4LYEA

Crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with substrate hopda
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
276
structure length
276
Chain Sequence
b'MFEQFESKFIDCDGIRTHYIEMGEGDPLVLVHGGGAGADGRSNFADNFPIFARHMRVIAYDMVGFGQTDAPDPAGFAYTQAARTDHLISFIKALGLSKICLIGNAMGGTTACGAALKAPELIDRLVLMGAAVNISPDDMVANRDDLAAVMSYDGSEEGMRKIIAALTHSYQPTDDIVHYRHEASLRPTTTAAYKATMGWAKQNGLYYSPEQLASLTMPVLVLGGKNDVMVPVRKVIDQILAIPQAIGHVFPNCGHWVMIEYPEEFCTQTLHFFGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MCP Hydrolase
molecule tags Hydrolase
source organism Sphingomonas wittichii
publication title A substrate-assisted mechanism of nucleophile activation in a ser-his-asp containing C-C bond hydrolase.
pubmed doi rcsb
total genus 99
structure length 276
sequence length 276
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lyeA00
3VVLA 5KWIA 5ALRA 1YB6A 1YCDA 2WUFA 2I3ZA 1CUZA 2YASA 3FCYA 3AFIA 3V9AA 5AK6A 2H9YA 2ES4A 5HKAA 4DGQA 4X92A 2DR0A 1DWOA 3C87A 3R41A 1U8EA 2WIDA 1QLWA 3H0CA 3AJAA 1LPSA 2BKLA 5JATA 1XQWA 4GHWA 1ODSA 4UPDA 2R11A 1N5MA 4Y9SA 5CT6A 1QTIA 1OILA 1B6GA 3V48A 2O2HA 3WA7A 1R9NA 2WUEA 4TPKA 4GLBA 4LKOA 5DLPA 1TCBA 3FVRA 4HTAA 5EIEA 4N8SA 1W6RA 1JKMA 1GPNA 3D2CA 4FMPA 1BCRA 4BBZA 3LIPA 1KEZA 2GBFA 1E8DA 3K2IA 2ACKA 5ALKA 1U65A 3R3YA 4Q3OA 1MN6A 1IZ8A 3G02A 3C5WP 2WJ6A 1Z68A 5E4JA 2AJ8A 1L7RA 3C8HA 3DLTA 4J0JA 2Q0XA 1ZJ4A 7YASA 3G0BA 5ALDA 2XUAA 3DOHA 5AO9A 5CTAA 3C8DA 3R3VA 3RK4A 3D2AA 3HRHA 2G5TA 3ZPXA 1SFRA 2WFMA 2GYVA 4PQEA 2JGFA 5JAHA 3KD2A 3Q0TA 4IH1A 1GKKA 4G1FA 1XZFA 4MJ3A 3EBLA 2BUAA 5AICA 2J3QA 2DQZA 5IKXA 5FP0A 1U2EA 5ALNA 4X00A 1N1MA 1CRLA 2PM8A 4KJXA 4Q34A 4C6HA 2FJPA 2Y6UA 3VVMA 3V1LA 3RLIA 1N5RA 4H7KA 4U2BA 2W6CX 3BF7A 3G0DA 4DNFA 4FNMA 3JWEA 1VZ3A 3UUEA 3PUIA 4ITVA 3FYUB 2OLEA 2XUHA 4A5SA 4G8DA 1CUEA 1J2EA 4BCDA 1MTZA 4ETWA 1OXMA 4KE8A 5A7HA 4P08A 4KE6A 4ARAA 4AQDA 3D5EA 1YA8A 5A7GA 4QWWA 5AM4A 1GPKA 3G0CA 4K6KA 3M83A 1MX9A 2OCLA 4GW3A 4HZGA 2CJPA 1XRQA 1A8SA 4DSAA 1A88A 1WM1A 1LPAB 1ACLA 1YSCA 5T4FA 3S8YA 1Y7IA 1QIDA 3CCCA 3D2BA 4JYMA 2BUBA 3ESBA 1ETHA 1CV2A 1QIEA 1CUYA 2J3DA 2WUGA 4RPCA 1ZICA 5AKXA 4PSCA 1ZI8A 3H2JA 2WFLA 5CT9A 2ONCA 4C4ZA 1W52X 3F96A 3R3XA 3O9MA 4RNCA 5AKIA 3WKCA 5BV7A 4X85A 2JGIA 3I2IA 4KEAA 4J0HA 5EHZA 3W04A 4J03A 1HKHA 3O0DA 3IURA 5HQ3A 3I2HA 3EQ8A 3PF8A 4B7ZA 2QJWA 2WHRA 1W75A 5DNWA 1B41A 4P92A 4BAGA 3FLBA 3L1HA 3DL4A 2B4KA 3SWWA 5ALYA 3C6BA 2VT7A 2JBWA 3JYHA 3E0XA 4QNNA 2PVSA 3TJMA 1C4XA 2WIFA 2OCIA 2ZYIA 5AH0A 1JJIA 1VE6A 3F9CA 4LXIA 1LPNA 3SX4A 5HK8A 4Y2VA 1TIBA 2IX9A 5ESRA 4U2FA 1WB4A 5IVDA 5BOVA 3KWJA 1DT3A 2Y1KA 1NU8A 1MAAA 4J0CA 5E4YA 1MPXA 2WLSA 3FSGA 2XQKA 2RGUA 5IVHA 1W76A 2VA9A 2ZSHA 4OB6A 4WDRA 5JASA 3FSGD 2PKYX 1E5TA 2ZYRA 2QXUA 3WLAA 5AI5A 3VJKA 4JEIA 5ALVA 4FHZA 3DYVA 4GI1A 4I4CA 3STXA 3HEAA 3H17A 2XMQA 4FOLA 3O4GA 5HQ3B 1CUXA 2OPHA 3X3HA 4UFPA 1UK9A 4Y2SA 4IQ4A 5AKYA 1A7UA 1SCKA 2FJ0A 3PI6A 3SK0A 3PFBA 3RM3A 4MQMA 2HRQA 1XZGA 3QMVA 5FUMA 3WL8A 1ZIYA 1P0IA 2CB9A 3GFFA 4FKBA 4X6YA 5ALFA 5ALLA 4XX1A 4X95A 1BRTA 4MXDA 2BGNA 4QZVA 2QZPA 4RE5A 5FPQA 3F67A 1AUOA 3F8SA 4PF1A 4HXFB 1XQXA 2OQVA 4C89A 2XUDA 2I78A 4UHEA 3AUKA 4DTCA 1QIFA 4L9AA 1QO7A 3E4DA 5I9IA 5CT5A 4UBOA 1CEXA 1QGED 5A71A 5HF6A 5T4EA 4G9GA 2C0QA 1XRLA 1DT5A 2I03A 3WL6A 2QT9A 1BEZA 1ZD2P 4G8CA 4GWLA 1D07A 4BRSA 2JEZA 5AI8A 5D6OA 3PFCA 3LP5A 3VKFA 4XVCA 1PJAA 3G8YA 3H2KA 5CT4A 1R88A 2VJAA 2WG1A 4EUSA 1MT3A 4CIAA 1YASA 4OB7A 1LPPA 3H18A 4IHAA 2HIHA 3OTQA 4XIIA 4C4XA 5ALSA 1UKCA 2AJCA 1CQWA 4AMZA 2PSEA 1Q83A 2ZJ6A 3AZOA 4OD0A 3W06A 5AOAA 4B83A 3A70A 3KXPA 1UOQA 4KYVA 5J3JA 4DMKA 4N8EA 5SYNA 4X71A 5LIPA 2CKMA 1XZCA 4J0IA 4LIPD 4Y2YA 2O7VA 2OCGA 3KDAA 3WK5A 2HU5A 2PU5A 3WQHA 1ORVA 1JT2A 3T4UA 3IIIA 4A16A 5AM1A 3WMRA 1R3DA 1XROA 4QDXA 1LBSA 4X97A 5EGNA 3HXKA 2VATA 5A62A 2O2IA 1WCYA 5ALMA 2OG1A 5LZ8A 5A2GA 4JNCA 3BJRA 4ZREA 2AJLI 1EDDA 5HF9A 4FFVA 5AKGA 4H7HA 4E11A 5HK9A 2OGTA 3IB3A 1PFQA 2XMSA 3D7RA 3VXKA 1CFJA 4BDSA 3ICWA 3PF9A 4EHBA 2XUPA 4UHCA 5ALZA 3O9VA 3WZLA 3MUNA 2XMBA 4H18A 5ALGA 4B6GA 4Y2QA 4LXHA 5D7BA 2AXEA 3C70A 4KRYA 2HDWA 3WL7A 5AM2A 2DCMA 1XKLA 3WKAA 4UFOA 4E46A 5HF8A 2XUKA 4PV7A 4EZIA 5DWDA 4DYHA 1BE0A 2HL6A 4GXNA 5E4TA 4J0DA 3DL7A 4BZZA 5C81A 4AO6A 4PSDA 4X91A 1AC5A 2BFNA 5AIBA 5C8XA 5JZBA 3GA7A 1J06A 3ESDA 4H7EA 2PSFA 1WB5A 5AK5A 3BF8A 3DOIA 2WSLA 1QIMA 3I2GA 3DS8A 3M81A 2Z8XA 3V1NA 4KR0A 1ACJA 3QH4A 3AZPA 2WTMA 4M0FA 4AN0A 3V1KA 4B84A 2BJHA 2RAUA 5AI4A 5EI5A 4UHBA 2FUKA 2DHDA 2HA3A 2WHQA 2YXPX 1JU4A 2XUFA 1S8OA 1DWPA 2HA2A 1QJ4A 2O2GA 4BC0A 3C43A 3WWOA 3LLCA 1BU8A 2WFLB 4FLFA 4JUIA 3Q8WA 1CUFA 4J7AA 2JIDA 2WILA 1T2NA 4YPVA 2HA7A 4Y2PA 4K2AA 2XDWA 1T4MA 4LYDA 2CMFA 4DM7A 2XUGA 4KRXA 2Y2UA 3H04A 4AO7A 6YASA 1SCQA 4WJLA 3C45A 3W9BA 1CUUA 2HRRA 4H35A 1ZD5A 4Y7DA 4C01A 2XMCA 5DTJA 3GBSA 2VTVA 4BE4A 2VAXA 1UFOA 3OG9A 3ZLVA 2HFKA 5K3CA 2RIPA 5ALHA 1W4LA 2DSNA 3OURA 4IH9A 5D3KA 4EBBA 4KE7A 5ALXA 5ALOA 3IDAA 1CQZA 1GZ7A 5CH5A 3I2FA 4MWTA 4BZWA 3T52A 3F97A 1H2ZA 5FV4A 3IULA 1F0PA 5JAUA 1HBJA 3B12A 4O08A 4H7JA 3D0KA 4EB0A 5DYYA 2XQGA 4G8BA 2WFZA 3WK7A 1UKAA 5K3BA 2E3JA 4UUQA 5EIHA 1CUJA 5HF5A 3I1IA 2HU7A 1JU3A 5FKJA 5CBKA 1AQLA 4Z49A 1ZI9A 4MYDA 1UXOA 4MEAA 3CN9A 3G9TA 3GELA 4JH0A 5AIAA 4W1SA 4Q1VA 5AOCA 1DX6A 2C5FA 4UBMA 1YA4A 3G0IA 4OUKX 5A6VA 1EI9A 3WWDA 4W1QA 4B80A 3HLKA 4FWBA 1F0NA 5AM5A 2H1IA 5LZ4A 1BN7A 2PBLA 4Y2RA 1DWQA 3NWOA 5ALQA 3WK9A 1EVQA 3HACA 4Y2JA 1FSSA 4P93A 2BUCA 3E1GA 5K3EA 5K3FB 1MX5A 3BWXA 3BE8A 1GGVA 3OPMA 4AMYA 4QLOA 2XE4A 3ESAA 3V1MA 2PSJA 2QS9A 4PW0A 1XKTA 2DHCA 4L0CA 2PUHA 4BB0A 3U0VA 4C4YA 2ZJ7A 2QXTA 4ZGBA 4AO8A 1CUHA 5ALJA 3PE6A 2OAGA 1JFRA 1I6WA 5H3HA 2QRUA 4L3WA 2OXEA 3WKDA 2AJBA 1WPRA 3ZI7A 3FWHA 1NU6A 4Q05A 1Q0ZA 4PO3X 3STWA 1G42A 4D9JA 2D0DA 3QPDA 5CXUA 1XZLA 3W2TA 2RI6A 1MX1A 4WFJA 4BATA 1QZ3A 2VJCA 1RWQA 3O4HA 2J4FA 5AKKA 5C8VA 4QDUA 4QLAA 4I3FA 5ALPA 4QEKA 3R3WA 3UMJA 4K6HA 4HXEB 4AX4A 2CEKA 1G5FA 2PPLA 5EHQA 1HDEA 1XQVA 1LPMA 2P8SA 4H77A 1BN6A 4N8DA 3C6ZA 1VOTA 5A7FA 3OM8A 3LCRA 3O4JA 1DX4A 2WG0A 2WQZA 5KREA 2JGLA 4HRXA 3OC0A 3NGMA 2EDAA 5AK3A 5AM0A 5HFAA 1UK7A 2CBGA 3WIOA 5K3DA 1EB8A 2IITA 1CUGA 5AHXA 4DMHA 5CT8A 1MNAA 3NUZA 3IA2A 1TKRA 2WIKA 1KU0A 1K5PA 4B0OA 3GZJA 4M0MA 2QM0A 2PSHA 3BXPA 4BP9A 3FCXA 1VE7A 4FBLA 2H7CA 3R0VA 4U2DA 4GDMA 2HA5A 2W22A 2NW6A 1U4NA 1RYYA 1E3QA 1Q0RA 1H23A 1MU0A 1QIHA 2GZRA 4OSEA 2Y6VA 4CG3A 1VZ2A 5DYWA 1R4ZA 4BVKA 3S2ZA 2O7RA 5JZSA 5LKRA 4WDQA 1G66A 3KWFA 2GBIA 1X2BA 4ZV9A 2QTBA 4UBKA 4BAZA 2QUBA 3STVA 2XT0A 2VEOA 3KSRA 1ODCA 3AIOA 3AZQA 4DLNA 1XZHA 3DDUA 1XZKA 1IVYA 3LS2A 2QR5A 1UOPA 2ECFA 1O6FA 4WCVA 3H19A 3SC2A 2ZYHA 3R3UA 1AX9A 4PSUA 2HFJA 2XB6A 4L72A 3QYJA 1ZGBA 3BDIA 4CIBA 2RHTA 1ISPA 4G4IA 1CIJA 2CZQA 1ZOIA 5LZ2A 1RP1A 5ALUA 1P0MA 1UOOA 3K6KA 5AK4A 4M0EA 3IUMA 4ZXFA 1XQYA 2VF2A 3G7NA 3H2IA 4X90A 1EK1A 3DEAA 1K6EA 1YAJA 1P0QA 2GBGA 1FFEA 1ZD4A 2WG2A 5FDFA 1BCSA 4UBIA 2VAVA 3WI7A 4OPMA 2XUOA 4IO0A 3K9BA 2OAEA 3DNMA 3HC7A 5DYTA 1P0PA 3H2HA 4FBMA 5DJ5A 3WWPA 2WM2A 1JJBA 3A2NA 2PSDA 3I2JA 4H7FA 1TCCA 5JYCA 4OB8A 2VSQA 2C7BA 3E3AA 2LIPA 4ZWNA 4BE9A 1XZMA 1J1IA 5ISMA 4MYSA 1VA5A 1QTRA 4TGLA 4Y2TA 1DTEA 3HI4A 1JJFA 3I6ZA 4E15A 3FYUA 1BROA 3C6YA 1THGA 2I3DA 3I2KA 1EK2A 3OOSA 2XLCA 1EB9A 2C58A 3FYUC 1CUVA 2WHPB 3QPCA 1GT6A 5JANA 3WK4A 1EX9A 3IUNA 5FXMA 4OYLA 2CUTA 3QITA 2GYWA 4W9RA 3A2LA 5JD6A 1VXRA 3WA6A 2ROQA 3MVEA 4QA9A 3I6MA 2ORYA 2DQYA 5HCUA 3DQZA 4N5IX 4CCWA 2HA4A 1ZJ5A 2V96A 1TQHA 3WK8A 4DNPA 1XRRA 4B9AA 4UHHA 1CVLA 1XZDA 1CR6A 4MEBA 1ODTC 1E8NA 1QIGA 1Y7HA 2C5GA 1AZWA 1K4YA 3C6XA 3IVMA 2HHAA 2PX6A 3ED1A 5AKLA 4X94A 4KE9A 2J4CA 3CCBA 3G9UA 5YASA 4FLEA 4B82A 2XQJA 2G5PA 1E89A 3QMWA 1XLWA 4W63A 3I1YA 2V97A 4K5QA 4Q3KA 3A6ZA 1GQSA 1EA5A 1HLGA 3N2ZB 4NZZA 2JGMA 5DTIA 3HABA 5AI6A 4AZ3A 3DKKA 1C7JA 5C8ZA 5LP1A 2HA6A 2K2QB 4OU4A 3ANTA 5E2IA 1SOMA 3GUUA 5CH8A 1QIKA 2XLBA 1HQDA 4BAUA 4QWMA 4CCYA 5T4BA 3WJ1A 4OYYA 3QVMA 1EINA 4J3JA 2XMZA 2WUDA 4MQLA 1QIIA 1VXOA 4LXGA 2XUJA 3VISA 1OCEA 1FFDA 3VDXA 1WPXA 1XFDA 1QFMA 4OCZA 2DHEA 3I6YA 2Z3ZA 3IBTA 4F60A 1USWA 3WKBA 2JGEA 4S0XA 1XLUA 3P2MA 2UZ0A 4P9NA 3WYDA 4QE3A 1WB6A 5HZGA 1LLFA 2ZJFA 4F21A 3CXUA 4DNQA 3KOOA 2D5LA 5HFNA 5CH3A 5AJHA 2XI4A 4ZI5A 2B9VA 5AM3A 3M82A 4U2CA 4AXBA 1EVEA 5EIAA 3DJYA 4HAIA 2C0PA 4UHDA 1A8QA 4Q3LA 2YH2A 3WYNA 3EF3A 4GBGA 4FDMA 3QM1A 3WJ2A 4DMCA 2XQFA 3FLEA 1FFAA 4AZ0A 4YASA 5K3AA 1YAHA 4BVLA 3DD5A 1GQRA 1LGYA 1QFSA 1UZAA 1TRHA 1L7AA 4UBJA 5IH7A 4H7IA 4CFSA 1VA4A 2BCEA 2XMDA 3BDVA 3DKRA 3FOBA 3M3DA 3R3ZA 1R50A 1CUIA 1UKBA 1CUCA 4CI9A 3STTA 3WK6A 1QO9A 3G0GA 4F0JA 4UFNA 3QBJA 2OGZA 1K63A 3IUJA 4G4GA 5I8PA 1MAHA 4ROTA 5ALEA 2WTNA 3ZLUA 4GECA 5BWCA 2FX5A 1DINA 4Q82A 3WIBA 3QPAA 5AI0A 4RGYA 1UK8A 1A8UA 2H7YA 5T4HA 5LKAA 4WFKA 1LZKA 3L1JA 4B85A 1J07A 5LZ5A 4EY8A 1L7QA 3TRDA 1H2WA 3ANSA 3N0TA 3CN7A 1YR2A 1YB7A 4OU5A 4XJVA 1QONA 5JD5A 1CUSA 3BJMA 4UHFA 4Y2XA 4TVKA 3BIWA 3HSSA 2VT6A 1ZIXA 3LIIA 4GEGA 3B5EA 2AJDA 1K8QA 5D3ZA 4DSZA 5DNUA 1EXWA 4C88A 5JZ9A 2PU7A 3EQ7A 4EY7A 5JARA 4BDTA 1WOMA 4KAJA 4INZA 5CRIA 2WKWA 2ZVDA 1ZI6A 5CMLA 1XZEA 4KAFA 4BRZA 5F4ZA 5LZ9A 2HA0A 3HZOA 5K3FA 3G9ZA 1BEEA 3BIXA 3FNBA 2QJRA 2C4HA 5KWJA 1N8SA 3WZMA 2RONA 4J0KA 1BS9A 2HM7A 2Y2VA 1EHYA 2JGJA 2VJBA 3ICVA 1WHTA 1IZ7A 1DQYA 3FVTA 3H2GA 3WWEA 4X6XA 5JAOA 4QDOA 4LHEA 3HYSA 4E14A 1IUPA 1X2EA 4W1RA 1VLQA 4BTLA 2XUIA 1CUDA 4NMWA 4XWGA 1XRPA 3VJMA 5AOBA 3F98A 4BTVA 2QKYA 4CCYB 1GKLA 2B20A 1EDEA 5DNVA 3STYA 2X5XA 4ZRDA 3D3NA 4WFIA 2VJDA 4YK7A 1AURA 1KU6A 5LZ7A 2QUAA 4NS4A 5AP9A 4HRYA 3PDCA 3TGLA 1DU4A 4F5ZA 1XZIA 4A23A 1E8MA 3W9UA 2XUQA 3O4IA 4U2EA 2QVBA 5CURA 4Y2UA 1F8UA 2GBCA 5ALIA 3EIOA 5CW2A 4HXGA 3PUHA 1M33A 2X8BA 4V2IA 5AKZA 1G4HA 1UT6A 3FBWA 3STUA 5LYYA 1EDBA 4EY6A 1SC9A 2G63A 3O95A 1CPYA 4G4JA 4AN1A 1LPBB 1THTA 4HS9A 5FLKA 1CUBA 1GPLA 1Q84A 3PICA 3MUOA 4G9EA 3EQ9A 5EHXA 3AILA 1UWCA 1UK6A 4AB1A 1JMYA 1QE3A 3H1AA 1MNQA 1LZLA 2ZSIA 4ZV7A 2WHPA 4IH4A 4EY5A 3D4LA 4B9EA 1Y37A 1YS1X 2VQ6A 5FOQA 1HL7A 2IIVA 3FYTA 4KAAA 2BGRA 3WKEA 5IVKA 1H2YA 5EHNA 1PV1A 2X76A 1AGYA 1R9MA 4X6UA 1VKHA 4LYEA 4EA6A 1IUOA 3ZV7A 5JAPA 3I28A 3NOXA 1C7IA 3FAKA 3BL8A 4JYPA 3GROA 4X7BA 4X93A 4G5XA 3RKSA 5FRDA 2ACEA 1HPLA 1FFCA 1TAHA 5KBYA 4CG1A 4WY8A 1XRNA 4N5HX 1ZD3A 2ZYSA 4BYMA 1NX9A 1IMJA 2WIGA 2EDCA 5JD4A 2PUJA 5ALWA 4I19A 3U1TA 5JADA 5K5EA 3VJLA 4U2GA 4BP8A 4QDTA 1E66A 4RE6A 2WIJA 1XLVA 5ALTA 3B3QA 5I7UA 3AINA 1MJ5A 1XZJA 4MWSA 1FFBA 4B81A 4CG2A 4EY4A 2QOEA 1TK3A 2OCKA 3WL5A 3MGAA 1AMNA 3W05A 4HVTA 3ZLTA 1H2XA 2XQIA 2DFPA 2R8BA 4W1PA 2WU4A 1CUWA 1H22A 4QDZA 3L1IA 5IVIA 3HJUA 1FJ2A 2GZSA 4KACA 2V9ZA 3WWCA 5AI9A 4X3CA 2Z8ZA 1O6GA 1DQZA 1AKNA 2QMQA 1TCAA 3ILSA 2JF0A 1LPOA 4C87A 1JMKC 1LNSA 2JGKA 5FPPA 3AIMA 1JI3A 1WHSA 2WU3A 5SYMA 4DIUA 4BCBA 1IUNA 1R1DA 2Z5GA 1CUAA 2EEPA 3G9XA 4H0CA 4BVJA 3R40A 3H1BA 4UBLA 4K6GA 4YX9A 1CLEA 1VJ5A 2Z3WA 1XRMA 3ESCA 3D59A 2HADA 5JALA 4PNZA 1XZAA 4FLMA 1ORWA 5AKEA 3C5VA 3DYIA 4WY5A 2V98A 3FLAA 2XMGA 1ZGCA 3JW8A 2RHWA 3IUQA 4H7DA 1W1IA 4J0GA 2OGSA 4BCCA 5C7YA 2WJ4A 1EH5A 2BAGA 2YYSA 1LBTA 5JIBA 3UUFA 5HKBA 2OQIA 3QZUA 5LLSA 4B0PA 5AKJA 1F6WA 3ZWQA 4DMFA 1SCIA 3DCNA 3AIKA 2H7XA 1QOZA 2JEYA 2HU8A 4BC1A 4ARBA 4UBNA 1MO2A 1XZBA 2GYUA 5CXXA 3RARA 4DNOA 1QIJA 5BWBA 4FNGA 3YASA 2B61A 5AKHA 3QMMA 1GXSA 2G4LA 1X70A 4FFWA 2XMRA 5EFZA 4FTWA 1YS2X 3A2MA 4NVRA 2WJ3A 2PL5A 3TEJA
chains in the Genus database with same CATH superfamily
3BGWA 1GZSA 1U8AA 1QH1A 2VQ3A 3DUFB 3E5MA 2Z8YM 2GOYA 2B2NA 4HK4A 4O4JF 5BVGB 3EW9A 2XXAB 3ETGA 2WUFA 3WTBA 4F2WA 5FYQA 3AL3A 4IHJB 4BQPA 2Q6OA 2O50A 3OOYA 2XDQB 5K0EA 1A9PA 3I5MA 5AK6A 1VG9B 3DBHA 4YCBA 3RPEA 4GPBA 3RQSA 5HKAA 2WMNB 3NKLA 1Y5RA 2GAFA 1U0RA 4TYMA 3TUIC 1P1IA 4WK4B 4GF5A 4ALJA 5JCZA 5KX5F 3AB3A 5BWLA 3SJZA 3R41A 1CEEA 3COJA 1G9SA 4HSGA 2A78A 3HUTA 3AJAA 1C30B 1P0CA 4I1SA 1D9XA 1RLTA 2BKLA 4MVJM 3MQ2A 1K1EA 4OA8A 4P5EA 1BOFA 5DF1A 5IBCA 3O8LA 1D8TA 4FILA 2EWVA 4GZMA 1TIPA 4HZUA 3IEMA 1M2VA 1X1AA 1QH1B 5ADUS 5AQEA 2Q1SA 1MIHA 1QG2A 3RBAA 4Y9SA 1WG8A 2WE8A 1OX4B 1LW6E 1YNSA 1DBVO 3PCTA 4LHSA 3NFYA 5KYNA 2VG8A 5TEVA 1IUKA 2HCFA 2HUPA 2UYGA 1W5FA 4IDDA 1E2BA 4TPKA 4E08A 3BULA 3DTVB 4GLBA 4KDCA 4DCTA 1FLDA 1TCBA 3BOSA 1HKUA 2QRJA 3FVRA 4HTAA 4LG1A 1H5NA 3T9AA 2YKGA 2FW1A 2B8JA 4G5SA 3PEFA 1JKMA 5EJ8A 5TT0A 3ZY3A 1E60A 4CKYA 3A1SA 3BD9A 4K9QA 5EMHA 5DWVA 1RIFA 4PYNA 4EPRA 4H16A 5C0OE 3GLGA 5CBPA 4PGAA 5CX1B 4C04A 4BNIA 4HYTA 5G4KB 2JI8A 1U65A 3GZNA 1LS1A 3IKTA 4N54A 3IVCA 3ZU2A 5A9SA 5KTKA 5NLLA 1Z26A 3B89A 2W93A 3COZA 1HURA 4FYMA 4IDBA 3VR3A 4BNKA 4NABA 1PR4A 1G63A 3C5WP 1Z68A 2W2TA 2XITA 2AJ8A 5F1PA 4Y1EA 3ICEA 1I2MA 1WNFA 1SY7A 1ZJ4A 1M8PA 2PGDA 4YUAA 4RVCA 4ZOCA 1PGPA 5ALDA 1KSHA 2XUAA 3DOHA 2FOLA 2QYTA 3DE7X 2AR7A 1XXHE 4UM8B 2P62A 4F72A 3KSDO 5F35A 2ZSDA 3G8CA 3DQQA 3W5AA 3ES9A 3A1FA 3EDQA 3O7MA 3RK4A 3X1MA 1QQBA 1G8GA 3D2AA 4BX3A 4I36A 5E1BA 1P3Y1 2I4NA 1XMOB 1WVMA 2EGHA 1H6DA 3F4KA 3HA3A 1QAMA 2VYVD 3RRMA 1WBDA 4PG7A 1PQ4A 3HJBA 4IH1A 5JAHA 1XD2B 1XU4A 1PGNA 1WBJB 2PKRA 2GEVA 5JXJA 1PUIA 4AKIA 1QPBA 4FOOA 4JLJA 1HNNA 3ISVA 5B3AA 3AF2A 4PNHA 5AICA 4HQ0A 1ZESA 4EYKA 1X1TA 3FJ1A 4AMVA 1VKRA 4RWEA 4UTXA 5FP0A 2AQIA 3OTIA 1N1MA 2G88A 4X00A 3IAS6 1CRLA 3UPTA 1VG1A 3FAZA 1GT91 1XCOA 4FFMA 2DUJA 3F6BX 4JJ6A 2QJTA 3ETDA 3LUBA 1G3MA 2VHUA 4N6NA 3VH2A 4C0AC 5FA8A 1I4LD 5LD2C 2DFVA 2KE5A 1NJ2A 5L3SB 1RWOA 2BFEB 2PS3A 2JATA 2RGDA 2IV3A 3WYEA 1JDBB 2OOSA 2OZLB 3RLIA 4ARSA 3WGVA 4CHGA 5E8RA 1UR5A 2Q49A 2W6CX 2AQ8A 4Y2GA 4DLLA 3G8AA 2KSQA 5KX5B 1UBOS 2YVKA 4UNQA 2WWWA 1OZFA 2NTJA 2QY9A 5BUCA 5JXHA 4KYUA 1CF4A 4RSHA 5CXSA 1U99A 4RAQA 2QZZA 3H5AA 3KVOA 3C1OA 4DNFA 4RKEA 1VZ3A 2V03A 3UUEA 2O1SA 3DKPA 3B1VA 3RDPA 4ITVA 2EF1A 5IDYA 1SUSA 2F1IA 1S89A 3AETA 3BKXA 2H3HA 2ZI7A 2DB3A 2OLEA 2XUHA 4LUCA 4N5MA 5TGDA 2KM1A 2D2FA 2ZUVA 4G8DA 4EZEA 5KHLB 3VC7A 5L3SA 1WU7A 2DKFA 4HH0A 4O5AA 5FFNA 4IGAA 1J2EA 2TMDA 2ZKIA 4AN4A 5JC1A 2AEFA 4CUZA 5IMBA 1DCFA 4C20A 5CA0F 2RIRA 3Q1LA 2PNFA 1OXMA 5F2EA 5A7HA 5KVAA 3BIJA 1RQPA 4MQ5A 4P08A 4WK2B 4KE6A 2CV1A 2QIOA 3A4VA 1TRKA 1X1DA 2EP5A 3QRWA 2Z6VA 4IOJA 4K6OA 4LJ9A 4MO9A 4NS1A 5SZIA 5I7HA 3OAAA 5DX0A 2XT9A 4LZWA 1SURA 5IJWA 5AM4A 3OQNA 4DV1B 1PNOA 4HFJA 3OZUA 3L7KA 4BNVA 3PFKA 1X0XA 1GPKA 3G0CA 1PF7E 4J1NA 1QTQA 1ADGA 1EP2B 1NBMD 3BA1A 4Q9KA 4L78A 4AC9A 1Y3CE 1GILA 2G09A 4NYMQ 4IWYA 1RD4A 4G1EB 5DE3A 4DEYA 1SBIA 3JS5A 5EQJB 1J0EA 3EGIA 3QEAZ 2ATEA 2GLTA 1JAXA 2C5AA 3EOBI 2I4OA 1U3DA 1AH2A 4OHFA 4MV1A 4F3RA 3Q6MA 2X8LA 4ENQA 1E9CA 1EEHA 2OECA 2XCOA 2Z4RA 4NCHA 4ZZ1A 4BVAA 3K0SA 4Q9NA 2YV1A 1KRXA 3E22B 1A88A 2QAJA 4FEYA 4I1UA 4LRWA 2J07A 1EXMA 1DLIA 1ZZGA 1ACLA 2WSIA 3C3MA 4BV8A 1I6KA 1HTTA 3BD7A 1F60A 5D8DA 5T4FA 4TYPA 3ZKAA 4EHNA 5JYDA 5K0SA 2W90A 3RRJA 5LMZA 2C2ZA 4JYMA 3DDOA 1YFLA 4KR6A 1EE9A 3ROEA 2HMTA 4S1VA 1RRVA 4D82A 4IIDA 4K9OA 2QRPA 2FKNA 2DPYA 3KKEA 3HU5A 3U17A 3UAZA 4C0WA 3C39A 3AY3A 4DA6A 2FW6A 3PA8A 2AEEA 2J3DA 4LPSA 3W6NA 4R83A 3ZDDA 4C7KA 4FXPA 2AZXA 1S1MA 3AW9A 1U2SA 2R62A 1ICEA 3R24A 4N65A 4NC9A 1S4MA 4TKUA 1FP4A 4DG9A 5EA2A 4CEJB 2I7DA 1C0LA 1KJWA 2AI3A 1C0KA 4FNAA 4GOKA 5GADl 5LMUB 4L02A 4R8KA 1VHQA 3DKVA 1VIMA 3IRVA 4X7PA 1QVVA 1YT5A 4HBGA 4JVSB 1RZVA 2QAIA 2NAFA 2AMVA 4RV9A 4HGRA 1HMPA 3SBOA 4POOA 4XGIA 4YR7A 5CT9A 1VFPA 4CF6A 4KPFC 3E84A 4C4ZA 2WOOA 4A2WA 4AULA 4DQVA 1X7YA 3GGDA 4PZPA 3R3XA 3UZUA 4G4SO 5EZYA 2GK7A 5TMPA 4OY3A 4MB0A 5BV7A 3REGA 2EJVA 2Y1GA 2JGIA 5K6AC 3L8GA 1A50B 2ZSFA 3LSYA 2NSHA 1RYMA 4KEAA 4B8WA 4J0HA 3UC5A 4YY3B 4ZTUB 3KKMA 3HPRA 3IDSA 5JAQA 4C1BA 2CNLA 1OPXA 5C4IA 2G1KA 4HYQA 3H1TA 3OPVA 3LAWA 4J03A 4OXIA 4ALKA 4HT3B 1UXHA 5HQ3A 1IIRA 2H1FA 4PO8A 3L4JA 4G0ZA 4B7ZA 1A9QA 2JVIA 3TLEA 1FS6A 2V3WA 3FPGA 3TRIA 1W75A 4RGBA 121PA 3PNMA 3BMQB 3PC6A 3FYSA 4L2IB 1B41A 4BAGA 4NPHA 3BORA 3DVAB 1L5SA 3FLBA 2BY4A 3L1HA 2BEWA 4XB6B 4R1OA 2CXSA 4CV1A 3A4NA 3ER8A 2PUDA 4JJKA 5CR9A 2FEAA 3DOUA 3BDAA 3GPIA 2XYRA 1VHLA 2ZJBA 3SWWA 2IZ7A 4RTOA 3A05A 2R4QA 1TZMA 3EVAA 4HLQB 3BD8A 1BMFA 1CYEA 5KOJA 2VT7A 4KSBA 4EVQA 2HNAA 2JBWA 4QUAA 4YRCA 1IH8A 4BMYA 3VR6H 3GOQA 2YHBA 1RLOA 1ZK3A 1T3ZA 3HCOA 4GEKA 3TJMA 3UT0A 4A6EA 3IXLA 2OCIA 3A28A 4ENTA 5FTNA 1JXQA 1NOJA 1M0TA 1JJIA 1IBRA 3LQFA 2PL9A 5TRTA 3PPWA 2RE8A 2XCIA 2CV0A 2A3NA 2DPLA 4H3HB 4RXUA 4HAUA 5LD2B 5DB4A 5DP2A 5E38A 3C4JA 4EG8A 1TZKA 1TIBA 4DUYB 3K09A 1WB4A 4RA9B 4R81A 3A1NA 3BBLA 4IFIA 5TF0A 2YIMA 5ITWA 2YHAA 4YJDA 1NU8A 1XMJA 2R48A 5E4YA 1K7CA 4NICA 1FDIA 2IHNA 4TN5A 1DC4A 2I1LA 3A7EA 3CNHA 5FOTA 1ZP6A 3U39A 5HE9A 3IMCA 3OPYA 5EJ9A 1NQTA 5CVDA 4QHTA 4DPMA 3EVDA 4DLPA 4N0DA 2X7JA 3KQVA 3WNZA 3MWYW 2ZITA 1ZW1A 2AKYA 2P5UA 1DPFA 2YWFA 4JLAA 3OH8A 4OHUA 1ZM7A 3EEFA 4OB6A 4DLYA 1Z35A 2ZBQA 1PEKE 4Q24A 2EERA 3GEEA 4FR5A 5C51B 3ZD6A 2GLXA 1FPQA 1UKZA 3DMYA 1NYQA 2X13A 4ZK2A 4YRAA 2YRFA 1QYWA 4IJVA 1MO5A 2A3RA 3KKNA 3VJKA 4US0R 1J8YF 1X8LA 5BMOA 4CQNA 3GRUA 1PJTA 4JP5A 4LAFA 4O2BA 3E8XA 5H16A 3KUUA 3SSNA 3WHLA 1Q74A 3NEPX 3DYVA 1Y5NA 4GI1A 4PRKA 2ZCVA 4I4TA 3OKPA 4B32A 3U3RA 1O8BA 2DECA 3X2EA 5HM6A 5KTSA 1IN7A 1HZJA 2W5UA 4CKXA 5T57A 1U0LA 1OI7A 3L79A 1MH9A 3KYIB 4II7A 3MERA 5JYEA 3PDUA 1Q14A 3AR7A 3PKIA 4RELA 4WA7A 2AI2A 1N5DA 2A33A 3KT8A 4JVOA 1YV9A 2C8KA 2XADA 1D2HA 1SU6A 4IQ4A 5AKYA 4DMRA 4Z8XA 3ZHRA 4ZICA 5KB3A 1XCGB 3TPFA 3G2HA 2QVYX 3W6OA 1YF3A 2FJ0A 2Q5FA 3SK0A 3RM3A 1E4EA 4PS0A 3WGLA 4ZT4A 1NR7A 3ZNQA 2QT0A 1YJXA 1FFSA 2HRQA 2P4SA 2JK0A 2Q5HA 3STHA 1YO6A 2JGRA 2YS6A 3PD0A 3HTXA 4MGEA 5I3CA 2OV2A 4ZAGA 4GNKA 3MMXA 4DWJA 2HTEA 2NQTA 2ZEJA 4FKBA 5GPBA 5ALLA 3U6KA 4Z53A 4XX1A 5MGNA 3VSBA 1COWA 1PRYA 2OHVA 3WLRA 2Z6UA 5E3HA 5AJTA 2BGNA 5IW8A 3NIGB 4N03A 3SC3A 3WGOA 3OIDA 4EYGA 3QKIA 1NULA 3REFA 5FPQA 4DIBA 1II9A 2Z5FA 3KEFA 1AUOA 2WT9A 2PD6A 3K53A 2ZT6A 3NKFA 2RD2A 1GPJA 4HXFB 2OQVA 2NO7A 4RCVA 3RW9A 4C89A 2I78A 2PMCA 2B1RA 1DO8A 3F9IA 3EUEA 3ZXSA 1DAKA 3L0BA 4IIYA 5D3QA 4DG8A 3MRSA 2A0FA 2J7PD 3BA6A 3BXHA 3PEWA 1CEXA 3IFSA 5A71A 3UNXA 1L2TA 1TCVA 4ZJZA 4XD7D 1PWZA 2RHBA 4W82A 1BDJA 4KKXB 4JKIA 1DT5A 3W5BA 2BFCB 4LZPA 4MRMB 5FI3A 4XX0A 4NSNA 4IJQA 3UK1A 4DHWA 1D0IA 1BX1A 3WRXA 2ID4A 4PG6A 1D07A 3TS1A 3X43A 2IOFK 1V8BA 2FPLA 4GXRA 3GX1A 1AKVA 2VHWA 5AI8A 3RR2A 4DSTA 1HLPA 1RSZA 3U7FB 3FXAA 4WXYB 3TQCA 1NMQA 3N6RA 2G28A 4NF2A 3BHJA 3RRNA 1LVUA 1PJAA 1G55A 4M9QA 4Q3BA 5CT4A 3CSUA 4YA6A 3SHQA 4D46A 3IXQA 5B2ZA 2B1IA 2V3VA 2IS2A 5EPOA 3BMCB 5BWMA 2CHGA 4ISBA 4ER7A 1F0YA 1OX6A 3D3WA 1MJGA 1MT3A 3FRHA 4UXHA 4EPVA 3M6IA 5J2UF 2HNKA 3A3YA 3P4YA 3IALA 3JD4A 4G0WA 2XWJI 3QW2A 1COWD 5ECYA 3ILYA 4MA0A 2IS4A 3SZLA 3C4QA 4ZAYA 4CZ2A 5K0ZA 2WF5A 1IN8A 3IPLA 2J0UB 4XIIA 1T0IA 3QX8A 5SZKB 2V4UA 3ASVA 1U0EA 4YDSA 5SZJA 5TY0A 2P5YA 4IDAA 3NGLA 1CQWA 2P65A 5COAA 4ND3A 1J8QA 3E05A 1N6KA 1Q6ZA 1IJFA 2VZEA 2I99A 4OD0A 4QSMA 4UW9A 3W06A 1EXDA 2AIRA 1A27A 5GM2A 1M0SA 4EJ6A 3KXPA 2Y1OA 1RFLA 5DYGA 1RCTE 1TO2E 3G6WA 4CLRA 2LVBA 1N5LA 3MW8A 3UQYS 4XWOA 2ZUFA 4FFBB 5BSMA 3WTCA 5BP7A 1C8BA 2VK4A 4URYR 4X71A 3RWOA 4YT5A 3T4EA 4B6EA 1XMQB 4I4TF 5D86A 1GFSA 2OENG 4KPUB 4AIIA 3U3MA 1V7ZA 3QENA 3A7DA 3CUKA 1XZCA 4HNGA 4I66A 1MA3A 3ELWA 4J0IA 4L4YA 1I01A 3FUVA 5AOVA 3PEUA 2XB8A 1W5TA 5FEMA 4RENA 4JC5A 4I81A 5DI9A 1ZHHA 1E3SA 1CE8B 3EQZA 4FEAA 4CMIB 4KUEA 1KC3A 1SXJD 3VR2D 3TRKA 3CVWA 4AWAA 1VGQA 1EHCA 1X9HA 4MR9B 3GG9A 4N76A 4G67A 3SQOA 2PU5A 4EUFA 4F1JA 3LOUA 2CVOA 2GM3A 1FRFS 1FYDA 4MV4A 1YRQA 4WOBA 3GPDG 4I08A 4CLRB 2CHQA 3O47A 1XROA 1XXHB 1LBSA 3RSQA 1E4VA 3FCAA 1BXKA 3HXKA 1ZITA 5CNMA 3SPXA 4GR5A 5I9BA 5LXTB 3OF3A 4N3GA 1CRWG 3S2IA 3TAHA 2OG1A 1EVKA 3PCRB 5LZ8A 4A1OA 5A2GA 4I1PA 3LVQE 3J7AC 3COVA 1L8XA 4TUYF 5DZSA 1V2HE 4PC6A 2DX7A 1V5WA 1LK5A 2Q3CA 4NE9A 1R12A 5CLGA 1X87A 3PVCA 5FAXA 2R5WA 3JAMA 1X6VA 1ESMA 1HK7A 1FVXA 2RK6A 3UCFA 4BFYA 1NQXA 2Q5LA 5CFPA 5ICGA 4JOSA 4FK8A 4IJWA 3RYTC 3ZW8A 3BCUA 1UKVY 3C6KA 4Y6PA 2XMSA 5EWMA 1YJBA 1P5FA 3T9DA 3RRFA 2QP3A 1CFJA 4WBXC 3FUTA 4FDLA 2Z1NA 4RANA 3E9YA 3ICWA 4IJ5A 1JPUA 2NZVG 4UM9D 2SKDA 3V4PB 4EHBA 4KLNA 2MSKA 2FW9A 1RXSA 2R0QC 1NLUA 4LV8B 4EKGA 4UHCA 2PLNA 3O9VA 1V37A 2H4XA 3OFNA 2NUTA 1T8PA 2EZTA 2V8OA 2WMYA 4IDNA 3DCYA 4CKZA 4BFVA 3EFBA 4OG2A 2JJ1D 4OYRA 5EZSA 1MVNA 1XWFA 3AEQB 2Q3MA 3U1VA 3LT1A 4V24A 4H18A 5FLYA 5FTKA 4UTRA 3L5OA 3DAYA 5C3MA 2EIHA 2W58A 2ZIZA 5D00A 3VDRA 3ZKWA 4BJ5A 1N34B 4NOKA 3RODA 4EYEA 4L8WB 4Y2QA 1L7OA 1WCXA 2X3FA 3DAGA 4L3VA 2PKEA 4TLMB 3RJMA 5ICSA 3PLNA 1TTPB 3B8EA 2DWUA 1PSDA 5WRFA 3WAJA 4JLWA 1ZG3A 5MFPA 2VH5R 2GGSA 5LVAA 2YV3A 3KU4A 1C0PA 3SM9A 3EXFB 1XKLA 3JVIA 3JATB 2GVZC 2IXDA 1E99A 3RYIB 3RJ9A 4Q9AA 4G9BA 2H85A 5FR2A 3TDMA 4AJ1A 4HNAB 4HDQB 5EKSA 1C9EA 1Y9EA 1YR3A 4UATA 5BV0A 4BMSA 3N0RA 3P2EA 4LGVA 4ZHQF 5DWDA 3N0XA 3IJPA 3AEQA 1F17A 2AG6A 2HL6A 1XIVA 2JLSA 3R0QA 1GCUA 2BISA 2VUTA 4GXNA 2FSIA 2BMDA 3AEZA 4V0SA 5H3LA 1K5HA 1XFAA 4LJ4A 2XE6A 4D8TA 4Q03A 2O3SA 1ADBA 3E9RA 3F3YA 2A58A 1L3CA 1CJKC 4RQUA 1MIOB 1VM6A 4IYRA 3COPA 3BXZA 1QR2A 1AC5A 5EKUA 4D3XA 3ZWBA 3QVUA 1H94A 2WHYA 3MIZA 2N3ZA 4PXAA 4ZYXA 5I5EA 1GL7A 2JAQA 4OLBA 1MABB 3WXMA 4PVCA 4KYTA 2LCQA 4MTCA 2QVCA 4YWHA 5KNBA 3NTXA 1TZCA 2ZANA 1O96A 2QG4A 2B0JA 3GA7A 4Q7JB 3URMA 4LTMA 5GJBA 3P71T 1H2BA 5IH3A 3RU2A 4RAOA 3ADBA 1P6QA 3AL0C 4TL8A 2X0NA 4RK1A 1Q0UA 2Z5LA 3JAKB 2C2GA 3UY4A 2Y92A 4D74A 2BGKA 5IYZA 4D9NA 1V4NA 3HBMA 4Z4FA 1SC3A 4XE5A 1O03A 5BVHB 4HBZA 5LL6P 4MW4A 2Z8XA 5ADHA 2WFAA 1DQPA 2ZS7A 2VSYA 3CZ4A 1I14A 5FNVF 5DM4A 2E87A 4M0FA 4Q18A 3TH5A 3V1KA 4KQIA 1K7FB 4B84A 3FWYA 2RAUA 2HHJA 4HC4A 2ACVA 1C41A 3W2EA 1ULZA 2PCLA 4TVSA 3FFWA 1NQAO 3L7CA 3QYAA 4RF5A 2DHDA 1Q1AA 3HP4A 2AA3A 2AZ4A 3LF1A 2WHQA 4NYJR 4OI4A 3ZHSA 3E53A 3HVUA 3QHQA 4UNIA 1CDOA 5C3UA 1JU4A 3LCUA 2F6RA 4FDVA 1S2LA 1J2YA 3WBFA 4EMTA 5HDBB 1MC1A 1DWPA 3PC2A 3W2HA 1I0ZA 3O2SB 4DDMA 3S8EA 1RYEA 2BL4A 1DBRA 1KWKA 4RSGA 4QM6A 3RHFA 1YRYE 2O2GA 4W5HA 3S27A 4MCHA 3VYWA 4WLUA 3L6CA 2WVHA 4B8ZA 5CVTA 3RC9A 2WFLB 1C3EA 5F9FA 1S96A 3EZGA 1QYCA 4G6ZA 3WNQA 1B26A 1FLVA 2PXXA 1JQBA 3BT7A 2ST1A 1DJNA 3U7RA 1YHYA 5BSVA 3Q85A 1GUZA 1OD6A 1YQ9A 5DI3B 3RC7A 5H4GA 2GO7A 3ZE8A 4ZMSA 5I4CA 2BI4A 1L7PA 3MPUA 4NOJA 1MEOA 4BXOB 1LQUA 1N5KA 3DBLA 5JVDF 2BGWA 3IQGX 1QF9A 2FRVA 1T4MA 4CMGA 2P67A 2PMWB 3EXAA 4RF4A 2A94A 1KQGA 1CDDA 3K1YA 4NFSA 1I1OA 3ZIAA 1U9ZA 3WICA 5M7EA 1XNJA 4KIJA 4AO7A 1SCQA 1Z0JA 1W1UA 4F2DA 4WJLA 3C45A 4YAJA 1P17A 4OV6B 2HHLA 3I9NA 2FCAA 3T3HA 5DGHA 1E7YA 3D81A 4H35A 3HUDA 1ZD5A 1W29A 4MW2A 4Y7DA 2IL1A 5DTJA 4ZOEA 1HYEA 3TFQA 4KO4S 4H1TA 2AFHB 3B6KA 4BLQA 3MT0A 3OG9A 1O9BA 3MFYA 1O0SA 2YWBA 3ZLVA 5FFFA 1SVOA 2EP7A 4PG4A 2C59A 3Q6NA 1L9KA 3A1CA 2RIPA 3R0ZA 3O4VA 1Y5LA 2XTMA 3RK1A 2JAWA 3WLNA 4AS2A 5JNVA 5EKXA 2RI0A 4IH9A 3F3KA 4FYHA 4EBBA 2HQBA 4BRWA 1H2FA 2I6GA 3UWOA 4EX7A 2KBEA 3TD9A 2OZPA 1HFJA 3HJGA 2Z4TA 1P45A 1T6NA 3B48A 3C1TA 3IDQA 3GLUA 3IDAA 3O92A 3QFCA 4GGPA 3T7JA 4C7VA 2QQFA 4ABTA 2I8AA 1T15A 4MYUA 1L5NA 2H00A 2O2YA 2AL7A 4QOJA 5FYDA 3S1AB 3UHOA 4WXRA 1CNMA 5FOVA 3TEMA 3DC2A 1H2ZA 3OZFA 5IFLA 1JR2A 3IULA 1RXIA 2H1SA 5JAUA 3OZWA 1PE0A 5JCJD 5AVZA 1HBJA 3B12A 2AFHA 3RUPA 1UT8A 2IV7A 1R5NA 1T0BA 4ZXPA 4UVIA 4DLRA 2HR1A 3MEQA 3ITEA 3ACDA 4B3HA 3LT4A 3JQ6A 4ASUD 1CZKA 2WD9A 4QREA 3S2FA 2J5RA 5EPEA 2Z9CA 2ID8A 4JX8A 3ETEA 3C15C 2GA8A 2D5BA 5DYYA 2PKCA 3CPSA 2AF4C 5I6DA 3HYLA 4LF7B 1BMFD 3FOZA 5A4KA 3WK7A 3NIWA 4C7MA 2AJTA 2E3JA 1GARA 5KO2A 4ZO8A 3KHKA 4C4PA 3WGUA 2CHFA 1CJTC 4AURA 3K9HA 4S04A 2QL7A 3N76A 1Z56C 2QP4A 4KKVA 2O4CA 5HF5A 1N2IA 5EYPB 4N7JA 8AT1A 2HU7A 4PTYA 4TTTS 5H8WA 1ZZEA 2HSWA 1P2SA 3EA0A 3UH0A 2HCJB 1A1VA 1U1EA 4UMVA 1IHYA 3A6FA 2C99A 2F1OA 5CBKA 1MOZA 1RMTA 1T9KA 3PL5A 1QV9A 1PT8A 3BZWA 3CN9A 3G9TA 1NNI1 3FFTA 1FUYB 2P1ZA 3SD7A 4QNMA 4E1AA 4R71A 3JQFC 3EEIA 4L7VA 4K03A 4W1RA 4YAUA 1JLRA 4OOEA 1L4FA 3IQHX 3NDRA 3GHHA 1IJKA 1I4DD 5FI0B 5AOCA 2DLCX 3D7MA 3PITA 2QVLA 4A8PA 3LKVA 3DT8A 3T7TA 1YA4A 2N0SA 5TQ0A 3GAZA 4G5RA 3SSMA 1XQ1A 2A9KA 1EI9A 2CK3A 1MC8A 1G17A 5IARA 4PHFA 4JVLA 2GA9A 1SVIA 3N05A 3BXGA 3QLUC 2HB6A 2PANA 1TFUA 2WKPA 4J9VA 3U4AA 4XPIB 2CHVA 1FNSA 5AM5A 4U7DA 3ZY4A 5LZ4A 1N5JA 3K35A 3NX4A 1YS9A 2GEDA 3BCSA 3QBTA 2QNBA 2YN0A 4AF8A 2ZUWA 1Q92A 3V2IA 2GPNA 3K70D 4E5NA 1VPWA 3G0HA 2B8EA 1EIZA 3L8FA 3BMOA 3HACA 4HS4A 3W1EA 1FSSA 1HI9A 2HLHA 4PLZA 4P93A 1ILWA 1T0UA 2GJ4A 4AJKA 3M9LA 3GOHA 1TI7A 5SYAA 2FRDC 3GRFA 1L6IA 3C3BA 5IAOA 1DEXA 1MPTA 3DLPX 3HCAA 3MJHA 5EJGA 4F96A 1IOWA 3KP1A 1CQIA 4M46A 1RYDA 2HF8A 4TV9B 2VP9A 1EFAA 4B3MB 3EPHA 4ZVNA 2VJMA 4AMYA 5B6PA 3ESAA 3V1MA 3VAZA 3K30A 2MOKA 4A15A 2DERA 2B1GA 2QS9A 3RVQA 3T1QA 4BIIA 1XKTA 1P2TA 3UEOA 2VAWA 3VO2A 4B6PA 4IZOA 3NCTA 5EHGA 3A04A 3TI9A 4OBBA 2AMFA 4NKRA 3G1UA 1M1XB 2NV2B 1K6IA 1R4NB 2AMYA 4P0PB 4KTTE 4MJ7A 3TQRA 1DEOA 3UJ8A 3V8MA 4DBLC 1EK0A 3PQ8A 3UKJA 2R1TB 2C42A 3S3TA 4ZGBA 3FWZA 1FJHA 3OQMA 4TSFD 5F98A 5ALJA 4F85A 2C83A 5IT4A 1B2LA 4PEVA 4LFBB 4QIHA 4YP7A 3EIEA 2YINC 2CCKA 2C7GA 4LCBA 4MVJD 4BQIA 2J3HA 1JFRA 1ZAKA 3U4GA 4U00A 1OXUA 3RVJA 2B7CA 4C05A 2B8WA 2ESRA 2OXEA 4BN5A 1L8AA 4GDFA 4UUMA 3LK6A 1RQNA 1WPRA 3O8OB 2YV5A 4IIXA 4L5AA 3KHUA 1SKYE 1NU6A 3FWHA 1T5LA 2CXNA 3VR6A 2ZZMA 4G1UC 5ARDA 5IYZF 1IEWA 1Q0ZA 4C4RA 3IKJA 4PO3X 1KI6B 2QN2A 2OHHA 1GRNA 1XALA 4MVWA 4UUPA 1PV2A 2PZ8A 4MR7A 4S1NA 3OFKA 3RG2A 3K1TA 3L7IA 3HVHA 1X7XB 1TL7C 3A3OA 3IB6A 1DKPA 1ZA1A 1PFVA 3WMFA 4WFJA 5C5DA 3TZKA 2WM9B 3LYLA 1O9GA 1S3FA 4YPFA 4BATA 2VJCA 3A14A 3UTDA 3VH1A 3BVPA 1GOTA 2AE2A 1ZNQO 3H5TA 9GPBA 2GNPA 2HMSA 2ODBA 3AHDA 3O4HA 2VSOA 4MW5A 1G7SA 2J4FA 4R1MA 1ZRSA 2F3RA 1V26A 4DJDC 1BQ3A 1CBUA 2WYWA 4FSXA 4I4TB 2NYAA 3D6AA 5IWAB 1R15A 2I1WA 2RAPA 3EK2A 4L8FA 4QLAA 4DW8A 4JOQA 4ZEOA 3R5XA 4Q7LA 3SBEA 2UZ1B 4I3FA 2P2DA 1G21E 4PHTA 4QEKA 3K2BA 1SUCA 3K05A 1MZPA 2ZRQA 3JALA 2W2VA 3M4NA 1DRJA 3GQBA 1L5VA 3THYB 4HXEB 4OX9Y 1HV8A 1J21A 2CEKA 2J08A 3I0NA 1UC9A 3F8TA 2QTLA 1BU5A 1W6UA 2AGVA 2P8SA 1BN6A 1UINA 2EEZA 2AH5A 5TPZD 4US2R 1Q1NA 1VOTA 1GY8A 2B4RO 1NBMA 3AVPA 1T2DA 1IJBA 3G7SA 4UHKA 4PYRA 5LQDA 2IKSA 2BKAA 3PUZA 1KERA 4RFLA 5DK4A 5TNXA 1DX4A 3ZWPA 5KNDH 4RJLA 2HN9A 2WG0A 4QPCA 1K08A 1ECLA 5KREA 1ZR4A 1MHPA 4UM7A 3TL3A 5EMNA 1UC5B 5EUBA 5BN3A 1GQ2A 3FJYA 1MG5A 4YCAA 2H1OA 1ZMXA 2E55A 1VSUA 1F8XA 3HI6A 4REMA 4Q3EA 4ZEMA 1GQFA 2CJYA 1IN1A 4WOCA 4CF4A 1NE2A 2BZ1A 5AK3A 4LDAA 5AM0A 2PTGA 4P35A 4N7MA 5FH9A 3HMKA 5PGMA 1TVEA 1G0OA 5HA5A 5EE3A 1UK7A 1BDMA 1EM6A 1T4DA 1T9DA 2DHQA 3WB1A 5HWSA 5K3DA 5MF6A 4XM2A 3JYNA 4B34A 4D5EA 4DCNA 2XE7A 2P0AA 4KV9A 2IITA 3C6MA 3CB4A 3DDZX 4ZKEA 1NW3A 4Y67A 2AF3C 1VRVA 2XDYA 1O57A 3LU1A 4N18A 4BJ3A 1XT6A 2QUIA 5KSPA 4DLVA 2G1PA 5T41A 3NUZA 5G3YA 3TIIA 5KYKA 1QKKA 1AUPA 1PL0A 1TKRA 3IA2A 1V1RB 1UBKS 3RAFC 3IPAA 4LYYA 2J87A 2WIKA 5DNEA 3RS0A 2IHBA 4KLAA 1K5PA 3VC3A 2XECA 3AF4A 1VCNA 3GZJA 2XUZA 1VIYA 1Z62A 4QJ4A 1P9LA 4NU5A 5HTOA 4RS4A 1DDIA 2HF7A 2AXQA 1H93A 4ZOQI 5L3VA 4CGZA 1U4OA 3BXPA 3EODA 3PUJA 2CCJA 5B2EA 4FFNA 4MVJG 2WAMA 4Q9HA 4ZC8A 1YGPA 1Y1TA 5EFOA 5JWRA 4FBLA 3FUWA 3CT6A 3H2YA 3W8DA 4B8YA 2WRZA 1K5DA 4PC3A 2QRHA 3BFVA 5CEJA 3IP9A 3P96A 4US1R 1QVAA 2HJWA 2OLKA 1Q19A 3MMZA 1J2UA 3DEJA 1CG6A 3EIQA 2R65A 4L5CA 4UCFA 1U4NA 3PPYA 2CE7A 3UXYA 2WA1A 3NASA 2FSSA 5G0TA 4B43A 4D3YA 4HYYA 2HPVA 3SBDA 3ADKA 2BEUB 2VDJA 4ZP1A 2V6BA 1WF6A 1IZ0A 2EIXA 1LSUA 1NW7A 3U7EB 1KTIA 2QRVA 2ZOSA 3GJTA 5KSOA 4HQRA 4CCSA 4AJLA 4CM6A 4F97A 3VZPA 1W47A 1K86A 1OXXK 1VZ2A 4CG3A 2O59A 3Q9SA 4QXOA 1PBNA 4XDHA 1AHPA 4QKQA 1RPNA 4HZIA 2CYCA 1OUMA 2RHMA 4MWZA 4TLDA 4XAQA 5LKRA 4TQ9A 1TTHA 4UREA 3U3ZA 5A0TA 2GZMA 2GBIA 2QX8A 3EVTA 4OK3A 4TS1A 4U9IS 1EUDA 1NSTA 3AP1A 4URZR 4RK0A 3UXMA 3PXCX 3MTDA 4ZV9A 2C4TA 2VHZA 2QTBA 1CZOA 4LC0A 3WP0A 5B6JA 2QUBA 1GRVA 3K4QA 1F4VA 3STVA 3ORSA 5DRTA 1RPAA 3OT4A 4MUNA 3LY9A 3ZYCA 4GIBA 1U81A 3KSRA 3TOXA 3AIOA 2E4UA 3MXOA 2EGUA 3FF1A 3NZEA 5JPIA 2RHLA 3AO0B 1OYWA 4DT1B 4ZJUA 3KAPA 1A2KC 4Y1GA 5K51A 1JF8A 2VDLB 2VOEA 3GT4A 3GUVA 4RPIA 2PZGA 1UOPA 3AFHA 2ZIGA 3KXDA 5D6NA 3VR3D 3OCWA 3V2UA 2QBYA 1X7HA 5AVJA 3UT5B 4PGFA 2FEPA 2BMEA 1IHPA 1TXGA 1YK0A 1IQRA 2GLUA 1BGXT 3CF6R 4ZZ3A 4I55A 4XYLA 3TG2A 5EMKA 1WDWB 1NLZA 3P19A 2IXAA 4TS4A 3ZTWA 4X62B 4PZ9A 1O7JA 3GJSA 2GS9A 2FMHA 1D7AA 1NYLA 3KXLA 1MB4A 1RI5A 4EO7A 1QYDA 1BOOA 4X3OA 2ZDQA 1IN5A 2P1RA 3NEJA 1VFNA 3AHIA 3HWX1 3G79A 2IV2X 4WN9A 4JKYA 1L4UA 2ORWA 4MB2A 4BEWA 2CLCX 1IZZA 4KWEA 5G40A 3ZNPA 2JFGA 3UJPA 1T1RA 3S40A 4OMCA 1DO2A 4RY2A 2NUBA 2DBZA 2BMJA 4J6EA 1QTNA 4IEIA 2RHTA 4TTPA 1CIJA 3K2EA 1M6HA 5LWQA 1YR8A 2CZQA 2M1ZA 2QD5A 1GCGA 1P75A 2F8LA 4LE1A 5LZ2A 4B2IA 1Z0ZA 2NVOA 3NBUA 1RKVA 2WV7A 5L7WA 1GA1A 2EZ9A 2G07A 3I2YX 3AK4A 3IDZA 3H75A 2XVMA 3OQVA 4YHBA 2Q99A 3BCHA 3DGFC 3HUEA 3EVCA 4ZCPA 4M0EA 3IUMA 2ZIUB 3NHZA 4TLCA 1NGSA 3GA0A 1NONA 3IBGA 3AV3A 4RVUA 4YQEA 5I7EA 3DBOB 2BM1A 2VPIA 4PAWA 5TDHA 2BOVA 2H4HA 2IP1A 1I7LA 3GO4A 1ORRA 5G1OA 4MUMA 4MPPA 3GXOA 2A7QA 4G85A 4F9GA 5A5FA 1L8QA 4P3XA 1L5RA 2DWOA 4OQXA 1U8TA 4I2NA 1T2CA 4M98A 2R6DA 4GBMA 2JS7A 2DT8A 3TLKA 4M38A 3U3KA 4TMKA 3ZWVA 1O2DA 1ZD4A 2R6HA 1GGHA 4ND6A 2WG2A 4WESB 4BKOA 5FDFA 5KVSA 5A6SB 3DFUA 4QJIA 4Q6BA 4AUKA 2R6GA 1DRUA 4PS1A 4UBIA 2IYOA 1NW9B 3OZ7A 4QYIA 1VYTA 3TKLA 1H65A 2F9FA 1CY2A 3WJ7A 2XUOA 1R0CA 4IO0A 4M0UA 4E1VA 2JJMA 1PZHA 3GFTA 1I7DA 2FR8C 2X22A 3AGQA 1UXJA 4WPGA 3EOZA 4JENA 5DYTA 1A4UA 3TZLA 7AT1A 1J0XO 1MW9X 2YHIA 1CEYA 1TEXA 5BQXA 1TGVA 1C3LA 4QAQA 2R96A 2WM2A 3OHMA 1RTTA 4U3JB 4ZMBA 3QJGA 3HKEA 3ZWXA 3CF0A 3I5YA 1GVHA 4EKEA 3MJRA 1GPH1 3HDVA 4UOQA 2ZQZA 1SO8A 4W5RA 1IAVA 3E3AA 4G5YA 1NI3A 2VF8A 1IIBA 1U94A 2I8CA 4B73A 2H2HA 1SKUA 4ZWNA 1CHDA 4II3A 1ONSA 3LCVB 3RSSA 4BE9A 1J1IA 3GRZA 4BUJA 3KJIA 5JSYA 2K4MA 3UIEA 4MYSA 4E2YA 1VA5A 3GAMA 1QTRA 2IODA 1YB5A 4JJAA 1I0LA 3Q9NA 1UXGA 1MB9A 5EZ5A 1UBGA 1JJFA 5KVQA 4JS0A 1XYVA 2MSNA 1M6NA 2ZR8A 2P9QA 3H83A 3NWBA 3QXXA 1AMUA 2P68A 3PDIB 1T26A 4YCSA 2B6NA 1GTMA 3H7AA 4Z99A 1THGA 2R7NA 4OUDA 3Q12A 1JV2B 4MW7A 1V6SA 1IDN1 1QG0A 4HDKB 5JBNA 3AHEA 1N7GA 1SBTA 1NA5A 4ENWA 5B30A 1RC8A 1IL0A 4KBYA 1X94A 4YVFA 5DM1A 4XYGA 1EB9A 1P5RA 2ZJ0A 3D3EA 4D4KA 1K6XA 4J8PA 3LZCA 4QBGB 1Q77A 2TECE 4WBNF 2WHPB 3QPCA 1OWLA 1T34A 5JANA 5MN4A 4QJBA 1KI3A 3IUNA 2F64A 3B85A 1VIDA 2XBLA 2XWQA 2C9ZA 1KRHA 2VK1A 2CUTA 1PYDA 4FMBB 3SY8A 1B0AA 1GGNA 4IPTA 3U4HA 4ZGWA 1NX6A 4E51A 3A2LA 2HEGA 1BVHA 5JD6A 1VXRA 5F73A 3N39C 4J2HA 4DS3A 1JIKA 3RVRA 3G5LA 3QFFA 2VSXA 4FW8A 4HX9A 5KSWB 3PUKA 3EVGA 3FTDA 4F2HA 4TKLA 1C4WA 3ESZA 1E6CA 4N5IX 3L82B 3KRTA 2HA4A 4OYHA 16PKA 5TPWB 4YUWA 5I3ZA 1ZJ5A 3OQOA 1EVIA 2NGRA 5JD3A 3C0KA 3LC1O 3MCVA 4QTTB 5IHXA 4IG4A 1JWBB 3RSCA 5CEEA 1TB4A 1S4QA 2HJGA 3ETCA 4B9AA 5G4LA 4RZQA 1G1MA 2ALJA 2MSCB 1HO3A 1WXHA 3CFYA 4AVYA 2QDXA 1XZDA 1ZRHA 1DX9A 3D64A 2C8VA 3K9GA 1ZCFA 3OLZA 4M1KA 4JJEA 2PGOA 1QH0A 3DHVA 3AF6A 1QIGA 3X1YA 1AZWA 4LXQA 4GC9A 3QNUA 1KSGA 3ZCPA 4TKVA 4RTLA 1YU6A 1F9AA 3ZIAD 3MTQA 5FEUA 3IP8A 4X1YA 2PX6A 3DULA 3ESXA 4YAFA 3EZYA 2LCIA 4N0PA 3EXHC 4ND8B 3DE6X 5L8VA 5AKLA 1UMDA 3GF4A 4KE9A 1GG8A 3THSA 4TSRA 4FB4A 5CBPB 3CCBA 5B3JA 3K6SA 3TTWA 3VTKA 1XKXA 1A5SB 1PT5A 4M0LA 4MV6A 3GZNB 3A0UA 4O0LA 2NVWA 1P91A 2HLDA 3PQ2A 2X9QA 1M9NA 4Y6QA 5AK0A 4M1OA 5J5VA 1NP3A 5BPFA 4Q12A 2ZZKA 4EHFA 2HTFA 1DBIA 3D4NA 3E2PA 1KC1A 2ZRAA 2Z1DA 2Q62A 3N2GA 5LA6B 4ZQIA 4J29A 4QRDA 4MQBA 2PRZA 4K1XA 1C2YA 1PT6A 1G60A 2GQ0A 4Q3KA 1V9SA 3KTAA 2D7CA 3UN1A 1EG2A 1SHZA 2OEPA 2QAGB 1EP9A 3HV0A 5KNCD 4JXXA 2II6A 2PH3A 4U8HA 4FGWA 4W5WA 3I12A 4WACA 2C8LA 5IHPA 3OHSX 4D4MA 2B8TA 1AKWA 2PS1A 3N2ZB 5ENVA 4PCVA 5DTIA 3MJFA 4NXMB 3QUSA 4KXYA 1GTSA 4TYQA 4BXOA 2HIMA 1T2FA 4GPIB 4FE3A 2HA6A 1DC3A 5IJAA 1V3UA 5LOVF 1F51E 3AR6A 4I6EA 4MP3A 4ZGGA 2E6KA 3ANTA 2AFIA 2EQAA 1JJ7A 3AKDA 5DBGA 5HOEA 5K0CA 1IPEA 1V35A 1KZHA 2RGAA 4M1TA 3RBXA 1IM5A 2QZ9A 3KJGA 3C8MA 5LNK1 1R66A 1ZH6A 5EJ7A 2IDKA 2JHGA 2NNLD 3I6IA 3TSWA 3RTBA 4QL3A 3ZY6A 5B57C 3IHLA 4RTQA 2NG1A 5H83A 4TZTA 3H8VA 1B43A 1JSZA 1Y1PA 2PD3A 1GEGA 2PAAA 2OB2A 2CMGA 3WJ1A 2YBDA 2R8ZA 4WZBE 1DDGA 3Q2KA 1EINA 1R0SA 1J2TA 1OROA 1JLSA 2XMZA 3D6NB 4NZYA 5J59A 4AM8A 1K98A 5K8IA 5EZYF 1K0FA 1FNNA 3PPVA 4C2BA 2CXQA 4NCXA 4HNUA 5F3WB 2WMDA 3ZD7A 3PL1A 1OCEA 1UP4A 2XDAA 1WPXA 2DJ5A 2HMAA 4KRFA 4RZUA 1TECE 3PNSA 1HYBA 5DIZA 1Q1GA 3K2QA 3RF7A 2CMKA 3I6YA 1NY5A 4ES6A 4BEVA 1YMQA 1OFGA 1TMGE 4JDPA 1R6AA 4EW2A 3GNTA 1E2PA 5J23A 5ED4A 3WKBA 3LLUA 5CXQA 1SIBE 4XSHA 3AU9A 1ZVVA 2IYEA 4MW6A 1OIVA 3MQFA 3WO1A 4OXRA 4QEZA 4DZZA 1JHDA 4OHPA 3TXXA 1QB8A 2IH4A 4FFRA 1RVV1 4WXMA 3RFCA 3SQXA 1VMEA 2QGZA 2UZ0A 4Y6OA 4XUGB 4QE3A 1YFZA 2GRAA 2V6MA 1Y3IA 9ABPA 3K8OE 4F21A 3NP9A 5DTEA 2IZ5A 3VYRB 1D4FA 2W7TA 3EC2A 4TM8A 4Z7JA 3L93A 1W0CA 3IJEB 4Z8YA 3C98A 5C18A 4QQNA 3N8IA 2H06A 1HLDA 5A9RA 2OBNA 5CH3A 1NKVA 3JQAD 4V03A 2XI4A 3BPSA 3Q40A 5LUAA 1N0IA 2VBCA 2B9VA 1XNRB 2A1UA 2ZDHA 4HWGA 2ZUCA 1EIWA 2V7GA 4S2UA 1QNFA 4D5GA 2FFQA 4BNGA 4Z4QA 5IUKC 1RI4A 1N9GB 2I1QA 3ZV3A 1D0VA 2J31A 1DRWA 3FNQA 1R18A 4OP2A 4RHYA 2C0PA 2WY2D 1HUQA 1A8QA 2GSWA 2CF5A 1JBEA 2VPWA 1E2JA 3M1AA 4Q3LA 4EEXA 3WYNA 4DRXB 5EMMA 2IW1A 1XXLA 2QTFA 3UJBA 1KTVA 3F74A 3OESA 3OT5A 5HS4A 3T3NA 4B31A 2FXVA 1P6XA 5C7OO 5J1SB 3O3OB 4DMCA 3FLEA 3V4LA 4V0RA 3QELA 4EELA 2A57A 3FZEA 2IU4A 1BVYF 2V4ZA 5JS7A 1SOWA 1KMIY 1DQNA 1ZU5A 4KX5A 4F93B 3PQFA 3CG0A 1F2TA 1E1CA 3GJ3A 1PQPA 2OSBA 4GM4A 4JB0A 3OM1A 4AJ9A 1F3OA 1JU9A 4RFSA 4EVIA 1T9AA 2IWRA 2I2WA 1UEXC 2Q4TA 4G2TA 1Z2PX 2QI9C 4NCIA 3MILA 4ZT6A 1DC7A 3L9WA 5CU7A 1MRZA 1QRDA 1DIHA 3NC4A 1XJ5A 3OU2A 3ZWKA 4H6PA 4KQJA 5IH7A 4JI0B 1SCUB 1V5EA 4H7IA 2GXSA 3D4BA 1ZSYA 4PZ0A 1ZH2A 2R2GA 1RLMA 1XWIA 1JSLA 2E4ZA 3JQGA 3KKLA 1KFEB 3NOOA 4P22A 4P80A 4WLOA 5F3RA 1M0EA 1OLOA 3OE7A 2CB0A 3BDVA 3GYBA 3U3DA 1W49A 2IUYA 3FOBA 2VJLA 4TKMA 4CJXA 3BK2A 1FJXA 1ZLXA 3R3ZA 3MS4A 4BNMA 4AJIA 3GFPA 3I61A 4UEJA 1AS3A 4TYWA 1FYWA 3IMGA 3TGWA 4KO2S 4ZHQB 3STTA 4F06A 1E63A 1QYXA 1U11A 3FTCA 5A4AA 5HZKA 4MW1A 1FA9A 5EP2A 1R7RA 2V5VA 3S5JA 3FVQA 1F8GA 3NBXX 4GKKB 3I5AA 1XV5A 1ULHA 1JXOA 1Y8AA 4IF4A 1HZZA 2I76A 1U1FA 5BN4B 1H1TA 3ZD8A 5KHOC 1NKTA 1EFVB 1NIPA 5L3QA 1FSFA 2BMFA 4I6JA 2HHCA 4NL4H 1S1CA 4QULA 4YHHB 1GG5A 1RYBA 1I1HA 3IPCA 3D7LA 3VU9B 3JVVA 3HJTA 5ILOA 2YUTA 4IF6A 3WDLA 1FQOA 1NQUA 3HPQA 1GR1A 4LQLA 3THXA 1AXEA 2QG6A 3EFOA 1XNGA 1EP1B 2CLEB 1K92A 5JI2E 5BWCA 2RGGA 4UVDA 3MJCA 1WXDA 3O8QA 5LU9A 1DINA 2R7LA 3F7NA 3WIBA 3HZRA 1ISJA 3ZBTA 5TV2A 4LN1A 3T1TA 1HDOA 1CSEE 1HGXA 2ZRHA 3D7NA 1T8SA 3GBVA 2PZFA 3RUCA 2A14A 2X4GA 3A3PA 3SIPA 2R5NA 2JFZA 2YCLA 4GE0A 3QPVA 5T4HA 5LKAA 3PXBA 2YFQA 4CMHA 1KIAA 1ZNXA 1LZKA 1QH8B 1E1QA 1U0OC 2Q2QA 5F7ZA 4ZYUA 3L1JA 1PR6A 3FROA 3G1TA 3PG5A 1J90A 1LF0A 2OZKA 5LZ5A 2VJPA 2GRJA 2CDRA 2AOXA 4EB6A 2IEZA 2NX2A 1L7QA 1BX0A 2QRGA 4K7JA 1H2WA 4KVFA 4X7MA 1T3HA 2VH1A 4CEJA 2O8FB 3KSMA 3RNLA 1IOVA 2VP6A 1TJNA 4RY9A 3SEAA 2IDMA 2QDKA 3QPBA 3LJKA 4OU5A 4XJVA 4AG5A 2XV1A 3BJMA 4F8JA 4L5YA 3RROA 2ZB3A 5HJ5A 4JODA 5JDCA 4QQKA 3N5KA 4TT8A 2OILA 5EC8A 1L3BA 4EECA 4NBWA 4HGQA 1W5BA 4E22A 2E2WA 4P5PA 3LIIA 2BGGA 1IN6A 3EZ2A 3IP5A 3PQ4A 5D3ZA 1Y8RA 5EVCA 4CQMA 4DSZA 1YACA 3JZAA 4HEA1 4EO4A 3H3FA 4K0RA 1PO7A 4P1ZA 1YUMA 2RC5A 2GPSA 2R1VA 5JZ9A 3ND9A 1WP4A 1TT5A 2ANCA 4U0JA 1N2ZA 2ZYDA 4YJ3F 3SSAA 4LRXA 4Y0NA 4MLZA 5CDFA 4DLWA 2R68A 1TJ5A 1X7WB 3A1EA 4XZ3A 2IU0A 4OQNA 3TZBA 4EY7A 4GSLA 4MP8A 1WOMA 4KAJA 5BOSA 1Z45A 3INRA 4A73A 4X8LA 5CX4A 1GZ3A 3EJWA 5CRIA 2WKWA 4E94A 4BO8A 1G8FA 1NYRA 4Q37A 1XZEA 2JLCA 1NN5A 2NSDA 2ODNA 3A4TA 3T0GA 1P9NA 5JZVA 3VTAA 2ETXA 3QVKA 1Z25A 4JQZA 4OHOA 2C7RA 3HZOA 4DYVA 1T36B 4OHVA 5DHUA 3G9ZA 1BEEA 3UOAB 2Q7OE 3O26A 2IKQA 2YOHA 3WGYA 4DQKA 2GXUA 4CKCA 1PN3A 4O5OA 1Y8QB 3IS3A 3QE4A 4LVNA 2OCYC 1IC6A 2QJRA 3L1VA 5F7JA 5AW5A 4ZVRA 5EHIA 5D5PA 3J7TA 3PQ6A 5KWJA 2I5PO 2NU6A 1RZRD 1N8SA 2MWMA 5IK2D 5IM5A 4F9FA 1U2DC 5AUPB 2C31A 2RONA 5T5QA 1C1XA 2WVJA 1A2QA 1QAOA 2JDIA 1PJBA 2X4IA 2Y2VA 3KK0A 3O94A 3O8DA 2PH1A 4O4JA 4DY6A 2H4WA 1KYTA 1EHYA 4AP9A 1USGA 1Z6XA 2JGJA 2VJBA 3SE7A 1IZ7A 5C5EA 1GPDG 2EW1A 3OD5A 1U2DA 1KHHA 1QVZA 4OAOA 1JSXA 1Z37A 2H9IA 4NARA 1EYZA 4UUBA 3NT4A 2OYCA 1PW7A 2FLKA 1BE8A 4ZDJA 2J33A 1USUA 2Y1WA 5IXYA 1ZQ9A 2REXB 4JBGA 4KVAA 1KPHA 2JANA 3PRYA 2P5TB 5HGXA 5HRCA 1DC5A 1H2HA 3A9UA 2D3WA 1LB1B 3OPYB 4GR9A 4HDMB 3GVIA 2GM9A 2PH7A 1FNMA 3JWGA 1KMHB 1DKUA 3OEED 4UZFA 4PTZA 4WECA 1SHJA 3FZQA 3ND8A 1KVUA 4BTLA 3LGAA 4MOWA 2R7MA 3NW9A 5A06A 5ITSA 1D4OA 2DPGA 4ZPXA 4IO1A 4QOIA 2FR1A 2GWHA 2ZWVA 1OLUB 2O4UX 2RHHA 1GUFA 3DV0A 1JFVA 1NN3A 4IJKA 4FI3F 4P4TA 4CCYB 1J39A 1USVA 2BR5A 2DAPA 2FZEA 1GKLA 3DDHA 4S2EA 1ILEA 1G291 1NMZA 1NUQA 1SWVA 1ZNYA 4U5XA 5DNVA 4RK4A 3OMXA 3AJDA 5B6IA 1SXQA 2X5XA 3LSTA 1Z29A 3PPIA 1GYPA 1QGOA 3V97A 1AN9A 4AICA 4YYEA 4E4TA 4QYWA 4CEHA 2WF9A 3MAJA 3DTVD 1JDUA 3PFGA 2VJDA 4YFYA 4F1WA 3C24A 3PR3A 1A4RA 2BMAA 3OQBA 2IE8A 2EJTA 4GGMX 1HTBA 2W2KB 3DW3X 4HB4A 4Q4CA 1H8ED 1EAYA 3FM9A 3GEBA 4NS4A 3FD8A 4OHBA 1VMAA 2AZDA 4R9RA 2DEUA 4G97A 1DU4A 3WRYA 5LQUA 3QXCA 3VGJA 3W3AD 3KT3A 1MAVA 1I6MA 3L8EA 2YWGA 4HADA 4QC2A 1DXHA 4CLOB 1EFPB 1K8XB 4HDRB 1ZD1A 3GJ5A 4U2EA 2QVBA 5B1DA 5CURA 1WXWA 3EMVA 5B1HA 2WT4A 3K4HA 4EG6A 3MJSA 4IQ8A 4Y2UA 4ZANA 4EY3A 3U49A 3JQBA 3GLVA 2IHYA 3OU7A 2J67A 2G9NA 1B1CA 3I9V1 5A0VA 2YMLA 3TMYA 1FNDA 3CNBA 1NFQA 3CX6A 3IR5A 3L7NA 7GPBA 3SJBA 3IEIA 3AHHA 1JS1X 4WKGA 1FC0A 3X2SA 1KEVA 4PC1A 2CLFB 1JL3A 4WLVA 1A9SA 5LNK6 2HBYA 5H02A 4LWZA 1FEZA 3B3FA 3MBKA 1AQIA 1VL6A 3FBWA 3TD6A 3STUA 3AUSA 2TMYA 4U7JA 3AF3A 5LYYA 1TVKB 2OLJA 2PUBA 4WBNA 1L5FA 4AXXA 5IAEA 5M29A 2XEXA 3LUPA 4YP6A 1E0AA 1KQPA 3DEKA 1H4SA 4HD8A 1YZQA 2CT8A 1RJ9B 1XJWA 4GOMD 3CUYA 4AMUA 1FXUA 2M6RA 4IRUB 1X7ZA 3AOGA 4MINA 2VTBB 3IVAA 2ZPAA 1ZL2A 3CMCO 3FYDA 4IV8A 3OKFA 3IL2A 1LPBB 1VJRA 2ODEA 2FWRA 4WKBA 4R2KA 5E6UB 1P1BA 3U80A 3FCSB 3RSGA 3M6XA 1QANA 5LJIA 4TZ6A 1ABBA 1HEYA 2HPAA 2MU1A 2P78A 2V5AA 4S24A 1NR1A 2M2IA 2YCBA 1H3EA 1CIVA 1GPLA 2Q1WA 1Q84A 2VCEA 2ZRLA 3MUOA 2G0AA 4GZ3A 3BH0A 3FBGA 3ORHA 2FX2A 1IFXA 5I8WA 1NNEA 2R4UA 3H0KA 3EQ9A 4RSRA 4EG0A 4PLFA 1JR6A 1XD8A 2J3EA 1D6SA 3IKVA 1W5EA 1A9ZA 4UXIA 3KZMA 5B1YA 2F9LA 1P18A 1ZDMA 1R27A 4XW2A 5H1YA 4WOPA 1ST2A 1UK6A 4AB1A 1PR0A 1STOA 1M34A 1ZCJA 3KSUA 2XGJA 1G6OA 2XPCA 4BLTA 4MV7A 2GK4A 4PGGA 4TLBA 2HJ9A 1WHSB 4K9RA 1LZLA 3I52A 3R44A 4GMKA 4QODA 2ZSIA 3G8DA 4KXMA 3R76A 4ZV7A 2WHPA 1PZFA 1AF7A 3DF7A 3T9CA 1EX6A 1W0KA 4BNNA 1TU0A 4MI3A 1CP2A 2ZAGA 3W79A 2GNAA 1KA9H 3T5MA 5F1KA 1OBCA 4OI2A 2J3LA 3PVZA 3TTSA 1YS1X 5B7QA 4R2WA 1H1DA 1BE6A 221PA 3AKEA 4EABA 9LDBA 3DZFA 4WFQA 5KU1A 2IIVA 3RO7A 2NUTB 3FYTA 4KWIA 2IU6A 4BX0A 5BV1A 1YE5A 3KX2A 2UYHA 3GN1A 5IVKA 2AN5A 3ACCA 2HF9A 5EHNA 4BBPA 3PNLA 4CYMA 1ADYA 3RYCB 4YNBA 4ARIA 2MHCA 4FQ8A 4BIMA 3IO3A 4ETNA 1DAEA 3G17A 3ZDXB 2HAEA 3LLSA 3HR4A 3MUFA 1XA3A 1L5MA 2EJWA 2Y4NA 4JITA 1Z0IA 1U1IA 3TW0A 1NW4A 1WMEA 1YDHA 5LMNB 4O3FA 3ZV7A 3HKDB 4GMFA 5JAPA 1MKYA 1YCGA 4B7CA 1RYFA 1EFRD 1X38A 1QFYA 2I1VB 4JVNA 1J33A 4JUBA 3KSAC 1WPGA 3C4VA 3FAKA 3ONWA 3ROFA 1HRKA 3LC2O 2C2YA 3BL8A 3HN6A 4D1YA 3WRXC 3OZSA 4Z4GA 2C57A 4N3NA 1QCZA 3PDIA 4X7BA 1ZGAA 1XGKA 1CZUA 5K3SA 1Z4PX 3KZXA 1C1YA 1Q0LA 5H0IA 2Q2WA 1U8ZA 2EATA 2E48A 2YVQA 4CDNA 1WR8A 3RYHA 2Y0BA 3HCBA 3NKVA 4CG1A 2TS1A 3OE5A 4WY8A 1XRNA 2Y1CA 3KC2A 4N5HX 4QU5A 1GGJA 2AYYA 3T3GA 5B37A 3S81A 4E7PA 3WGTA 1ATZA 4BYMA 4DARA 4WLFA 2W00A 2WVGA 4C07A 2CVPA 5JD4A 1GEEA 3WAGA 3K7EA 3FH0A 1NJ5A 3DPSA 4C0QC 2AHRA 3ORRA 3GT3A 2FY8A 1M7BA 1P29A 5COQA 1MQSA 3CO0S 3IKMB 1PR3A 4IP0A 3VJLA 1HT0A 1L7MA 2WVAA 1NNLA 1E66A 1UJ4A 3DXXA 3EUFA 4BLRA 3GLFA 1KDYA 1YRWA 3GRRA 2HWKA 1KMNA 4L5IA 4ESEA 4B3SB 4AZWA 5I7FA 2IZ1A 5I51A 4N49A 5GINE 2A88A 1KI2A 4LF4B 1LX6A 2HJHA 3DHYA 3PGMA 4NPAA 4YRPA 3SE0A 3ZH9B 4B81A 3P2IA 5KSYA 1OYYA 1IHOA 4WRRA 3PEEA 4HY3A 4WCDA 3G49A 1M8JA 2XCLA 1YBVA 1PNVA 2OCKA 1JG7A 3QBVA 3W8FA 3LUKA 2YWXA 1E5VA 4AF7A 3PRHA 1WY7A 4FEGA 3ZEAA 3BBPA 4AZTA 2CD7A 4JV5B 2R8OA 5DPMA 4ZVUA 4HVTA 2FFAA 5FLEX 1Y7PA 1T5SA 1AXGA 1UBCA 1XPRA 2B99A 1L8OA 3KD3A 5ALVA 5IAGA 2C4NA 1XU7A 2C5LA 2J48A 4M88A 3RV3A 4R2JA 2XQIA 3I9LA 2DH6A 1PWYE 2BE9A 3T54A 4NJOA 1LS6A 1MORA 2HV9A 5AW0A 3ZHYA 2DR2A 2WZCA 2WU4A 1GN8A 3N0VA 1CUWA 1EDZA 3DR3A 1JNXX 4HH3C 4PX5A 1PK7A 1CJSA 1UDRA 2J3JA 4H2DA 2HV8A 4GKBA 3HDJA 4XR9A 1FK8A 3DBHB 1R4AA 3OM0A 4QSHA 1UAGA 5KJEA 3SZMA 5A2QA 1FJ2A 1ORTA 2PZEA 3IT0A 3M1YA 2ATXA 1NOKA 4KACA 4JIGA 3C3JA 4BYGA 5P21A 2OYRA 2K7ZA 4C9BA 3MMSA 4B75A 2MR6A 1ULAA 2ORVA 2QMQA 4F5WA 1TCAA 2PHZA 3F71A 4JOCA 3BJZA 1LPOA 2FN8A 2FW0A 4R8LA 1LNSA 2JGKA 3L06A 4HQLA 4BHTA 2PRIA 2J3MA 1C4OA 2FEMA 4YRSA 3NYRA 2WU3A 1XEWX 1DFGA 4MHTA 2BEVA 1E0SA 1CB7A 1GO2A 2VNJA 2FZ5A 1OFVA 1ZU4A 4OQFA 3WS7A 3ZJUA 1Z22A 4O2AB 3D5TA 4B40A 3HNOA 4DR5B 1F2UB 3QK7A 3DTVA 2Z5GA 4AX8A 4LYHA 3HUFA 3T4PA 4RIIA 3ZW7A 1CJCA 3V00A 1Z38A 2EEPA 1EBUA 1U3UA 4BQOA 4QXAA 1PDWA 2PZKA 2RGYA 3SF0A 3KR0A 2BLNA 3R40A 4EEKA 3D6JA 4MS3A 4H31A 3G5AA 3SDBA 2PIDA 1W36C 1ZXBA 3U3XA 1P1CA 1OX5A 1QRAA 5IZCA 3QNMA 1W36D 4JI8B 3QE9Y 1C7ZA 1TKAA 4JP1A 1CLEA 3AI7A 2F90A 4KO8A 3FGZA 4PRZA 4G0QA 3TR6A 4HLDA 4GRAA 2OMKA 5FBHA 4JYBA 1RYNA 2D1TA 4LSZA 3NT2A 3U9LA 2J5BA 4PNZA 3H5IA 1RWKA 1XZAA 2C2BA 1F8YA 3CZCA 3K20A 4KN5A 5CDSA 3CVVA 4KFTA 2FR0A 2IXBA 2XT6A 5AKEA