4LYEA

Crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with substrate hopda
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
276
structure length
276
Chain Sequence
MFEQFESKFIDCDGIRTHYIEMGEGDPLVLVHGGGAGADGRSNFADNFPIFARHMRVIAYDMVGFGQTDAPDPAGFAYTQAARTDHLISFIKALGLSKICLIGNAMGGTTACGAALKAPELIDRLVLMGAAVNISPDDMVANRDDLAAVMSYDGSEEGMRKIIAALTHSYQPTDDIVHYRHEASLRPTTTAAYKATMGWAKQNGLYYSPEQLASLTMPVLVLGGKNDVMVPVRKVIDQILAIPQAIGHVFPNCGHWVMIEYPEEFCTQTLHFFGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A substrate-assisted mechanism of nucleophile activation in a ser-his-asp containing C-C bond hydrolase.
pubmed doi rcsb
source organism Sphingomonas wittichii
molecule tags Hydrolase
molecule keywords MCP Hydrolase
total genus 99
structure length 276
sequence length 276
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lyeA00
4N5HX 5K3AA 2GZSA 2H7YA 3BJMA 4UUQA 2ECFA 3BF8A 1CLEA 3H1AA 4AMYA 5DTJA 3ZLTA 4J0IA 1EH5A 4ZI5A 5JD4A 3C45A 1E8NA 4GI1A 5CURA 1MAHA 4MWSA 4NZZA 2PX6A 4OB6A 4AZ3A 1TCBA 5JAPA 1BCSA 4OU4A 1S8OA 2E3JA 4C01A 4K6GA 2DQYA 2AXEA 5AICA 5ALJA 5K5EA 3I2HA 4DIUA 2OCIA 3O9MA 5EHXA 1ETHA 4DNFA 4DYHA 1MU0A 3WWEA 5LZ2A 4PSCA 3V1LA 3O9VA 3IUMA 3STXA 5HF8A 2OGTA 4BAUA 2JGKA 1QIEA 2XQKA 3WK9A 3K9BA 4C4ZA 5AI5A 2OQVA 4KACA 5E4JA 1BEZA 3H1BA 2B20A 4XIIA 4QWMA 1ZI9A 1CUXA 1DINA 1FFDA 3F9CA 4KAFA 2QRUA 1NX9A 4BAZA 5I7UA 4EA6A 5CT5A 1CUWA 3D7RA 2PBLA 4H7KA 4L9AA 4Q05A 3C6YA 3E3AA 2J3DA 1CUZA 3LIPA 1LPMA 3O4JA 5E2IA 3H2JA 2DFPA 3C87A 1QTRA 3WWDA 3RARA 4OU5A 3A70A 3WJ2A 5BWCA 2JBWA 3F97A 3RM3A 4GLBA 2XDWA 1QO9A 1HDEA 2BUBA 2XUPA 4IH1A 1T2NA 5ALHA 3UUFA 5CH3A 1G66A 5ALXA 3F8SA 5I9IA 4UHCA 3AZPA 3M81A 5JD5A 3ESCA 4NS4A 3AILA 5AKHA 5AP9A 2CEKA 3LIIA 4QEKA 2OCGA 3STVA 4MEBA 1TRHA 4B0OA 5F4ZA 4LHEA 1XLWA 1BS9A 1N5RA 3W05A 4I4CA 4Y2JA 5DYWA 4UBKA 1K6EA 1E66A 3Q8WA 2RONA 3QYJA 1JJBA 3WWCA 2RGUA 3OTQA 4DMCA 3FVRA 3I6MA 1XLVA 1XQWA 3M82A 1CPYA 2J4FA 5C8ZA 1FSSA 5T4EA 1EINA 4M0FA 4X93A 4K6HA 4J03A 2DHCA 5FUMA 4QDXA 1R9MA 1JI3A 2ZSIA 2BGNA 3FAKA 5KBYA 4FWBA 1XRQA 4EY6A 1ODTC 2PUHA 3C8DA 5CT6A 4B81A 2WUGA 2XMZA 3FLEA 3N0TA 5JZSA 4TPKA 1ZOIA 3GFFA 1WPRA 4QZVA 4PSDA 1AKNA 4BZWA 4A16A 4KRYA 1E3QA 4L3WA 1QLWA 3DL7A 5AKYA 2AJ8A 2VJCA 5ALZA 5YASA 4BVJA 3HRHA 3A2MA 4P08A 2J3QA 3IUQA 1G4HA 1XZFA 2WIFA 2OG1A 2JF0A 5JYCA 3H17A 4BATA 3WL7A 2BUAA 2XUOA 2WHPB 1F0PA 5DNVA 1CUHA 2C4HA 2JGEA 4PSUA 1LPPA 1D07A 4BC0A 5A71A 5EHZA 1ZIYA 5AH0A 3M3DA 5K3DA 5EHNA 1H2ZA 1RWQA 2DCMA 1Q0RA 4CG3A 4F5ZA 2FJPA 5HFNA 1W1IA 4LIPD 2QJRA 4N8EA 1QO7A 1EVQA 2AJCA 3HSSA 5DYTA 5AM1A 1UZAA 3AINA 5DJ5A 5HKBA 4OYLA 1EA5A 3V9AA 4P93A 1CUUA 5HQ3A 5HF5A 1OXMA 5T4FA 3C8HA 5SYNA 1BRTA 5T4HA 4DLNA 1GQRA 2ROQA 2X76A 4H35A 2C5GA 3KXPA 1G5FA 3VJLA 4Q82A 4J0KA 4KRXA 3D3NA 4W1RA 5EFZA 3LP5A 5CMLA 1I6WA 2EDCA 3C5WP 1O6GA 1R1DA 4CCWA 4G8BA 1G42A 1MNQA 3IUJA 5IVHA 5JAOA 3HC7A 1DX6A 2D0DA 4UHFA 2BJHA 1IZ8A 3STWA 4DTCA 1GKKA 4HXEB 1U65A 1XZIA 1XZLA 4EY4A 3WI7A 2WM2A 2WG1A 5CT9A 4E15A 2RIPA 1ACJA 5H3HA 5ALVA 5AKGA 4DGQA 5LKRA 2B4KA 5FKJA 1YB7A 3FOBA 2XUJA 4J0JA 3NGMA 4UHDA 1JU4A 3DYIA 4YX9A 1ODSA 5IVDA 5AKKA 5JALA 4G5XA 3I6ZA 3DYVA 4OSEA 1ISPA 3FBWA 1IUOA 2PKYX 3LLCA 4X7BA 2HL6A 4PNZA 4H7DA 3PUHA 1CUSA 1XZJA 4DMHA 2Z3WA 1PFQA 4X94A 3G02A 3QBJA 5HFAA 4KEAA 3D2AA 3ILSA 3WKCA 4MWTA 4KAAA 3H18A 3DOIA 2V97A 2QTBA 1AGYA 1BN7A 1R50A 2O2IA 5FP0A 1CEXA 1H22A 1Q0ZA 3WWOA 5EIEA 4FKBA 3BXPA 1LBSA 2XQIA 1LBTA 1YS2X 2C58A 2C5FA 1TKRA 5A2GA 1CVLA 5AOBA 4A23A 1WCYA 2IIVA 2CBGA 1UXOA 4HS9A 4FHZA 1Y37A 1J2EA 4G4GA 3QM1A 1VOTA 1N5MA 2JGFA 1K5PA 3ZLUA 3BL8A 1A7UA 1T4MA 1VJ5A 3KSRA 1XLUA 2FX5A 4FDMA 3ESAA 1M33A 1W75A 2G5TA 2VSQA 4ZV7A 3OM8A 4PV7A 1XZGA 2QT9A 1THTA 4BP9A 3G8YA 5EIAA 3QMMA 2Y6VA 3O4HA 4U2CA 4X90A 2QMQA 2WKWA 2OGZA 3I2KA 1K4YA 1ZJ5A 2XUQA 1WB4A 3QMWA 1MO2A 4RNCA 4GDMA 1XQXA 3VVMA 4AO6A 5E4YA 5FPQA 4AMZA 1F0NA 4WDQA 3WA7A 5CTAA 1NU8A 2VAVA 4IH4A 4M0MA 3BDVA 2Z8ZA 4JNCA 4X6YA 2Q0XA 3H2GA 2XMBA 3DEAA 4ROTA 3CN7A 4DNOA 1WM1A 3RKSA 2YASA 4WY5A 4X6UA 1UK6A 4ZWNA 3OC0A 2OXEA 4UBIA 5AKZA 4DMFA 1BROA 1WB6A 5AOCA 1L7RA 2WIGA 3WK4A 3DOHA 2WFMA 3QPAA 4Z49A 2BFNA 3S2ZA 3WIBA 1KEZA 3AIOA 4X91A 4BE4A 3F67A 2W22A 5A7FA 4HAIA 4UBJA 5SYMA 5DWDA 1Q83A 4Y2SA 2PU7A 4OUKX 5ESRA 1CQWA 2Y6UA 2HA3A 2C7BA 4EZIA 1GPKA 5FDFA 3FNBA 4U2BA 2XQJA 1QIKA 1ORVA 4YASA 2OLEA 3L1IA 1YSCA 4ZV9A 3FSGD 4J0DA 5HF6A 2PSJA 4KE7A 2QKYA 2HA7A 3L1JA 3U1TA 3KWJA 1JMKC 4UBLA 4C87A 5EGNA 3IIIA 1ZGBA 4UPDA 4JYPA 2WUFA 1XQYA 3ED1A 5FLKA 2FUKA 4CCYB 1DWQA 5BV7A 4N5IX 3WK6A 4Q3OA 1A88A 4QLAA 1XZAA 4GEGA 2P8SA 3WK5A 2VA9A 1CFJA 2VAXA 4MQMA 4Y9SA 1BU8A 2GBGA 4M0EA 1VE6A 5JZBA 1TQHA 2YXPX 1MX9A 2K2QB 2HA0A 4G8CA 2WJ6A 4XX1A 3QZUA 2D5LA 4Y7DA 3OPMA 1BCRA 1LGYA 3HACA 3L1HA 3C6XA 4N8SA 3GA7A 1PV1A 3D59A 1LZLA 2OCKA 1QGED 3I6YA 4G4JA 2WG0A 4WFJA 1DWOA 1VA4A 2XQGA 4P9NA 4IHAA 1U4NA 3AZQA 3EBLA 1GPNA 5HF9A 2ZYHA 5HK8A 5ALPA 1XZKA 4TVKA 1MJ5A 3T4UA 2XMSA 3PF8A 2BCEA 5ALMA 3A2LA 1YCDA 1P0QA 3ZV7A 3WKEA 2HADA 4UFPA 3FYUA 5AK6A 4EUSA 3DKRA 3R41A 5ALOA 5AM3A 1DQZA 3WZMA 1E8MA 4BTLA 2ZYRA 2H9YA 5AKEA 4B85A 1P0MA 3QPDA 5D7BA 1H2YA 3EQ7A 3ICVA 1EDEA 3EQ9A 2WQZA 1RYYA 2PUJA 4QNNA 4UFOA 4U2GA 3IVMA 1AX9A 4YK7A 4W1QA 4H7HA 1UOQA 5ALKA 1ZD2P 4H18A 1MT3A 3PE6A 2BUCA 2VJBA 3G9UA 2ES4A 4X00A 2YYSA 2PVSA 4UHEA 3IURA 2ZVDA 3D2BA 3WMRA 5ISMA 3RLIA 3VISA 4UBMA 3VJMA 4W63A 1QZ3A 5JANA 4INZA 1EDDA 3G0CA 3V48A 2CUTA 4B0PA 1GPLA 3HI4A 3HXKA 1EHYA 4WFKA 1ZD5A 2C0PA 4HTAA 5K3EA 2O7VA 3CCCA 5DTIA 2XMGA 1LPOA 3WWPA 2HA2A 4Q3KA 4OCZA 4UBNA 5AM5A 5LLSA 2QR5A 2QUAA 2WG2A 3E1GA 1QIJA 4MYDA 1UKCA 3N2ZB 4ZREA 4A5SA 3AIMA 1MX5A 3H2IA 2XQFA 5IVKA 5FPPA 3G0IA 5AJHA 4RGYA 1GT6A 4BDSA 3VXKA 2PSFA 1E8DA 1XKLA 3DJYA 4MEAA 4C4XA 1XROA 3B3QA 2VF2A 5A6VA 4B80A 5DNWA 1U8EA 2RAUA 4FMPA 2ZYIA 5ALWA 4IQ4A 4N8DA 4DM7A 3Q0TA 1TCAA 4QDUA 1B6GA 2OGSA 4HVTA 1Q84A 1XFDA 2WU3A 1CUJA 1TAHA 3FCYA 4K5QA 4EBBA 4GHWA 4CI9A 1WB5A 1UK7A 4EHBA 2Z3ZA 4KYVA 2RHTA 2XLBA 6YASA 1USWA 2V96A 1FFEA 5BOVA 1VXOA 2XMQA 3VKFA 1R3DA 5ALEA 5AI8A 3TJMA 3FYTA 1XZEA 3FVTA 1J1IA 2H1IA 3BE8A 3O95A 4JYMA 5DNUA 1DT3A 5ALYA 3TRDA 1SFRA 1GXSA 5LZ5A 4L0CA 1H2WA 1SC9A 5LIPA 1XRNA 3WYNA 1VZ3A 2AJDA 3MGAA 2PPLA 3C5VA 5ALUA 1GKLA 4FOLA 5C8XA 1CUAA 5AOAA 1NU6A 3WL5A 4QLOA 4GW3A 5IH7A 1GGVA 2ZJ6A 2QVBA 1QIDA 4X92A 4Y2UA 1CUVA 3PDCA 2H7CA 5K3CA 2QS9A 4B9AA 1Y7HA 1THGA 4CIAA 5AO9A 2WIJA 3S8YA 1IUNA 2ZYSA 3K6KA 3G0GA 2X8BA 1AC5A 1EK1A 1LPNA 1QTIA 5JAUA 2QOEA 3GELA 2PSDA 4GECA 4AZ0A 3EIOA 1TCCA 1ODCA 4ARAA 1HL7A 3DKKA 5ALIA 2GBFA 1LNSA 1YS1X 1DTEA 4BRZA 1MX1A 1JFRA 4FLFA 4RPCA 4H7IA 1SCQA 5AM2A 4RE6A 4EY7A 4HRYA 5A62A 4AO8A 4ITVA 1UFOA 5AI6A 3DL4A 3BF7A 2WHQA 1MNAA 4HRXA 5AK4A 1TK3A 2HFKA 3E4DA 1GQSA 4UHBA 4CIBA 4Y2RA 2VT6A 2ZSHA 1WHTA 1VA5A 1W52X 3GBSA 3KDAA 2XI4A 1GZ7A 3A2NA 3BJRA 4FBLA 2I78A 3I28A 4Y2VA 3C6BA 1U2EA 2GBIA 3W9BA 3FSGA 2CZQA 1UWCA 3SWWA 3MUNA 2WJ3A 1QONA 2XMDA 4PQEA 1EK2A 4Y2PA 3I2JA 5LKAA 2JGIA 1IVYA 2BGRA 5IKXA 1MN6A 5ALQA 1WPXA 4U2DA 2CMFA 3G0BA 3I2GA 3M83A 2ZJ7A 4AB1A 2DHDA 5D3KA 3NWOA 2O2HA 1CUFA 4HXFB 2WTNA 1H23A 1WOMA 1CUGA 2VT7A 7YASA 2X5XA 3QMVA 3ESDA 3R40A 2VEOA 1AQLA 5JIBA 1EB8A 4E46A 4H7EA 3W06A 1CRLA 1E5TA 3FWHA 4G8DA 4QDTA 5CT8A 3C43A 4G4IA 5AI9A 5FOQA 3WKAA 4F0JA 4OB7A 2XUDA 4IH9A 4BE9A 4BZZA 2IX9A 2B61A 5LP1A 3SK0A 1W6RA 3QPCA 1JMYA 3LCRA 1UOOA 4FFVA 4XVCA 1BEEA 3NUZA 2WUEA 2WHRA 3ICWA 1CUYA 1ZI8A 4GBGA 2QXTA 4LXIA 5AHXA 4C88A 5EIHA 5AK5A 4I3FA 4MXDA 3OG9A 4F60A 1LZKA 3V1MA 3VDXA 3IULA 4C6HA 3T52A 2GYVA 1FJ2A 2HIHA 4ETWA 5HKAA 4FLEA 4G9EA 2HA5A 1X2BA 1YA8A 5HCUA 4J0GA 2G5PA 1SCIA 4FNGA 5CRIA 3G9XA 1ZD4A 1SOMA 2XMRA 4GWLA 4BC1A 4LKOA 1CUEA 1FFBA 4UFNA 4BCBA 2AJBA 3DCNA 4X71A 4EB0A 1YAJA 1ZJ4A 3BDIA 1JKMA 4G9GA 1FFAA 1VXRA 2O7RA 5CBKA 4BBZA 2XUHA 2HA6A 1K63A 4PO3X 3WQHA 3GUUA 5ALTA 4GXNA 3V1KA 4BVKA 1C4XA 4FLMA 4WJLA 4UBOA 5T4BA 2I3DA 2OPHA 1CUCA 1UKBA 2G4LA 2V98A 3QITA 2EEPA 4BYMA 1YAHA 2WLSA 5K3BA 4DNQA 3PF9A 1YA4A 2VQ6A 3C6ZA 3PUIA 1EXWA 3GZJA 2VTVA 4DSZA 1EVEA 1CIJA 4WY8A 4E11A 3UMJA 1AUOA 3HLKA 1XRLA 2GZRA 4X97A 1XRRA 4QWWA 4PW0A 2XMCA 2PL5A 2DR0A 3WZLA 3AJAA 4DMKA 1HPLA 3BWXA 5ALRA 4W1SA 1YASA 3E0XA 5LYYA 2OQIA 1X70A 3STYA 1UT6A 1XZDA 2DSNA 1EX9A 4EY8A 5D6OA 4CG1A 4X95A 5JARA 3WYDA 2QZPA 1VZ2A 4BAGA 3JW8A 3ANSA 3B12A 1R88A 1IMJA 2AJLI 4C89A 4NMWA 2JGMA 3PICA 1A8SA 2HHAA 1YR2A 5CXXA 1QE3A 1QOZA 3STUA 4QDZA 4Y2QA 2H7XA 3RK4A 1AMNA 3DNMA 3LS2A 3TGLA 1O6FA 1JT2A 3MVEA 2RHWA 2Y2VA 1OILA 5LZ9A 4S0XA 1CUDA 1TIBA 3G9TA 3O4IA 4WCVA 4ZXFA 3ZI7A 1LLFA 4RE5A 5BWBA 1FFCA 1BN6A 2OAGA 2DQZA 2WHPA 2O2GA 2WILA 3FLAA 4C4YA 1X2EA 3P2MA 4H7FA 5CXUA 1J07A 2HU8A 5JATA 3A6ZA 3IDAA 5JZ9A 3R0VA 1EI9A 4XJVA 4Y2YA 2Y1KA 4FFWA 1IZ7A 2HRQA 4V2IA 1DX4A 2ACEA 4OB8A 5AM0A 1P0PA 4BDTA 3OOSA 4FTWA 1AURA 5CW2A 2C0QA 1EDBA 2QUBA 5FRDA 1LPSA 2WTMA 1W4LA 4BB0A 4J0HA 4Q1VA 4X3CA 3WJ1A 4J7AA 2PM8A 5ALLA 1CUBA 3H2KA 4TGLA 1QIIA 3O0DA 2XB6A 2HM7A 3BIXA 2WFZA 3VJKA 2WSLA 3X3HA 1DWPA 5ALNA 3KOOA 5AKIA 2EDAA 2CJPA 4OPMA 5C8VA 1XZCA 2QM0A 4H77A 1R9NA 5EI5A 3PFCA 4X85A 4DSAA 4J3JA 4UHHA 2HU7A 5JAHA 3JWEA 3ZWQA 4QA9A 5JADA 4KE8A 3W9UA 2XLCA 4QDOA 3WKDA 1C7JA 3BIWA 4FNMA 3JYHA 4G1FA 2WFLB 4Y2XA 3IBTA 1SCKA 2Z5GA 4X6XA 3HZOA 5IVIA 1VLQA 4P92A 2ZJFA 1ZGCA 3DLTA 1Z68A 3DS8A 4IO0A 2RI6A 1UKAA 2XUIA 2VATA 2HU5A 2R11A 2J4CA 2JGJA 1Y7IA 3G7NA 5AK3A 3H2HA 2XUAA 1MAAA 3STTA 3R3XA 2UZ0A 3KD2A 5HQ3B 5C7YA 4W1PA 5JASA 2VJDA 4W9RA 3FYUC 5KWIA 4B9EA 5DLPA 5LZ8A 4AX4A 4ZGBA 3AUKA 1XZMA 1HQDA 2HFJA 1QIGA 4BCCA 4CG2A 3ESBA 1J06A 3D0KA 1ZI6A 2XT0A 1YB6A 4KJXA 3ANTA 4MYSA 4LYDA 1WHSA 4BTVA 2YH2A 5CH8A 1JU3A 2PSEA 3I2FA 2R8BA 3G0DA 3R3VA 2OAEA 5AI4A 3K2IA 4AQDA 1P0IA 5E4TA 3DDUA 2ORYA 4LXGA 2BKLA 2ACKA 3NOXA 5CT4A 4FBMA 5D3ZA 2WIKA 3SC2A 2WU4A 3OURA 1L7AA 2Z8XA 4D9JA 1UK9A 1ORWA 2OCLA 3D4LA 4B82A 3F96A 1F8UA 3HJUA 4BCDA 1OCEA 2LIPA 2XUKA 1HLGA 5LZ7A 3FYUB 4AO7A 2HDWA 2BAGA 5DYYA 3CXUA 4DNPA 4LYEA 5K3FB 1KU0A 2WFLA 3WA6A 1N1MA 3W04A 1EB9A 1DU4A 4H7JA 4QE3A 3YASA 3H19A 2XUGA 4OD0A 4Q3LA 4MJ3A 1XQVA 1QFSA 5JD6A 3W2TA 5HK9A 2HA4A 3QVMA 1W76A 3TEJA 4MQLA 1HBJA 3U0VA 3WK8A 3KWFA 1VE7A 1B41A 5AKLA 5CH5A 5FV4A 1CQZA 4HXGA 4BRSA 5AKXA 1CR6A 3HYSA 4NVRA 1C7IA 1XRMA 1E89A 3B5EA 5FXMA 2GYUA 2JIDA 3AZOA 4YPVA 3C70A 5KWJA 1HKHA 3DQZA 4LXHA 1JJFA 4KE9A 2DHEA 4EY5A 1QFMA 2JEYA 3V1NA 2GYWA 4AN0A 4H0CA 1LPAB 1XKTA 5AKJA 4B83A 4B6GA 3AIKA 3G9ZA 2WUDA 3UUEA 4JUIA 1DQYA 3IA2A 1XZBA 1QIMA 2GBCA 5I8PA 3H0CA 4Q34A 1A8QA 1QIHA 2G63A 4U2EA 1DT5A 1JJIA 2PU5A 2JGLA 4AXBA 3R3WA 4HZGA 1N8SA 3SX4A 3EQ8A 3DD5A 1MPXA 2W6CX 4JEIA 3WKBA 5HZGA 1LPBB 1CV2A 4AN1A 3WIOA 1UK8A 5AM4A 3FLBA 3VVLA 3I1IA 1AZWA 1R4ZA 5AIAA 3I1YA 3QH4A 3WK7A 2VJAA 5ALGA 4BVLA 2I3ZA 3IB3A 1XRPA 3R3YA 2B9VA 2V9ZA 3AFIA 4I19A 5AI0A 5A7GA 1IUPA 4O08A 4WDRA 3WLAA 1RP1A 1ZD3A 1ACLA 4U2FA 4KE6A 5ALDA 1ZICA 4E14A 1H2XA 3D2CA 2WIDA 4K6KA 4Y2TA 1PJAA 4KAJA 3ZPXA 5AIBA 1L7QA 2PSHA 4ZRDA 2XE4A 5J3JA 4J0CA 4K2AA 2JEZA 2HRRA 3HEAA 3CN9A 1QJ4A 3O4GA 4BP8A 5C81A 3GROA 5EHQA 3WL6A 3PFBA 1BE0A 3R3UA 5A7HA 1UOPA 1MTZA 3IUNA 3F98A 5K3FA 4B84A 4KR0A 5ALSA 3WL8A 2Y2UA 4OYYA 4WFIA 2FJ0A 3FCXA 3I2IA 2CKMA 2QJWA 3EF3A 2I03A 3CCBA 1QIFA 4L72A 3MUOA 2XUFA 2ONCA 4XWGA 4ARBA 2CB9A 3R3ZA 3PI6A 4CFSA 4F21A 4CCYA 1KU6A 4PF1A 2QXUA 5LZ4A 1CUIA 2NW6A 1XZHA 1F6WA 1K8QA 1VKHA 5ALFA 4JH0A 4B7ZA 3H04A 2IITA 1A8UA 2WJ4A 1ZIXA 3HABA 3ZLVA 5KREA 3D5EA
chains in the Genus database with same CATH superfamily
1HLPA 3E0QA 1SD2A 3EWIA 3IEUA 5K3AA 1ZHHA 3DUWA 3BMOB 3Q3CA 4MKIA 4ALJA 4PCUA 1KR5A 3SICE 1LRLA 3SNHA 3MELA 2O3JA 1KOLA 1ZW1A 5IM5A 2JDIA 1WF6A 3L5OA 2QQGA 1CE8B 2PUDA 1BCSB 1VE3A 1CLEA 3DBHA 1U90A 1GUAA 4TTSA 4TM7A 5FNVF 1U8UA 4BNGA 3KQYA 3EZLA 5J9FA 1UQRA 4NU8X 4S1VA 2HC9A 1J56A 2VC2B 2R7AA 1JV2B 3PPWA 5IKEA 5LU9A 7MHTA 4HNAA 2FSVA 3A28A 4GE3A 5IN4A 1EH5A 3GAZA 1AGNA 1H0RA 1TYDE 3L0BA 2WDZA 5ERYA 4TSRA 2YHSA 3TEMA 5I4KA 1I4TD 5IMBA 3DAGA 3C45A 2BT4A 1E8NA 2GB4A 3EHDA 3IL2A 1BDHA 1JPVA 4M54A 2JFPA 2P0YA 5CM8B 4IS3A 1MAHA 2PX6A 1NI4B 4O5AA 2HQOA 1I7LA 4DR4B 5JAPA 3SHVA 1BCSA 1J0XO 1M2NA 3CUTA 2P2LA 4HLCA 1RE1A 4OU4A 1DG9A 5AMXA 1KDPA 4Q7EA 4YMUA 1BVYF 2CXRA 2OK8A 1H5NA 3HL4A 1YKGA 4Z9YA 4ZJZA 1QH1B 1SBNE 3HCFA 4FX2A 3RT9A 3VYRB 4CWAA 5K5EA 1VKRA 1A3CA 3H3FA 5H3LA 1NBIA 2Q4BA 3CNBA 4LDQA 3T4XA 4B3FX 1PGOA 2GKOA 3M49A 1O89A 1ZCAA 4CUJA 4P6VF 5J4YA 2VQEB 3TBHA 3SX0A 1IK6A 3W4JA 4TKLA 3PDIA 3WADA 1R9GA 1Q16A 1N2OA 4DNFA 4O2AB 1A2OA 4HAVA 2PJUA 1QG6A 2DH5A 3C3JA 3JD1A 3ZGYA 3HKEA 2VQSA 2AX3A 3HN7A 5GONB 4H3HB 3O9VA 3IUMA 3SI7A 3FGZA 3FLMA 1NP3A 1W5AA 3K9WA 1BXKA 4ZARA 2IEAA 1IG0A 1UFRA 3BMCB 3R5KA 2OGTA 3BTSA 1BXRB 3GGCA 2V4UA 1Z47A 4NBWA 3HVRA 2FZ4A 2XQKA 3ND9A 4RK4A 3NUGA 3HU3A 1QFXA 4HQKA 3OH8A 3VVBA 3VJRA 5DDIP 2NUBA 3EVNA 3FROA 3KJZA 3MXTA 1IWOA 3OJCA 1D2AA 4LK3A 4F9FA 1M1ZA 3HXTA 5E4JA 4JITA 5THXA 2RG7A 2DB3A 5B4TA 3KEMA 1V1MB 3H1BA 1MJNA 3KZCA 2JJYA 4WXMA 4RS3A 4BMDA 2PH1A 1ZI9A 5IPFA 3OIYA 2SBTA 3DVLA 4KXLA 1DINA 3AF1A 4WKGA 4EL5A 3IUBA 4YUZA 4Y9DA 4WZBE 3Q3JB 3P2YA 4KAFA 5SV2A 1VPWA 4J1TC 3FOFC 2H00A 3IHKA 4BBPA 2EYUA 4CN9A 1FU4A 4JGBA 4W5TA 1K68A 4FYVA 3D7RA 5CT5A 4URXR 1YI0A 1TK9A 5HM8A 4H7KA 1PGNA 2NVUB 4C3OB 3Q2KA 2CL5A 3C6YA 4IKEA 4ER0A 1C3XA 1E2PA 2J3DA 3BJIC 2BY4A 1CUZA 1FDVA 2FMIA 2BM1A 2HXYA 3EDCA 2Q5EA 4JCCA 5F51A 1QCCA 2PGIA 3HM2A 4LTMA 2X0NA 5DI3B 1QTRA 1QPGA 2R0QC 1Z6QA 4KQ2A 1FDWA 1GTMA 3PJFA 5AQEA 5ILOA 2BR5A 2OVBA 3BSSA 4PQYA 1NPYA 4YJ2F 2N0SA 3F3YA 4I81A 5EMNA 2IY9A 4D3FA 3GJ8A 5BWCA 4L73A 4ZYTA 3EUWA 3ZCQA 1M7BA 1G7CA 1C81A 2ECOA 5DGXA 1EFLA 4IDFA 1TO1E 2EJBA 3KQTA 5JS1A 4TYYA 3GG2A 1L7MA 3ZS8A 1IOVA 1XD2B 3DZHA 4JP2A 4RO0A 3VR1A 4O2BB 3SP1A 1YVUA 4MMXB 2NUPA 2X41A 1DAMA 3I39X 5ALHA 5CH3A 3WGGA 1O5IA 4UTXA 1YS9A 2V0GA 1G66A 3KEGA 1IM8A 5ALXA 3CQ9A 3ONDA 1A4RA 1GNTA 1GPUA 4XGRA 3RHZA 3JAWB 4R68A 5I9IA 3WG9A 3AJ8A 3E2PA 5I51A 1XR3A 2GJ4A 4I8XA 4W8HA 4M88A 5HKLA 3M81A 4IJ5A 5EIWA 4XSGA 2FNAA 4RD0A 3K0BA 4YDSA 4NS4A 1ULBA 3OKAA 5FAKA 1U0EA 2E82A 2J59A 3I9V1 2CEKA 2O3UA 4TM8A 5BOSA 5DWVA 4NICA 5H70A 2H92A 3STVA 5AW0A 2R48A 2Z2YA 3KB1A 1JEAA 4MEBA 4MCHA 621PA 4PLTA 2AC7A 4OXIA 5JSZB 5AHKA 1G5RA 1TRHA 5BYBA 4EDHA 1H6CA 3DWEX 5TQVA 5ARBA 1K7FB 1XLWA 2GPBA 2WKQA 4I5FA 4RH0A 4XUDA 3BIOA 1CHDA 2AVNA 3L7CA 5AW7A 4JAVC 1GTL1 3A4YA 4TTRA 4Y2JA 1ZKMA 4CM4B 3Q8WA 5ELMA 1FFGA 4FYWA 1RBQA 4UOQA 2ANBA 3HP4A 3QYJA 1REQB 2Y76A 3NETA 3UMVA 2MMGA 3DT6A 2CDBA 1A9YA 1ZINA 4NZ9A 1JIUA 1GA1A 2GESA 1Z2NX 3IE0A 3KQMA 4YGYA 4Z1MA 3V4PB 3OD1A 2F4VB 1XLVA 3BILA 1I7PA 1SVNA 3F6RA 2V7GA 3B6KA 3IBFA 1Z6ZA 3L4BC 3OOYA 1TJPB 4DLZA 4D3DA 3WGTA 4I7EA 4JXKA 4OATA 3TQCA 5C8ZA 1YUNA 2IHZA 3A05A 3E03A 1U0TA 2Q5JA 4IY1A 4ZOBA 4JJEA 1M76A 1EINA 1P29A 2PRJA 5HQJA 4KGXA 4ZI3A 4RYLA 2DHCA 2OB2A 5JDIC 5FUMA 3VTZA 3DR5A 1RJFA 3WYBA 5BW8A 3GAFA 1H05A 4M89A 5HKKA 3AKZA 1R9MA 4PPNA 2J6IA 4HBZA 4XIFA 2VDVE 2BI7A 1XCOA 2EOAA 2BGNA 2H4XA 4GMFA 3WNVA 2QQEA 1NF3A 2AG8A 3GUCA 4ZDWA 1TQ2A 2NV2B 1Z9BA 2PZGA 1DNPA 3ZE8A 2H4FA 4F8YA 3EXFB 4OBEA 4B6QA 2C5AA 2JL1A 3ZOZA 4ZQHA 4OHCA 2I6XA 4B81A 2WUGA 2LCFA 4MIYA 5EZYF 3C85A 3AL3A 2OGUA 7ABPA 3LXUX 2C00A 3LUJA 3RJMA 4EUHA 5IJ0A 3AI2A 1G63A 3G2IA 2W6JA 3HYTA 2O2YA 1ZH0A 1ZOIA 4XX0B 3AL2A 3GD7A 2H6EA 2IPMA 1FYEA 1WPRA 3NRBA 2Q41A 4DG8A 1YJQA 4OHBA 4PSDA 1HETA 3TJRA 1W2HA 4KRYA 4KUEA 4WLFA 4KR3A 2CSUA 1PIWA 1L7XA 1T0IA 4E32A 2JGDB 1XRJA 3I37X 3DL7A 2X14A 2VDOB 3MFYA 4KP7A 2VJCA 3LF2A 4MJLA 3TMYA 3VR0A 5FOVA 7REQA 2Q3CA 1N7JA 2ODNA 4J7CA 5ALZA 3UVEA 5KHOC 1GLNA 3ZIAD 4EGCB 1JNXX 1UBKS 3D54D 3VZQA 5ENDA 5TMPA 3HRHA 3P20A 3ZDRA 5MHTA 3AEXA 1C0IA 4V0RA 5EXEA 5H1YA 5CLJA 1MT0A 2J3QA 3IUQA 1Z62A 4LOIA 4ZQIA 3ZHCA 2AN9A 3TNJA 1HQKA 1MIOB 1YTLA 2JIZA 2C83A 3K0CC 1E1QD 2B7LA 1HORA 3IKLA 1JW9B 2BUAA 1F0PA 5HDQA 4AT1A 2H17A 2O0LA 2PA3A 4TWZA 4F7DA 1UPCA 3MM4A 3TIXB 1N0WA 1Z8FA 3K8YA 1LPPA 4HGNA 4YRMA 2P4QA 1WXDA 3PHIA 2V0CA 3QFTA 1DC8A 4DJJA 4S04A 5DCYA 1VG8A 4PX3A 3H8SA 4U6NA 1T10A 5AH0A 2I2XB 4D81A 1OSNA 2RGEA 3EIFA 3M3DA 2B36A 1VPVA 1HT0A 1PZHA 2ALJA 5K3DA 3QJGA 2HLNA 5IK2A 3NONA 3E61A 4IDAA 1N25A 1FX0B 2G0NA 3G17A 4FD3A 1M0SA 3L7LA 3EXG1 5TEVA 5AYVA 3CG4A 3N2IA 2W6OA 1GV0A 1RWXA 3QVKA 2JC3A 3QUTA 3TDMA 1L5FA 3C2QA 1II0A 1GL3A 4N8EA 2YQ5A 1ISSA 1DEHA 1TIKA 4EG7A 4TLBA 3RF7A 2G72A 2FZLA 4HRVA 4N0PA 1YMVA 4RL4A 3HSSA 2Z1MA 5DXAA 2XSZA 2AEEA 2J45A 2K87A 5DYTA 4EITA 3NCTA 5C5CA 5C8YA 3U7HB 1F5SA 2X1HA 1Q17A 5LB4A 5K2MA 3SLKA 1JEYB 3V9AA 2NSHA 221PA 1RQXA 3P9QA 5IZCA 2WP8J 1F9AA 3EGCA 4KH0A 1J0EA 4LYYA 1CUUA 3ZQUA 5K8IA 5B30A 5ECDA 2RKWA 4ZTUB 1PFKA 2FR8C 1EGAA 1Z0KA 4ID3A 4ZHSA 3JCZA 1VBMA 3ZY4A 1PVVA 3KK0A 2MMCA 4UM8B 3E9RA 3L0SA 1V9SA 4NHOA 5I7SA 1HGXA 1T9DA 2HMSA 3OCUA 1JE0A 5TX7A 3UG7A 5I7RA 5J58A 1N36B 1AKTA 3Q7QA 3ZQKA 1TF7A 3GFGA 4N3GA 4BZXA 4NK5A 3O03A 5EIBC 1BFKA 2GPWA 2GEVA 4JN6B 5C5DA 2VTEA 3NBYC 3H1GA 3PVSA 4MVXA 4Z9XA 5TY0A 2OD7A 4J0KA 5KYWA 2Y9MB 3QNUA 4KRXA 1E9AA 4GIBA 1CEYA 4L5BA 1AUXA 3KHTA 4OQ4A 1RE0A 4RACA 4QUAA 5ITSA 1I14A 1RT9A 2FUCA 5JDCA 3OA0A 1YONA 1Z7BA 4FGKA 1YZFA 1B7GO 2QDKA 3KG2A 3EG9B 4BMPB 1WWKA 1LQ2A 4FS8A 4NS1A 1YKFA 3SIPA 3UAWA 3ZCTA 3IPCA 4LN1A 1KEEB 1GZSA 1O6GA 4CCWA 2PUBA 4JODA 2WKRA 3PFNA 2YOGA 2BDTA 3HKDB 4IGEA 3N74A 1NNEA 2ZIEA 2CVPA 4R9UC 3EVFA 2BHRA 2W6PA 2FEKA 3NO4A 1DKRA 1G6OA 3IUJA 1FMCA 3THRA 4XUGB 4NYMQ 5BW4A 5KUTA 2J31A 1R8SA 3F6EX 4X1OA 4OG2A 3T94A 1DX6A 2G67A 3EXHB 2WJHA 1L4EA 2LBPA 3C1OA 4NATA 5JO9A 4QFBA 1AZLA 5KVQA 5C2JB 3KQLA 4UMDA 2QMZA 5A1TA 3W1VA 4KR7A 1C29B 4DDKA 1WDWB 1E0KA 1RIFA 2ERYA 3JYNA 2DHRA 4QRDA 3T3DA 1U3FA 2WWTA 4DTCA 1OYYA 2ZBDA 3QIVA 1SQSA 5JWOA 4HPWA 4DLWA 1IEVA 3IRUA 4IO1A 1XJ0A 3ECCA 3DT8A 4HFNA 2DLNA 3PD1A 4HNTA 2VAMA 2WM2A 3TZLA 5CT9A 1TTPB 1Y1KE 4MVJF 3W5SA 3ZDFA 2Q21A 1G41A 1ACJA 4WNCA 5H3HA 1S9DA 5IAAA 2O6HA 2I8LA 2YBDA 1W5FA 4TV8F 5CLLA 3VYSB 1SCNE 4JBNA 4W99A 4DGQA 4EELA 2V7XA 3KPVA 4UDNA 4YMVA 1OX4A 5JSHA 3ESRA 3LUKA 1K1EA 3ZBQA 4IGFA 4AWBA 3A9TA 3BQNB 3UT5A 1E3TA 1Y9JA 1JR3A 3NGMA 5CFMA 3MQFA 4B32A 2BHSA 4IV0A 4B44A 4BWVA 4D9BA 1NBMD 1R6DA 2ECQA 2VUUA 4WZ6A 6AT1A 2IPAB 5EJ4A 4KX5A 4YX9A 2PYZA 2ZJ3A 5AKKA 4Z9BA 3RSLA 4LBVA 1HEUA 2TYSB 3CNHA 1Y4SA 3N75A 1ZUNA 3NC0C 2A35A 4PHGA 3J81A 4E94A 3JYLA 2QT1A 3K5WA 1S3GA 2OC9A 3W6NA 2YWRA 4MLDA 3TD9A 1GNQA 1IUOA 4G0NA 2QX4A 2QQ5A 2REBA 3LNCA 2IHVA 3PDWA 2GZ1A 2R85A 4WKCA 5CGQB 3KQKA 2HL6A 1T8PA 2ZRNA 4PNZA 1JHMA 4H7DA 4BX9A 4ETNA 4EYKA 5KNDA 2FPXA 2EKZA 1KNXA 1R8JA 2EARA 3NVDA 3PL1A 3C74A 3PXXA 4L51A 1BGWA 4GG1A 3W8DA 3T95A 5I9SA 3S2YA 3PFHA 1KO7A 1E2BA 1P2BA 3GGDA 3FYCA 3R77A 3CZ4A 4W82A 5HMLA 2V7QD 1EQAA 2PKCA 1CK4A 1EGVB 3EGIA 3O3OB 4Q12A 3D6TB 3SYMA 5DK4A 5E6SA 3HB1A 2QTVB 1MGPA 3RK1A 4F86A 1MH9A 1R0KA 1TO2E 1RWVA 1YF3A 3ILSA 3GR6A 2N9UA 1LI4A 2J5XA 1OAAA 2G77B 1DDOA 2IYOA 4MWTA 1HDCA 3SIXA 3ZXYA 5J4KA 3OUUA 3TG8A 3DOIA 1CIPA 1R50A 2O2IA 3ITKA 4LJ7A 3U3XA 4PX5A 4IVNA 2O5CA 3U4CA 1OZ0A 1AT1A 1CEXA 1N5KA 1Q0ZA 3G2LA 2AG6A 3D8UA 5EXXA 3GNSA 4FR5A 4HWOA 3U7GA 1WW8A 1TYBE 4OQFA 4Y9RA 2QF7A 1T4CB 1U1CA 4LGYA 4BHTA 3ABZA 2TRSB 2UUOA 3NTUA 4KITB 5CJ2A 1R0BA 3LPMA 2QG9A 9LDTA 1DTWA 3FMVA 2YV4A 1HT1E 2I6UA 3RV4A 2XVXA 3FDZA 5FO1A 5LC1A 1D1QA 3JQ9A 4G07A 2GUWA 5AOBA 4CMCA 1BFDA 4LF4B 4A23A 1R6AA 2OHGA 1NUSA 2IIVA 3BXEA 1DIHA 4BFUA 4LCEA 4ADSG 1HDIA 5KQPA 5KTPA 1JSRA 2QN8A 4FHZA 2ASVA 5CJPA 3QE9Y 3VYVA 3EZNA 4GZ6A 5FF9A 1K89A 3F73A 5CB4A 2GVDC 2ZAIA 4QPZA 3COJA 4EMSA 2DUNA 4QYSA 5DBHX 4JK3A 2FHPA 2JGFA 1F3LA 1LRJA 2FPLA 3D0RA 1G2OA 3BL8A 3KFLA 3KHKA 4B3GA 2LP4Y 1T4MA 1VJ5A 2Z5LA 3KSRA 4MUFA 1GTG1 5EZYB 1F8XA 3TIVA 2YJGA 3GQVA 3H5LA 4CLDA 2Q62A 3LT2A 1M33A 2ZE5A 3O26A 1GUFA 4TRNA 1GWNA 5DCWA 2VSQA 4ZV7A 2HZBA 4BFZA 3QRWA 1T25A 1ZVJA 2WUWE 3GPIA 3SSMA 4Y6GB 5F1KA 3L7KA 4N7JA 1XZGA 3E3NA 2QT9A 2QP4A 3GNQA 3BFVA 2PANA 4K40A 1Z2CA 3Q41A 4QOGA 5L3SA 4TLLB 3C7CB 5IASA 1KVSA 3V8NA 13PKA 4M1YA 4JLVA 1K86A 4OV6B 3OQPA 2D1RA 4RX1A 3SYTA 3PKJA 2CV2A 2F55A 1JSCA 1NJ5A 3NV7A 3NIDB 3PCRB 4D3ZA 1BJTA 1WSDA 3T15A 4M4SA 4LF9B 4TN5A 1RCUA 3BGSA 3EIWA 5B4VA 3K71B 5BN5B 1EMDA 3OZIA 4HLDA 4TWRA 4U2CA 4WNYA 4X90A 4QICA 3C5HA 3CZ9A 3QV1A 4R1LA 4JEMA 1N8TA 1J99A 1PK8A 3Q2OA 5BNTA 1K08A 2R2GA 1CERA 5KX5A 1K4YA 4BEJA 1G55A 1GILA 4KMMA 3SEFA 4TX1A 1OTXA 4HVLA 3VOSA 1OX5A 1U02A 4UC0A 4CKWA 1MLDA 1MO2A 4HLNA 4RNCA 1CDOA 4E03A 4LYGA 2JFBA 2Q3DA 4GDMA 1LXCA 5AW9A 1Z2DA 2F9FA 3QE2A 1XQ6A 3TGPA 2PUVA 3A1WA 4E12A 3Q7TA 4D99A 4DBLC 5FPQA 3SBEA 2X77A 1KH3A 3K72B 4C78A 2UUCB 1L5ZA 1EESA 5TC4A 4AG3A 4MRVA 4OQNA 4EJSB 1NU8A 2VAVA 4HDMA 3RVSA 2F64A 1MHTA 1KEEA 1BXGB 2O1XA 5BQXA 3E7FA 3DUFB 1TL7C 1CNMA 3I1FA 4PC7A 3DZ8A 3PP8A 2Q1SA 1BW9B 4QX6A 4CTJA 4ZQFA 1P73A 2J3HA 4ZA2A 4S1PA 3A6HA 2XGGA 3HBNA 4HH0A 4LVOA 4HCJA 3VAYA 1NL3A 4F2DA 1WXHA 4HTFA 2FEMA 4L5CA 3HB9A 3CN7A 1HA3A 1E99A 3M6XA 4PLCA 2ZSFA 1WM1A 2WT9A 1IU9A 4PZDA 3UV3A 2ZRKA 3T4PA 5LUBA 4WY5A 4BQEA 3M3HA 5CG2A 1Y4ZA 1U5AA 2NO4A 5K2OA 1X7HA 2X0JA 3LPDA 1HG1A 3NDIA 1N5LA 4LV6A 3WNBA 1PG5A 2PIDA 3IVXA 4EG6A 3QU2A 4HDSA 2OXEA 3EXG2 4NENA 2QI9F 4UBIA 5FBRB 3UOAB 1JZSA 4XOUA 4DMFA 1NRXA 1XVIA 1ZNXA 3A1UA 3D4OA 4QYWA 5K6AA 3DBOB 4G2TA 2D8AA 4X61A 1L7RA 5LN1A 4CXMA 3IMGA 3DOHA 2WFMA 4L2IA 1NW8A 2PH7A 3BFJA 5D86A 4ZZ0A 4NC9A 4FPXA 4D82A 1BDIA 2A84A 1IXSB 2IT1A 3S2ZA 4S1TA 1KEZA 4XVQA 3G6WA 3N0VA 5TB5A 2QHXA 3ZE1B 4BE4A 3F67A 3AVVA 2ZUFA 3FYHA 4KV9A 5BMVB 4ML3A 2ZT7A 2NO1A 1EBBA 1W9MA 5FYQA 2BFMA 3MRTA 5A7FA 1N78A 1DO8A 3GGPA 4HAIA 5E6UA 3N59A 4DS3A 5KNCA 1JBKA 1OXTA 5SYMA 3U0BA 5IF3A 2WD7B 5TR9A 1Z0UA 5J2UF 1P4JA 2XRMA 3D3QA 4M6WB 4QLBA 4Y2SA 2J9GA 2B1QA 2P9TA 4IUDS 4YR9A 2RAVA 3SQXA 2HA3A 2FWBA 4FJ2A 4RSGA 3X1MA 2IZ6A 2IP4A 1YBHA 2CCGA 4O4HF 2XTZA 1JHDA 1GPKA 1RPNA 5COQA 5FDFA 3PXGA 2SCUA 2HRCA 3ND5A 3B9PA 1Z7WA 1ZH4A 2FWRA 4TMXA 1UBSB 1U1FA 3CWZA 1JSZA 1W0JD 3OTWA 4BU1A 2BKUA 1QIKA 1ORVA 2HTFA 5BV0A 2V4ZA 3DEFA 3B36A 3DE2X 3R75A 1YK0A 4J7XA 1SKUA 1ZK2A 4EDFA 3F5FA 3UCFA 4D8WA 1P1BA 3UMCA 2AYZA 2WAOA 3FSGD 2CHEA 1OIWA 5ESDA 5A3RA 3PFWO 4KLNA 2RI0A 3VKUA 4MS1A 1JLRA 2I4NA 1JU9A 1JDZA 5KNCD 3L1JA 4BL5A 3KWJA 1J90A 1JMKC 3MWGA 3VR4H 2VWGA 3IIIA 1G5IA 2YMQA 4QKQA 5IBRA 1HL3A 3WC4A 1R2QA 4UPDA 4PLGA 2WUFA 1YQGA 1JHOA 4QJ3A 2E6UX 1DWQA 2XEXA 3H8VA 3QU9A 1UXIA 2R4QA 4IOLA 4CCYB 5BV7A 2NTYC 1NT2A 2O2CA 3SBDA 2VJYA 1PNQA 1R3UA 3MWFA 2PMKA 4FDVA 3QPWA 2QR2A 1U6KA 2O2SA 4XVUA 2F6RA 1KMIY 3VFDA 3W79A 2Z5VA 3O2SB 3PV0A 1IWBB 5IBCA 1ML4A 1XZAA 3AEKB 5EWJB 5ELXA 4GEGA 5B7GA 2P8SA 4OQXA 2HWYA 1NN3A 3FWNA 4IG4A 4TTVA 3DTYA 3IAXA 3KJFA 2F3UA 2ZRFA 3H1PA 4PNEA 5JLJA 4HGPA 3PNVA 1XMIA 4FMCF 1A8HA 4OFBA 5EE3A 4KZKA 1U81A 5CAEB 1BU8A 2C61A 3F3SA 3BMNA 4Q6BA 5B2ZA 4I3HA 3U81A 2QX9A 1Z5PA 2XBUA 4H3KB 3B8HA 4DR2B 1OWPA 3BD6A 1ST3A 5TQ0A 1PZXA 2AV6A 2IYAA 4TV9A 1HE5A 3E22B 3QSYA 3CH4B 3H2BA 5CB4B 5HUHA 4TKUA 1G64A 1N5IA 1M1NA 2G8NA 3V34A 4YHBA 1P7WA 1W2GA 2QAJA 1KJ9A 2Q3BA 5AUPB 1FLDA 1MC4A 2VT2A 3CF0A 3OPMA 5CITA 3LUCA 3L1HA 2B3TA 3C6XA 4DA8A 5BSGA 5AXDA 4GMHA 2R6GA 4RBNA 3RU2A 2HKIA 4PYKA 2CNNA 1USUA 1IULA 1ZMTA 2BEUB 2O50A 2OCKA 2P11A 2SKCA 3I6YA 4HF7A 1RYDA 4RVSA 5JD3A 5B3JC 2CV0A 1WP9A 2HAEA 2WG0A 4XYEA 4WFJA 5EAIA 1Q50A 5TQ2B 3K8QA 2HJVA 3TD6A 2JARA 1TAGA 2O1EA 2IYPA 3GJRA 4JLSA 4PSKA 1KO1A 4RLQA 5EPOA 1XWIA 4KWIA 2HHCA 2GM5A 1IN6A 3MQ2A 4ND4A 2ZUBA 2Y68A 4JLBA 4R54A 3HY4A 4YYEA 1S2IA 1PR1A 1SQ5A 2WWWA 3C16C 3AZQA 3I30X 3EMKA 4Q21A 4ZOEA 3CYFA 4ZZ2A 1NRWA 1YC5A 5ALPA 1E9EA 5FEMA 5TS2A 5L9AA 2VRBA 4TVKA 3RI3A 1IEXA 4ZT3A 3T4UA 5K01A 2GJKA 4EW1A 3IR7A 2WP0A 3FJYA 1NXOA 1EUZA 1KC1A 3CRW1 3P7MA 1M2GA 3PNLA 3Q85A 3QQ5A 5J5AA 1D04A 1P5FA 4L4UA 3GNLA 1P0QA 3OTOB 1W34A 3LC1O 3PGJA 3WKEA 1SG9A 2FR0A 2Y1FA 1R4MA 2Q1TA 1ZQ1A 3LUBA 5DGHA 2VUIB 5EJEA 3T1TA 3GT0A 3ETNA 5CHYA 4F12A 1SBHA 2AFHE 1JF8A 2A9JA 3ACCA 4U63A 3GLFB 1MIOA 3R41A 2ZM6B 1WPQA 1MORA 1LLUA 1QQ5A 4LHZA 5C9ZA 5F1PA 2VKTA 1HNWB 4ITRC 4BNKA 1E8MA 1UEJA 1WXQA 4BNTA 1RVDA 2AE1A 3QSGA 2JKZA 2VNHA 5FWDA 3ZWAA 3K0AA 5AKEA 3D3WB 3WL4A 4B85A 1OMOA 4YTEA 5JS8A 1NBAA 1NC3A 4I5GA 1IXYA 3RUIA 3QPDA 2E37A 2WOOA 3P9KA 4RFSA 1VFNA 3I1JA 3EQ9A 3KE8A 4NDAA 2HMAA 2HSWA 3L04A 4WCFB 1X9IA 1XCMA 2PUJA 2D1SA 3S27A 1DUSA 4I2VA 4HTFB 4B6FA 5JWRA 1V11A 2MR6A 4Q66C 4ZN6A 4RF2A 3R7BA 1QRTA 4UFOA 2NXEA 2WWGA 2FMHA 3P19A 4ND5A 3IVMA 4GKVA 4U9UA 3MTIA 1SAYA 3EPRA 4H7HA 3ENZA 5CVCA 3TQSA 3V6LA 2FETA 3BXHA 2ZIWB 1KI6B 5A6SA 2ZOSA 3DCYA 1W96A 4FFMA 5BSTA 4YGXB 2L18A 4EJ0A 4MYRA 2C2HA 2PR7A 2X9VA 1F17A 2YYSA 4RPJA 5A04A 1W44A 2PVSA 4J9UE 1DPFA 1B6TA 2AFHB 2IEBA 3GLFE 3F6YA 5C1PA 1OH6A 4MW2A 3RC9A 2R6DA 1BFUA 4RFVA 4RESA 3VR2A 3WIUA 3D2BA 3WMRA 4D9FA 3UK1A 1NZFA 2HF8A 2R4UA 2W2OA 5M2QA 3DO8A 4U5XA 3VISA 1A9RA 1Z5VA 1DBIA 1V5EA 1JEEA 1WULS 2F67A 1TA9A 4GSLA 5FWAA 3V7WA 4QGFA 2B25A 1UDWA 1QRAA 3O8LA 4QOEA 1UFQA 1XGKA 1YDWA 2ERXA 4JP3A 4L7VA 3RFCA 3UJHA 4JC8A 4MPJA 3USCS 4CODB 4U00A 4QYXA 3VYTB 4DABA 3W5JA 3LQ2A 4KVGA 3S2IA 5LFAA 3TDNA 1DHTA 4XWAA 3UG6A 1H0KA 5AFSA 1AN0A 1LTKA 1B00A 4XB2A 5BXQC 1YVPA 5DXFA 2QORA 3MJ4A 3VYUB 1XTTA 1R5NA 4HTAA 5EZ6B 2DY1A 4KN5A 4MNTA 4NOKA 4F3NA 3WWPA 2HA2A 1FZTA 4BMVA 1Y9DA 3SF0A 4QAQA 5GIPE 1F0KA 3AVYA 4UBNA 4ER5A 4IMJB 1TYEB 1BHQ1 2ZB8A 2QR5A 5C52B 3D1VA 3WLEA 4DLAA 1LK0A 1LSUA 2CXTA 5E3JA 1IB6A 1FRFS 3PVCA 4IHQA 4Z54A 4G85A 1K3UB 1W6UA 2Q0QA 5EQTA 5AW1A 1W0KA 4FWTA 1XJQA 2OBBA 3SSOA 2BMDA 1LX6A 2I7VA 2NO0A 3V32A 1GG5A 2AN1A 2OILA 4O63O 5JXGA 3QPBA 4NYJR 1ZVMA 1P62B 3IH5A 3MS7A 1MX5A 2HWKA 2OD9A 4MWZA 4DSTA 5IVKA 3R74A 2W6ID 1DLIA 1B2RA 3PTLA 3SFZA 4OLAA 3DBRB 1SR8A 4N3NA 1UWKA 4L3VA 4FB4A 1OVMA 2NU6B 5AJHA 1ZN9A 2FFAA 3VI4B 4RTSA 2NUTB 3VXKA 2ODEA 3TI7A 2L0XA 3D6NB 4Z3OA 1JHYA 2QTZA 4X1YA 2EWWA 1KMMA 1IE3A 3GBVA 4YXFA 5LA6F 4H16A 1SEVA 3X2SA 4YMWA 4DT1A 2HDHA 2OC4A 1JQLB 4XJTA 4I5IA 3AEUB 1LI5A 1YBFA 2BEWA 2ZRHA 4TLEA 4F6RA 4C4XA 5LUAA 4PYMA 4URHA 4YJGA 1XROA 2HQRA 2JLCA 2B4AA 1NUUA 2DT5A 3B3QA 2AMYA 4ACBA 3E9YA 1YULA 2XA9A 5HRCA 4MPRA 1PU2A 4EPTA 1OGIA 2HT1A 4DG5A 2W42A 3BWBA 3UAGA 4WUTA 2VRCA 4MICA 2BHNA 1GT91 3INNA 4UMEA 5DRYA 4ENVA 4IQ4A 2ZTLA 3THSA 2PRKA 2VDWA 2VP2A 4N8DA 1R4NA 1EFPB 2POCA 2V55B 1HC7A 1K8YB 3INTA 5BWOA 5F1OA 1IZ9A 2I62A 1OH5A 2VJOA 4YRQA 3GEDA 4RDHA 1LV8A 1CQIA 1KYYA 4G5YA 3Q0TA 3CG0A 4KBGA 2D2XA 2RKBA 1EVIA 1L4GA 2VJMB 1A9SA 2J9YB 3QUSA 4EGSA 2X8JB 2XWQA 3WP0A 5H8WA 1XL1A 2NQ8A 2CF6A 4RCVA 1OFUX 1NW4A 1R8YA 1XFDA 2NPOA 1OI3A 2WU3A 2GZ2A 3GRUA 3L6RA 2YYYA 4J4TA 3KKNA 5ESXA 1NP7A 1CUJA 1MENA 1TAHA 3BEOA 3FCYA 3Q7RA 4FEGA 4BO3A 4YQYA 1NULA 1R18A 1N7HA 4GKKB 4CI9A 1T91A 2A57A 1J7KA 2WJZB 1P1FA 4EHBA 1OBOA 1WV1A 3PIRA 4I66A 5TARA 4TVOA 2IL1A 1GGMA 1OY1A 2J0VA 1HMPA 2FWMX 1KWGA 3FKSD 3FTQA 2C8KA 4NMMA 4YNBA 3FMFA 5KAMA 4E5NA 4CKBA 4GBJA 5B3JA 1FMLA 1DBWA 1FNNA 1BMFA 2XJ9A 3DOOA 4IJQA 1EZ1A 1KR2A 1R3DA 4KQIA 4RMJA 3TJMA 4JUBA 4DJTA 4PWZA 3FOEC 3N2GA 2WZDA 2IHJA 2FCAA 2YV2A 3GEEA 3I6IA 1E59A 1J20A 3ESQA 4LTNA 1MQAA 3G1WA 3RIEA 1W47A 4FYJA 4N0QA 3UMYA 4AZTA 3FRHA 3KB8A 1R74A 1BW9A 1DT3A 1Z39A 5DW3A 5CIYA 3DCJA 1TFRA 3MC1A 1PDVA 1G21E 3NDBB 1I2ZA 1RHKA 3LUHA 4NKRA 1ZEJA 4ZYUA 2Q3MA 3TRDA 2AOVA 4M53A 2UYQA 5IRCD 5HOQA 4I99A 3CURA 3SDZA 3BWDD 2VF5X 5HG0A 2QYHA 4QUIA 3G2OA 5FULA 1LSSA 4L0CA 2HTEA 1YL6A 4NMXB 4EHNA 1I7SB 1EX6A 1CF2O 1SC9A 2W2LD 3GYBA 3HRKA 1L5YA 3AEQB 3DEJA 3O93A 4OA5A 4BQPA 4W8OA 4Y6OA 5LIPA 1AMOA 2Q5CA 3H4TA 2W9XA 1FYWA 1PT8A 3IQZA 5FFFA 1XOIA 2P6PA 3F5QA 3PLNA 3ER6A 1RKBA 3PNSA 4XJSA 1ZHFA 3GZTB 3C3WA 4M9SA 1W59A 2R6R1 1VIAA 2VPIA 4RQUA 1GKLA 2GLTA 2LPMA 4ZPXA 4DREA 1RKXA 4F1JA 3LK6A 2BM9A 3RVDA 2MSCB 1PLJA 1RSZA 5I9LA 2IC5A 1UBFA 5HW0A 2XTJA 2Z58A 1XNJA 2ZUVA 4KXMA 4GW3A 3LW8A 3UT0A 2ZJ6A 4ER6A 1NW9B 5D5HA 3BCSA 1P60A 4HG2A 5COBA 5JI3E 4IDQA 2PT6A 1E1LA 3KU4A 2D1TA 2XA2A 1JE1A 3L40A 4MDFA 1MRNA 3A4VA 3VBCA 1JAIA 2BONA 1A2QA 3WRYA 1PNTA 1YU9A 4R2XA 2IHKA 4O4LA 4XCQA 4DUPA 4GYWA 5E95A 2XV1A 1FDOA 2MSEB 3F9RA 2PUCA 4JY7A 1FP7A 4CKXA 3QXCA 1GAXA 1XMJA 1Q7CA 4IX9A 2HSJA 3B5JA 2CLDX 3EY9A 3OJOA 4FNAA 4QPDA 5KJEA 3VX4A 4BE7B 1RQGA 5K0GA 3HJCA 1ULTA 3PHGA 5K45A 1HR0B 4WZAB 2B1IA 1QTIA 2VUSA 1N0IA 3QKRB 2P5TB 1Q5PA 3OX1A 5DZSA 2R25B 4ZU6X 3RT1A 4MQ5A 3L92A 1FMFA 1O4WA 1N1EA 2NVBA 2YNMC 1K6IA 4WA7A 3WBFA 3ZHTA 1K27A 2FUG1 3G49A 1F1JA 1RIIA 4CKZA 5IWAB 2A5YB 4R0VA 2QU8A 3D64A 3CT4A 2H1VA 3NOQA 1L5WA 4YI3A 4AJJA 3AHFA 5AHWA 5TMBA 2G0TA 3QTLA 4BLWA 4E51A 1JJ7A 5JNLA 1XCPA 3F8TA 3LGSA 4NAUA 3IJEB 3BMOA 4II2A 5ALIA 1XI2A 1TEVA 2VPYA 3CSUA 1HZZA 4UHKA 3AWIA 4XI9A 5HIMA 5BYJA 3H65A 4YV2A 1JEYA 1Z07A 2LDXA 2HCRA 2QTTA 3L7BA 4N39A 3MJCA 4OLJA 4P31A 4ZU1X 3WJ7A 2ONYA 4A0SA 4CEIA 4J3NA 3PKIA 5HGXA 1SCQA 2O2DA 1LNQA 4HGOA 3R9XA 4DQVA 4I36A 4RE6A 5T6BA 2Q9CA 2QTCA 1GN9A 1KQ3A 1X80B 2EKPA 3DLCA 4ITVA 4NFYA 2C4VA 2OHJA 4RHCA 4AO8A 3TLCA 1Q0PA 3DL4A 4JFRA 5IF9A 3TRFA 5KSYA 1J0AA 3FVWA 4R5HA 4U7GA 3E3MA 1TK3A 2V5VA 3QVWA 4IOMA 1YRAA 3E4DA 3W34A 4UHBA 4CM9D 4CU2A 3H3XA 4LFAB 3ORSA 8ABPA 4R1NA 1A82A 3RASA 3EGDB 5FBWB 5HTOA 3NT4A 2HO4A 4BFWA 1O5TA 2IYSA 3OEEA 2IYZA 4NZMA 3V1YA 5EJIA 4FINA 4E31A 3DSRA 4N0MA 2NN3C 2IE8A 4ZVUA 5KOIA 2DBYA 3NH9A 3Q9SA 1NSFA 4FBLA 2NADA 1U3DA 1OT5A 3P9XA 4IDGA 1KS2A 5JO0A 3TBFA 1U2EA 1IQRA 4D1YA 1EVKA 3M6MD 1JG1A 1RVV1 4PY2A 4OLBA 3GNTA 3I34X 1G2PA 4HYQA 3FSGA 2COKA 4UEJA 1FUEA 3ROEA 5F23A 1YGPA 2XMDA 1VL6A 1KH1A 3QWBA 2HIGA 4IWNA 4Y2PA 1E3LA 3UBMA 3RPEA 2GK7A 5LKAA 4MR8B 4G5OA 1IVYA 2YV3A 5EMMA 4Z1MD 5TF4A 2GRUA 2ZIGA 1KOFA 5A1JA 1WPXA 3A11A 4PN7A 2CMFA 3KVYA 3PUXA 5FQNA 5ARCA 1Y63A 4ZO6A 2F7SA 1UANA 4XLZA 2QPTA 1JIXA 3LYLA 3M33A 4JI4B 2AMJA 2D2IA 3NDPA 4FDTA 2O8DA 1NMZA 1S2OA 1Y1LA 1SVUA 1SBCA 4MMZB 1CUFA 3GDOA 3K3PA 4ZCIA 4GVXA 4N5MA 1WOMA 1CUGA 3ABOB 5HRAA 1I51A 4K7JA 2HSEA 3UPUA 2ZJ4A 3RHSA 5DHPA 5I4BA 1WUJS 5E3HA 5GVSA 2R62A 1UJBA 3N3BC 5T6MA 5LQSA 4WKNA 2IZ0A 5FUVA 3DFZA 4G4SP 4BO0A 1U8CB 5I6DA 2GZMA 1DARA 1QV7A 2R7NA 1X7WA 3FR8A 5EMJA 1JI0A 3HA3A 1UDCA 3L8YA 5EJMA 1KZGB 2VEOA 1UPAA 3D4NA 3R40A 2CXOA 4U02A 3RVJA 4E46A 1IDOA 2J85A 4X66B 4H7EA 3DMYA 3W06A 4ZCRA 1E5TA 3IMFA 4G8DA 5LMCA 1U8AA 3RJTA 1GJRA 2IEIA 4QDTA 2A9FA 3C43A 5LB2A 4QUDA 4Z2YA 2B37A 2BGKA 4U7HA 1HFKA 5LOVA 2UUAB 1QSGA 3HSYA 3LF1A 2PK3A 2JLQA 4KMOA 3TS1A 3IHWA 2M6SA 5FOQA 4V3CA 2A14A 4RV4A 2JAWA 4XEHA 4OB7A 1YFJA 1Q0SA 4IH9A 5K0NA 3EZYA 1VSUA 4FHEA 1G17A 2VR1A 3FNEA 9MHTA 1T0JB 3ELUA 2I9PA 3DT9A 2C5LA 2G70A 2QE7D 1W6RA 3H5TA 3SK0A 2VWHA 3VSAA 1ZESA 2DGDA 5ECWA 1KRWA 1LW6E 4EG0A 4U9HS 4FFVA 1PYDA 3VKWA 1G7SA 3AM1A 1FQOA 3MMPA 1PFYA 5D85A 1VIVA 1M5RA 1Y4AE 1OWOA 1ZI8A 4GBGA 1U0FA 5AHXA 1GG2A 4PICA 3ZTWA 2G28A 4KN9S 4F5YA 1RYZA 3K1YA 3PFIA 3LXXA 5AK5A 2DPXA 1EM8B 1EEHA 1FQJA 1VPDA 2VXOA 5EIHA 1JECA 4A92A 3OG9A 5D51S 4CMJA 3EEIA 2JJ2A 4GYJA 1OH7A 1FDTA 3V1MA 3ZD8A 1KA9H 5BW6B 2JA2A 3D81A 3IULA 5LQRA 1G1MA 4HYTA 2D8MA 3PQDA 1P2TA 3PCXA 4AMUA 3U48A 4P83A 1QGDA 5BMVF 2KHZA 1II8A 3SX2A 1KK3A 2I34A 3D8SA 2H2AA 4QATA 1I24A 4G9EA 4GD3Q 3AR8A 1C3EA 3E7DA 4FFBA 4OF4A 3L79A 4HWKA 1BMTA 1YA8A 3NBQA 4OQZA 1JALA 4US1R 4UPVA 1O9BA 1RYFA 4I0WB 3TMAA 1T6XA 3P0IA 3TL2A 1ADFA 3LRTA 3IALA 5TQ0B 3WSVA 1W29A 1SY7A 1G8PA 1PR9A 1XF9A 1SCIA 1KMNA 1T4CA 1TX4B 1T3ZA 1XC7A 2VUTA 3BERA 3G9XA 4O2BF 4BEWA 4B74A 2Y71A 4PGHA 1FP4A 2XMRA 1XLTC 5ILGA 1KQPA 4RA9B 2PR2A 3EAQA 2OQRA 4PZ0A 3L0IB 4CMBA 5CVTA 2V6GA 3CPEA 1DZIA 5FADA 1YT5A 2XWSA 1BTOA 1RRMA 2AKAB 1REQA 2A6PA 4YJ2B 1XTZA 4Y18A 5IJ9A 3PNBA 2WSYB 4CLOB 4I4TB 5DSTA 1KI3A 1RQ7A 4HHEA 3AFMA 4F84A 3F6CA 4F46A 5K6TA 1E1QA 1JDVA 3FSEA 2EKLA 1JWLA 3AVXA 1YE3A 5LMNB 4WUVA 3B1VA 1QGOA 4NEHB 5DW0A 4BRUA 4CNQA 4Q7MB 1JKMA 1MW8X 2IXAA 1QUFA 4P0PB 3MTEA 4GSKA 4RANA 2GUGA 4LOLA 3WHIA 4WQMA 3WB2A 4A0RA 2HA6A 1D4FA 4BFLA 2NP7A 2CMGA 2B1GA 4V24A 4Z0PA 2H5EA 4AJNA 1Q0LA 1QGUA 1XHLA 3G5AA 3HFGA 1FUKA 4TSKA 4D4IA 4WJLA 7AT1A 1KMHB 4KNYA 2HDOA 4C04A 5T4BA 4K9NA 2OPHA 1R8QA 1UDBA 2H7VA 1JGTA 1UKBA 1ZK1A 2V98A 1QS0A 1KFJB 1W2WB 3G2MA 1XEFA 3PHCA 3QITA 1VJGA 5IP5A 4BYMA 3FCOA 2I2CA 1BXGA 1O4VA 5B4UA 4UD6A 3G82C 4D74A 2VRNA 3R7LA 2OUIA 4NCBA 4MHSA 1Q7TA 3PG5A 5C8DA 4UAUA 5E9AA 5J59A 2J6HA 2UZ1A 3FXAA 4D2IA 1D1PA 1YCHA 3GVXA 3ZK9A 4EW6A 4IXMA 5I7VA 4DSZA 5K3OA 2BMWA 4DG9A 2PQ2A 6REQB 2Q1WA 3DLIA 1JA0A 4C5AA 1CIJA 1OXVA 4YHHB 3D4BA 3MILA 5EE1A 3AESB 5ADHA 4E11A 3ISVA 4HLUC 4CV0A 3L8HA 4PAQA 3O3NB 2ISSD 4JR2A 3RHFA 2BF7A 1PV4A 1ULSA 4UMFA 3HLKA 5C8YF 1GVHA 5L7WA 1DQNA 2PV0A 4ON9A 1ZJYA 4X97A 2BBOA 2EZTA 1TW3A 1TKCA 3ET4A 4FNOA 5AXCA 2HEIA 2VH5R 1GNRA 1GHTA 3AETB 1P9WA 1JR6A 1CS0B 1KFCB 2DR0A 5CB0A 1N6LA 4Z6KA 4PQFA 2AOUB 4H9GA 1RD4A 3TE6A 3RS5A 1BDBA 1FIUA 1T1IA 4LHWA 2E49A 1M0TA 4DMKA 3KHUA 3EWNA 2QBYA 1GLGA 2GASA 5DOZA 3FPBA 4BJ6A 1FDSA 4X1IB 1DBSA 3BWXA 4ND3A 5C7LO 4G84A 5CIQA 5K51A 4DPLA 3ETGA 3K92A 5G53C 1L5GB 2JIOA 3CVUA 2WM9B 3BB3A 1VKOA 1K5GA 2DSNA 1SC1A 1JPUA 4JQSA 3R76A 1AQIA 1D3AA 1YS7A 2M1ZA 2A8YA 2QL5A 3GQBB 3Q7SA 4K3UA 1M10A 4I5DA 3DPSA 1Z88A 3DM5A 1IY1A 2J9ZB 1G291 1AG9A 3MEQA 2W58A 4X95A 1OROA 5JXIA 2YXEA 1CR4A 3NFRA 4WKPA 2H29A 4U0JA 3JW8A 1VMIA 3G13A 5JRDS 2VSXA 1IMJA 2J87A 4C89A 4ER3A 1W5EA 2XOXA 1EIWA 4UCWA 5HEKA 1QG4A 3ENQA 5HOEA 2C1EA 1DI0A 1P2FA 1YOVB 1L1EA 2N47A 3EXAA 4R1UA 3GMIA 2ON6A 3SYKA 3S55A 2AK2A 1GQFA 3JR3A 5H59A 4K46A 3U44A 3HA2A 2VHXA 4G65A 5JUWA 2WAMA 1JH8A 5CXXA 1N6KA 1I6MA 4XVHA 2PGAA 1DG1G 3NBAA 4I8DA 1F2UA 3VVCA 4IZOA 3RUFA 4RF3A 2SNIE 2NYRA 3DDWA 2PS0A 3R7WA 4BQQA 2HLPA 4V0ME 1E32A 1F20A 4ONEA 4RK6A 3CKYA 3TTVA 1YDGA 2C7PA 2Q2WA 5G4LA 5TNXA 4AJEA 4IPTA 5D3MB 4P4UA 4KLCA 3MJRA 1ZRSA 2GS9A 4DJDC 3UJ6A 2HPZA 3DXXA 5BNWA 4FC7A 2VPPA 4DCJA 4EZEA 3GPDG 1E4EA 1LJLA 2GVNA 1AVTA 2Y2VA 4URVR 3CPSA 3QEKA 5LZ9A 4NXNB 4S0XA 1CUDA 3JWPA 1G8MA 2PEZA 3SQOA 3LFUA 4BO2A 5KYWB 3ON5A 4KQXA 4X7MA 1LLFA 3KXDA 5IBPA 1OQAA 5BWBA 3GLGE 1ATZA 2FKAA 2Q8QA 3GT4A 3KB2A 3COWA 2OG2A 2RGCA 2OAGA 4BNIA 4PSAA 2WR8A 4LHXA 2WHPA 4WLEA 4C4TA 2E87A 5LDDC 2FRXA 3MTJA 4G0ZA 4QBTA 3I4CA 3ND8A 4X1YB 5CXSA 2D4HA 4FX5A 1V0JA 4HDRB 3UWPA 3E18A 4ZI7B 1ZN2A 3FLAA 3FPLA 5JJLA 3H5OA 2NACA 1X2EA 3P2MA 4UVIA 2J07A 3AB7A 4UEQA 5HILA 4LXYA 4EKNB 2H3HA 1BWPA 2E4YA 4DBZA 2XZLA 1Z3IX 5ARDA 4TUYB 4TQGA 1V5WA 2IHUA 1J07A 5K1ZA 4A8PA 4KI0A 5JATA 2RBEA 2VVTA 3IDAA 4ZIRA 5A4DA 2Z8YA 5JZ9A 2O0KA 4HD8A 3RVRA 3T8YA 1EI9A 1U6IA 4Y2YA 1MJGM 1BHJA 2NO6A 3MZ0A 4IQ8A 2QLLA 4N9QA 1W94A 2EATA 4OI1A 1KKLA 4YAKA 4B4WA 1KZYC 2XJ4A 3P2JA 1ABBA 4OB8A 3ZDAA 4JUFA 4PXSA 4D0LB 4E09A 2XNDD 3FHTA 1P0PA 5DBEX 3ENNA 1G16A 4O2RA 4AD8A 5LQNA 4HBGA 3I9MA 3QKRA 4FTWA 2BGLA 1V3VA 1AURA 5CA1F 3QW2A 1WJGA 5F2EA 5JZMA 4PX9A 4RD3A 5IDXA 3CEJA 1COWA 2BGUA 4QTZA 3NGXA 3PD7A 2NZ2A 1DCMA 3T9DA 1XK7A 3B1JA 2NSLA 2G40A 2IHBA 3HL0A 4D79A 3N0XA 4DCVA 1W4LA 1HE1C 3IP7A 5LXTB 5JSQA 2V6JA 4B3RB 2CV1A 4RVDA 4X3CA 4Q18A 5CVVA 1A9PA 3GD5A 3EXFA 4J7AA 1WNFA 2R4TA 5CU7A 5C1BA 1OBVA 1CSEE 5LJLA 3N58A 4ZO7A 1XTUA 3H2KA 3DMPA 4YREA 2CLEB 3SMQA 5F77A 1OC2A 4GKAA 1TW2A 3H87A 1VSTA 5KYXB 3O0DA 3W5UA 1J25A 2XB6A 2DP4E 5AVRA 1E4YA 3A9CA 3BIXA 1QR2A 1E9FA 5FPSA 5BRNA 3X3HA 1QQAA 4RVGA 3KOOA 2P27A 2CJPA 1X80A 3M34A 3U3ZA 3ZH9B 4EPWA 1ONPA 4INOA 3L1KA 4OPMA 1G9XA 2P5YA 2WU8A 1R9NA 1PZNA 1QGUB 4YCMA 1SU6A 3PFCA 3UCEA 3S81A 2OR3A 4X85A 2D7CA 3ADOA 4DSAA 5AW4A 2GX6A 1JBEA 4JVMA 1T6YA 2QR3A 3C7KA 2PYIA 3H84A 4H3VA 4J3JA 1GPDG 4ZO9A 5SZHB 4G89A 2E89A 1DC5A 4NFHA 1UH5A 3K09A 3ABQB 2YIJA 5AVZA 1XTKA 1LVUA 3ZWQA 3A9VA 1B93A 1LTHR 2CF5A 2LDBA 4RGQA 4TV9F 1V45E 2W4IA 4HFMA 3QYFA 1HE8B 3HM9A 2E5LB 3HMKA 1C4KA 2NG1A 2NTJA 1VLZA 2P3QA 3QV2A 3EPLA 1C80A 1E9DA 3ZCRA 1J39A 3G2HA 3UH1A 1U6JA 1Z5NA 1VLJA 5D84A 3HS3A 3AIIA 5KVSA 2LUOA 1WHSB 3DA8A 1OHHD 4RNDB 1Y3IA 3FNFA 3R5SA 4Z7OB 3B1FA 1ZC4A 5H83A 3AESA 1A9QA 1EWKA 1QNFA 1TD1A 2CFIA 2H1HA 4ZAFA 5BQ5A 4X6XA 4A03A 3HZOA 4N4AA 1NPTO 4I1RA 3VHLB 2C7OA 3NTOA 3MWKA 4Y1GA 1HO3A 1RPAA 2QSZA 3OVMA 2BTQA 2PFKA 3QX7A 5JPCA 4Z4HA 4L57A 2I3BA 4PYIA 2R9VA 1Z68A 2KWIA 3N9IA 3D1JA 4LE1A 3DS8A 5AVQA 4KHZA 4TYPA 2FZGA 2XUIA 1TVKB 3C15C 2HW8A 2PRZA 1II8B 5ELLA 2A0KA 2AOUA 5LVAA 1AKYA 3N70A 3OHMA 1L8AA 1NQAO 4GXQA 5A4KA 5KYYB 3ZV5A 3NP7A 3GFRA 1ND5A 5U9CA 2J3MA 1Y7IA 4B76A 1PE0A 4M98A 3F71A 4JHXA 5AK3A 1Z34A 2JZOA 3MT7A 2XYHA 3NALA 5FI3A 3E7WA 4C0WA 1MAAA 4MYTA 1Q2XA 4EABA 1XTRA 2Z04A 3BMCA 4KQCA 4M1WA 3STTA 1KI2A 1P61B 4C4RA 3SC4A 1EA7A 4NFLA 2O8BA 2C94A 4RORA 5JASA 2M9MA 1HNXB 1KQFA 1RI4A 2HK8A 5LMZA 3VSCA 1O6ZA 3S2UA 5BNIA 3HZHA 1HV8A 4A36A 2JFWA 3FY4A 3R6DA 2PUFA 2JAXA 3NFYA 2F62A 5EZQA 4UAGA 2I33A 1HKUA 1VHLA 3VPFA 1IY2A 3Q3HA 3BSYA 4TZ6A 4IR7A 4GM1A 1RXVA 1QTQA 4NBLA 3SYRA 2Z98A 1JA1A 2JASA 3C6QA 2QM7A 3GFBA 2FFRA 1VKJA 1ENOA 3CLHA 2TMYA 3JAWA 3LWZA 4OMCA 4CG2A 1DGQA 2ZUUA 4M9XA 1ZJJA 3CW9A 1XYGA 2Q4TA 2FFHA 2RHMA 2H2HA 2XT0A 3EYWA 4A82A 3FB4A 4ZYYA 4MS3B 3O83A 5DYGA 3ANTA 1O58A 1VLHA 2W2LA 3GFQA 4J9VA 4MYSA 1IIRA 4Y8VA 4Z9FA 3ZCUA 4PPFA 5JVDA 2J5KA 2AOXA 3CUUA 3UMSA 2OAP1 2CNKA 1D0SA 3N8DA 5IAKA 3ZWWA 4S1WA 1I3NA 2YH2A 3AEUA 4HQOA 5CH8A 1HY3A 4HLUA 3FIJA 3TFQA 5L51A 1Y6GA 2Q8PA 4DLRA 3ZCPA 3DKIA 3GUHA 5EIBD 2GEBA 1TYAE 4L15A 4R1QA 4LDRA 5IDQA 4OUDA 5ITWA 2D5CA 2O8FB 2GN9A 4LZJA 5EMKA 4IIYA 3RVMA 2CWWA 5AI4A 3QVJA 3K2IA 5AHRA 1Q1NA 1QYWA 4JKYA 1EJ2A 2CFCA 4FOPA 5JYDA 3WQSB 3KR9A 5IC6A 2C98A 2WF6A 2EV9A 1LJUA 2IOHA 1UJ5A 1GCIA 4FIZA 1LLCA 4UXJA 5CT4A 5FYDA 5HZHA 2V65A 3COYA 5EIXA 4FBMA 2BHTA 4NNJA 1G5HA 3T1VA 4EH1A 5KYUB 1L3IA 2MYNA 1N0HA 4GM4A 3FUCA 4XASA 2CVOA 1N6RA 5EJ6A 4BY9E 1SCUB 1UK9A 3O4VA 3T7KA 4EQ6A 1M5TA 1L5SA 1ORWA 3O7WA 5EY5B 3FGPA 5HYVA 1T2EA 3IKMB 4R1TA 2D5IA 1G6KA 1YZLA 2PMBA 3NOOA 1A72A 4KYUA 2GEUA 4DLXA 4C03A 1A8PA 4EJ6A 1QHFA 2IUSA 2JANA 3F96A 5D00A 4ZFNA 3QIAA 3NNNA 3G88A 4UZSA 5KYGA 1G20E 2QZ9A 5CLFA 3RRYA 2GWHA 4JJ8A 4A8HA 2V3WA 4QXOA 1HLGA 4OHXA 3TNLA 3MHPA 4GQIA 2D4AA 5CG1A 2XYQA 3AV3A 3CZ5A 3FYUB 1WEHA 4D97A 1V8PA 2AL7A 4O4LF 3CCFA 1UBOS 5HBRA 1FFXA 4Y0VA 3EUAA 1LRKA 3CXUA 4DNPA 4HEQA 1KMHA 2VDNB 1E2DA 4HWRA 3PA6A 1EHCA 1K8RA 2WSMA 6GPBA 2WNIA 2ADMA 2WFLA 3L7MA 2AQ8A 1KRHA 4DM3A 1PS9A 1DS6A 2VTDA 2GAIA 2XE8A 4E5KA 4CF4A 3ISJA 3KEQA 1PYOA 1D7AA 2FCRA 2OBYA 3P9CA 3KE9A 1DU4A 1NGSA 4OXNA 3SF8A 4YRBA 5BMVA 2VK8A 3UHAA 4EO4A 1H8HD 2FEXA 4M1OA 3KXKA 3YASA 3A8TA 3H19A 4S0ZA 2OFPA 5BT8A 4RULA 4F4IA 1M2EA 2HF7A 3HPQA 2VP0A 1E2JA 3PE4A 3NCHA 3KR2A 4JASB 4Q3LA 1U04A 4L6IA 3NXKA 1B76A 4RABA 5M34A 1B3BA 2CC2A 3JTEA 3W2TA 3AONB 1QH0A 3P9IA 2AF4C 2UVPB 3QVMA 1E6KA 3N5KA 1HBJA 4X7RA 3GIDA 4YA6A 5DMXA 2DBZA 1P5HA 4UXIA 1GA6A 3KWFA 4BMOB 4QREA 3UMMA 3I42A 1Q6ZA 5I7FA 4RTJA 2FI1A 1NXXA 4MQFA 4F72A 2FK8A 4JLJA 5DX1A 4RZ2A 5K6AC 5CCXA 5IJ0B 4CKBB 4QTYA 1R5BA 3PXUA 5ICMA 3L93A 4GZ5A 2ZCVA 5IFKA 421PA 1UZNA 1CR6A 4D6YA 3MGCA 3AUYA 3ORFA 2ZAOA 5L53A 3BA6A 2I6GA 4FDAA 1ZO8A 2DWUA 1VCOA 2IX3A 1J00A 2JCXA 3HWSA 3LDUA 5FXMA 3OZVA 3GGOA 4GL2A 4I1IA 3C70A 1L3BA 1GZ4A 3MLBA 4WKOA 3NJ8A 4Z4EA 2F4NA 1QQTA 1FOEB 4V0MA 4MQFB 1QP0A 1V2HE 2ZYUX 3UB4A 4DJFC 1QFMA 1MX3A 3LL7A 2VDMB 3CE6A 3SJAA 3OWXA 1Q3KA 4XIGS 1OU0A 3V1NA 2HIMA 4P80A 4H0CA 2IXTA 3L4SO 4ND2A 4MUNA 1WL8A 4RLFA 3GVHA 1DRJA 1VBKA 4JX9A 4MRMB 4YV7A 3O2NA 2FSHA 1HEYA 3LH5A 3C8UA 2XT9A 4CLOA 4JHLA 1PFGA 2R79A 3CRZA 1UZUA 3DTVA 3WLSA 4BKMA 5EFOA 4H4DA 4P86A 5SY4A 3QY9A 3QG1A 5LQUA 5HIJA 3RS7A 2OXIA 2B3DA 1QVWA 2YZNA 2NYAA 2FSVC 5IJAA 2GCGA 3WLRA 1WMEA 5I8PA 3HB0A 1O9HA 3CUEF 1UPTA 3DD1A 4FZ5A 2F43A 2G63A 4G0MA 3HB4X 4X8MA 4YP7A 4LF5B 2Z5FA 3GRCA 4MDHA 3SBOA 1RJ9A 4C3ZA 2F3SA 1PI3A 3HCEA 3N7AA 1T0HB 2IPNA 5U4XA 1AO3A 1Z6TA 1MCZA 2UZAA 3I53A 4BQNA 1RI2A 3R3WA 3NWPA 1N8SA 5H82A 3DD5A 2ZVQX 1T8YA 2YMMA 3KEOA 1NVKA 3KHSA 1MIHA 2WYOA 3JQFA 2UYGA 4XQ0A 2XGJA 5JTTA 1VB5A 3TLGB 4DWVA 3UM9A 4DEXA 1SQ0A 1U2RA 3GRFA 4ZVKA 4FHGA 1J7JA 1QQ6A 1TVEA 3SEQA 1XPRA 3AW8A 3I1IA 1S2GA 1COZA 1TMGE 1MXFA 4CL8A 2X0RA 3JQ7A 4XM2A 4JDPA 3FR7A 4EJSA 3DFIA 1NBME 2ZUDA 4X64B 2V5UA 2P9CA 3QH4A 1IPFA 1MV8A 3ZI4A 2J1LA 5IZCC 1RI3A 3MWEA 1NMSA 4ARCA 5T5QA 4Z8XA 3CUYA 4G09A 1QO0D 3F90A 2MSNA 4UQOA 4CMGA 5JNSA 5LYJB 1U3TA 4WOCA 3VPSA 1E1NA 1N9ZA 3V3TA 1NVEA 2ZYAA 5LYJF 2IPXA 2C07A 1DG3A 2BSAA 3O8NA 1GAQA 1X1AA 3OZAA 5A7GA 4EGJA 1KETA 1MO5A 1NKVA 1J6UA 3I04A 1YBVA 3EMVA 4HB4A 4O08A 4YRRA 2QTMA 3WLAA 1ZD3A 1VIDA 1OFUA 1Z6AA 3D8TA 4IJVA 1ACLA 2RGNA 3NHMA 4I9FA 5EWLA 4ASUD 3V4ZA 3JQAB 2PYDA 4RIIA 3OZXA 3UTCA 5JR3A 4FEYA 4RXUA 5ALDA 3PNOA 4FU0A 1H2XA 1GU0A 2BN4A 3DL0A 4K6KA 4E5YA 2W2VA 2G9VA 4KAJA 3HCCA 3IKVA 4NDNE 5AIBA 1BZYA 2PSHA 2ZUSA 3DH0A 2OYSA 2XE4A 2YCBA 2KI5A 3M1LA 4KKXB 4MEJA 4J0CA 1EK6A 1PEDA 1R6BX 3L41A 3RO7A 2DSTA 2G80A 2H0RA 3LDFA 4Z4QA 1KEUA 2JEZA 1JYFA 2EIXA 3OCWA 4EHJA 1O57A 3HEAA 3TSOA 4YUYA 3EXIB 3CN9A 4OIMA 3GFTA 5DWQA 1KE1A 1CJCA 2H31A 3EGXA 2YMPA 1NJ2A 3ILVA 1QXSA 4CU5A 1CXZA 3LUGA 2NU8B 2X4IA 1N32B 4PC6A 3PFBA 3WRXC 4HX2A 1GCOA 1C50A 2W90A 4J0QA 3EASA 4OJKA 5CUQA 2ZROA 3G85A 5JSYA 3R5HA 4GI3A 4MAMA 1MO3A 2ZRDA 2FTKE 3IUNA 3OT5A 4Q16A 4HX9A 4E4YA 3DVAB 3W6OA 1EG2A 4BNUA 2ZTHA 1XPOA 3JX9A 5T67A 3OZEA 3KOZA 2C92A 5ALSA 1YQTA 1SWVA 3ONNA 4NONA 1S9HA 5EP2A 4U7DA 2EWVA 2QN7A 2QB5A 2IH4A 1B6SA 1K75A 3D0QA 3K30A 3LQQA 4L95C 4DIKA 4CN8A 2CZGA 3L49A 2FJ0A 2AG0A 2ZTUA 4X20B 5KNDH 2V03A 1LDNA 4UOZA 2DX7A 5BORA 4PYNA 4AW9A 4BNNA 4PCAA 2DFDA 5MGBA 5IM4F 4C7OB