4LYJA

Crystal structure of small molecule vinylsulfonamide 9 covalently bound to k-ras g12c, alternative space group
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
TEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
molecule keywords GTPase KRas
total genus 57
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lyjA00
3AVTA 4WAUA 3FKSD 2V1XA 2YWGA 2QNRA 3BFKA 4QJ5A 1KMQA 1U98A 3NVAA 3ZQJA 1XFAA 2WWHA 3FYHA 1E96A 2IS4A 3DM9B 4LJ8A 2D7DA 2I4IA 1US8B 2W2TA 2WIAA 3GEEA 4JS0A 2JIZD 3HR7A 2QTVB 4BEJA 1HA3A 2CDNA 2EFCB 3K09A 1E9EA 2KB0A 4NYMQ 2AKYA 2A7QA 4XTRA 3U61B 1IQPA 2ZS8A 3K0CC 4TYNA 1XD9A 1CRQA 1QHHA 4B71A 4ZI3A 4TYYA 3SN6A 3SBDA 1JEEA 3CR8A 4B3GA 4LDJA 3U7FB 1IY1A 4YXWA 4X8HA 2G83A 2YV5A 4LJ5A 4PQFA 2VSXA 4WA7A 1W36D 1KMHA 4PAOA 2VYFA 5TARA 5FR1A 5IK2D 2ZRAA 2WWFA 2B8TA 1TU4A 3A1WA 2ZE6A 4NYJQ 2CL6X 4AY2A 2ANCA 1KSFX 1GL6A 2C9CA 2WJJA 3I8XA 3K9LA 1TF2A 2UZIR 2WSMA 3KKOA 5L3QA 2OCBA 4P4UA 5CJPA 1G19A 2DY1A 4AYTA 1XU4A 2F43A 1W49A 1ZW6A 1VYVA 2OUKA 3NBFA 4ZDWA 5A5GA 1G4UR 4Q5IA 1H8ED 1ZP6A 3OEHA 1F6BA 3U44A 4C9BA 4ON9A 1C4OA 1E9AA 1N2CE 1QDEA 4DDVA 2ODBA 2R65A 5TXGA 5GADl 3NHBA 1Q1BA 1ZM2A 1UKVY 3GFOA 3U3OA 1WF3A 2Z43A 4Q1FA 1WCV1 2ZREA 4H9GA 2Q9AA 5DN6D 2IWHA 2DWQA 3F8TA 1NI3A 2O0KA 2AR7A 2D62A 2Q3MA 2GCPA 1W0KA 3FKSA 1E98A 3LH5A 4JL5A 5IT5A 2J0UA 1L4YA 1UADA 3HDTA 1U9IA 5KSPA 1M34E 3CF6R 1P6XA 3VR2A 4EFNA 4URYR 2QG6A 5JS8A 2BCGY 4GBMA 2R8RA 5B64A 2NO1A 3KXKA 4V0KA 5G3ZA 1OSNA 2QMEA 1EWQA 3LBNA 1OB5A 1XMJA 4B3FX 2BEJA 3K8YA 3U3JA 4ARZA 4O0MA 5HR5A 3B78A 2Z4SA 5HTKA 1XCGB 3SHFA 3RWOA 2JJ2D 3O47A 3GLIE 1ETUA 3GMTA 3LWNA 4E5UA 2ORVA 2H7VA 5AJVB 4E09A 2NZ8A 1R0XA 3B82A 2G1KA 4MYUA 4BLSA 4A1FA 4E22A 4FCTA 3BWDD 1Z0DA 1E1RA 3RS0A 1E2DA 5FPTA 5E4FA 1JJ7A 2P5SA 2F9MA 4NYIQ 1C9KA 2ZI4A 4IEEA 2LWIA 2W6JD 3H2YA 1IXRC 1AQYA 1E0JA 2QT1A 4Q4JA 2VSOA 4PZZA 1E9FA 2E9SA 3MSXA 1K8RA 2PLRA 2ZRLA 2PJZA 1FUUA 1Z3IX 1S9HA 1II9A 3RS4A 1UM8A 2FG5A 3F3YA 3FHCB 3NWJA 2ZTSA 4KVGA 3OEHD 4JLOA 4Z54A 2CE2X 2QTHA 2DR3A 3R8FA 3F5FA 1GNRA 2EWVA 3TVDA 1N6HA 4DJTA 3KJIA 4V03A 4Q7MB 4YLGA 4C0JA 2BOVA 3CWZA 4Q00A 2QP4A 2ZRJA 4ZKDA 3I3SR 1KSJA 4FMDF 3ZZTA 4EAQA 1BOFA 1M74A 3K0SA 821PA 4IVQA 3V9PA 3HU1A 1AKEA 1OV4A 2EU8A 2OAQ1 3TMKA 3U3MA 3N2EA 3I62A 4OQXA 1NG1A 1Z0AA 3LFUA 1SULA 5BW8A 3MLEA 2WIBA 3CRW1 5KPDA 2WJYA 3VR6A 3B9QA 4NYMR 4IVRA 5TV2A 5BN4A 4F92B 4NTZA 4QBHA 3VTKA 3HWSA 1E1QD 1YE8A 3CX7A 1YZQA 4WZ6A 4KHZA 4LGMA 2GEVA 3KJEA 4Q47A 3AP3A 2OEPA 3C5CA 3NC0C 2DYKA 1KAGA 3BFVA 3HJNA 2QE7A 4TYPA 1KK1A 4HUQA 3U2QA 3LXXA 4JIMA 5HZHA 2JLZA 4PC3A 4IEIA 2BBWA 2QI9C 2VP4A 1KO1A 1SQ5A 5C18A 4WOPA 3NBYC 3AF1A 3FMOB 1ONBA 3W3ZB 3VMFA 1N0VC 3RS2A 5FTJA 1IY0A 2VHQA 1S9DA 3SHWA 1ZBDA 3AVQA 1IJEA 2IYVA 2OLKA 3B2EA 3OIUA 2J46A 4NONA 1G7TA 2F1RA 2A5DA 4PSAA 1DVRA 4MDFA 1GZSA 3RLFA 2Q9CA 4PZLA 4QBFA 1G8GA 3ECCA 1K5DA 1OKKD 1AIPA 3ND9A 4MUBA 3LA6A 4BECA 4YDSA 2JEOA 2PLFA 4WVFA 2QMHA 1T4GA 2ZRFA 3PIRA 3CNNA 4J0QA 4OI1A 2KWIA 3QXCA 2ZANA 3H0KA 3MCAA 2QEQA 1R0ZA 2IYRA 1DAFA 4TTRA 5IK2A 4M21A 2ONJA 3QXHA 1XCPA 1E2KA 2NGRA 1HV8A 4O25A 3PV0A 3QF4A 5A0FA 1VKJA 3KQKA 2W6ID 4C30A 3T35A 1J99A 2QP3A 5EP3A 2NTYC 2EFGA 3AQ4A 2J7KA 2W58A 1Z2AA 4GOJA 4L4UA 4RSGA 3SJZA 5AUOB 2O8BB 3T61A 2ZRCA 4MYCA 1UEIA 2HLDA 5J47A 5GJBA 4OJKA 1KSGA 3GLFE 2P65A 2KBFA 2BMFA 2W0SA 3DOFA 3X1DA 3CONA 4KBFA 1XXHA 3FHTA 1F2TA 1Y3AA 4PX9A 4JLNA 4TLAA 1GVNB 2O5VA 4Y0AA 1KI2A 1IONA 1Z0IA 4M1KA 2HXSA 4BFTA 4HI0E 1R2QA 2GZDA 3FE2A 3J81k 3GPLA 4TQUS 2H16A 1BO6A 4IKEA 1V43A 4QG7A 2AL7A 2DFNA 4B32A 4DCVA 1HURA 2ECKA 2H5EA 3PEVA 3TUIC 1LF5A 2QRZA 2G77B 1G1MA 2C96A 3SI7A 2RHDA 2J0SA 2HDNB 3UXMA 4RZ3A 3EAQA 3D6TB 4Q4HB 2F1HA 3UWKA 1BKDR 2RCNA 4H1UA 2WWXA 4ZV4A 2B6HA 3PENA 2IYXA 1CIPA 3GLHA 1XJ0A 4KO8A 2J9RA 3B8HA 5HE8A 1GP2A 4DCUA 2ZS9A 4D0LB 3IHWA 3QSYA 4UKDA 3LBHA 5FFMA 1Z6AA 4MDEA 3P27A 4NU0A 5IRCD 5E7JA 2WMOB 2IWRA 1Z07A 1KI8A 3U4QB 2JJ2A 1X8JA 2D4HA 1T3SA 4DT1B 4CZ2A 4DZZA 2HEIA 2WWYA 2ZE5A 2V3CC 4NE2A 2LKDA 2IUTA 1QVAA 1TX4B 4L8GA 5GVRA 3IIJA 5CITA 1KI6B 1E2GA 4DWJA 3OFNA 4AG6A 1XMIA 3CRVA 4Z1MA 1GKYA 4PHGA 1W7AA 1QHNA 4Q4AA 2ZJ5A 2PMDA 4NCHA 1Y63A 2KBEA 1T91A 2WOOA 2F3RA 1W36C 2UVQA 4DHEA 1NY6A 1EGAA 2VLIA 1B0UA 4RD1A 4GT1A 5C46F 1NY5A 2AHOA 2G0TA 4JLJA 4BLRA 4Q7LA 2XEXA 4QJ3A 4OHWA 1FOEB 3R8CA 3GLFA 1RW4A 1IXSB 1Z5ZA 1U8AA 2AWNA 3FB4A 4IDOA 4MGIR 3C41J 2HLDD 1FTSA 1W44A 2IYTA 4II7A 4RCZA 4KVAA 4IDPA 1Z0FA 3WP0A 3GJ8A 4PO8A 1JBKA 2D3WA 3MFYA 1DG1G 3A8TA 5AUPB 5KUTA 2IBMA 1SVIA 3EWAA 3NKVA 4PPNA 1W4RA 2WM9B 2XNDA 1OHHA 4W7SA 2J87A 2HUPA 5BN3A 2XZOA 3CH4B 2C95A 1RPZA 3HPRA 3FHOA 4XD7D 5EE3A 1QRAA 1A82A 2QGNA 2QP9X 1VHTA 3A6PC 2P6UA 1KNXA 4Q9HA 1CF4A 2O8CA 4B43A 3T06B 4L15A 2MSCB 3VNVA 1E2JA 1YZGA 3G5UA 4B48A 2F1JA 1IN4A 1GL7A 1U2RA 3X1XA 2REBA 4UNRA 4D4JA 3AUYA 3TQFA 2GKSA 1LW7A 1N6PA 4GP7A 1G3MA 3SFZA 4XVUA 2ATVA 1ZD8A 2OILA 3EPJA 3WRXC 3FTQA 5D3QA 4G1UC 2FPMA 4YQFA 2R6FA 2WAXA 3LO5A 1XXHE 4TLBA 1XEFA 5CB8A 3SQXA 4PC1A 1YR8A 2IA5A 5A4JA 6Q21A 1SVOA 3B1ZA 1RIFA 1FFHA 2I1QA 1E2QA 4W5WA 1Z83A 8OHMA 1QHSA 2RGNC 2YOGA 2IUUA 1JXOA 2V9PA 4CVNA 4D82A 5JLJA 3WY9A 2BJWA 1X3SA 5P21A 2FZLA 1ZIPA 2IYWA 2R44A 5SZHB 3FMPB 3CNLA 3DHWC 4Q1DA 1YQTA 1M7GA 4DSTA 3WBJA 3H1TA 4B6FA 5AUNB 4HUQB 5JHHB 4LBZA 2ZETA 4GOXA 2ZSDA 2A5FA 2WSSD 2FX3A 3LV8A 2CLCX 2XZPA 4CEHA 4CEJA 3GCGA 2X2EA 1ZM7A 1T3HA 1U0JA 4XSHA 5FUYA 3W6PA 2BC9A 2R6AA 3NH9A 2XGJA 4DXAA 3Q72A 2GCOB 1TPZA 1S0UA 3C7KA 4AKGA 4JT4A 4TL8A 3DOEA 5UKDA 1AGRA 1Q22A 5ELXA 2GWHA 2W2VA 1JQLB 2Q3HA 2FSHA 4GMXA 4AK9A 2RH5A 4LHWA 1JPNA 5AUQA 1LFDB 2P2LA 2A5JA 4LOAA 5JWOA 5KDOA 5CM8B 2QBYA 3LQQA 4BRUA 1XJCA 4QXAA 1GRNA 1OH8A 3U3KA 5SZJA 2Y8EA 3IBYA 1YKSA 3EG5A 2WJGA 3W34A 1S1CA 1WDTA 2FF7A 1DAKA 5FUVA 5EXTA 2DPXA 4NH0A 1UF9A 3DO6A 5FH9A 3R7WA 3ZVLA 3GD7A 4B35A 4B74A 4L9WA 4PPGA 4AG5A 1IXZA 1U99A 2VQSA 1FW6A 1Z22A 1ZUHA 3FVQA 3Q7PA 3ZZ0A 3IQXA 1JAIA 1JI0A 2YJTD 2C78A 4LHYA 4MGZR 5JWRA 3LVRE 2CNWD 1KI7A 2HJGA 5CLLA 5FOVA 4WIAA 4QNMA 3ZD6A 2ZRPA 4URXR 4DLVA 2PT7A 3MUFA 4MKIA 4JSYA 5DNYB 2ZJBA 3RRNA 3K70D 2N46A 2ZROA 3K0FB 3VNUA 4MRSA 1ODFA 1J7KA 2YNMA 1H8HA 4C2UA 4US2R 1ZU4A 5CLQA 1IN6A 4AIIA 2JDIA 2GVZC 1ANKA 4Q1CA 2WBLC 3A1VA 2VHCA 3AP1A 3D7MA 3LVQE 1JJVA 3THYB 3THOA 1ZM3A 2ZU6A 2GF9A 2CVFA 2OHFA 1AKYA 1G3UA 1Q44A 4OQMA 3Q85A 5EQTA 4UJ5A 2WJIA 3EWSA 2GA8A 5J4HA 5KNCA 4R2IA 1OPXA 2ORIA 2B92A 5KSZA 3NHAA 4KU4A 5FTLA 4RD6A 2XB2A 4OHYA 4LBYA 3V00A 3CRRA 3TGPA 3AVXA 1P3JA 3VR4A 3OAAA 5F2EA 3SOPA 4B3BA 2HCBA 3MWLA 2IXGA 1VMAA 4K81B 4OQLA 5JEDA 1G20E 2J0QA 4HDQB 4NHOA 2W00A 3L0SA 3WXMA 5FI0B 2FU5C 3U7EB 3ASYA 1F2UB 1R8QA 5DI3A 1NMXA 1VCIA 1Z6YA 4FMCB 3U3RA 4D6PA 1I4TD 2D7CA 3M6AA 4LJ6A 3EA0A 1CBUA 1CTQA 4GRAA 3PUVA 3KJGA 4R98A 2BCJQ 3ZD7A 1NP6A 3IUYA 1J70A 4C0QC 4XH9B 5HKKD 2NIPA 4PC2A 5E95A 4TSFA 2WICA 4NP6A 2RGGA 1SZPA 4LV5B 2R6DA 4TMTA 1TQDA 1WB9A 5BQ5A 2FPLA 3BOSA 2NG1A 3AKCA 4GSYA 3NG1A 3VX3A 4IDHA 2FFHA 3OHMA 1RC8A 3ONWA 1GOTA 4RCYA 1VG0B 4RZ2A 1D5CA 3LX8A 3M0EA 4Q02A 4JLDA 3K53A 4CF7A 3MWJA 2ZM5A 4GDFA 4C0SA 4N0EA 2ZRMA 4TYQA 1ZNYA 2FSGA 3NC1C 1FNNA 1RRPA 1W0KD 1ZIOA 1G17A 4QOSA 4DCSA 4TYWA 3RS7A 5CK4A 3EZ7A 1EFUA 3CM0A 3ZH9B 1GILA 4TLEA 1M7HA 3TSWA 1ZC3A 4A0FA 1P9WA 1GRQA 2OCPA 4K46A 1W5SA 5LBIA 2WVJA 1W2HA 3AF2A 4EDHA 2A2ZA 1VPLA 2FGJA 4D4LA 5JSZB 2CK3A 1LB1B 4D4KA 1D9XA 3KKPA 1KOFA 1UBGA 2IYUA 2ZSEA 2ZEJA 5IDVA 421PA 1GM5A 4XJXA 1A4RA 521PA 1RE0A 3LRPA 3U5ZB 4JLVA 2OLJA 2CBZA 1JXMA 2GVDC 5AWFC 2ZR9A 3DZ8A 3KUCA 4B2IA 3L8ZA 2PJRA 2GCOA 2ZR7A 3IIMA 3QY0A 3SC3A 5BXQC 3BB3A 4KFTA 2HT6A 3VKHA 4MRRA 3TAHA 4QKQA 1BS1A 1TQ6A 1HT1E 4UQOA 4Q9IA 1EFTA 1PLJA 5TVKA 1FX0A 3EZFA 2BMJA 5EXSA 1QVRA 3SNHA 1RKBA 1E4VA 1DAGA 2CJWB 1TF5A 3SR0A 4AKEA 2F55A 5EXPA 1E2EA 4K8OA 3QUSA 1NN5A 2VF8A 5G40A 1CXZA 2ERXA 1W36B 2VHTA 4HEJA 4HUTA 2VSFA 1QG4A 1XMSA 2O8EA 3QF4B 5CDFA 4KCGA 4HAXA 4MA4A 221PA 3GJXC 1XPRA 5B2ZA 3ADCA 3I1FA 1P2TA 2ZR0A 3TAUA 4Q7JB 1OYWA 3SJBA 3GLGB 5EE0A 2G0NA 5KHOC 4F38A 1CP2A 2GJSA 2QQEA 2IEZA 3QE0A 4JLPA 4PO1A 4B34A 1E2PA 2EFEB 4TMKA 2G88A 4BUJA 1MRSA 1KDPA 1W47A 2X77A 3BK7A 1PV4A 3K9GA 2HT1A 1HUQA 2RGEA 4GI7A 4PXAA 1Z0JA 5EZ5A 3ZVNA 4M1MA 5FTMA 2P3SA 5J5CA 3H84A 2ZS7A 4G5SA 2DWOA 3ZGXA 3TR5A 1UBFA 3EASA 2GCNA 1GFIA 4M2LA 1II0A 3UMFA 1KI1A 1UKYA 5FR2A 4LHZA 2V7QA 4US1R 3QNUA 5JI2E 1WRBA 4LYJA 3H86A 4DIEA 1G5TA 2R6GA 1HTWA 1L8QA 1N5LA 3EXAA 1N6NA 2ZRDA 4BEBA 1Z2CA 3CF0A 1H8HD 4RD3A 2O8FB 2GNOA 5L3SA 2XJ4A 4LRWA 4A8JB 4DLWA 4HYYA 2HF8A 3GLGA 4B73A 2QMUA 1U0LA 3EA5A 3QKUA 3FMFA 2JLSA 4LY6A 2REXB 3GJ3A 4DSOA 2FPKA 2Q6TA 2RGXA 2YWHA 4G5QA 3GLHE 3ZZUA 2IYSA 1CLUA 1PUIA 1G8YA 4QJ4A 2ZJYA 2RGBA 1WQ1R 3N5CA 4QHTA 2BM0A 1GDDA 4TLDA 3S1AB 1E2HA 3QEOA 5FPYA 3HYRA 1CR2A 1CJUC 2ZPTX 1A5TA 4CRWB 4KI0A 2TMKA 4QL3A 1TUIA 1P72A 4F7WA 1G4AE 2JLQA 3RRMA 4BLQA 3AEZA 1MO3A 2XOKD 1UPTA 1XEWX 1JALA 1YR7A 2IC5A 4V02A 4Q4AB 2FSIA 3BAFA 4XSGA 3PXGA 2J0VA 5HPYB 4ABYA 1Z8FA 3QI2A 4FCWA 4KXFB 4JLMA 4HLDA 3V4FA 5JRJA 4LZZA 4PZYA 1ZU5A 2CCJA 1G7RA 1H8EA 1Z08A 4JVSB 2GXUA 4KLNA 1RVDA 1S3SA 4GZMA 5GJCA 5JSZA 4DB2A 1G21E 2GETA 4YMUA 1OYYA 4KSBA 3S1AA 4EJSC 2YOHA 5HZKA 1LNZA 3ZVMA 2DFTA 1E0KA 2DCUA 5E3HA 4NDZA 5FL7D 4F91B 5J4KA 2X2FA 2C77A 3CPHA 4GFDA 1VG8A 4BE7B 3EZ6A 5EZ6B 1O3YA 1E99A 1DG3A 1XF9A 3LX5A 4M1YA 2C5LA 4XD7A 4PTLA 3RDPA 2BIFA 2C9YA 2VF7A 4FWIB 3IO3A 3QKSB 4ACAA 4UNPA 4B33A 2X1VA 3W6OA 3B13B 4OYHA 4DLRA 5JMTA 4TTQA 5J4VA 4I1SA 3TNFA 4M9SA 2IUSA 2CL0X 4X8LA 3IGFA 2QA5A 1NN1A 4TWZA 3B1XA 3PEYA 2FNAA 2NO0A 2A78A 3QXJA 2O0JA 3VX4A 4I4LA 4OI2A 2FZ4A 4PAQA 2RGDA 5KYKA 3KFVA 3ND8A 5K8IA 3PFIA 1P5ZB 4BASA 1N25A 2ZIAA 5AR1A 2JIZA 1AS0A 4ZCLA 4LUCA 5HCIA 3O8RA 4E03A 2Z0MA 2ZRBA 4A92A 4LCBA 4S2EA 3RNLA 3MJHA 3OEEA 4HDOB 2XSZD 2JATA 4IW3B 2C9OA 4MGYR 1WA5A 4TTPA 1B23P 3QJYA 1L4UA 3W8RA 2F9LA 3LDAA 4EKDA 5JJLA 2BHRA 5BYJA 1E94E 1VIYA 1JPJA 3KJHA 4LHVA 4IFBA 4FD2A 1GNPA 2XTNA 2OG2A 2RMKA 1N0WA 3NEJA 3CKLA 3GJ4A 4TQAA 1TADA 3R9IA 3K0AA 3A58B 5DISB 2CJWA 4N0DA 1E2IA 5FBVB 2E1RA 3C14C 3PCRB 4YMTA 4IJMA 4X8OA 2HJVA 2PT5A 3BERA 3CO5A 1E2FA 2GEUA 4M1WA 4Q7KA 4OK3A 2IS1A 1RJ9A 1YZLA 5TMPA 5DYGA 1NN0A 4W5HA 1G8HA 3CF2A 1XEXA 1X1RA 3BD9A 1NG9A 4A0HA 1O87A 4AYWA 4BWYA 4LJ9A 4WXPA 1CRPA 3GEHA 3WBKA 4MYHA 4P4TA 1RRFA 4HLUA 4TL7A 3IBGA 4LYAA 1QZXA 4CT4B 1XZPA 3X2SA 2IHYA 1DO2A 3UG7A 4G5RA 3QXXA 2H18A 3G0HA 3WP1B 4JBYA 3FWYA 1LV7A 2XNDD 1P60A 3MD0A 2J7PD 4RFSB 4HLQB 4DT1A 1NJFA 2NZJA 5FPHA 3QVVA 2VP9A 1S4QA 3BJIC 3UWOA 1NMZA 3GFPA 5LPNA 1CR0A 2AFIE 1P2SA 3DM5A 1EFHA 4HAZA 3U6KA 5DHAA 5JWHA 4U7DA 4BFVA 5AJYA 5JJIA 5FUXA 3K1JA 1F3OA 3B5JA 4Q18A 3EZ9A 2JLUA 2ASEA 4V0ME 3RHFA 1ZD9A 1JEDA 1PVOA 3DMNA 4I1VA 4P33A 1W46A 3RYTC 1T3LA 3TE6A 3ZIAD 4XVQA 2WJVA 5JFGA 2OM2A 1F5NA 3CZQA 2JJ1D 1GRRA 4D4MA 1UAAA 5GJWC 1AS3A 1KI9A 3RWMB 4HB3A 3ZLJA 1VCOA 2AX4A 1NLYA 1G18A 2JLRA 2ZUCA 2Q9BA 4DUGA 2PH1A 3W5IA 4ZI2A 1OIWA 2ZI3A 2QPOA 3JZMA 3BFXA 4MQBA 1KY2A 1KY3A 1CEEA 1KJZA 1ZNXA 1VDZA 4JJKA 1T5LA 4M1TA 4P3YA 4DDUA 5EE5B 5L3SB 4CIDA 3UMRA 2GDJA 3AVVA 1N5KA 4QHYA 1OJLA 4WBSA 3LW7A 4B44A 1UBEA 1F48A 1G7SA 1D2NA 3W90A 5IHPA 4P0TA 1YZNA 2O8FA 1DOAA 4BZXA 4PHTA 4IXNA 1XPUA 3LNCA 3RAPR 3JVVA 4G01B 2VRWA 2H92A 2GJKA 4LSGA 5KDLA 1Q3TA 2PX0A 5CB6A 2RGNA 2EFDB 2YINC 2IYQA 4R9UC 1N6OA 3CX6A 4HB0A 1Q21A 1NVWQ 2ANBA 4PR0A 2BBOA 2CL7X 4KFUA 4RKEA 1KO5A 3WMFA 4B3CA 1ZM4A 4MGKR 2WOJA 3ICQB 4I1UA 4GL2A 2QAJA 1KK0A 2QSZA 4D81A 2ZRIA 1OXUA 1RRGA 4HAYA 4D0NA 1R5OA 2OXCA 1DPFA 2REOA 5HCNA 2IXFA 4HZUB 2FJUA 3TSZA 4PHFA 2NO7A 1MOZA 1OXTA 5G3YA 3QPUA 2KE5A 4OHXA 1RYFA 4JL6A 1NVVQ 4KSCA 5AJXA 2CHQA 2QY9A 3KQNA 4IDNA 1Q0UA 1FZQA 1XTSA 1FX0B 2HV8A 4NCKA 3UG6A 1QG2A 4ERNA 4MYTA 4EPXA 1DAIA 4A8JC 1VTKA 4DEXA 3D8BA 4C7OA 1GUAA 1SVMA 2DHRA 2IL1A 3AF0A 3N2IA 3QG1A 2YWEA 2O8CB 4EQ6A 2IK8A 2AD5A 3QXSA 4KFRA 4LPKA 3HPQA 2C03A 5JRZA 4EPRA 3M1IA 3VKGA 3P20A 1L7VC 1OB2A 1Z6TA 2F1IA 4M8NE 2NMVA 4ZIRA 2WZQA 4R71A 1GAJA 3KQLA 5KDDA 4OBEA 3TUZC 3KX2A 2QSYA 3BH7A 4A82A 4PPQA 3UK6A 5K8TA 5LB4A 4RZUA 1G6HA 2G6BA 5FOSA 3SDZA 3QKTA 4ZCMA 3T1VA 2FV8A 1WXQA 5CK5A 5C2JB 2BM1A 1NSTA 2XNSA 5BYKA 2XZLA 1P4SA 2OBNA 3AF3A 5EP1A 1T8UA 2ZSFA 2F7SA 3OFND 1SVWA 3OEED 4C0KA 4DLYA 5LB2A 4RD0A 1AQUA 1T9HA 1W48A 5JZVA 3CRMA 5KU1A 2QM7A 3AGPA 3WNCA 1SGWA 4ESVA 2F43B 2NPFA 1EK0A 4PO9A 1NVVR 4QGAA 4KAXA 4DLXA 5LDDC 2GESA 5EE9A 1DAEA 1VCNA 1E9RA 3VHXA 5SZKB 2H57A 4AKIA 1JB1A 3IEVA 3GLIB 1ZJ6A 4OK6A 3IILA 2J5XA 4Q1BA 4TZ6A 2WPDA 1XD8A 4O2RA 1KDTA 1M8PA 2FFAA 2OCYC 2OBMA 1DEKA 2CE7A 2PEYA 1EESA 3GP8A 4B47A 3CWQA 3B1VA 3GLHB 4KV9A 3ADDA 1CJVC 1AA9A 3GJ5A 4EFMA 4D25A 3EW9A 1DAHA 2ATXA 2CEAA 1K5GA 3ETLA 4W5JA 1BYIA 4Z8XA 5EP2A 3EARA 4RFSA 2BV3A 2ZUBA 4A2WA 1FP7A 1G6OA 3KFXA 1Z28A 2CLDX 4RD4A 5DN6A 1XX6A 1CKEA 3MWYW 1PUJA 3EPKA 4KODA 3F0TA 2GEDA 4I1OA 5SZIA 4ZDKA 4A8JA 1EWRA 2AFHE 5FI1B 1RFLA 3T1OA 1CJMA 1NVXQ 3CIOA 2R62A 3LBIA 4RD2A 2RGAA 1HYQA 1NVUQ 3TK1A 5JECA 1LS6A 1T6NA 2P0EA 3EX7C 1KDOA 1XEXB 3LY5A 1HQYE 3BE4A 5JS7A 2CXXA 1CS4C 4BFYA 2QM8A 1RRCA 5K8LA 5F9HA 4IDQA 2ZXUA 2FMXA 2Q3FA 2Z83A 1MKYA 4OQNA 1AN0A 2BJVA 4M9XA 1G9XA 2FN4A 3B6EA 1R0YA 1DADA 1XTKA 3BBPA 2FEMA 2QPTA 4BQSA 3BGWA 3AVYA 4IOJA 1PZNA 3L0OA 3ZIAA 4EJSB 1ZVQA 1XD2B 3WNBA 4EPYA 4RZXA 5FBRB 4HZUA 3B60A 2JLVA 5G53C 1W0JD 2VP5A 4S35A 5FBWB 1NNEA 1A7JA 4XTCS 4LJAA 3D31A 3KQHA 2ORWA 4LV8B 4UNSA 3Q8XB 4AD8A 1P7CA 1VIAA 1JQJC 2CCGA 2VH5R 2NPIA 2HYIC 4DDWA 2X19A 1VCMA 3DKPA 2CHVA 3VHLB 3H4MA 1JNYA 2BVNA 2W6JA 4W9MC 1DO0A 4BPBA 2IW3A 2BMEA 2PZGA 1TQ4A 4NYIR 3IDQA 4TN1A 1E2NA 4D80A 3KKMA 1QBKC 3T1QA 1GG2A 4Q1AA 4JKIA 4U02A 4A0RA 2ZYTX 2IEYA 1YR6A 2AXPA 3OE7A 1CR1A 3BS4A 2WAYA 3E70C 4E07A 3M4YA 621PA 1COWA 1MRNA 3A37A 3LD9A 1II8B 3A4MA 2D74A 1KJYA 4JYCA 3AVOA 1D8TA 3T34A 1Q3HA 1TU3A 2A9KA 5F98A 4DCTA 4UXJA 4GZLA 2XAUA 2WMNB 1S3GA 1TEVA 4IFEA 3HYTA 5FOUA 3PEUA 2GAAA 4FW9A 3QPWA 4M22A 3O8CA 1JR3E 1CR4A 1SKYE 2BWJA 4US0R 4NL4H 1I4LD 1QHXA 1ZMXA 4Q03A 4TT3A 3O8BA 3HU2A 3TBKA 3L2OB 1G7CA 4Q01A 1ESNA 1YU9A 2D2EA 2YC4C 4V0OA 4QM7A 1IJFA 1R7RA 2VPPA 1I2MA 4YXWD 4EFLA 4DSUA 1XTRA 2AKAB 2ZJ8A 3R9WA 2W0MA 4M9QA 4CEHB 4CEJB 4JBWA 1N0UA 2QAGB 3ZQ6A 1U90A 1IN5A 2Q0HA 4D2IA 5TDHA 1FPMA 5FOWA 4DC9A 1KYIA 4P32A 1OKKA 1OFIA 1ZINA 1K6MA 2ZE7A 4ASUA 4A36A 2BKUA 4RY2A 3LLUA 5JBQA 1QHHB 4TL6A 1HT2E 3WRYC 2F6RA 3C5HA 1KK2A 2EFHB 3IEUA 4Q9LA 2O52A 1GITA 1XZQA 3IKJA 2V7QD 1G41A 2BBSA 2HF9A 2EW1A 2K5UA 3PJRA 1NBMD 2W6IA 3AB3A 3WMGA 3Q3JB 5FBQB 2IT1A 1F60A 1W0JA 4UXIA 4P4SA 3X1YA 3CZPA 2OESA 1ZD1A 3JZAA 4IOMA 2G9NA 2QUZA 4F4CA 1SHZA 4IOLA 4HAUA 4MKFA 3KL4A 2QMOA 1JAHA 4ZDIA 5DLQC 4TSFD 3R7WB 5EJEA 3AKDA 2WWGA 3QQ5A 3QIAA 3V4RA 1X8LA 2OO7A 1N6LA 2GHIA 3Q9LA 2VBCA 3CBQA 1VHLA 2C04A 1W2GA 3GLIA 3IIKA 2V54A 2WWIA 1E69A 3RVBA 3C8UA 1Q57A 1COWD 4V0NA 2V6JA 4DRZA 4RFVA 1BIFA 1XRJA 3THWB 3QF7A 4WZBE 3RC3A 4A15A 1KKMA 1RZ3A 1J8YF 1F2TB 1MH1A 1NIJA 1W5TA 3RS5A 3T1TA 2WPDD 2O8DA 2Z6VA 2QQ0A 4C0AC 1SXJD 2GXQA 1OLOA 2IHBA 2UKDA 1ZRHA 2ZRHA 1ELOA 3ICEA 3QBVA 2DB3A 1RYHA 4NYJR 4ITRC 4WXRA 4LJYA 2ZI9A 4PHHA 4A2PA 4DCNA 3KKQA 4JVLA 1UBCA 3ZYCA 3L0PA 3I5XA 3CRQA 1PLLA 1RJ9B 1XMVA 2CK3D 4YC7A 1DE0A 2KJQA 2QGZA 4XWAA 3A36A 3FGNA 3DZDA 4NMMA 3NTUA 3MJRA 1E1RD 2LKCA 1DBSA 1AM4D 2V4ZA 2YZ2A 3OAAD 4ASUD 5KSYA 1E0AA 2ZSAA 1KGDA 1NL3A 1YZTA 4Q66C 4DLZA 3RC8A 2QAGC 2Z5FA 1ZC4A 3K70C 4QBIA 1FQJA 4JLBA 2PX3A 5EE1A 4QGFA 4C3ZA 2ZJZA 1E79A 4TMXA 2FWRA 2DFKB 2GZAA 1U8ZA 2O8DB 2CNWA 1TNDA 1KZ7B 4MITA 3TVTA 2D06A 1X86B 2A3RA 3A1SA 1NBMA 2C98A 3B1YA 3N70A 5AK0A 1Z29A 2E87A 1J90A 1JR3D 3A1TA 3WYAA 3HU3A 4PQRA 3L43A 4PC6A 3LW8A 4LJ4A 4A2QA 1EFRA 2WTUA 2XXAB 4QFMA 2JAQA 1T0JB 1Z47A 1TQ2A 2FDCA 1IHUA 1X8KA 3WYFA 3DVLA 2I1VB 5AJZA 4FN5A 1MO5A 2QL6A 4FIDA 1GKIA 4BLTA 5J4LA 1YRBA 2JJ8A 4B76A 2VP2A 3WMEA 5JJKA 1MABB 4IXMA 2GAOA 4Z1MD 3FPAA 3RSOA 1E6CA 4FCVA 4UXHA 3CB4A 2C2HA 2RGCA 4URUR 1A2KC 3BB4A 3FKQA 4TQ9A 2QRNA 1XEWY 3FDIA 4ZCIA 2QAGA 3W3AA 3P4XA 3BC1A 4HAWA 4JSTA 4AWXA 1OHHD 4QRHA 4F4IA 2Z4RA 2ZQ5A 3PR1A 4NZYA 1E1QA 1U8YA 3W6NA 2GJ8A 4DEYA 3BH0A 1I2DA 1KMHB 3QKSA 5DSZA 2MSDB 5TB5A 4QGGA 4DKXA 1SXJA 3KUDA 3OE7D 2ZJ2A 1S96A 4LYHA 2EVWX 3L8YA 3NEYA 5EP4A 2PZFA 1TUEA 2PZEA 3I8SA 4QNRA 4Q9KA 4QHSA 5GJVC 1P73A 1U81A 2J1LA 1CULC 3QOFA 1ZAKA 3KQUA 2X8AA 5KSOA 1UEJA 2PCLA 2NO9A 1X1SA 2OFOA 3RABA 1XNJA 4MH0R 4GNKA 1ZUNB 1BMFA 3TH5A 2FE4A 3T5DA 4NPHA 2R2AA 5JCPA 4QGHA 1E9SA 2HCJB 4BFXA 2FOLA 2XX3A 1CU1A 1OXSC 1KK3A 1IBRA 1TL7C 1EXMA 2P5TB 4HB2A 2GJAA 1P9RA 4KFSA 4B3DA 1XPOA 3QG5A 2OV2A 5DHFA 2WKPA 1GKUB 1P9NA 1ZCAA 2G3YA 4IRUB 1D2EA 1AK2A 1ZNWA 4NBSA 1YZKA 4BLOA 2DFLA 5L3VA 4O2LA 1D2MA 2WKRA 1SXJC 4OL0A 4YMVA 4AI6A 3SYKA 1KO8A 4BRWA 1UKEA 4M53A 3W9YA 1IM2A 1JECA 1QF9A 1A2BA 1JR3A 2IXEA 4HLUC 1BYUA 4LPSA 2J45A 3TW4A 4XWKA 4D26A 4LYFA 2ZVQX 1KZGB 2DBYA 3I5YA 3K0AB 4LJ7A 2GILA 4Y0VA 1IOZA 3TLXA 3X1WA 1IN7A 2ZRGA 4B3XA 2PMKA 3K0EA 4L16A 4NCJA 1Z0KA 2O8BA 3SFVA 2JJ1A 4JVNA 1G3RA 3OF5A 3IQWA 1UDWA 4HAVA 5J40A 3SQWA 1UKZA 1IY2A 1HQCA 1CJTC 4LX0A 1TF7A 3E2IA 4CYMA 2YC2C 1R6BX 5FL3A 4B6EA 3OESA 2YVUA 1G5RA 5FL7A 1E9BA 2AK2A 5DH9A 2ZE8A 4I99A 1AZSC 4A0GA 1OF1A 1SKQA 2BEKA 4JL8A 4DVGA 1EG7A 3SS8A 1XXHB 5AJWA 5JCZA 2JLXA 1VECA 3BB1A 4ZO4A 1T8TA 3QKRA 3L0IB 4GMDA 1N5JA 2CVHA 4LBVA 1L2TA 721PA 2GXAA 3E1SA 5FPSA 1XDBA 5J4YA 1J8MF 3SBEA 2ZAMA 5DI9A 4L9SA 1OE0A 1MO4A 2ZITA 4Q1EA 4PQYA 4XVRA 5KTYA 4BFZA 1Q12A 1FMJA 4DLTA 5FOXA 1FUKA 2BKEA 3VU9A 1S1MA 2GTPA 2QT0A 2GBLA 3DDCA 2ODNA 2JDID 4N3NA 2IYZA 2ONKA 4OQFA 4Q4LA 4AC9A 1C1YA 3IO5A 5C4GB 2ZYWX 3AVUA 3PUZA 4M4SA 3THWA 3EIHA 3SEAA 2J59A 4HZIA 4M0LA 3SYLA 2GRJA 1FP6A 2W2XA 1GL9B 2GZHA 4PAMA 3CNOA 2V8OA 2ZJAA 2B7BA 3I32A 1NLFA 1N6RA 1YZUA 3OIVA 4AYXA 3CUEF 1G64A 2B8WA 5DIFA 2JCSA 3JVUA 5DYIA 2V1UA 2I3BA 5CYPA 3CX8A 1XB2A 1SKYB 3K9NA 4URVR 1XCMA 2OSBA 1Z6XA 2OE2A 1VG1A 2QE7D 4EIWA 1ESMA 4BFSA 1NN3A 4JT2A 1FNMA 2B7CA 5C4MA 3CR7A 1Q1ZA 1TMKA 5HE9A 1MABA 4JJZA 2FFBA 3BORA 3CPEA 4FI3C 1HH4A 1OH7A 3B9PA 3C4JA 2JASA 3SE0A 1W4AA 5JI3E 2N1BA 1Z63A 2OFWA 1D9ZA 3GJ6A 2XSZA 3BRWD 3DEFA 4FWTA 3QENA 2FA9A 1BH2A 3K9HA 2Q21A 4XOIA 4TZ0A 2P6NA 2VTKA 4MKHA 3ADBA 1MT0A 3EPHA 1NIPA 5L8VA 1SVSA 1KTVA 1FTNA 3WYGA 3B1WA 4C4PA 5LD2C 2A5YB 3BXZA 2JA1A 4A9AA 1F2UA 5DI3B 2WJHA 5E7IA 2LCFA 2VHUA 3Q5DA 2QROA 2GXSA 4IOKA 4C2TA 3B85A 4ILEA 1R8SA 3T12A 2C8VA 2XITA 3OIYA 5H1YA 2ZJOA 4A6XA 4G5OA 4OI4A 4LK2A 3E5HA 1Q1EA 4LI0A 1SXJB 2RAPA 4C0BA 2G1JA 4LV6A 2OXRA 1T5IA 2GK6A 4ACBA 3TR0A 4V0MA 4Q48A 1IN8A 2UZ3A 3KB1A 2FH5B 3CPJB 5FTNA 3VFDA 5B30A 4HLCA 1FQKA 4G3XA 4LC0A 4CEIB 1G16A 3UMSA 3AF4A 3W8NA 1XTQA 1OXXK 3WHKA 2OBLA 2ZYVX 2AWOA 1ZCBA 1II8A 1OIVA 2HYDA 2J3EA 3HP1A 4TT3D 5G41A 4BFUA 3AVPA 1P62B 2RB4A 1E9CA 1J2JA 5M04A 5KOYA 3RRYA 1ZM9A 3AP2A 1EX7A 3ZS9A 5EUMA 3ZJYA 2VEDA 2A30A 1M6NA 1OFHA 1SXJE 3KTAB 5F9FA 2PBRA 1E0SA 1H65A 4OK5A 4YDHB 4IVPA 4URZR 3TIFA 4CEIA 2WKQA 2O0HA 5LD2B 4TL9A 1ZNZA 1HE1C 3SZRA 3I73A 4BLPA 2VO1A 1G3QA 2ODEA 2NQ2C 3EIQA 4PSVA 4X8MA 3P26A 1N6KA 3UANA 2AN9A 3C16C 3U7HB 1R5BA 5B58C 3U44B 1NF3A 2ZUDA 1MR3F 2QN6A 3R20A 4DLSA 4Z8YA 5KNBA 4DB4A 1S2MA 2MMGA 2P67A 2QENA 4HSEA 1XJQA 5L3QB 4GPTA 3VQTA 2WHXA 2A5GA 2JLYA 1TAGA 3KTAA 3CLVA 3PG5A 4F93B 2QBYB 1DTSA 4XIGS 4RKFA 4C0LA 4A6PA 1NKSA 3K0FA 5H70A 5ANRB 4ZDJA 2JGNA 1P2VA 2L0XA 2QZ4A 1NBME 1G5PA 3WHLA 3NIBA 4B75A 1MO6A 1KI6A 1UFQA 5DO9A 3DL0A 4FMCF 1SVLA 3U6BA 5BN5A 3THYA 2XTZA 1G3IA 1R4AA 1GIAA 1IAQA 2V55B 5JEEA 5F3WB 4HATA 4PFSA 1M7BA 1TTTA 4LBWA 2FSFA 3EPLA 3LXRA 4Z51A 1OW3B 2ZI7A 1GTVA 4C0HA 4QM6A 2IF0A 1N5IA 2SHKA 2VL7A 3C15C 3R9XA 3GLFB 2YKGA 2IF2A 2ERYA 2MMCA 4NKRA 3REGA 5FUWA 3U4QA 1DELA 4KJZA 1D6JA 4PANA 3VR1A 2QPAA 2OFXA 4OHZA 3OZXA 4HDCA 2R9VA 4LC1A 5JHGB 2CMKA 3K70B 3U60B 5EUQB 1G8PA 4MRPA 3O8DA 3PUWA 3NXSA 1XTIA 3TRFA 4JVMA 3TW8B 3DPUA 4ARZB 2OT3B 4DSNA 3EC1A 2NOAA 4V0LA 2J7PA 1G291 3ZS8A 4KYUA 1AS2A 4QBGB 2HXYA 3RANA 1WE2A 4JYBA 5D3MA 2VP0A 3GQBA 1NJGA 2RKOA 4DIDA 4CGZA 3VU9B 1E32A 2QU8A 1Q20A 3GLGE 1JR6A 3I72A 1PJRA 4M1SA 3PUXA 1EFRD 1FL9A 2XOKA 3I4LA 4UNNA 3NBZC 4MKGA 4DLUA 4UJ3A 2FFQA 4U00A 4IHQA 3GJ7A 1P75A 3FMIA 3KB2A 3AV0B 4EJSA 4NCIA 3THXB 2EQBA 3FOZA 5C1BA 2OCAA 3G82C 4CW7A 3IPXA 3BH6A 3EC2A 3TJZA 1XTJA 4KBGA 3KXIA 2XJ9A 2WV9A 3VKWA 1XD2A 1SHKA 2QORA 2XXAA 3A4LA 1NKTA 4RVCA 4NCNA 1DARA 4HB4A 1AZTA 2H8KA 3P32A 4GOKA 5FBLB 2JLWA 3AM1A 4C7OB 3NDBB 1GWNA 1S8FA 2GF0A 4U5XA 3X1ZA 3SYNA 1I4DD 3MAAC 3T5GA 2D2FA 4KITB 4WW0A 1A1VA 4FXPA 3REFA 4FMBB 2CHGA 1KHTA 5GVSA 1E2LA 2CLSA 3ASZA 5CYOA 1XBTA 1ZUIA 1R0WA 3WNDA 4CT5A 1W4BA 2ZSBA 3NDPA 4P31A 4EQ6B 2ZI6A 4KYIB 1P2UA 3OIWA 4ESHA 5L3RA 2XB4A 1KSHA 4D0GA 1OXVA 1T0HB 4OKSA 2ZU0C 4Q21A 2GJ9A 2XTMA 2H17A 4OI0A 2YHSA 2QTFA 5B57C 2BMDA 3I61A 1KI3A 2CCKA 2FEOA 4JLAA 4Q9JA 4PSKA 1KO4A 4TMWA 4TLCA 4M9ZA 3ZDQA 3D3QA 3VR5A 3UPUA 1VYTA 3W5JA 4H1VA 3SU8A 1EFCA 2ZRKA 4JLKA 3VR3A 4BFWA 1U94A 4EPTA 1OFUX 4L5BA 1KJWA 1LVGA 3A1UA 4BZPA 4EUNA 5KNDA 1M1YE 2B21A 1E4YA 1V5WA 2VHJA 3MWKA 3QVUA 2IYLD 4YMSA 3RS3A 1WBDA 4O3MA 2O8EB 1LTQA 1VYUA 2KI5A 1AGPA 4B2LA 3Q5EA 1NSFA 3I92A 1OIXA 2EYQA 1CJKC 2OAP1 1HEIA 3KZ1E 1AJEA 3P4YA 4TMVA 4JKYA 4BGDA 1E79D 1N6IA 2VIIA 4DBLC 1KKLA 1R5NA 4BZQA 1OFTA 1YJ5A 5FTKA 2ZVPX 3AKYA 2WWWA 1YR9A 1LF0A 2DWPA 1R10A 2W83A 4EPVA 1US8A 1MV5A 1G8FA 2AD1A 2GBLC 2GK7A 3MG9A 2EYUA 3NH6A 5CIQA 5DE3A 2AXNA 1DAMA 4Q19A 2YWFA 4P4SB 5HKKA 1QHIA 3AH8A 4A4DA 2ZAOA 4M1OA 4ZIRB 4JMPA 3SJCA 4LHXA 5CIWA 1KAOA 5KO2A 3QEJA 1LY1A 4DDTA 5CM9C 2FGKA 121PA 4AURA 4FMDB 4OJQA 2F3TA 3QBTA 3IHLA 5FOTA 4XWOA 3PQCA 3L82B 3AUXA 3PUYA 2H1LA 4PC7A 3LAWA 2PCJA 4Q4HA 3AVWA 1UJ2A 1KDRA 3DKVA 1U9IC 5TY0A 4MUAA 1E2MA 3Q7QA 4TMZA 3T15A 3RSLA 1KNQA 1KI4A 2VP6A 3ZVRA 1Q1QA 1XWIA 3CH5A 2J41A 3UKDA 1W4CA 4MRNA 2ODWA 5K8UA 1YVDA 4JZKA 3VAAA 1PLKA 5EXXA 3TSOA 3TUJC 1P61B 4OHVA 3AKEA 4G5GA 3KKNA 3QKRB 3PVSA 2BBTA 4ZKEA 5FPKA 2BDTA 2J0UB 2N42A 2KSQA 3NBXX 1NMYA 3KDSE 1Z6GA 4KLZA 1NLZA 4Q4JB 1XP8A 2AK3A 1E9DA 2IX3A 4G0NA 3PEWA 4POAA 3GJ0A 4GP6A 2ZYUX 1SVKA 5H68A 2ZI5A 4MRVA 1BMFD 5E7MA 2YYZA 3U7GA 3MRSA 1KIMA 3SJAA 3QPVA 3P1JA 4WZAE 1OH6A 3LLMA 1EX6A 5KPJA 3LQRA 1E3MA 1ZYUA 3K0CA 2NO6A 1UDXA 5D3MB 2WSSA 4R7ZA 3KXLA 3MGCA 3PITA 5DGXA 3RRZA 4F4JA 4PPFA 1WP9A 1WBBA 2MSEB 4B2PA 2IS6A 1YHNA 5BWMA 4YMWA 2OZEA 1Z06A 1N3BA 4URWR 1WMSA 3AGQA 5CJ2A 5H8WA 2EWWA 1QHGA 4CDGA 3FFBA 3FFAA 1W1WA 5CDFE 1KO7A 3TKLA 2IS2A 4I81A 3BIFA 3GEIA 4EPWA 4YONB 2V6IA 4JBXA 1U0HC 2P6RA 2IYYA 4DUGD 3MMPA 1DS6A 3CW2A 4N1AA 2C99A 2PEZA 1YRAA 3EZ2A 4ZPXA 1M2OB 1LS1A 3GFTA 2VA8A 4RJLA 3K09C 1NRJB 4AKHA 1HE8B 3IPYA 4FINA 4LWZA 1GNQA 1TEXA 3THXA 2PL3A 1OH5A 3DMDA 1OT3A 3A4NA 3UATA 1FMLA 1HY3A 3TQCA 1X6VA 4R2HA 1VG9B 2ZRNA 4UNQA 2RHMA 2R6CA 3UIEA 3ADKA 1QHYA 2YOFA 3HR8A 4QC2A 3B7GA 1GSIA 5IF9A 3EIEA
chains in the Genus database with same CATH superfamily
1KFKB 3K9WA 2YWGA 1V5EA 1YWGO 2MT9A 4H6WA 3ZE6A 5DCLA 3G02A 1P1JA 3NVAA 1XFAA 1B6TA 2WWHA 3B8EA 1EUQA 3R3JA 3DM9B 3DV9A 4LJ8A 1UC5B 3FVWA 1X42A 1A8QA 5BWCA 5IYZF 4DLNA 1P7PA 1V71A 5ARBA 3DDUA 2YJ4A 3HJHA 3IQGX 5DNCA 3HR7A 1GU0A 2QTVB 3PYMA 4RORA 3W79A 1IULA 2CDNA 2X3YA 3SR3A 1IB6A 4QUKA 3X1JA 4NEGA 3TLJA 2KB0A 5ALPA 3ZDXB 5IJ0B 2AKYA 2F8MA 4FIZA 4HQNA 4TYNA 2JB9A 3V1KA 4B71A 4E4TA 2JVIA 4TYYA 3U7FB 2OHGA 1JSXA 1RJFA 3LHKA 4CMIA 3D8SA 3PRJA 2G83A 1UPBA 1AHNA 4YRTA 2YV5A 4LJ5A 1T2DA 2QTMA 5EZSA 3TBFA 3WGHA 3BVPA 4PQFA 1KMHA 3NAZA 1ODLA 5TARA 3H16A 1GXSB 4P7BA 5HM6A 2R7LA 4RS3A 4J91A 3A1WA 1IIBA 2ZE6A 3KWJA 4MTLA 2WWVD 1KSFX 3I8XA 4NDNE 5DULA 2WSMA 2G06A 4L4ZA 5HIAA 2HK7A 1XC7A 2Y2VA 5CJPA 5AICA 4AJ1A 1BHO1 4OSEA 2B5VA 4EB8A 1AA6A 2QRKA 2QRVB 3DNPA 1SM4A 1FYWA 1YA4A 1W49A 3EGCA 3ANMA 4RTLA 3M7IA 1VYVA 3W1VA 4ZRNA 3NX4A 1GGVA 1JDBC 5SICE 4EA8A 4GM0A 1ZSVA 2AV6A 3L7OA 4F9TA 4RGBA 4I5DA 2QYHA 2W8BA 1QONA 1QZUA 3ZGOA 1RQPA 2WB4A 4L74A 4L50A 2IFTA 5D5HA 3U44A 3EIWA 3T5AA 4UTOA 4DDVA 1OLUB 1U5BB 2ODBA 2R65A 1ZOLA 2X76A 4I3GA 4NZMA 3WMXA 3NHBA 5B7GA 1ZM2A 4QSMA 1UKVY 4NRDA 3U17A 3WS7A 1WF3A 1PR2A 3C3EA 5AKJA 4BJHB 1OA0A 1YONA 4ZVMA 2YWXA 1WCV1 3JQ6A 5C52B 2JCGA 4H9GA 2AYXA 1QMGA 2Q9AA 1P7WA 2DUUA 2F9FA 4FUTA 4G4GA 4GI3A 5TT0A 2IWHA 2G40A 3T7EA 3TGWA 3LZDA 1FVHA 1GO2A 4OO3A 2XYQA 1NJ8A 1A9YA 1VLJA 2O0KA 1SOAA 1HG0A 3W9BA 2D62A 1B42A 4BNGA 1H9CA 4EKNB 2HWWA 3QTBA 4Y1RB 4FGKA 1E98A 5I51A 2BJHA 4HDSB 3HDTA 1M34E 2ZSUA 1ZONA 5EI5A 4URYR 2QG6A 3ZUGA 1TI7A 4PYIA 1ZMBA 4RVHA 2BCGY 2A3NA 4MA0A 5B64A 2SBTA 3HKBB 3KXKA 1HDXA 3DFMA 1PGPA 1OSNA 2H5JA 3ZHVA 2ONZA 1XQYA 4IIGA 1E1MA 4QUDA 1QOPB 4K28A 4Q82A 3OD5A 4XQ9A 1XMJA 3G0OA 3LKBA 3U3XA 4EL5A 3W1EA 4AQDA 1PJ4A 1EIWA 4JD5A 1M6EX 4XIJA 4ARZA 4O0MA 3A2NA 4CM1A 1YBVA 1RYBA 1J2RA 2OCIA 5HTKA 2AOXA 3B6MA 3R3HA 3PJFA 3JZFA 2O19A 1CYDA 3O47A 5K0TA 5JDCA 4HX2A 4M9CA 2VQDA 1ETUA 3LWNA 4RJIA 3T3EA 1R0XA 1N3YA 3B82A 3SYMA 2OCGA 5J4KA 4DR1B 3IVCA 4QOFA 3RGGA 4BATA 3OZ7A 4U3JA 1RD4A 2QGFA 1JDTA 5BSRA 2XNHA 3A7DA 3ENQA 1YFLA 4OHOA 3OCXA 4EG5A 3SQNA 1OI3A 4RMJA 1FY2A 1ZCFA 2HW8A 5B53A 2VHWA 4IRMA 1QE3A 2ZI4A 4R83A 5ICEA 3HS3A 4WY8A 2W6JD 4CR7A 1AQYA 4Q4JA 4PZZA 2P8SA 5AIAA 2AG5A 2PLRA 4RA9B 2ZRLA 1COZA 2PGXA 4G2NA 5LOVA 1FUUA 2OXEA 3E3MA 1BFUA 1Z3IX 3HUEA 1S9HA 3HXPA 5B3AA 3RTAA 2ISSD 3D9QX 5F3DA 3RRJA 4CM4A 3U4HA 4ENRA 3DVAB 3FHCB 1UJCA 3NWJA 5AP9A 3E1GA 1BDMA 1XA3A 2YUTA 2FPXA 3BTVA 2DR3A 3F7OA 5TRTA 4R5MA 1W87A 1WMDA 5KNBD 2O5CA 2I2XB 4DJTA 3MOIA 2PTHA 4E1AA 5LQNA 3KJIA 1TJPB 2H2DA 3IP3A 4KWHA 1KP2A 3GY0A 1UC8A 4Q00A 4V38A 5A4DA 4HSGA 1ICIA 2E6UX 4FMDF 3TL3A 4EAQA 5AESA 4IIJA 3O94A 4OFZA 4IVQA 821PA 4MHOA 1ZVMA 1JMYA 3HU1A 5FLXA 1XXLA 2HQ1A 4PX5A 4I19A 4XPZA 4DQXA 4L1KA 1GQ2A 2HIMA 3EUFA 1Z4OA 2Z6QA 4FYHA 3MLEA 2WIBA 4IX1A 1YRLA 3IAM1 3CRW1 1XZIA 4IFTA 5KPDA 1M2VA 1SQFA 3VR6A 4NYMR 5BN4A 3V1UA 4QBHA 1XZEA 3MB5A 2DHDA 5IEJA 4ANFA 3Q1LA 5EJ2A 1Q0SA 3C7AA 2QN2A 2FQYA 3JZDA 4KHZA 4P53A 4WKCA 2HB6A 2FHSA 4LGMA 2GEVA 4QAJA 4AULA 4ES6A 4HNGA 4Q47A 3AP3A 2OEPA 1KAGA 5JS2A 1ABBA 5IKEA 3U2QA 2NU9B 3LXXA 3WGNA 3ORHA 4P3PA 4PC3A 4B5LA 4J2TA 3NV9A 1EX9A 4EHAA 4NJOA 2H4HA 2VP4A 1KO1A 1SQ5A 4RF5A 4DJEC 5C18A 4YUWA 1ZJJA 3NBYC 4WOPA 3TRIA 3AF1A 3FIJA 5DBFA 3VMFA 2Q3EA 4EY8A 4LMRA 4XUCA 4E5PA 1DFGA 2VHQA 3GIWA 4YACA 3MJ4A 1O8BA 2BI7A 3IAHA 4H7JA 4BBJA 1K9SA 1IJEA 2DWUA 3FTPA 2J46A 4LVCA 4NONA 2XBMA 1G7TA 1BE6A 1ZWKA 3SICE 1NBEA 4BMCA 2PH5A 4NZZA 4AP9A 5HUJA 3GWGA 3ILXA 2Q9CA 1NR1A 3K94A 4WOBA 4LFCB 1LDYA 4QBFA 3FNGA 4KTVE 5LQAA 1CDDA 1H2XA 1CUEA 1GZ3A 3CXRA 4OP2A 4C29A 4QYTA 2JIRA 4WVFA 5AM2A 4PXYA 3D0RA 1T4GA 1ICEA 4O5OA 1IPFA 4LA4A 1KEZA 4NF2A 2KWIA 1X7GA 5CT6A 3QXCA 2ZANA 5H16A 8AT1A 4NV0A 3V8RA 1N78A 2ONJA 4HWRA 1M75A 1Y5NA 1E2KA 1HV8A 1CUAA 1YS6A 2W4MA 1VKJA 3KXDA 2RKWA 3LT5A 3T35A 4FOLA 1IN1A 3T3MB 1PS0A 3QA9A 4G07A 3ZLVA 1Q77A 4KV7A 3OE4A 2REQA 2W58A 4BV2A 4RSGA 1MIOB 5MF6A 3AL0C 5AUOB 1IVNA 4K9QA 3T99A 5IZ4A 4XA8A 3FCXA 5I48A 4NLLA 5H4GA 4QXMA 5A6SA 4LYEA 4BE9A 2HLDA 4MCJA 5GJBA 2VKQA 1JV2B 2QN1A 1WABA 3DVQX 3K05A 2QF7A 4XGQA 2BMFA 5JANA 4DR4B 5EIFA 1OAAA 1RJEA 2C4VA 3SBOA 1WBDA 2C7BA 1AV7A 1H23A 4P81A 4BQRA 3M81A 4GXRA 1Y3AA 1L5YA 4KGXA 3H1EA 4OATA 4BJ1A 5JDIC 1K68A 5TQJA 1QIFA 1G0NA 2XDQB 4TLAA 5EZYB 4Y0AA 1KI2A 1IONA 1Z0IA 2HEGA 4M1KA 5JZOA 4HI0E 5ALQA 5K01A 4FX5A 2DFPA 1T8RA 2ZIGA 1URPA 1R6XA 3SP1A 3STYA 4B80A 1BO6A 1ULZA 1P4JA 3RADC 1LSJA 3FG9A 2AL7A 3R5SA 2A6PA 2WF5A 4DC1A 4DCVA 1E62A 1V8FA 1VRVA 2ETXA 1RQ7A 2ECKA 1QKJA 2H8GA 2H5EA 3O4JA 1LF5A 3O90A 2PX2A 3P9XA 2G77B 4IJ5A 2C96A 1E7MA 4MVJH 4GG1A 5BMVA 2RHDA 3QVMA 2HDNB 2J0SA 1O95D 4BVEA 1PG2A 3BILA 3GRVA 3ZE2B 2XNCA 3EAQA 3OOSA 5B1SA 3UHFA 5IKPA 1I1HA 3A1EA 2ZVDA 2QZZA 5DHQA 4O2AF 3UWKA 1TVMA 4D42A 5KX5B 2WWXA 4D8YA 4ZV4A 3VR5H 3PENA 2IYXA 4CF6A 1RBYA 2RIRA 3DEKA 5ALDA 1XNRB 1XJ0A 4KO8A 5FV7A 3B8HA 1V3UA 1VIVA 1ZBQA 4JJIA 4EGQA 4DCUA 5HW0A 3JQFA 2R1VA 4TRRA 2IV7A 3VJLA 3ZGYA 1PL6A 3O0DA 3ZDRA 3LU1A 2AI1A 1Z6AA 2IJGX 2OXFA 2XQJA 3EH2A 5FIUA 3GP5A 1VJ5A 3P27A 2HKIA 5E7JA 5JDIA 3DFUA 4ZP1A 2PUGA 4DZZA 4CMBA 2BGTA 3RB8A 2V3CC 5DGCA 5THKA 4D4GA 2LKDA 2IUTA 2C4UA 3PUHA 2AI3A 4R4JA 3H1FA 3RARA 3TW8A 5CITA 1KI6B 4PZDA 2E4VA 3O8QA 4EECA 5KTPA 4D0RA 4AG6A 2ZUFA 4YDRA 1JIQA 3RUHA 3F8WA 3KQTA 1Y7PA 1BU5A 1GKYA 1W1UA 3Q3EA 4MMZB 4RGQA 5G02A 1J49A 1YQDA 1YA8A 4DMGA 5T7BA 1OAOA 2P77A 1T91A 4QFDA 1W36C 2UVQA 4MW4A 3KZNA 2FHPA 2PNJA 5HJ7A 3ILVA 4PNZA 2BEUA 2FUG1 4MPPA 4XFDA 5C46F 2AHOA 4IH9A 4IUDS 5JQGA 2W93A 3K7EA 3C6QA 4Q3OA 1ZN2A 4EEXA 2J3LA 1NMSA 3CV3A 1X80B 3GJQA 3GOQA 3IV7A 3QE4A 4IEFB 1E7RA 3C41J 2NSLA 3UBMA 2OYCA 4JASB 3C87A 2FR0A 4RVOA 5DN9A 3UJNA 5KTKA 1D1SA 1QX4A 1H2HA 2ZAYA 1EXVA 3SYTA 3U7IA 4OIFA 3T3GA 1EE2A 2FMUA 3LUCA 3MJEA 2OQIA 3QFFA 1RXCA 4KK3A 4CTKA 3WP0A 4RULA 1M8JA 4IHAA 3HWWA 3I64A 3VNQA 1JBKA 2YASA 1YZVA 1DG1G 3IMKA 3N8KA 4QPJC 5IEBA 2W2QA 1SVIA 2CLHB 2HMWA 3CHYA 4F84A 2YIJA 2C9DA 4YRQA 1GYRA 4PPNA 1QB8A 3ML1A 1RAIA 4CKZA 3BHMA 4DC0A 4PX2A 2WM9B 3GZTB 2OV1A 1LBQA 2J87A 5BN3A 2EG5A 3BE6A 3VNSA 2GRUA 4GLFA 3HPRA 4LS3A 1YF3A 1NXQA 3E58A 3EFOA 2EL9A 3COVA 3KR2A 3R5HA 1QRAA 5GINE 5CVUA 2QP9X 1U0SY 3NEPX 1DIBA 2N1MA 1BDJA 4HXGA 1N2CB 3LUAA 3CSDA 1E6LA 1QV6A 3EY4A 4XRRA 4XQCA 1JA0A 5TQ0A 5EA2A 1U2RA 1TQ8A 2ILTA 1B8UA 3OPXA 5EHNA 1WXGA 2Q49A 2REBA 1QVVA 3BUSA 1RTTA 3AUYA 2GKSA 1FRFS 3CE9A 2Q0QA 3KNZA 4GP7A 5KTRA 2R87A 3CN7A 2K6GA 1J1ZA 4UBLA 2ATVA 1ZD8A 2BSQA 3WRXC 4INOA 2G08A 1FTWA 3IPLA 2FPMA 5LYJF 4I4NA 3AFNA 2R6FA 2ACVA 3HVRA 2GAJA 1XEFA 1M1NB 3I76A 2F17A 2HHAA 1MPTA 2R3SA 4I4TB 4ZODA 4CL0A 5A4JA 5LA6A 2WU8A 3H75A 3MWDB 1E2QA 8OHMA 1T8YA 4FQ8A 1QHSA 2YOGA 2XIJA 4G84A 4CVNA 2VFAA 4N41A 4R7TA 5TQ0B 4I08A 4D0SA 2DVMA 4RESA 1EIZA 3AEQB 1QAOA 5P21A 1QO0D 1ZIPA 2IYWA 2Z2XA 2FOIA 2JIBA 2R44A 2Z58A 3ESQA 5SZHB 4O08A 2FZKA 2JFNA 2Z2JA 5ENZA 5LP6C 3CNLA 2ZJ4A 3P19A 4H4DA 3M33A 3EOZA 4Q1DA 3VZSA 4BX3A 5JASA 4H6XA 5AUNB 3Q5GA 4NBNA 1MAAA 4CE6A 3SWWA 4ZT2A 2ZETA 5ARCA 2A5FA 2I8CA 2IX9A 3E27A 1HOXA 1X7XB 3LV8A 1NBOA 4XSVA 2J6BA 3TQRA 1K3TA 4EHJA 3L4JA 1XQVA 2OA0A 3WMRA 1DPGA 1RWNA 1U0JA 2NV0A 2WD9A 1BCSA 1AGXA 4WXYB 3ZNQA 3NH9A 1TOAA 1KMIY 3ABRB 3MTQA 2VNIA 4IKPA 5F4ZA 3Q72A 5FI5A 3WLHA 2ZUWA 4DXAA 4JC5A 2GCOB 4UTRA 3C7KA 4JT4A 3PNOA 4TL8A 1X15A 4OBXA 3NP7A 3STHA 2VZEA 1PGOA 2EFJA 4JP2A 2LD4A 4BNWA 2J9ZB 4XWWA 2V0NA 5HVNA 4AK9A 1HSOA 2EJBA 1QQBA 4EABA 4INZA 5KDOA 5CM8B 2QBYA 2I6UA 1PG0A 3LQQA 3M6XA 2G71A 4LMPA 3CEPB 1DKOA 1GRNA 2R79A 4CNQA 5B7NA 1OH8A 2Q1UA 2PBFA 3R0IA 4CT0A 1CQJB 2R8OA 4ZT7A 4AZSA 1YKSA 2B5OA 1USKA 3PGA1 4GQIA 4URFA 3T7IA 3BXHA 3VGPA 3WGZA 1UBKS 2FF7A 3EAGA 1DAKA 2W9XA 4XYMA 3VPCA 1CY0A 1UWKA 4P5DA 1DEXA 5BN5B 2DPXA 3W78A 3OD1A 4GO1A 4A8PA 5HF6A 3GEDA 2EZ4A 4B35A 4B74A 4L9WA 2PGDA 5EYPB 4AG5A 5FA5A 5LQDA 1OT5A 1MIOA 1GNTA 1U99A 2H54A 1OZGA 1ZUHA 3GG2A 3KT0A 2BAGA 4L5AA 4TYMA 3ZDFA 4LFAB 1C0IA 1JAIA 3CMMA 3I6MA 1WKBA 3FCYA 4MKZA 2RK3A 4HYTA 5FOVA 1WCXA 4B0PA 1SBNE 4URXR 3ANNA 3KOOA 2PT7A 3IEKA 3P2OA 2X0FA 3LZCA 4JSYA 2K87A 5DNYB 2ZJBA 2N46A 2ZROA 4R1NA 2PUDA 1DSSG 3ZXXA 4C2UA 3B2QA 4US2R 1YL7A 1SUPA 2CWWA 3BGSA 3AR6A 1VHDA 4AIIA 1NC3A 2WABA 1X9GA 5BR8B 3A1VA 10MHA 2IEBA 4FLMA 3LVQE 4TV8F 4ZAWA 1R27A 3N39C 1RHMA 3JYOA 3F7TA 2GF9A 3RQIA 4DV1B 1G3UA 3HKDB 3EBOA 3DF9A 4F8EA 1R16A 1ECGA 2WJIA 4QOGA 2GA8A 1J24A 1R8JA 3I9JA 3JV7A 3MUNA 3O8OB 5EMKA 3OX4A 3TRHA 3ZY2A 1IBMB 4XDYA 5KSZA 3AEUA 3V8VA 1K2WA 3NHAA 4DLLA 3H17A 4OHYA 1Q1NA 3DZHA 3R7AA 2XB2A 3EVAA 3E7DA 4LBYA 3GQVA 1MD9A 5AW3A 1IOVA 1PNQA 4HMOA 3ZU3A 4P58A 5IJAA 1R8YA 2DFVA 5BSHA 5BSUA 1J7JA 3V6LA 3SG0A 1RNLA 1AMUA 4R2XA 5BSMA 3BSWA 2HF7A 4ZVRA 4OQLA 1ODCA 3TTYA 1G20E 4E3ZA 1DIRA 2IPLA 5I7HA 2OBYA 2J0QA 3KD2A 1YC5A 2JFZA 2IZ7A 3ELWA 3GMDA 1XYVA 4HNUA 2XMBA 2FU5C 3EQ6A 3NM4A 4TS3A 3G6WA 1R8QA 2WE7A 4D6PA 2UXCB 2I6QA 1I4TD 3M6AA 4RE6A 4C14A 3S6JA 2Q9UA 1ZK2A 1NP6A 3UB4A 1JZQA 1CD5A 1QS0A 4C0QC 4DM7A 5HKKD 1PVVA 2IHJA 1MXFA 4Y9DA 1ORVA 4O6VA 2WICA 4K6KA 1ODKA 4TSFA 3D6HA 1XIVA 2RGGA 2B2CA 1ZXLA 3RVQA 1VE3A 4LV5B 2R6DA 5AOVA 5JSQA 1EAYA 5DHSA 4X24A 2AOUA 4YP7A 3GT3A 4KWEA 3ZOKA 4GLOA 4KRXA 2ZG6A 2YVQA 2MSNA 3TOVA 4CU2A 3VR6D 2H9IA 3M0EA 1VKNA 4WLFA 2HSEA 3CUKA 1AV6A 1NW3A 4GDFA 2ZRMA 4TYQA 3PRYA 3L7IA 4TUYA 1I14A 3C1TA 1MFZA 1V11A 4QDKA 1V11B 1HZZC 2D54A 3I9LA 4DCSA 1K5PA 4EH1A 5CT5A 3QW4B 3DXZA 4GKBA 4NOMA 3CM0A 4RABA 3C3WA 3VR2D 4Z3OA 4LOHA 2PGJA 2PBLA 4ZGGA 1GILA 1IUKA 5LQRA 3KZOA 1YIOA 4HRVA 3URMA 2B6NA 3PX3A 1JH8A 4O4LA 5SY9A 2WVJA 3U56A 4MV9A 1W2HA 2VTVA 2WJAA 2PQMA 3E18A 3I3OA 1TKRA 1R0KA 2AJBA 3B36A 1LC0A 3FAZA 4QTUB 1VJDA 3AIKA 3IMGA 4BB9A 4D4KA 2VJAA 4MQFB 5EHIA 2YIVX 1H4QA 1JBEA 3DZFA 2IYUA 2GEFA 3PNKA 1MP0A 3R7SA 4ALNA 3RC1A 1DTEA 3PEEA 4JI3B 4XJXA 5HXAA 3INYA 1ISSA 4ID3A 3KLNA 2EIXA 1VJRA 4YPFA 4UE3S 5JH7F 5EHQA 4B2IA 5FNVB 1FC0A 3U4GA 4ZHQF 1P29A 2J6IA 4N5MA 3SC3A 3U4CA 2NW6A 2HA7A 3VKHA 2B82A 5IP5A 3N2KB 1F1BA 1BS1A 1LI5A 5KNBH 1TQ6A 2F3SA 1HT1E 4UQOA 4ZHQB 1T34A 3CNHA 2YZ7A 2R1VB 2H59A 1N5RA 3FJ1A 4PRZA 3W9SA 3Q3IA 3TLEA 2XCRB 4I4TA 2JNWA 2I99A 3CRNA 3IESA 2R00A 5EERA 2NTEA 1IZ0A 1T10A 2NZUG 1IBCA 1ACLA 2CJWB 4RZHA 1FNDA 3SR0A 5JZBA 3GX1A 4AKEA 2CV1A 2BZSA 1E2EA 1Y9JA 4KK4A 4QFBA 5G40A 4F5ZA 2G5CA 2ERXA 3D8UA 5TGDA 1M2WA 3R3ZA 4HEJA 2AZMA 1WIWA 1QG4A 4JT9A 4PSUA 3DCIA 4YP6A 5D8DA 4KE6A 2Q28A 1TJ3A 5CDFA 4P08A 3QLUC 2R1TB 2C2OA 5A02A 4Z53A 221PA 4IIHA 1E1KA 1XPRA 1E3LA 3ADCA 4QOHA 2Y3IA 4PBTA 4J1QA 3TAUA 3TZEA 1OYWA 1UBSB 4V3CA 1YJQA 3SJBA 4BWVA 2G0NA 3EMKA 4ZOBA 4CCSA 4E5SA 2IZZA 1RHQA 2QQEA 3VVBA 4B34A 1E2PA 1YL5A 1P0FA 3CUYA 2R0QC 2G88A 3NGXA 1V9LA 1PV4A 4CUJA 4GPEA 1HUQA 2HT1A 1ZY2A 3AFIA 3IVXA 3Q9NA 4C6HA 4QEDA 5DTQA 4K1LA 2BHNA 2XR1A 4H1WA 1N75A 1PX2A 5CLHA 3UOGA 3QVWA 3E9MA 3ZVNA 3U19A 3WK5A 2H4JA 4UDYX 3FR8A 3KSAC 3HACA 3ZGXA 3PC3A 1HEYA 5HWSA 1Z7EA 4MZXA 4M2LA 3ZGLA 5D5QA 3KSDO 3X1MA 1UKYA 4XEUA 4LHZA 2O3SA 2VAMA 2I87A 2JD1A 4US1R 4MVJE 3EBPA 4GBJA 4B46A 1WRBA 5BV8A 3Q8WA 4WRRA 3BD8A 3UMJA 3NORA 1KQ3A 4LZLA 1DRKA 3EXAA 3IXQA 1N6NA 3JZIA 3NLLA 1Z2CA 4MR8A 2F62A 4BEBA 1PL8A 1MQ8B 2GNOA 4XB1A 1BMDA 3I83A 3CNQS 4A8JB 4MQ6A 4CCAA 4ZA2A 2HF8A 5JQGB 2D3TA 2W22A 4KMOA 3H65A 3TFWA 5A03A 2CXQA 1U0LA 1K3UB 2JAOA 3ODPA 4UDNA 1Z35A 2EX1A 2LVBA 2GLTA 4LOLA 4YJ3F 2JLSA 1DFHA 4FONA 1OAOC 1HDZA 2FR1A 5T8KA 2FPKA 4QU0A 4NI5A 2JAUA 1MHPA 3LP8A 2IYSA 1TO1E 1G8JA 1PUIA 1S01A 3NYWA 1M9NA 2ZJYA 2RGBA 4IQ0A 1Q7CA 2OB1A 4OBBA 1YDMA 1GDDA 3ANSA 3D8NA 1E2HA 4GL4A 4JI2B 1EP1B 3EXHB 3GD5A 1EXDA 3OU6A 4QELA 2ZPTX 1SU6A 4CRWB 5BUSA 2ALJA 4QL3A 4ZT3A 2Z08A 3AHDA 4ZCTA 4BNDA 5LWHA 1P0PA 4BLQA 1P5FA 3RJMA 3ZLUA 5D7BA 1Z0ZA 1GAEO 3MYRA 1JALA 1YR7A 3BKWA 3PXGA 2NV6A 4ROTA 2J0VA 4YYEA 1TECE 1U0RA 4YJGA 5BN4B 4JLMA 3RUFA 1KERA 4Y3UA 4L5CA 1QGOA 4M0MA 1G7RA 1Z08A 2NWQA 2E85A 3ZDAA 1S3SA 2O3RA 3OMLA 5LU9A 5JSZA 1G21E 1A9RA 4ENSA 1S2OA 4YMUA 3CLKA 3MTGA 3FNHA 3FRJA 4N65A 2DCMA 2JIDA 1NHWA 2PT9A 1U7UA 2R8EA 3G8BA 2YOHA 4KSBA 5NULA 1GPYA 1N34B 2CD7A 3QHQA 4FE7A 4F2GA 1BEUB 4RKYA 4HJRA 3L7YA 3MSCA 2W6NA 1R12A 1LI4A 1TZKA 1V5GA 4FBGA 4GFDA 2P2YA 4HX9A 3IQDB 3F4BA 5ISMA 3R7LA 4BE7B 2VYND 1TXGA 1O3YA 2POCA 3QTTA 1H5QA 3LX5A 4DIKA 2C5LA 2VXCA 3RKSA 2E0IA 1QC5A 1A76A 1DDGA 3ZN2A 3OFVA 4UNPA 4Q93A 3KKKA 4B33A 5DP1A 1RLOA 3IV9A 2VJYA 3TZBA 1E6WA 2JBAA 2OTCA 4N0QA 4OYHA 3UGQA 3WOVA 3TXYA 3RIYA 3EDCA 2OORA 1VC2A 2G82A 4UZFA 4Y18A 4EQZA 2CJPA 4WCVA 2IUSA 3MJDA 4K5QA 4CG3A 4IVRA 2QN3A 3DBVO 3NTXA 5T41A 3UK0A 1VP3A 2W2KA 5EIXA 1ADYA 4MW5A 3PEYA 2NO0A 4FLFA 3L0ZA 3X0DA 4LE2A 2O0JA 5F1KA 2VJDA 1PUXA 1NNI1 3UA4A 3VHRA 3VX4A 2BSAA 3PGKA 5T67A 1JG4A 2QZ9A 3OOHA 2CT8A 1HDOA 2EP5A 2K2WA 2PG3A 2RGDA 1NV9A 3ADOA 3PHBE 4I5IA 1VFNA 2H2IA 1RQRA 2VT7A 3C1OA 5K8IA 1FFDA 1P5ZB 3LHDA 3Q3VA 5ERYA 3TEJA 2PRZA 4Q3KA 1TO2E 5KYTA 3OJCA 4LUCA 1X1TA 2FPGA 3BFJA 5E9QA 4S2EA 3RNLA 3MJHA 1NBHA 3TYXA 1J2YA 3ZEAA 2JATA 5J58A 2C9OA 1QGUB 2Q6VA 4TTPA 4R7GA 3I1IA 4PWZA 2PSJA 2UXBB 5D3ZA 5JH7B 5K0ZA 1V39A 3FH0A 4OLHA 5FP0A 1ZN8A 5DKFA 3E3AA 3EB9A 1SUAA 2DRIA 3TX6A 1TVKA 3DO8A 5IX8A 5C80A 4MROA 3E23A 5JXGA 2CHFA 2PWBA 1FW8A 2RMKA 1N0WA 3IA7A 3AU9A 4EMSA 2R5NA 3P96A 2PZBA 3ZIDA 3GJ4A 5LIRA 1TADA 2FJPA 3R9IA 3K0AA 3NBMA 2QD4A 3MRTA 4LZAA 1WNFA 2YBDA 4Z2AA 4JIGA 3E7XA 3RR2A 1EUCB 1MAWA 4NSNA 3FCCA 4MPDA 1DJMA 2BFFA 2HJVA 2JBWA 1QVZA 3BERA 1S6YA 2DPMA 3IALA 1AUVA 3MAJA 2D1FA 2GEUA 4J1NA 2BGRA 4Q7KA 3UJDA 3V7NA 1HE3A 2JHAA 1YZLA 1GPBA 3D7KA 3MK31 5TMPA 1MPXA 2NZXA 3CF2A 3SF0A 2YFQA 3WWDA 5KYYB 1NG9A 5JY6A 2H07A 3HUDA 4A5OA 4ETMA 3DFFA 2J6CA 4B85A 5KVSA 5HSGA 3W5DA 4KAAA 3ENKA 1CRPA 5DBGA 5A1JA 4UQPA 2V03A 1R4NA 4TL7A 1T35A 3T7AA 1KJQA 3PBKA 4G09A 2I6XA 4LYAA 1QZXA 3ETJA 2QQ5A 1R50A 3ONNA 1DEHA 3NV7A 1XZPA 2LW7A 2NO5A 1Q16A 1PT8A 4ZOLA 1ENYA 5LXTB 4HJXA 4UULA 2O8NA 2VDPB 1ETHA 5E4JA 5K0BA 1GFZA 3QXXA 2H18A 3R5JA 4AT1A 5KQGA 1OWLA 1AMOA 2H3EA 2C2KA 1NI4A 1FS6A 2J7PD 2CSXA 4RFSB 2AC2A 4HLQB 4V0SA 4TV8A 5I9SA 1HLFA 1ND6A 4I1IA 4ZC8A 2IU0A 1ZR4A 5J2TF 4QXPA 3DT8A 4L73A 5ALUA 1T3ZA 3RTGA 4NMXB 4DCPA 3BJIC 4X93A 1P2SA 5IAJA 1EFHA 2F8TA 1OPRA 4HVAA 5GGXA 3WJ1A 5KB3A 3NHLA 2HO5A 2XQKA 3EZ9A 4ENVA 4H3SA 3CKYA 1UOQA 3R4CA 2ASEA 1LQ2A 2LDBA 3A6FA 3RHFA 4I1VA 5EWLA 3RYTC 4JA0A 3H1PA 5JFGA 4G4IA 1TUBB 3VZRA 1P74A 1KE1A 1F5NA 5BYBA 2P4HX 1CUJA 2CW5A 4EYQA 3T94A 2R47A 1KI9A 2O5EA 3CO0S 3WDSA 1XCOA 1G18A 4DUGA 5KVVA 3GA0A 2PH1A 4D3ZA 4UHHA 1RAEA 3DNFA 3M5WA 3QU4A 2DJIA 3BEOA 3NTLA 4FT4A 1PYOA 3DZIA 3RPEA 4E21A 4YCCA 1VXRA 2Q5HA 1X8XA 3F9IA 4UE2A 4XYBA 1FF9A 1G6Q1 1T5LA 1U28C 4BMVA 5LZ4A 3KPJA 1O0SA 1M8KA 1UM9B 4QYIB 2JLCA 2QSJA 4K3UA 5BUQA 1SELA 2COEA 4KMRA 3LW7A 1JA9A 1UBEA 1F48A 1P4HA 4G24A 4B44A 5IHPA 1BQ3A 2V4UA 5ICFA 1JDZA 1RXWA 2QPLA 3KE8A 1CDEA 3Q11A 1U6JA 4JBGA 3LWDA 2I7TA 2VRWA 3LYHA 1YD7A 2PMEA 5LKRA 1Q3TA 3LK7A 1A96A 4ALLA 3TAXA 3F6PA 3NVMB 2EFDB 3RW9A 1KH3A 3FWPA 1E1NA 4UU8A 3RBXA 3WDLA 3IJPA 4KIJA 4PR0A 3JAMA 2B1IA 4B3SB 4WH0A 1N2CA 4U2FA 4B6SA 1KO5A 3COPA 3WMFA 5DWVA 6ADHA 5CHEA 4DMFA 2BD0A 4TKVA 3ICQB 4U7TB 3AESA 5AHKA 3WBBA 1UFKA 3GDWA 4D81A 1C2TA 4GOND 2NYAA 2REOA 3NKLA 1ISMA 4GZ5A 2C3UA 2P91A 1MOZA 2B2NA 1OXTA 1UANA 2ZOSA 3C5VA 3QPUA 2KE5A 2XHEA 4IMIB 5G3YA 3WWOA 4BNDB 1RYFA 4B79A 1Z2NX 1TIPA 4JL6A 5AJXA 1X38A 1W8DA 1CCWA 3QUAA 4F06A 1Q0UA 2FRDC 1TA4A 2HV8A 4O1HA 4BLUA 3EZYA 3UG6A 2ADMA 1QG2A 1SKBA 3LM8A 4MYTA 3B53X 2PA3A 4Y1EA 3D8BA 1HF3A 3D4NA 1GUAA 4AFNA 1HE5A 2YWEA 4X71A 1DQRA 1E66A 2IDMA 1OGJA 2IK8A 3E03A 4MO9A 3U13A 4A27A 1B8OA 3QXSA 1WHTA 4RY8A 3UUGA 4AJEA 2YXBA 1ULUA 1TIBA 4NMWA 3M1IA 4AX4A 1A8IA 1L7VC 3E35A 4M8NE 1ISJA 4X63A 4X45A 1JJBA 4RE5A 4QUHA 5BSGA 2QSYA 1HPLA 2TS1A 1E6UA 3GMIA 3KDAA 3DLHA 5MN4A 2B83A 2I2FA 4FNGA 1HDIA 2AN5A 4MJ7A 4NU6A 4YP1A 4YAIA 5FX2A 4RZUA 4F0JA 4ZHQA 3QKTA 1FMCA 1WXQA 4GHWA 5CK5A 4G1MB 5CXQA 1CEYA 3F74A 4HWGA 2XNSA 2WZDA 4B7CA 5BYKA 2C7RA 1M1ZA 4JSRA 3FCUB 4EJ2A 2ORED 2XZLA 3G1WA 4WNAB 4RA6A 1PDWA 1Q95A 4W8GA 5EP1A 1JFSA 2ZSFA 2F7SA 3OM0A 3UWSA 3MMZA 1V3TA 2O9JA 1PU2A 1SH7A 3KAQA 5LB2A 3WFJA 4JEUA 4RD0A 4B6PA 3G2MA 1T25A 1AQUA 2Z3ZA 2YWCA 1T9HA 3B3FA 4QTTB 4BNLA 3ZR4B 1GFWA 2RGYA 2XGSA 4COKA 5K0JA 2QM7A 4KRFA 3WNCA 3K6KA 4FHZA 5EHGA 3VYWA 1TB4A 1U6KA 3IB6A 1CE8B 1KYVA 1L7EA 1A77A 2A8YA 1TRKA 2P2GA 2Y4NA 2YW9A 3D3NA 1ID1A 3O2JA 3QNMA 2PRKA 2HWYA 3HLTA 4M7RA 2F48A 4DV4B 1DAEA 4QO8A 3DE5X 2LTAA 5BNIA 1YQEA 4CLOB 3AHCA 1ZJ6A 4YPVA 4TZ6A 3WJ7A 5IM4F 3FDZB 2ADFA 2WPDA 3GEMA 2NZWA 4O2RA 5AI0A 1KDTA 1KY4A 1M8PA 5BWLA 5CB4F 1LJLA 1JAXA 1SPXA 4RTNA 4YT8A 1M73E 5DNVA 4L3VA 1QP0A 1JNXX 3GJ5A 4R2MA 4EB6A 1AY0A 4EFMA 3MTIA 3U3ZA 1Z2OX 2OBXA 4LF6B 2GD6A 3H9CA 5HEKA 2QMZA 3EG9B 2ATEA 4HWTA 3D5QA 3H8JA 4KPUB 2ID4A 4XRGA 4MPJA 4Z1OA 1RS0A 4CMEA 2DHCA 3ICCA 2GPTA 4NFHA 2ZUBA 1FP7A 1G6OA 1XP5A 2GN2A 3F71A 3HI6A 4MIOA 1OZ0A 1R88A 5AKKA 3CVJA 3MWYW 1PUJA 4N5IX 4EUFA 1E3IA 3I5UA 1IQ0A 4KB5A 4JWKA 3GZJA 2FEWB 3P2JA 5DZSA 2QZJA 1CIJA 1EWRA 4FXOA 2HA4A 4A8JA 5IUJC 3T1OA 4BB6A 3CIOA 3PQ8A 3QOXA 3K72B 1NVUQ 3DTVA 2Y1GA 3P71T 3GNSA 1SIUA 4D02A 4W8HA 5LYJA 3MT0A 1XEXB 5K2OA 2DQ4A 1HQYE 3BE4A 3PRHA 1Q14A 3O1LA 4UCWA 5JS7A 4RPIA 1YRHA 3ISVA 3ABSB 3SZMA 5G4KB 2NZVG 1JHPA 2JCBA 3Q3CA 3ZV3A 1LJUA 4Q9NA 6YASA 2C8LA 1KZYC 1TZJA 1F2DA 1PWHA 3PQ3A 3LKZA 3RODA 4IS3A 3IELA 3TKAA 4QTZA 2NACA 2BJVA 3AUSA 1J5PA 3FAKA 1YB4A 1BX0A 2OZPA 2FEMA 3GELA 3NW9A 4WE3A 2DKNA 2QPTA 4FVTA 3QV2A 3PDIA 1FDUA 4HRAA 2FZCA 1JJAA 4KGVA 4KKXB 4NY1A 4BNIA 4AJHA 5AKYA 1J0DA 3PDJA 3ZIAA 4EPYA 3IEPA 3N75A 4HZUA 1FP2A 2XUFA 5FA8A 5CIYA 1M2JA 3HVKA 5FBWB 3LLSA 2Q8NA 1A7JA 4LJAA 3IV6A 3KQHA 1W88B 2P69A 3OZTA 4LQDA 4UNSA 4AKTA 3PF9A 4FFDA 4I4CA 1T9KA 1JQJC 2VH5R 2HYIC 4DDWA 2ID9A 4NNOA 2CHVA 5BRJA 4GR9A 4XUDA 1L9XA 4FSDA 3FUUA 1JNYA 4TMYA 1XKTA 4BQPA 1A9XB 1CG6A 3HCOA 4TN1A 3WJ2A 1Y3CE 4CM8B 1Y1SA 1DI0A 1T9BA 2ORYA 5K03A