 1TIBA 2PSHA 3V1NA 4B80A 2XMDA 4J03A 4RPCA 1AX9A 3IIIA 1W6RA 4A23A 1Y7HA 4G4GA 1A7UA 5ALTA 3STUA 1J1IA 1MT3A 5LLSA 4RE6A 3AINA 1N5MA 5ALQA 5DLPA 5FPQA 1VZ3A 5JZ9A 3IBTA 1WB6A 2J4CA 3D4LA 1CUUA 2ZYSA 2JEYA 1C7JA 5EIEA 4QDOA 2R8BA 5ALHA 4V2IA 1TAHA 4OU5A 2QM0A 2GYWA 3HEAA 1VXRA 2J3QA 5JANA 3HC7A 1VE7A 1ZICA 3R3XA 3ICWA 4I19A 5IKXA 5FRDA 3NWOA 1ACLA 1QTIA 4J3JA 5D3ZA 4YASA 4ZREA 2OLEA 4H7EA 4Y2QA 1VA5A 3BIWA 1XZAA 2QXUA 2EDAA 1XZEA 4OD0A 2QMQA 4AZ0A 1Q0ZA 2VT6A 4MJ3A 5CTAA 3OTQA 4E15A 4DMFA 3P2MA 2QUBA 3U0VA 2OCIA 3T4UA 1CFJA 2I78A 5C8ZA 2FJ0A 2QVBA 1N5RA 4GWLA 1XQWA 2AJ8A 4AB1A 1CUHA 1YS1X 2E3JA 3ICVA 1R9MA 3R3WA 4DMKA 4FKBA 2XUIA 3IUNA 2OGSA 5LZ9A 1YS2X 2QJWA 3M82A 4U2FA 5ALSA 1QIIA 2WSLA 2DHCA 4FNGA 5ALDA 4X91A 4WFJA 3U1TA 5CT9A 1BRTA 1GPNA 1HKHA 1CUZA 3H1AA 4CI9A 4KR0A 4OU4A 4BZWA 2WFLB 3NUZA 1JJBA 1QLWA 5DTJA 5SYMA 4LXIA 1IUPA 3WYDA 1WB4A 3O9MA 4UUQA 2QT9A 5A2GA 4LYEA 1BCSA 5ALVA 2BUBA 3I2HA 2QTBA 3IA2A 1ODTC 3GA7A 1FFEA 3DYIA 5A6VA 3AZOA 2R11A 4Y2PA 3FSGA 3BF8A 1YAJA 1YA4A 1G4HA 3IUQA 3VJLA 1XZHA 1LLFA 1TKRA 1CUBA 7YASA 4B84A 5AK3A 4B6GA 4X93A 3DJYA 1FSSA 2JBWA 1QIGA 2OQVA 5AIBA 3C70A 3WWEA 4KAAA 1P0PA 4WFIA 5AKKA 3I2FA 1EK1A 4F0JA 5AM4A 2PUHA 5T4FA 4HRXA 3ZI7A 5K3EA 1MPXA 4BC0A 3I28A 3WLAA 5HQ3A 3SC2A 2XUFA 1EVQA 2XB6A 1T4MA 4EUSA 4ZRDA 1QJ4A 3D2BA 4H77A 4BCDA 4G9EA 1ODCA 3WKDA 1VJ5A 2HA7A 3V9AA 2BFNA 2JF0A 1PJAA 4BZZA 5EIHA 4C01A 3WK7A 1ODSA 3STWA 2HFJA 2HHAA 2XQGA 1CUSA 1CIJA 1ACJA 2AJLI 2AXEA 2B9VA 2WIDA 1OILA 1R1DA 5JAPA 2ONCA 2XUAA 3QYJA 1VE6A 4O08A 4K6KA 4DTCA 2XUGA 2BCEA 5EFZA 3ED1A 3WWCA 3WZMA 5K3AA 1G5FA 3FOBA 1DQYA 1QIFA 2ZJ7A 2VT7A 5JZSA 2CUTA 2XMZA 3E0XA 5ALNA 1WHTA 3O95A 3EQ8A 4EY4A 2Z8ZA 3L1IA 4FFVA 2I3ZA 2GYVA 1K5PA 1NU8A 4X95A 1QO9A 3G0IA 4Q3OA 3O4GA 1GKKA 1TCBA 3AZQA 4CCYA 4UFPA 3PFBA 1EDBA 1TK3A 2DCMA 1QE3A 3N0TA 3WL6A 4H18A 1THGA 1LPAB 5AIAA 3IDAA 2WJ6A 2WFZA 3BWXA 4DMHA 2WM2A 5CT4A 5IVIA 3E3AA 5AKGA 3G0DA 2B61A 5LZ5A 1G66A 5AM3A 1QIKA 4ZGBA 4AMYA 2DQYA 4PV7A 2Y2UA 2C5GA 3WK8A 4I4CA 1TCCA 1U4NA 2XI4A 1BU8A 3DL4A 1GPKA 1AURA 4G4JA 1B6GA 3HSSA 4BE9A 2WTNA 1BEZA 2CZQA 1G42A 1XZKA 4KYVA 1W52X 4B81A 1UWCA 3WK5A 1XQYA 5ALGA 4UHFA 1ZGBA 4MEBA 5K3DA 2OGTA 1E66A 3ANSA 2XMSA 5AKLA 3B5EA 3IUMA 1QIJA 3M3DA 2PL5A 1A8UA 1Q0RA 3ESCA 4UFOA 5FP0A 3E1GA 1TCAA 3SX4A 1QIHA 3O9VA 3KOOA 5FUMA 4EY7A 5I8PA 5JD6A 1J07A 2BKLA 1L7QA 3WJ2A 1CRLA 4M0FA 1JU4A 5DTIA 1GGVA 4CG1A 2EEPA 2VA9A 1CUVA 5ALXA 3G9ZA 4Y9SA 5AKIA 3PF9A 2JGKA 4Y2TA 4DSZA 3ILSA 1MTZA 1FFBA 2BUCA 3OC0A 2XE4A 2JGJA 2WUFA 1SOMA 5ESRA 5HF8A 3UMJA 2CB9A 5HCUA 1L7RA 3C6BA 1ORVA 3QMVA 2OCGA 4WJLA 2BUAA 4DM7A 5KWIA 5BWCA 3WK9A 1SCKA 1XRQA 2WJ3A 4GW3A 4C4ZA 1BN6A 3FVRA 3H19A 1OCEA 3STYA 1CUCA 4HS9A 2QZPA 3BJRA 2G63A 1ETHA 4F21A 3BJMA 5CH5A 2PM8A 5C8VA 1XRNA 2WHPA 2HADA 3WZLA 4INZA 5CW2A 2C0QA 2XUPA 2OCKA 4OB7A 4DNOA 2OPHA 1R9NA 4EHBA 2XUQA 3LLCA 4KRXA 3I2GA 5FDFA 1W1IA 3H2KA 1VKHA 4HXGA 5HQ3B 5HK8A 3QPAA 4FBMA 1YB6A 4HTAA 4J0DA 2DQZA 1HBJA 5E4JA 2W22A 4J7AA 4EB0A 1XZMA 3WYNA 4GXNA 4PF1A 2WIFA 1GQRA 2QOEA 1MN6A 3HRHA 3NOXA 4QEKA 3VISA 4BVKA 1XZDA 3QM1A 3WKBA 5LYYA 2ECFA 4DMCA 1DT5A 1CUYA 1VA4A 1YR2A 3HYSA 4QNNA 4X6YA 4Z49A 5ALEA 2GBIA 2WG1A 3C8HA 4Y2SA 2QXTA 1N1MA 5ALMA 4QZVA 3YASA 2PX6A 1CQZA 4BDTA 4E14A 3PDCA 3G0BA 3JYHA 5CT6A 2V98A 1CUEA 3ANTA 1C7IA 1HDEA 4Y2RA 5AKEA 1XZFA 1W76A 4BRZA 1PV1A 3LIIA 2IX9A 4M0MA 4Q1VA 1FFDA 3L1JA 4KACA 4QE3A 1EI9A 3ESBA 5CMLA 4CCYB 1USWA 4BTLA 1CLEA 2W6CX 1UFOA 1EVEA 4Y2UA 4UBKA 4DLNA 3O4HA 4EY8A 2PSEA 4U2BA 5AK5A 5AJHA 2DSNA 3AIMA 5KREA 3W04A 2CJPA 5IVHA 5AI6A 2HA0A 2VSQA 1QTRA 4UFNA 2HA2A 5ALYA 3C87A 4FLEA 4FLFA 1CUDA 4DNFA 3ZLUA 4B0OA 1WM1A 4AMZA 4AX4A 1DT3A 2PUJA 2ZSHA 1BEEA 4X97A 2ROQA 5ALLA 5JAHA 4GECA 3H2IA 3OG9A 4X3CA 2PVSA 3WIBA 5IVKA 4MQMA 4L0CA 3STVA 3I6MA 3R3VA 4CG3A 1GT6A 3HXKA 5BV7A 3HJUA 3ZLVA 3SWWA 1K63A 3CCBA 3H0CA 4X6XA 2QUAA 4CFSA 4TVKA 1GXSA 4EZIA 2VAVA 3OOSA 4H7IA 1UOOA 1XZIA 5AM5A 1DWOA 1EDEA 4N5IX 4QWWA 4BTVA 1ZOIA 5FV4A 4GI1A 4NVRA 3TJMA 4D9JA 1LBTA 4W1PA 5ALWA 4UHHA 5CH8A 3DNMA 1F8UA 5AKJA 3OURA 4BCBA 2Y6UA 4HVTA 4RGYA 2AJDA 4FMPA 1DWQA 1ZIXA 6YASA 2AJCA 1XFDA 5LZ2A 1MJ5A 2XT0A 4QLAA 1X70A 2WIGA 4X71A 1R4ZA 1UT6A 4FBLA 1EX9A 4DNPA 4G8DA 1ZJ5A 4X00A 4WDRA 3KXPA 1SCQA 3HLKA 2DHEA 3GELA 4GBGA 1QFMA 5D6OA 4BBZA 2RHTA 4M0EA 2JEZA 4Q05A 3RARA 5EI5A 1CUXA 3H1BA 4MEAA 1XLWA 4DIUA 3LP5A 5A71A 3VDXA 2V96A 4OYLA 5J3JA 1H23A 2O2IA 4ZV7A 1K8QA 1JMKC 1CUJA 1P0QA 2D5LA 4U2EA 4Y2VA 4BRSA 2YYSA 1ZIYA 2XLCA 2XQFA 5CXXA 3CCCA 3DOHA 3C45A 4BVLA 3BXPA 3FLAA 3KSRA 4BYMA 4KRYA 1T2NA 5FLKA 3O0DA 4J0HA 5ALPA 2GBFA 4QDUA 1EB8A 1K4YA 3LIPA 4Y2JA 5AICA 3WMRA 2XMGA 3G02A 1MU0A 1CEXA 4N5HX 3EIOA 3GROA 3VJKA 5BOVA 3QH4A 2PU7A 5SYNA 1U2EA 3F9CA 3H2GA 1ORWA 1VLQA 3ZPXA 1U8EA 3GBSA 2DFPA 2G5TA 3PUIA 1LPBB 5AKYA 3ESDA 1QO7A 2WUDA 3G0CA 1X2BA 2BJHA 4AZ3A 1BS9A 2HM7A 2RHWA 1WHSA 4L72A 5I9IA 4UBLA 1IMJA 3TEJA 3I1YA 3QVMA 1XROA 1E3QA 5AI9A 5CRIA 1MX9A 2H7YA 1D07A 1B41A 3BDVA 3EF3A 1XLUA 3FVTA 4H7FA 4BAZA 5T4BA 1JJIA 3V1MA 3QMMA 1KEZA 4QDTA 3WWPA 5AP9A 5AM0A 1EB9A 2C0PA 5JATA 3L1HA 1I6WA 2ORYA 3QBJA 2HRRA 4AN1A 4U2DA 1PFQA 4BP9A 2GBCA 1O6GA 4P93A 3KWJA 2WUEA 4J0GA 3RK4A 3O4JA 3H17A 3WKEA 1YSCA 4Q82A 4AO8A 1JI3A 1OXMA 3WA6A 2G5PA 4WFKA 2QRUA 4U2CA 4ARAA 3S2ZA 1LPNA 4J0KA 2QR5A 2XMCA 4BATA 1VXOA 5DNVA 5BWBA 3WL8A 1XRMA
chains in the Genus database with same CATH superfamily
4IVQA 3LWBA 5HKKA 2OHXA 3NFRA 4OO3A 1Z0IA 2WIKA 1T36A 3A6DA 3NETA 3Q6NA 4J07A 5JCJA 2HJVA 4DA4A 1L7AA 1U0BB 4CLDA 5F9MA 2PQ6A 1R0BA 3VZCA 1ULHA 4DDTA 4KYIB 1M1ZA 4UHEA 4TGLA 3OCVA 3GLRA 1GZ7A 4POAA 2OTCA 4JZYA 1E1NA 4WUTA 2JIDA 3WGLA 2DT8A 5FPPA 3WNDA 4P3PA 3QJYA 5FWYA 2Q3HA 3BG5A 4E70A 1E3WB 3INYA 1W0JD 2W70A 5F52A 2CBGA 4WZBB 3UH0A 2AEFA 3D7LA 1BW9A 1PR5A 1WEHA 2DKOA 4IQ8A 4Q93A 3OOHA 2RI0A 3FD8A 2QL5A 3GPIA 4QDZA 1TYZA 4QATA 3RSLA 1QQ6A 4PC6A 2QN9A 3E9EA 5DCUA 3AY6A 1YA8A 4N8DA 4KSBA 3HKEA 5AVJA 5FYDA 5BNFA 3K0BA 4TZTA 3GN2A 5CFLA 5GJBA 3LUDA 1DAMA 3FNQA 2GXSA 4BVEA 4QPJC 4XVHA 5BNIA 5JJBA 1IN5A 2XV1A 1E5QA 3NIFB 4MRRA 3OPYA 3K8QA 2XYQA 3CW8X 1PG0A 4C14A 4GU5A 1OPXA 2ZYRA 4P31A 2V7QA 3ROEA 1ISIA 3EXG2 1E63A 1N3YA 1UMCA 4URZR 1QKIA 4MWTA 5DHQA 4V1CB 5DDIP 3HJRA 1X42A 3LECA 3RSOA 1KY4A 1NVWQ 1JAIA 4F3KA 4KE7A 4NZPA 1SQGA 3QOWA 1U3TA 3R40A 4XB2A 4PSVA 1VL5A 2B82A 3QXSA 3UTDA 3REQB 4EUNA 1KEKA 1GIAA 3ZWKA 4V0OA 4ROTA 1XD9A 3ZJTA 1LFAA 3W5CA 1LV8A 1QH1A 5E9QA 4EYQA 5CB4A 1DPGA 1G3QA 2VP4A 2XDQB 2YNMC 3BMCB 4TT8A 3VFDA 1P2FA 2EOAA 4RXTA 2QMYA 3F9RA 3PC3A 4TWRA 2C94A 1XL0A 2OK8A 2ZIXB 4L5BA 2AXQA 3IT2A 1K0UA 1NRJB 2R8OA 3ZCUA 2VHXA 3AFNA 3QLUC 1NLMA 1C29B 4HC4A 4BLPA 5JH7B 5DMHA 4MDEA 4HDMB 2PUFA 1KU0A 3SEAA 4FD3A 1RJWA 2YFHA 3CVJA 1IY1A 2NXEA 1D8TA 3EGIA 4EGCB 5AW5A 1KPGA 3QLVC 4F4FA 4AULA 3L0SA 1SZPA 2JI8A 4JKYA 5COBA 5E3JA 1Z63A 3IXQA 1XPOA 3AEZA 3CZ9A 1PJ8A 3M6UA 3PNLA 3G8CA 1HDCA 2BVNA 3LGXA 4S1PA 5FL3A 5I6DA 3OPXA 2NSLA 4GUDA 5AOCA 3KK0A 3HV0A 1Q11A 4B83A 4LKOA 3MYRA 4CIWA 3NRJA 3N2EA 1YQQA 4GMXA 5A9SB 2L19A 3GJQA 4P4SB 5H9VA 3DCNA 3WIOA 1PW7A 3GR6A 1GNVA 2OZEA 1JU9A 1N4AA 1GCIA 4QTZA 1NBAA 1UOPA 1FU8A 4Q7EA 5I7AA 3DMTC 3J80A 2RHOA 5TJHA 3NEYA 2EYUA 3OCXA 1QKKA 1MO2A 2A0KA 4YMUA 5BSGA 5GVSA 5KSWB 3I37X 2A0FA 2CXNA 3X44A 3R9WA 2FFHA 3AI1A 1ESCA 3L0OA 1JH8A 4M8LA 1NPTO 2I03A 4NFYA 4ENQA 1U2PA 1XZPA 2OCBA 1OC2A 4G84A 1TE2A 1FQWA 1S1CA 4JMLA 4AO7A 4BHTA 1BE0A 2WVGA 4R83A 3SQXA 5JALA 3FUTA 4KQ9A 1XZBA 2GN6A 2ZYVX 3KOYA 2OBXA 4PFJA 1U3FA 4HT3B 5H16A 5DHUA 3DDHA 4FI3F 4R1UA 1E64A 1IZ9A 1BO6A 1XP8A 1FEZA 1JBKA 4C22A 4D26A 3FRIA 3RQIA 1WOYA 2O54A 1KI4A 1NR5A 1SN7A 2SKEA 3P4XA 4TMFA 1S2OA 2C4NA 3AR9A 3LPCA 4JNKA 1CIVA 4YQZA 1FP7A 3MILA 4L3VA 4QUEA 4NK5A 1PTJA 1TUBA 2X8WA 4KDEA 4XWGA 1PNRA 1US8B 1OYVA 1P0CA 5B58C 1YJCA 1XE3A 2VYVD 4MA5A 4JCCA 2Q0SA 4KGXA 3EHEA 1UK9A 3ZDXB 5K5EA 4N1AA 5AW1A 2IUTA 1TT7A 2DHDA 5EG5A 3WL7A 1U9ZA 1VHQA 4ZXPA 3KEOA 3WFZA 1WF6A 1ZD8A 2FW1A 2PUTA 2O8DA 1BXRB 3AT1A 2OR3A 2YY7A 3QTBA 5IWCA 4W1QA 1BZYA 4DUPA 5GONF 1A98A 4C87A 1MO5A 4YRIA 1M8FA 1QCCA 4UASA 5DW0A 5C3UA 3A06A 3KWLA 3NRBA 4IIJF 1P29A 2AN9A 4B0PA 1SG0A 2D1TA 2I55A 1GTSA 5I7EA 3MAGA 1H65A 1Z88A 5EZ5A 2ZKIA 2CNWD 1A96A 1JIKA 2B2NA 1SB9A 3GVIA 3V3TA 4B4KA 5I9SA 1HWYA 4P3NA 4RHTA 3LBAA 2G4CA 4X54A 3DQZA 2OO7A 3HDHA 1ODKA 2O2ZA 4MPJA 1Z4JA 2AUTA 3I3SR 5TJ9A 5JAZA 1R50A 1BWSA 3K0HA 3Q11A 4CDNA 3DDCA 4RGVA 5HRCA 2JLBA 1EFPA 1EUCA 4DIFA 1HLDA 2P6MA 2GYYA 2OCDA 1TZCA 3I45A 5B4TA 3BJZA 3TX2A 2HPZA 3CUUA 2LR0A 4ZFNA 1E94E 5JAOA 3A9UA 1EE2A 4YJ3B 4OQ4A 1W6UA 5AVXA 3DT9A 2CN1A 2ZJZA 4QREA 2Y1OA 3I92A 2G25A 2NPFA 4BFZA 1SUFA 4URHA 2O0MA 3RS8A 3EN0A 3HY3A 3BQ9A 3QVVA 3ZWAA 3CNBA 3TAUA 2OV4A 2I99A 2P68A 4LCEA 4AXBA 3Q3IA 2CLLB 4IS3A 1GPMA 1R6AA 2DUNA 3MMPA 4HQ0A 1S96A 1VQ1A 2DJIA 4MS4B 4MUIA 2OV2A 1SELA 3SSAA 3I5XA 4YI5A 1B93A 1IUKA 1Z0FA 3G9XA 4GI3A 4I5DA 4BNGA 4WOKA 4RXMA 2O19A 2HO4A 3ZWNA 4RK6A 1Q6YA 1HRDA 5B30A 1EWVA 1ZMBA 3JWPA 3KJHA 4ADSG 1T6BY 1VCIA 3DW3X 3J81k 1OH6A 3FYUA 4LMRA 1UXOA 4JJZA 4OY3A 4ZZ2A 3REFA 3WMFA 1UK7A 4TXHA 4H27A 4DR7B 4BNXA 4L78A 4HB2A 4AY6A 2RCYA 1JR4A 4FFPA 3TLBA 2P6NA 6ABPA 3M0EA 3G2OA 2CHGA 1K27A 2OFFA 4EEKA 1UMBB 3GF4A 1OHHD 1RE1A 3K09C 3BIJA 2QORA 3QF4B 1SNYA 1SWWA 1RLMA 2FSVC 3IALA 1WXQA 5A4JA 1QV9A 3R7FA 1I01A 5FCDA 4AJ4A 4QUHA 4CTJA 4W9NA 3F7TA 1KPHA 1VIYA 4WN9A 2YQ4A 5LP6C 4KNVA 3WQSB 1JFVA 1OX6A 3CO0S 5IZCA 2WSMA 3D43A 1KTIA 1G9TA 3K0EA 2C2BA 1QWOA 5JASA 4ZMBA 4U1RA 5JBQA 3C7CB 4DCPA 3SYRA 5IYZB 5CH3A 2Z0MA 1HL7A 2FW0A 4P5PA 4C6TA 3EAQA 1G7SA 3TBFA 1ZU4A 4R2KA 4YBZA 1V9CA 1M6WA 3I34X 3KYBA 1GDTA 1G0NA 1KI3A 1WHTB 1KO4A 1MXFA 3AETA 4JEIA 4XYEA 4B7UA 3T4EA 2PKYX 3FSRA 4J0IA 4IDBA 2PU5A 2D0PB 2OHVA 4ITVA 1H22A 4RV5A 3TI9A 2FKAA 5D1HA 5A62A 1BQEA 1RHJA 3C8MA 1FNMA 1ZBQA 3K4HA 3IKMB 1YB4A 4IGAA 4G25A 2ZWVA 1JA1A 1IJBA 3U2QA 1EFAA 4XX1A 1QRDA 4CTKA 1E6CA 5K3CA 3Q5DA 2WU4A 2MYNA 1U0FA 4ILEA 1HL3A 3IAS6 5EHXA 2JGDA 3I6BA 1E9SA 2QTVB 1FXWA 3GXOA 1U9IA 1U2ZA 2SBTA 5HEKA 2NU6A 4B6JA 3AJ8A 1N2IA 3RHTA 1KQPA 2O14A 3KKMA 4URUR 1IXSB 2HJSA 3SJAA 3OTGA 5G4LA 1XNGA 3TLEA 3VH1A 3ASYA 4B3JA 4ARBA 4JASB 1X74A 2OUKA 2I33A 3H4TA 2TMGA 4K9SA 3C0KA 2HEGA 3RVQA 4K2AA 4YQYA 1OXTA 2C7VA 4TWZA 3THRA 5EKUA 3HNOA 4ZQFA 4QUJA 3DAHA 3MCVA 1TX4B 1CZUA 2YWRA 4FCWA 1IHOA 1ZK4A 5GTDA 1YUMA 1ZJJA 1E2EA 3BKXA 3JQAD 2DKNA 3WI7A 4BP3A 4EGFA 1B7GO 3BHNA 3TUZC 4LHSA 1XCGB 1WSDA 4X1IB 1LBIA 4KXLA 1SIUA 2XODA 3IMKA 3MJHA 5JVDB 1BFUA 3RB8A 2N1BA 5H68A 1A95A 5LFAA 3FCUB 1SD2A 3AC0A 1J2RA 3G17A 4FW8A 3C5WP 1ZU5A 2IC5A 3KHKA 4K9KA 1U8XX 4CCWA 3ADBA 3IX7A 4TWIA 3NT5A 3AR5A 1YIAA 1WRBA 5K8IA 8MHTA 1YQWA 4IFTA 4X6UA 2P78A 1PWEA 2P69A 2ZWMA 3KU4A 4HPXB 1LH0A 3CC8A 1T0BA 4HWKA 3W6ZA 2V9PA 4ARZB 1VG8A 4MWSA 4DBZA 3HJGA 4PIMA 4UDOA 5JCXA 1Z4LA 1HE4A 1M5RA 4LGCA 1RM4A 2XR1A 4OFXA 1IHYA 3DH0A 4Q03A 4V0NA 3RV3A 1CULC 2Y4NA 3HK2A 3NBFA 5FPSA 4KNYA 4Z7QB 3FMPB 2QU8A 1OMOA 2VSFA 4FDVA 5AOAA 4OSEA 4XDGA 3WC4A 1FJGB 4BO1A 1YU6A 4PN7A 2UVPA 3DE3X 4GBMA 4R40A 3TEMA 3H87A 4UDYX 1TFRA 5CK4A 2Q9UA 4IX9A 5LWQA 1KJWA 2G80A 1JFLA 2GCEA 2WB4A 5KJFA 3Q9NA 4MWZA 3KQUA 3RM3A 2YQZA 2O8EB 2WQZA 3B51X 1LGYA 5CT8A 2OQRA 4NCXA 3AR3A 4UHBA 3QX7A 3P7MA 5F51A 4XCXA 2HV9A 4PNHA 1K9VF 4MWDA 1YS6A 4IY1A 4ZI5A 4ZICA 2FW7A 5JECA 3IOMA 1M74A 3VI3B 2OKCA 1ZVKA 4XTCS 3QKRA 3ZGOA 1JEOA 1RPTA 2A30A 2FP4B 4JYPA 1ZUHA 2K7ZA 4B3MB 5GV8A 1D9XA 3QG1A 4AYXA 1JPJA 2IIPA 3PK0A 3HYLA 1L7EA 1FS4A 2FH5B 4N9QA 1RE0A 5BSMA 3G8YA 4AG3A 2VTKA 4IX1A 2VJDA 3GJ7A 4BLUA 4F5DA 4ZI2A 1YJ5A 1E4EB 2VCYA 4U39A 2MR6A 3WISA 1PV4A 4KJXA 4WXEA 2IU3A 1PGJA 1PUXA 2CMFA 2P30A 2Q1SA 1DPFA 1NNSA 4J1SA 4NCKA 1XYYA 2R7LA 3HBLA 3O4FA 4WCDA 5I8ZA 3S8MA 3MCAA 3NASA 4XUCA 1VBFA 1OB2A 4X61A 3OIDA 3A04A 3QU7A 5HIMA 4X84A 4DT1A 4P08A 2GFIA 2IU4A 1ESZA 3HMQA 4JS0A 3W8EA 4Y7DA 1RM5A 5CJ2A 2AFHE 3D2AA 3CX3A 3EXEA 4C4YA 2NYAA 2ZYAA 3V1KA 4CKEB 4JODA 4RFSA 2HRBA 4G4SO 2F1RA 5HKBA 1Q57A 4YIHA 2JC3A 2VOEA 4HDSA 3R5FA 3V2GA 3CGGA 1USUA 4PFSA 1CQPA 2Q46A 3DP9A 3SLGA 4RSMA 1D4FA 4MRSA 4ZHQF 4J7CA 4TMWA 3T3OA 3H1TA 5CEJA 3IKLA 2ZRFA 4QGHA 3R3UA 3SZMA 1TZMA 2FX2A 3U40A 2OD9A 3R7SA 4BQQA 4G86A 4D57A 3MJDA 5FLXA 3K6KA 1P5HA 3DTYA 3DKVA 4QIHA 3AB7A 1MOQA 1RRFA 2CEKA 2FFJA 1BFKA 1C30A 2RG1A 1W93A 2P2LA 1WBDA 1G5IA 5IKPA 1FUYB 2G8LA 2HKIA 2DECA 3IRUA 4XVRA 1PK7A 2WOJA 3RIHA 1NY6A 5TMDA 4RHEA 2O1EA 3LTEA 3PTLA 4TV8A 3HJNA 3UZUA 4JFRA 4FMDB 4I6JA 3LH5A 4R2JA 1IEWA 1Z62A 2AFHA 2VHQA 4M49A 4Q19A 2QNIA 3JYOA 3KS9A 4U63A 4Y2YA 5FF9A 4XWYA 4CM8A 1RPJA 4M1ZA 5FKJA 2VTBB 1OIVA 1MB9A 1LNQA 4PX3A 2GK7A 4RD6A 1U02A 3OO1A 4X63A 5K3FA 4E5UA 1JPUA 3C3MA 1F0PA 2WHPB 2ZJ6A 2F43B 4QEZA 3TD6A 4HBZA 3QKSB 1YRBA 4I55F 2Q3DA 5CX1B 3PEYA 2I4IA 2YZNA 5FBRB 5IFKA 3MQ2A 4NCAA 4IIUA 2B5VA 3IVMA 4RE5A 1LBSA 5DK4A 3LT4A 2IK8A 3JAWA 3CW2A 4XASA 1FNCA 1KRHA 3WZ2A 3AFIA 1XCMA 4BNUA 2OVBA 3Q8MA 3A3PA 1L8QA 1RXSA 4LXGA 4M7RA 2OORC 1Z7EA 3QYPA 1U94A 2CJXA 2WJZB 2FUNB 5HSGA 1X7ZB 2E18A 3CVOA 3GEPA 4PLYA 2GBLC 2RK6A 3EVTA 5UKDA 1ZL2A 3TKAA 3SYKA 3WB1A 4JJEA 2X0NA 3H4VA 4AMBA 4BE4A 5KNBA 1OYWA 3KJNA 5C51B 2FF5A 4TYMA 5LA6B 1JN0A 4PR0A 1MAUA 4MEJA 1FDVA 4LOJA 3M6IA 4MNTA 1SU4A 1ZO8A 4KPUA 3SF8A 3T7DA 1K2WA 1R66A 2HA4A 2K2WA 3IAUA 3L1UA 1EE9A 2I2XB 4M60A 3NORA 3E4DA 3ENQA 1JIJA 4PZPA 4RAQA 3ZX4A 4A82A 3Q8LA 5JSZA 4NFSA 1MPTA 2OQIA 2WILA 5KQGA 5L7TA 1XWWA 2ZJYA 4D8VA 2FDCA 1GNRA 3W4JA 4BKQA 4B5LA 5KWJA 1ULUA 3CPEA 4D96A 4YK7A 3EGWA 3F6CA 3CLVA 2QJRA 2QTTA 2P79A 2QW1A 5H4HA 4TL9A 5LJLA 3HCNA 1ZYUA 2AXNA 3TG2A 4A2WA 5IBPA 4N0PA 4TN5A 3QSYA 4P92A 2WYVA 3HZOA 1IB6A 4ZYZA 5MN4A 3LUGA 3KKOA 3G0GA 4O4IB 5DP2A 3ROQA 1U2GC 1Q12A 2AE1A 2QG4A 4URVR 1AHIA 5LKRA 4CXMA 1WY5A 3CNLA 1RLOA 2PEZA 4PSAA 4WNAB 4TMZA 3ELDA 4BWGA 2WT8A 2P65A 5A0FA 3UYKA 3C3WA 3QSGA 3CN9A 4RTQA 1VP9A 1COWD 4A8JC 3IJRA 4IKEA 3LQRA 2NQ2C 3I1IA 3GH3A 4OK5A 3M81A 1XDSA 1IN6A 4CF6A 3K4PA 1LDNA 3BX1A 5AW6A 2PX3A 3AEUB 3E48A 3DHWC 1FX0B 3INGA 5I9NA 1TMGE 1TM4E 3EHDA 4LHEA 1KAQA 2HF7A 4NNOA 4XQCA 1O94A 2NZVG 5LUAA 1FTNA 1O87A 2H48A 1XAGA 2G1AA 3VZQA 2Z98A 3S68A 1SZJG 2EKDA 1WUJS 2OE2A 5B57C 2O8BB 4JBLA 1T4GA 4EHKA 4AS1A 5E6RB 1WMFA 2HWKA 3NHZA 1IQPA 1N8NA 2Z8XA 3IXMA 3OO0A 4JNCA 4DA7A 1L4GA 1C0IA 5C81A 2P1ZA 3KVYA 4J0FA 4PYLA 1RI2A 4G89A 5IH3A 2GKOA 1H5NA 3X3HA 3ZS8A 1JDTA 1QAQA 2BGLA 2PR2A 1IZ7A 2O6LA 5G0SA 4COKA 5LQJA 1UZMA 2QX4A 2F2TA 1KMNA 1UUFA 1J9ZA 1JUDA 1LPOA 1MJFA 3KYDB 4L0MA 4NOKA 4RPLA 4XGKA 2AJBA 4AKEA 3TRDA 2DPHA 3OPMA 1RKXA 2AFIE 4JVMA 1EK2A 2N0SA 3PEWA 4RJKA 1L9KA 4PQGA 3PXGA 1TM7E 2EKQA 3EPKA 4UCWA 3EK2A 2LXNA 2ZIZA 2G07A 2RIRA 3NANA 3KX2A 2FW8A 1DBQA 4YT8A 2YUIA 4EENA 3JWEA 1ND5A 3ZXYA 3OP4A 4Y9TA 1LVHA 3DVAB 3KOMA 2WD7A 4HGNA 4ENVA 4S1NA 3PQEA 1AGYA 1TYCA 3DPUA 5DH9A 3QFCA 5BQ3A 3WYCA 3BMOB 1WCYA 4WLOA 1WMBA 3DKKA 1Y81A 1SOWA 5CDHA 4KV7A 2AYZA 2DR0A 1U3GA 5BMVA 1OBOA 1BHO1 2WM3A 4HZUA 1JFFB 3KQVA 4ZWNA 3W9YA 1D6JA 5A6SA 5IABA 4OH1A 4PW0A 3QFRA 4ZV9A 5A4MS 1CWUA 4LC0A 3E2IA 3LNTA 1I7SB 3K0AA 1E3EA 3HPQA 1M2HA 2WSYB 3UMCA 4DIEA 3SEQA 4IXTA 4JGIA 4EITA 3KR2A 4OHRA 2JANA 3FPFA 5KTPA 1GTVA 1NT4A 2EZTA 1AE1A 4IICA 4LC9A 2Q6KA 1G8JA 1QGOA 3OJEA 4IH9A 4OXNA 5B7NA 1NVKA 1DX4A 3FBWA 4MWBA 1M33A 4YT5A 1V43A 4UTOA 1LU9A 2ZRKA 3W6OA 5B5SA 2DBVO 2WT9A 2BGTA 1D1TA 3BS4A 3C7TA 3E84A 3ONWA 4IMJB 4XSGA 4IJQA 1FY2A 4KIWA 1C1DB 2G71A 3UAWA 1HMYA 4OJTA 3BIOA 1RAGA 3G5AA 2CHVA 4AZTA 4ZYYA 1LW7A 1S5PA 4FXOA 4TROA 4S0ZA 1OI4A 3WK4A 4EAAA 4JJ4A 3SYMA 4WY5A 2HAEA 4LDPA 5DPMA 1A4XA 1J09A 3PLNA 3TM5A 3BE4A 1Y3HA 4BN0A 1YNOA 1HEYA 2YOHA 3RF7A 3G8AA 1L1RA 2Q3JA 1G2PA 3C3YA 1ZL0A 2WSIA 4AUKA 4D97A 1C7FA 2WYHA 2D8MA 3JATA 3R9XB 1G3UA 3ZQJA 3JQGB 4LC1A 2B99A 3RSZA 4ESVA 1W2WB 4E5DA 2XUZA 3URMA 1ODFA 4Q21A 1SCUA 2Z9DA 3THWB 3PDIA 2ZYHA 5CDSA 3AVXA 5HUJA 2IHUA 3C3EA 4RZSA 1GRRA 3IAEA 2GPJA 1PR2A 2QL7A 2HU5A 2C8JA 3BSSA 2XMQA 4G5HA 2XVZA 4XD2A 2V58A 4ZXFA 4ZVTA 2FN9A 4KN5A 4F5ZA 2XZLA 1T2UA 3OBIA 3I0ZA 4GZ6A 2ZT8A 2HLHA 4HNRA 3TJZA 4PX2A 1SK8A 4BX3A 2G5GX 4FYMA 5F77A 1IOLA 1Z47A 2FQWA 1QYVA 3H5WA 3QBDA 1Y6FA 1WXDA 2HY7A 1KDYA 1CF4A 3T3HA 2XGOA 3N28A 1VPLA 4CT5A 3ND6A 3LV8A 1MABB 2G4LA 3ICEA 5BURA 5KYUB 3P2YA 3VZSA 3Q4GA 1YKFA 1H94A 4TLCA 3S40A 4W1RA 5ES4B 4QNMA 1DC4A 2VYCA 3CZCA 4P58A 1ZA2A 4GHWA 3WDLA 4QXQA 1F7VA 1FVHA 3HA2A 5JSHA 3FUXA 1KYVA 2CW5A 4NI5A 1GPLA 1I2MA 1U3UA 3OA0A 4C5AA 4W5NA 4ZYVA 1RQ7A 3U6BA 1RCUA 3SSNA 4MKZA 4N8SA 4V0LA 5HE8A 1FIUA 4IKPA 5LZ7A 3ZWQA 2Y9MB 5TQ2A 2FEMA 1QOPB 1TZ2A 2QI9C 3EDCA 5FQNA 1UCFA 2YW2A 5E6SA 4KR9A 3PF8A 4PQRA 4FLMA 1MF7A 5EJAA 4AFNA 1Z82A 3FYDA 2FRXA 3IIKA 2Q8NA 1T10A 1RW4A 1L4UA 1M76A 4ZQGA 1G3IA 1BJRE 1E3SA 2G77B 3OQIB 3PCRB 2ES4A 3I2JA 1AV6A 2P9ZA 3O82A 5JQWA 3HWWA 2WQ6A 4FTWA 2IF0A 2QVGA 4NBWA 2UVDA 2B3DA 2OECA 3THYB 3BULA 1AT1A 5FFMA 3UOAB 5C1BA 1S7GA 1ILEA 1F5SA 4BLTA 3BK1A 3GU3A 3BZWA 3K0SA 4WXPA 3TJRA 2W2OA 1RYYA 1WSWA 4EQ6A 1AKWA 3D8SA 3NDJA 5LLDA 1FMTA 2VQEB 1IXZA 4NY1A 1LB1B 4GKVA 2HT6A 2Y2VA 4GWKA 5AI5A 1QFYA 2C4UA 1JWBB 3ON5A 2WJ4A 1UDRA 3SQOA 4GL4A 3BH7A 1X80B 2IZ0A 2ZJFA 4OMUA 4R16A 3EIQA 2HD4A 1V48A 1URPA 3Q10A 1YJ8A 3G2IA 2ZSIA 5M3BA 3RASA 3WRVA 5EHQA 2I8LA 4C2BA 2WBLC 2JFBA 1CU1A 3JWIA 3LPMA 1PFWA 5D5QA 3QVLA 4LGMA 5KYGA 3G9TA 4FYHA 4LJLA 2RKOA 5F4ZA 4PICA 2ZROA 3MGGA 4BAUA 4EA6A 3DOUA 4JLUA 1NMXA 5B3KA 3ZXSA 5FXMA 3X2EA 3OM8A 1CF9A 1SHUX 3U13A 2V8OA 3PPYA 4E11A 2PY6A 1E9CA 4EY6A 1QFJA 2CJWB 1SVMA 1MOZA 4YRGA 5E95A 1UJBA 2WF5A 2HA5A 3VKWA 3BTSA 3ZY6A 4PZYA 3NHPA 1YFZA 5CCEA 1RC0A 2F62A 2PRIA 3ZY4A 1CVIA 1SCJA 4TYYA 3K0CC 4G41A 4LG1A 4MH0R 5HFJA 5ERYA 3D5TA 3FHTA 2VNKA 3ORQA 1KP9A 4WA8A 5J2UF 1UBJS 4WXHA 3UHAA 4F93B 5DN6A 4ALLA 4Y67A 5CYFA 2FLWA 3HMKA 5IT0A 2UZAA 1ZNXA 2PS3A 4NCBA 4LBWA 1UWVA 2VJMA 3GYGA 2JDID 1CY0A 3OECA 3O2SB 2F9FA 3P5BA 4L74A 4ND1A 5EPOA 2WFLA 3O8OA 5SZKB 1F2TB 3PYLA 4UUBA 5A9TA 4TPKA 3LS2A 2DPXA 2FMTA 1LQ2A 4ZI7F 1IZZA 3KD2A 2G06A 4IHJF 1M0TA 3IYLW 2J59A 4LJKA 3FB4A 3Q8WA 3VC2A 1H4SA 2XE7A 1RWMA 2XYPA 5E6UB 2DAPA 1RAIA 1QVRA 3M6FA 1NW4A 3QHAA 1Z07A 4WQMA 2QD2A 1T1RA 4G36A 4DCTA 5KC8A 3D3KA 2FSIA 1J0XO 2GCPA 3RFVA 4JL5A 1MNAA 1D2AA 1T5LA 1WXWA 2XJ9A 3QWBA 3THXA 1AA9A 1AQLA 1EINA 1DC3A 2FKNA 4Y1GA 4WV3A 4HDNA 3TDNA 4ERXA 1JG3A 1NULA 5LP6F 1RM3A 4UBIA 2IYWA 3SK0A 4DUGA 2HMUA 3VV2A 4XOIA 1PWHA 4L07A 2HRDA 4KQHA 1V39A 4XARA 1XVTA 4OGFA 3PUHA 4BMOB 2E1RA 1NJSA 3UN1A 3AUTA 3ANXA 1UKCA 1TYDE 3KT6A 4CF7A 2GJKA 2FR0A 1U9JA 1AB6A 4H4EA 2EG5A 2ZDGA 3PFCA 3BHMA 3CRW1 3BA6A 3ROZA 1N57A 3TRKA 3UY4A 3TQSA 1XHFA 1CR6A 4JP8A 1WV0A 5E2IA 4MVJM 1L0BA 2BBWA 2DUUA 2GCNA 3MB5A 3HZRA 1GKLA 1S8NA 1W581 5A1TA 3HJBA 4O4LF 3ZQ6A 3NHFA 3CMMA 3PDJA 1IG0A 1ESMA 4WSOA 3VHRA 4RZIA 2Z3WA 4RU1A 2O7SA 5BSRA 1GN8A 4KVFA 4PYKA 1M83A 1IUNA 2HWXA 1CVRA 1S7CA 1N6RA 3V8PA 4AZ3B 5LMCA 2JW5A 1G6HA 5IAOA 3BXEA 4MKRA 1WD5A 3GUUA 4QU5A 1K9SA 1AQJA 3NHRA 2PUEA 2HBZA 3W2EA 2EP8A 4ER0A 1QH0A 3QWIA 4E03A 1O8BA 3GLHE 2FR8C 4N76A 1FSPA 3FDZA 3K94A 4H0CA 5F12A 3GA0A 2BD0A 1Y37A 1U9YA 3BHIA 4G26A 2G0NA 1SXHA 3IAHA 1IJKA 2JHGA 5G40A 4EIWA 3OHPA 2WAYA 3WO0A 1NZJA 2F48A 2QX6A 3FWPA 4FGUA 1QRAA 2PUVA 5BXYA 5FBVB 4WKNA 3D5QA 1F8XA 2OWEA 4I66A 2TRSB 3N0VA 2ONYA 5EP2A 3AEXA 2REQA 2HWWA 4YBRA 3WQHA 3FAZA 5H3HA 2DU8A 3QGMA 2VPWA 3GGJA 1H3EA 1U0EA 3EUWA 1HV8A 1QPBA 5BN3A 1PSZA 3ZS9A 4GC9A 3PQ7A 1L7VC 4WW0A 1KY3A 1UK8A 4TRNA 4ZMSA 4FW9A 5ADHA 1CDEA 3GFRA 1MKYA 1ZD5A 4FZJA 4L2IA 4CFZA 1T3ZA 3AESA 1J33A 1PZGA 2X1LA 3IUSA 4G24A 4RVFA 4XI9A 5M34A 1KZ6A 2H92A 5TIIA 2JFPA 2MHCA 4Q9NA 3WDKA 5C8DA 1RZRD 2VDMB 3HU2A 4MKXA 5A7GA 2VK4A 2W2TA 3Q3VA 1XZLA 3QK7A 3QP9A 2A78A 2W6OA 3CF0A 2PLAA 5J9FA 2A94A 2FW9A 3DZIA 4AXXA 4H7HA 3UK1A 3FCYA 1W9MA 4ZAZA 3GPDG 2WMOB 2B78A 4ZU6X 1E2PA 3SIWA 5DCYA 1F0NA 4WVFA 2E5LB 4ZK2A 1ZIPA 5EXSA 1EIWA 5G4KB 2FQQA 2AW5A 3KKLA 4MMXB 4Q4LA 4NMXB 2ZYIA 3UPUA 4HS4A 4QGBA 1HQDA 2W8ZA 2RJOA 1LF0A 1DADA 1LC0A 1N9ZA 4MS3B 4UCXA 1HDIA 3DBVO 3I39X 5HILA 4R68A 4EKEA 1GCAA 2IZ7A 2JZNA 4EDHA 3P4UA 5JEDA 3UJPA 1EE1A 2QM3A 4BY9E 3V42A 4LYHA 3D6AA 2NVWA 3O93A 3H83A 5G2OA 1MW9X 1THZA 5FWYB 1L7XA 5CA0A 5HGXA 421PA 6NULA 2G9RA 1SOVA 2I3DA 2VTVA 2XQKA 1LPSA 3F7MA 1BW9B 4Y6OA 2Z3ZA 2JJMA 2B2XA 2PX5A 4NV1A 1O5IA 2EWWA 5H4GA 3D31A 3ZBTA 2HX1A 4QYIB 2AG8A 5KQLA 3QLTA 2UUAB 4F2WA 4KP7A 3HKEB 4JLWA 1U3VA 4OLFA 1MRNA 2WPDD 1ZJ6A 4YC7A 1JDBC 2C1ZA 5CNKA 4LYDA 4QHTA 3AB3A 3TNYA 3U3OA 2Q5HA 4TXNA 3F46A 3RG8A 1SK9A 5LZ4A 2A58A 4E2FA 5G41A 4HXYA 1BMDA 4DG9A 1LLDA 3RO7A 1QQTA 2HZBA 2OZPA 2ZPUA 4Z0HO 2WNHA 2J7PD 3C1OA 3CKYA 3GJYA 4LRQA 2GKGA 3H11B 4QXRA 1PAUA 3AHGA 4X62B 2GM4A 1UMKA 3ZGYA 2RHDA 3ZE0B 4AQ7A 1AX9A 2A1TS 1RTKA 4BNDA 1O95A 5EWLB 4EAQA 4ML3A 4B3BA 3RUEA 5C8YB 1NUTA 3Q3JB 1KMMA 2EBHX 3OZSA 4HAOA 3UAOA 2VK1A 2R1VB 5ALTA 3STUA 4AMUA 1XF9A 4GYWA 1P4SA 1MT3A 2JJ1A 5FFNA 5LLSA 1USKA 4UVGA 1SXJE 2Q6TA 5TPWA 2AV6A 3ZZTA 4DMRA 1H93A 1QH1B 5EJ7A 4R8KA 5ALQA 2P9CA 4GPZA 5DLPA 4NABA 4K3UA 4IJWA 1I33A 1OIXA 2PN1A 3HCAA 2C9OA 4Y9UA 5FPQA 3U4CA 1DJPA 3CLHA 1VG9B 2MOKA 1VZ3A 3HN2A 3W5BA 4ZAYA 2JCSA 5DLDA 3HB5X 4HUTA 5BR8B 1REQA 2R1TB 5GM1A 5TGTA 4Z9AA 4BMZA 4Q3DA 3ABOB 1IBRA 3MXTA 5ALHA 2QVCA 2N47A 2X6QA 4MVJD 1EMDA 3WGUA 2PKCA 4DV7B 5A5EA 2JAHA 2GYWA 1II8A 3ABIA 2NNLD 5JDCA 2D5CA 3SJUA 4CQLA 5KNCH 1VXRA 4RORA 5JAQA 5LPNA 1L5SA 5JANA 2VNIA 3WLJA 4QECA 1I3NA 4WNCA 4ZU1X 4EJSC 4GMDA 3KT8A 1G9SA 1ZICA 3PPVA 1TKAA 4I19A 2VUIB 3SX2A 3UKJA 3K70B 1KYQA 3W4KA 5I45A 1IEXA 3S2GA 2QV7A 1ACLA 4BNZA 2QRVA 4J2HA 4YASA 3KXIA 1JHPA 4JUCA 4ZREA 1VA5A 4OUDA 1LDMA 1TK2A 2PD6A 4YV1A 4Z3KA 4IF6A 4XQ0A 1V47A 2DH6A 2CL7X 5LJIA 5KYYA 4MJ3A 5HM8A 2G1UA 2A35A 2FAXA 2R6AA 5J1SB 2ZUDA 1KSFX 2QUBA 4OAQA 3GPLA 2Z43A 4ZIRA 5AFSA 1I1OA 1M1XB 1CFJA 5FTMA 1Q7CA 1XIVA 1QCYA 2I78A 2DVMA 1YJXA 2UDPA 2WABA 3L0YA 3RFUA 1INLA 3B1YA 1T9HA 4AKTA 2AJ8A 2VDVE 4AB1A 1FE8A 5U4QA 2VZ0A 2YN0A 1O57A 2O07A 2F8TA 4V02A 3RRNA 2ZE7A 3FTEA 3PEEA 2YFYA 3ROKA 2NZYA 3ICVA 3SJ7A 3UFBA 3SKVA 4OJKA 2JKVA 1RPAA 4U00A 4FKBA 3BYZA 3TR6A 4CBVA 1GTJ1 2I6UA 1QB7A 1AY0A 1ODLA 4LI0A 1YS2X 1OKKA 4LQ4A 3M82A 4S05A 3I12A 3LOUA 2QZJA 2JLUA 4U7PB 1EKXA 2YRFA 4RFLA 2DTDA 4M9XA 5K4GA 5TT0A 2VCHA 1JX6A 3FWKA 4DBLE 3P96A 5I7RA 5DO9A 4URYR 2G0TA 1GSHA 4D5EA 3L0PA 2VWQA 4F4IA 2I2FA 5T5QA 4O25A 1ISSA 4AC9A 4ZKDA 2Z9BA 5FJIA 4RMJA 3I5YA 2O8DB 4WFJA 4I8IA 1DQPA 3OBBA 3H1AA 3PHCA 2DFTA 1G63A 4CI9A 1JNYA 2H3HA 4OU4A 4BZWA 5K03A 2ZT7A 2O2XA 3KELA 4OL9A 5JS7A 3CRVA 5IT5A 2HHLA 3KTFA 4FCVA 4Q15A 1TIKA 4UCQA 3ZHYA 1QLWA 1GP2A 1UZLA 2F7SA 3GNLA 1ORTA 4CM4B 5DTJA 4CETA 1NL3A 5AR1A 3UH1A 3VNSA 4D6YA 3KZOA 3OLVA 5BPFA 1CNMA 3QHQA 4TMTA 2HZ7A 2X2OA 2OO5A 4FR0A 2ZITA 5A2GA 3NEJA 4X41A 5EIBD 2IWRA 1QGYA 4QJIA 4AS2A 4LYEA 2RB5A 1MB3A 3QQ5A 2BC9A 4UDNA 3WJAA 4JROA 2IV3A 1VTKA 2WJIA 2B1QA 2BUBA 1EUCB 2Y92A 2ERXA 3W5UA 3I2HA 2DR2A 1ZH6A 3RU9A 2JLQA 3GJ6A 1MB4A 3IA2A 4NENA 1TJ4A 3WDMA 5HDBB 5DM1A 4HX9A 4W7IA 4XH9B 3KZKA 3DAOA 2GUWA 3UUGA 3AZOA 4Y30A 4AF8A 2R11A 4LJ7A 3FSGA 2XEXA 3MPOA 3EXIB 3G5MA 4WRRA 2QTMA 5CW1A 4NAHA 3E58A 4HEA6 1I1NA 3IUPA 3NGLA 1G4HA 1FU7A 3MINA 2ZBPA 2FDRA 3PGKA 2DCUA 1XZHA 3IOCA 5KAMA 4WTOA 5ITZB 3TZ6A 1DGQA 4G1BA 1EFVA 3E7FA 4DDHA 5DI3A 3GJ3A 1CUBA 1EFLA 4JLPA 5FBQB 1G38A 3I6IA 3NZEA 5AK3A 1J22A 2R2AA 2YRWA 2FN3A 3F8TA 3R0JA 4FJ1A 4M22A 4C4TA 3OU6A 4LJ6A 4JN6B 3MRXA 4RV9A 3WBBA 5GGXA 4BV3A 1H4TA 3R2JA 1DC8A 2X19A 2YHUA 3M3HA 2D59A 4AL4A 1K5GA 3DNPA 1E0KA 2XX3A 1JA0A 1RQXA 1HSOA 3PNOA 3KKPA 4NH4A 3J81A 4CIYA 1EWKA 3JZMA 2CFOA 4OSPA 3LP6A 5FIUA 1L5LA 1H3NA 1P39A 2I1VB 4I50B 1TA4A 3GW8A 3M70A 3PUXA 4ZJUA 1TZJA 4EO7A 2I65A 5T4FA 4DL9A 4GVPA 3AYZB 2XE6A 5K3EA 4GF5A 2O2DA 3WLPA 2V3WA 1JNXX 1VL6A 4ZP1A 3I28A 4DLYA 1QHSA 4WADA 5TF4A 3G5TA 1E6WA 1EG7A 3HUTA 4C0QC 1QRRA 4YYZA 3UJCA 2XUFA 1RYHA 3GLTA 4PRKA 2XB6A 1T4MA 4LDRA 3MJFA 3DT6A 3GRVA 1P4RA 2ZM6B 2HF8A 1BKSB 3FJ1A 3L8MA 1MGOA 1XV5A 4WBSA 1ZPDA 2NU8A 1DXHA 1GCUA 1VIMA 3IBCA 4G9EA 2HA7A 1ZRHA 1JPNA 2LTAA 1UT5A 1IMOA 4M0PA 4DA9A 4RO0A 4ZOLB 4ZJYA 1QRTA 1H8EA 4R1LA 4Z9YA 3MRVA 1PEAA 4NOJA 4CN8A 3I6QA 1GRCA 4M0LA 1S6YA 1RLJA 4RVCA 1PJAA 1CG6A 2GEVA 4FONA 3WGHA 1AQNA 1SH7A 3LW8A 4KFSA 1WB9A 4QXOA 5CFZA 4OATA 1KVTA 1X8LA 4BZZA 1P2GA 5EIHA 1PFVA 1JEJA 3GAAA 3SG0A 3LYLA 1F6DA 4C01A 5CEEA 5L9AA 4EF6A 3A25A 4FZ3A 1H6DA 1Y3BE 1PS0A 2P9BA 3STWA 4KBFA 3ZJ4A 2VRBA 1IXRC 4YP6A 4AN4A 1W7AA 2B4YA 3BTOA 2P6OA 3ZI4A 1J42A 4HGOA 2IJGX 4AICA 5TMBA 3UHPA 3AEYA 1G20A 1K6MA 1E60A 4YRBA 3MWDA 3NEPX 1OILA 3D8BA 1R1DA 3ACDA 2BFPA 4M8SA 4N47A 3VR3A 3T3NA 3ZOZA 1EUQA 4MLZA 4X20A 3WB0A 5BYBA 4Y6RA 2FZ4A 3OZ7A 3PA6A 1P7CA 4I5IA 4FU0A 2Z4RA 4RABA 4DTCA 1JF8A 3DC2A 1JSZA 4CV2A 2R6JA 5C7OO 3OJCA 2GZHA 4B4WA 5LQMA 5IM4F 2JLYA 2DHQA 4QTXA 2ASVA 3R5HA 5K3AA 2C2ZA 2Z2IA 4RACA 2JI4A 3QTTA 4Q1EA 3FOBA 2AE2A 5FPTA 2EFYA 2ZJ7A 1B6RA 3A14A 2PEYA 2XMZA 3VU1A 2HXGA 1QU2A 5ALNA 4LTNA 4QQFA 5HOQA 2R6DA 3F3MA 3HTXA 2H31A 4CEIB 1HFEL 3ITNA 5HKKD 1KI1A 2CVQA 2C42A 4UQLA 1PFKA 3CFYA 2PNJA 1NONA 3G89A 4KWEA 4YYEA 2Z6VA 4JP5A 5JJCA 1ZHHA 3JALA 3IDSA 4US1R 5EUBA 1C0EA 3MHPA 3R4VA 5F2NA 2E5FA 2QEQA 1TCBA 1IBKB 3GEBA 2RMKA 3RYCA 5AHWA 3SS9X 2XHZA 1WLYA 4B8YA 1B6SA 3KUKA 4I14A 4YRSA 4Q02A 4DYDA 1I2ZA 3EZNA 4ZCLA 4DYVA 2PWAA 4BJ1A 4PANA 1DAFA 5E7QA 3UVEA 3QU5A 3RAEC 5A0TA 1GL7A 1HYQA 1L4YA 3HWRA 1FDOA 1THGA 5T8KA 4BVBA 3W90A 1JLHA 1V7CA 2AD5A 3HXPA 2WJ6A 2WFZA 1ZN9A 3ENNA 3O03A 4RMGA 1QWSA 3SZGA 1N6NA 2QI9F 1CR4A 3O94A 2UVPB 4FDAA 4HG2A 4NQZA 5CT4A 4CMKA 1UMDB 5CXQA 1EAYA 2A92A 3GVXA 2CBXA 2ABWA 2C4MA 2V7QD 4LDJA 4Q1BA 5AKGA 2W2MA 4YA6A 4Z3DA 2W2PA 4E32A 2CVFA 4HLQB 4DCGA 5JW6A 2FMXA 3L4EA 3L7NA 5LQAA 3Q6IA 5BSVA 2GK6A 5KTMA 5AOVA 1IHXA 3NOOA 1TCVA 4HNAA 1R8YA 3G2KA 3ZWPA 1GZUA 3ZY3A 3H5VA 4LKRA 1PK8A 3VU3A 3G2QA 3WXMA 2G9UA 5FTLA 1VL2A 1DEOA 3KEQA 2X3FA 2P2ZA 5KQRA 1KI6A 3SICE 4UM8B 1DEHA 3HSKA 3FW1A 5ED0A 2Y2UA 3ET4A 3EWNA 3FETA 2B4TO 5K2MA 1VHTA 2F8MA 5FUQA 1OF1A 1V1MA 3QKRB 4I4CA 5EHIA 2OLJA 1GTZA 1MUUA 1DCKA 1DUVG 3LPDA 2OZLB 4YJFA 3U3JA 3KKQA 2YWGA 4B3IA 4RCVA 2WZQA 4EHDA 2K7FA 1E1QD 1OREA 3QKTA 5F2KA 3E6AA 5EKSA 4N5NA 3SBXA 4B35A 3DBRA 1SQ6A 1XCPA 1T0JB 4MW1A 1GPKA 3NHKA 3MTJA 5CLHA 4Z86A 2G72A 3LC1O 3SM9A 1J2UA 3VKHA 2TECE 3CF4A 1B6GA 4DLXA 1GTRA 2WTNA 1BEZA 3AF1A 3AF2A 2CZQA 3HKCB 3RS4A 3ZVKA 1HFWA 3U3KA 2P2GA 4CJXA 1W1UA 2FZCA 4RBNA 2YVLA 3A4MA 1OAAA 2D06A 3K70D 3ZDYB 3PEVA 2JCXA 4FFOA 4KMOA 3WK5A 3O92A 3ZD9A 5BYKA 3CA8A 1XQYA 3SHVA 2IF2A 2WMNB 5BOSB 3HP4A 1NOKA 1QUEA 4KO2S 5K3DA 4BJ5A 4EPXA 5JSKA 1A7KA 4U7WA 2OGTA 1H2AS 3A2KA 5BSTA 3GUHA 1R4MA 1KC1A 3LQ1A 4R1OA 2DETA 4NDZA 4M1WA 2FG6C 2MMGA 3O7WA 1EM8A 2Q5IA 2QR2A 3IUMA 4GQAA 4HUQA 4I1VA 5CP8A 4F56A 3HO8A 4O2LA 4MRMB 3OFJA 4TUYA 4MULA 3ESCA 4BO6A 4UFOA 4RTLA 3WGTA 3UBTA 2IUEA 2A86A 1VDMA 3E1GA 2CVHA 5J1TB 3SX4A 3TOVA 3ZC3A 3AKDA 1X86B 3KM0A 4DLZA 3M49A 3VTKA 3O9VA 1T0IA 5FUMA 4EY7A 1RC1A 1SPBS 2JFGA 3JWHA 3PXCX 2GF9A 2B83A 2AQIA 3K16A 4CM9A 3PE3A 3FNRA 1XTRA 5I8PA 1J56A 6CHYA 1O96A 5JD6A 2Y0CA 3WLQA 1A4IA 4HEHA 3WJ2A 2F67A 2BFFA 4Q7MB 1SU7A 3WLOA 1SKAA 1S9DA 2FXVA 1SIWA 4LRSB 4BB5A 1XVUA 1CRZA 1U8ZA 3DDOA 3B36A 4C3ZA 4K1XA 3ECAA 1C30B 3TMAA 5I4IA 2EEPA 3RNLA 4BX0A 5BYAA 1VBKA 3PGXA 3ZV3A 5LLTA 1Q7GA 1RRPA 4CMEA 3WRXA 2H85A 2R5FA 5CFQA 5CLIA 3L2OB 5BN5A 1E2HA 3T5CA 1KQNA 1EQAA 4XA8A 4TV8B 3USCS 1SVUA 1Z2EA 2ZI6A 2ODPA 4LV6A 3DT8A 3WMWA 5JS8A 2RBEA 4I3GA 5AKIA 4YMWA 2NM0A 3DUFA 4Y2TA 1T35A 1IOZA 2M1ZA 1XMIA 2ZJOA 3H1GA 3IOEA 4P84A 1NATA 1PR9A 1VPDA 3CSSA 4QNRA 2FPLA 3MA0A 1T9DA 1KK0A 2OHHA 5DSZA 3OUUA 2RKBA 2R86A 1XAJA 2XE4A 1QPZA 2F59A 2JGJA 2WUFA 3WYAA 1U5BA 4JR2A 3NYIA 3UMJA 5F4BA 2WF8A 2C9BA 1AQIA 1F9AA 1I4OA 1S4MA 2FI1A 1KL7A 1KEUA 3LUPA 3VRHA 1N5IA 3X2FA 4B33A 1GGEA 4MP6A 1A0OA 4TMVA 5HYVA 4P33A 5MGBA 3S29A 4LOKA 5H81A 3JAWB 1T24A 1L7RA 3C6BA 3PNVA 1ORVA 1Z17A 2BGJA 3L6OO 4I81A 1C41A 3MT9A 3WBJA 2XDYA 2P11A 1EFKA 1SAYA 5F2EA 4EG6A 5DHAA 3KZVA 4HRAA 1FRZA 5DXAA 5IBCA 3AHJA 4RH1A 5BWCA 1CDZA 2V7TA 2NTNA 2VHZA 2XXJA 3WK9A 2AI2A 1SCKA 3H99A 3NB0A 4K88A 3D4OA 3MMNA 5I7OA 2Y8EA 2QYTA 4ARIA 3EMBA 3MB8A 2D62A 4B3FX 2H08A 1G18A 3L9XA 1OCEA 1C9NA 2QTFA 1KAGA 1CUCA 2XRMA 2YMLA 3NONA 1YB2A 3STYA 4EUHA 1F12A 3BJRA 5K51A 4CRWB 1TZKA 1TJNA 1E4VA 1W0CA 2Z08A 4EJFA 4BGDA 4XPIA 3VHXA 1ETHA 1Z0KA 1DBRA 2QM7A 2CSXA 2OYCA 4KPYA 4Y1EA 2IP2A 2CC2A 4KG7A 2RHHA 2OSBA 3AV0B 3FN4A 3FPEA 4G85A 3RQSA 3SQWA 1B0ZA 1Q1GA 3B1KA 3N8IA 3O8NA 3QWFA 4C21A 5JSZB 1XCLA 1XRNA 5JJ5A 2FWMX 4WX2B 1P45A 3DBLA 4YMTA 4INZA 2EJTA 3RHSA 4OGLA 1YZQA 3AKCA 2OENG 5A3QA 2O8CA 1RXVA 1DLJA 1LX6A 1PHRA 5EE5B 1IQUA 5FLYA 2X9GA 4MCAA 4TL7A 3PC2A 1BEUB 2CFRA 5C1PA 2ST1A 3S2YA 2A1UB 2WZDA 3SVTA 3ZGZA 5FOXA 2H1WA 4M8IA 2WIBA 3D2LA 6AT1A 2QTWB 2XKKA 4CR7A 5FWAA 2NVBA 5ICGA 1U28C 4NG5A 3AL3A 2ID7A 2OCYC 3BMQA 3OX1A 4Q48A 2AEJA 5C5DA 4EA7A 1VCNA 3PHJA 4XRGA 2C07A 5DGXA 1V5WA 3NOVA 1P1FA 4HTAA 1H9AA 2EKBA 3ROFA 1R0CA 2COUA 1HT0A 2FWNA 3SX0A 3VZDA 3AXTA 3JWJA 1SRRA 5CNMA 1MQSA 1TRKA 4QOEA 4F7DA 3UPDA 1U80A 2FGKA 2OM2A 1PJSA 4PN3A 1XZMA 1C8BA 4YDQA 4MUGA 1PQ4A 3Q7PA 1R74A 3PC8C 4GXNA 4WI1A 4DDMA 4ETIA 4DV6B 3DHVA 3CUWA 3M6VA 5IP5A 2VP2A 4JC5A 3ZE1B 1Q19A 2J09A 2BMAA 1ZMRA 3IV6A 4MGEA 1RVDA 4AT1A 4GOJA 1EVYA 1IN8A 3K7EA 4E5KA 1FNDA 1ZQ9A 2UVQA 3FZYA 3EY4A 1E6KA 1QGDA 1MN6A 4Y18A 1P9WA 1FNSA 3NOXA 4YAIA 4DQUA 5IJ0B 1U6KA 3TIXB 2I6GA 4YROA 2B69A 2Q2VA 2VEDA 3FFBA 3LLMA 1E6UA 1ZFNA 2IOQA 2UUPA 3PFNA 4JOSA 4RJIA 1TTQB 5BWLA 1UADA 5E0KB 2WTXA 3QM1A 3WKBA 1G3MA 4JGBA 4KIUA 1XD8A 4NCNA 4O4HB 4OHBA 5LYYA 2J5BA 4NU5A 1SHLA 1Z0JA 1VCOA 3FKSA 2BONA 4WCFB 2Y1CA 5ALEA 2ATVA 1KE2A 4RA6B 2WG1A 4MLDA 1O97C 5D01A 2P2DA 4C29A 4Y2SA 1YE3A 1V3VA 1X7YA 2QXTA 1N1MA 5JSFA 4DADA 5IXYA 2EGGA 2FQYA 3AFHA 3LLSA 4QZVA 3L6DA 2DGDA 1NMSA 3I9LA 3TW0A 3FVQA 1RQNA 2CK3A 2TYSB 4LJRA 3OM9A 3I9OA 1F0KA 5LVAA 4L76A 2ZULA 4RY9A 3WGKA 2C9MA 4RS4A 2IQIA 1Z2AA 1YQ9A 3BERA 4GNKA 4IUCS 4PLCA 4F4UA 1P7PA 2V98A 3HKBB 4K9PA 1I2AA 4HWOA 3W2GA 4DUZB 5SV2A 3ILXA 1C7IA 1X94A 3I4LA 1XR3A 2E4ZA 4KLRA 3KB6A 3T7CA 4EKNB 2ZVQX 1HDEA 3CG0A 3D7KA 1HX7A 2ZQYA 1T0HB 1U98A 1VE9A 2EX1A 5F3WB 4YJ3F 1L4EA 1S01A 4PBTA 5A6SB 5TQVA 2ERCA 3R7AA 3KO8A 1XZFA 5DT9A 4EO9A 3O21A 2CE2X 1UKEA 4ITRC 4JD5A 2ZUEA 2ZTUA 3QE0A 1RRVA 4I1PA 2RK4A 2UYQA 5EMJA 3DBOB 4TZ6A 3EFOA 3QLUA 1TK9A 3L9WA 4P7FA 3LO8A 3NC4A 3QVKA 1HE1C 4DB4A 4Y0AA 2K5UA 2Q4EA 2QJOA 1DTWA 3CUTA 4M0MA 2GAOA 3NT2A 4KMRA 3V7NA 2O5CA 2VDWA 1HNNA 2V54A 4ICIA 4KACA 3I23A 4R3UC 3K71B 1D1QA 3KHSA 3GXBA 3ESBA 1GNQA 4C04A 4EJ6A 4CCYB 5JRDS 3PHLA 1M0WA 2FWIA 1PJ4A 2BGUA 2NPIA 4M1OA 4FYYA 3SKYA 1HE2A 2HMYB 1Y8RA 5EQTA 4FFDA 2BFEA 4M46A 4S1OA 5EIBC 3W8RA 4MROA 5BT8A 1JWAB 2RGXA 1YUNA 3B13B 3PHIA 3O4HA 1ZM9A 3IGFA 4EY8A 1IIBA 3VSDA 5CHYA 4I8DA 4U2BA 4HOYA 3UQZA 3BICA 4E6PA 3LP8A 2CV0A 4KO8A 1JEEA 3W04A 2Q5EA 2W2QA 4GE3A 4XYGA 4GMFA 4ZO9A 1E2JA 3RJTA 5EWMA 2OMEA 2VSQA 3BSYA 4NBUA 4UE3S 4A0FA 2AOXA 3KAQA 2NZWA 3V7YA 1IFXA 3LHIA 4RPGA 4FLEA 1PX0A 3ZTYA 1UAGA 2Y0DA 2YVKA 1UM9A 1W19A 3DFMA 3KPJA 3R1IA 2OESA 2FEKA 1DELA 3N2GA 1GU7A 1AGRA 2WIAA 4AUEA 1KQGA 4AJNA 1XBTA 2O8FA 3Q6MA 3ZHZA 3N87A 2V0GA 4TLBA 5KS2A 5IAGA 3ZLUA 5IYZF 1Z56C 5A2QA 1LTQA 3G13A 2PGDA 3IQGX 3ASZA 1Y6JA 1ZW1A 2JA1A 2R0QC 1NZFA 4IXDA 4B0OA 3FFTA 4PAQA 5G0VA 4AMZA 4IG4A 2ZBEA 1HQYE 3ELBA 2AYYA 1AHHA 1JAYA 2OILA 2GWRA 2MR5A 2D1YA 2GHQA 4JGGA 4MV1A 2JJ8A 4YRFA 4YRQA 3SEZA 1JEYA 4BEBA 2Q4DA 3E9YA 1ID8A 2XAUA 2WTBA 3N7TA 3TQFA 4RF3A 4BFXA 2ZYTX 3DXFA 1OGIA 1FTYA 1OFGA 3VSEA 3H2IA 4CQNA 3OG9A 1Z3CA 4WK4B 2Z5FA 3UMGA 1KP3A 1PVDA 2GJSA 3KWMA 3NV7A 4DSUA 3RSGA 3A6LA 5IVKA 4G5OA 4DIKA 4MRNA 4MQMA 4L0CA 4EB6B 2X42A 2GI4A 5BNZA 3C4QA 5DP1A 2XAAA 2VHEA 3FPAA 3KBOA 2YYYA 3B85A 3EDYA 4KR6A 1L6RA 1T3SA 2XCRB 3UAZA 2IIQA 4RJ2A 1LRLA 4UZFA 3I64A 4RADA 1FQOA 2JVJA 5TQJA 2HBRA 4HYEA 4M0CA 3H0CA 1JQ3A 2WPNA 1HG0A 4BVGA 4JLOA 5FOSA 4YUWA 4TVKA 3IJ5A 3TH5A 4K81B 4WWHA 5AJTA 5HUHA 2IHKA 1Y6RA 1DBSA 3SY8A 4WKGA 5C18A 1YR3A 2E2WA 4H7IA 5FNVB 3S55A 2MTBA 1Y5NA 3L0BA 5AM5A 1EDEA 1P2DA 4F1KA 3F49S 5JD3A 3E35A 4KB5A 4J16A 4F91B 4RDIA 1AM4D 1LBTA 1ISMA 2UAGA 4OQFA 5KX5A 1F8UA 5AKJA 2PL3A 3W7BA 3HV2A 2B94A 3LQFA 3Q40A 4DLVA 5IXJA 2FFAA 5D5HA 4V0SA 1Z6GA 2Y6UA 5CR9A 2QMHA 3TXXA 3NT4A 4KQKA 2EL9A 3NI2A 4HVTA 1Z8DA 2EL7A 2PYIA 3PL1A 2H5JA 4IZ6A 4KXUA 1C2TA 1ENOA 5REQA 2P91A 1R16A 4GVXA 3HUUA 4K05A 4YQFA 4ZQIA 1JI0A 1E9AA 3PR2B 4HEQA 2AJDA 3UXMA 3E4CA 1HT1E 3NBYC 4DC0A 4B7XA 2Y27A 4RYDA 2CYAA 3PFGA 4MO2A 3USZA 4QM6A 4GXQA 5LSAA 4G0VA 3F2VA 3ZWYA 3NUQA 3BGSA 3R6DA 1DWQA 4EO4A 4R9NA 1NRWA 2AJCA 2CHFA 3BQNB 3ODGA 5H9WA 5FI1B 2F8SA 2XT0A 3QXXA 4KGDA 3KUUA 3P9RA 3ND7A 4IDEA 4MWEA 1W87A 3F74A 4YVFA 4A5OA 3LX8A 1X70A 2QRLA 3AFOA 4O2RA 4OL0A 4QLAA 1E1RD 3KRTA 4QYWA 4WERA 3DEFA 4OMDA 3AKEA 2R4UA 1NYRA 4D3ZA 2ZTHA 1M75A 1QP7A 1ETUA 2KLHA 2XD4A 4Z4GA 5H80A 2VJYA 1R4ZA 2KW5A 1UT6A 3UWSA 5L95A 1B0UA 1KK1A 3C24A 3UGQA 3GLGE 1A1SA 4N7BA 2MSWA 4PCVA 3O8OB 5AVWA 2P41A 4X00A 3CRNA 3KALA 3U19A 3HCRA 4WDRA 3ZU2A 3SBEA 1DJOA 4OFBA 3T1HB 4QRDA 1U2DA 2W2KB 4KX3A 1TTHA 4JY7A 4YACA 3D0QA 3RJ9A 3TXAA 3B48A 3B1JA 4BBZA 4FXPA 2NYUA 4HN4B 4V03A 2RHTA 3TN7A 3W8FA 2Y9PB 3H97A 4BNHA 4ZCTA 5JY1A 1Q0UA 1KDOA 1R4NB 3RARA 1JQKA 3GJ8A 1E9DA 5KNCD 3TEFA 1PIWA 4L0QA 3H1BA 1LLUA 1XXHE 3FZQA 3R0ZA 4MEAA 5FBLB 5FOWA 2N1MA 5KNBD 3THXB 5DYGA 3H0EA 1NUSA 2C2WA 2I9KA 4TMYA 2D1FA 2XNDD 5HIIA 1F1JA 3VDXA 3L0IB 1YDFA 3T15A 2QSJA 4QFDA 1Q22A 4OYLA 4FCTA 1DE0A 1ZOPA 1H23A 5TT1A 2CLCX 3I73A 1KJ9A 1B15A 1MG5A 2O2IA 3AM1A 2V8BA 3P0IA 1V26A 4I1YA 1UC8A 4BJ3A 1NMEA 1WXXA 4BV2A 4JJIA 2D5LA 2ZVPX 4U2EA 4BO0A 3ZWCA 3C1AA 3MJEA 3ZZNA 3CVWA 3PQ3A 5KTNA 1GLNA 3GLGA 4QAQA 3DB1A 2GSDA 2ID4A 3DZBA 4YDRA 3AHDA 1DL5A 2X22A 3PXUA 5HHTA 3SFTA 2X1HA 3D6TB 5EZYA 4GLOA 4NESA 4P35A 5EEGA 2AMVA 3OF5A 3MWEA 2XVYA 3JQQA 4AP9A 2FGJA 3U7FB 5IJAA 2H1CA 2Y1EA 1V11A 3O0DA 4FB4A 5BSFA 4GZLA 1ZNYA 4J0HA 4WXMA 3TM4A 3L0DA 5DM70 1BH2A 1U3DA 1ZKDA 4JYBA 1V37A 1X7WA 1EB8A 2OFXA 1VI2A 3QPBA 1XZNA 4DPMA 1XXHA 2FVYA 1TAQA 3NDPA 2HDNB 1R10A 1U6JA 4DF3A 3O8QB 1J00A 1NVTA 2XTJA 1KJNA 1GUBA 2D2VA 3GROA 3N2KB 5D7NA 2X8AA 1K08A 4ZJPA 3NBMA 1M6NA 1T29A 3ETHA 4Z8XA 3VPSA 3JTEA 4Q9HA 2CSUA 2HYDA 2I9PA 2W6PA 1AOXA 4GXRA 3NP9A 4E4YA 2OD2A 2OXCA 3AU8A 3B6IA 1LNZA 1DX9A 4KRGA 1EVKA 1VJ0A 5L4LA 2JG3A 1LQTA 3B3GA 3MBKA 3GP8A 1SKMA 3TLGB 1WXGA 2POQX 3ODPA 4FUQA 3ZPXA 3ZI0A 3OLQA 2Y1DA 3OLYA 1QHFA 1UBFA 3EJ6A 1UQTA 4CMIA 1NJGA 3GRUA 3C98A 5DHFA 1SRQA 4Q9KA 2QA5A 3QLEA 4R1SA 5AKYA 3ESDA 3HVKA 4HJRA 4L2IB 5H8WA 1TM3E 2QQFA 1GRQA 2YN2A 2HBYA 3AESB 3LBFA 5AXDA 5TMPA 4QSMA 2ZKLA 1T1IA 1YOVA 3L0ZA 2WUDA 2QLMA 4C06A 3NVMB 1VHLA 4F3CA 3H2SA 2BJHA 1B8OA 1G5RA 4B40A 1A8PA 1UXKA 1JQLB 2W90A 3H7IA 1ID1A 1X39A 3FROA 3MN1A 4ZQHA 1IPEA 4YCLA 2XNHA 3VC7A 2XCTB 3N58A 3VNUA 1CZLA 3K6JA 4IINA 5I9IA 2OFPA 3HL4A 1PTJC 2PMCA 3F6EX 2FQXA 4PYRA 3VC3A 1NC3A 4PZLA 2JBHA 3HLYA 5GGYA 5LA6F 1QQ7A 4HTFA 2J85A 2AMLA 2HLDD 1Q2UA 2XYRA 3IRVA 4FMBB 4OBWA 1DBIA 1XEAA 1YR6A 4X1KB 1D07A 3EF3A 3K8ZA 4Q3AA 4BO2A 4YUZA 4TT3D 1A2KC 1ZMXA 5T4BA 1JJIA 2EFDB 1MDBA 2FPPB 4KXWA 5DZSA 2I76A 3V1MA 3FHJA 3M3PA 2A6PA 1IBMB 3CX8A 1P8AA 2I0FA 3GCDA