4LYJA

Crystal structure of small molecule vinylsulfonamide 9 covalently bound to k-ras g12c, alternative space group
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
TEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/inhibitor
molecule keywords GTPase KRas
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lyjA00
5L3QB 5H68A 1G3UA 1RW4A 1Z0FA 4V0MA 4CZ2A 4ZKEA 3LAWA 1R4AA 1JEEA 4O25A 5A4JA 4BEBA 5ELXA 1Y63A 121PA 2Z0MA 3QPWA 4RZ3A 1KKLA 5JWRA 3OZXA 1KDOA 1E99A 4HUTA 3L0OA 1VECA 2R6AA 3ZVLA 3FYHA 4TLDA 3C15C 4WZBE 1SVKA 3B1YA 1A2KC 1FZQA 4DLUA 1XPUA 1XTSA 1RE0A 2GETA 1Z3IX 3LBIA 1Q1QA 3F8TA 4K81B 2JLZA 4PSKA 2VIIA 1KO5A 3VX4A 1LF0A 2QAGA 4AURA 4LWZA 2OBMA 2OXCA 4I4LA 3UG7A 5DHAA 4ON9A 1US8B 3W9YA 4F38A 3BFKA 5IF9A 1E9SA 1SVSA 4QXAA 3HDTA 2QPTA 5KDLA 4Z8XA 2B8TA 4AWXA 4RCZA 5EQTA 1NVXQ 1DE0A 2ZRJA 3EZFA 4FMDB 4IKEA 2FFQA 5FTLA 1BS1A 8OHMA 1UDXA 4PZYA 3A8TA 6Q21A 1NMXA 1SXJA 1WRBA 2QAGC 3CLVA 3L43A 1NJFA 1MO6A 4LHWA 4QKQA 3WYGA 2PJRA 4NBSA 4FXPA 2QENA 4X8HA 1BYIA 2G0TA 3OFNA 4DSOA 1Q44A 5H70A 1KSFX 1ZNWA 1U0JA 1IN8A 2QP9X 5FOWA 5JJKA 5DGXA 5BWMA 4OQXA 1EFHA 1IY0A 4HLCA 1R0WA 4DJTA 2WAXA 2OCAA 4WBSA 1KSHA 2W0MA 4Q4AB 5JEEA 4IOMA 3RRMA 2O8CA 1JJ7A 4U7DA 1R5OA 2VLIA 3PUWA 4CEIA 1Z2CA 1FQKA 2IEZA 3CM0A 3Q85A 1XZQA 4FCTA 2FFAA 2UKDA 3A4LA 3NKVA 4TYPA 3SFVA 4BASA 2YWHA 4DUGD 4FWTA 3GJ5A 1J8YF 1CIPA 1CJTC 3UMSA 2ZIAA 3FMIA 4HYYA 5J47A 4U00A 1FX0B 3AVPA 3QKUA 2Q6TA 4M21A 2V1UA 1QVAA 1Z28A 5L3VA 1NKSA 1YR8A 4NYJQ 2G83A 1A82A 2XZOA 4IXNA 5EE3A 4JLMA 3ZDQA 1W46A 4PAMA 2ZJ8A 1SZPA 2D06A 1E2DA 3LA6A 4HB0A 3LDAA 4OHYA 4DDTA 5G40A 2ZSFA 3BB4A 3DKPA 4G1UC 1F3OA 3GJ4A 4NE2A 2QA5A 1GG2A 2BVNA 3FHCB 3R8CA 1W36C 4AI6A 2O8DB 2FN4A 4JZKA 4AD8A 1RZ3A 4CT5A 1DO0A 4F93B 3MWKA 2UVQA 1KI9A 4OI1A 4QBGB 4DCSA 3L0PA 4JLDA 4XIGS 2O8EB 3KQNA 3LBHA 3AF4A 2A5JA 3A1SA 1Z6GA 1N0WA 1ZM7A 4DB2A 2IYWA 2WWXA 1CR4A 3EC1A 1R8QA 3U2QA 1XPOA 2Q9AA 1Q3TA 3T5DA 4BE7B 4RD2A 4A2QA 1FMLA 3MG9A 2ZUBA 1N3BA 2IYLD 3NG1A 5BN3A 2FA9A 4TWZA 2PEYA 4JLAA 3BE4A 2ZRIA 4GFDA 4Q1CA 3W5JA 1YVDA 2CVHA 4DUGA 1FUUA 4F7WA 3VR2A 3TSZA 3A1TA 2IA5A 2X2FA 4O2LA 5AUQA 1IN6A 1N6PA 4L9SA 2Q3FA 4M4SA 5B2ZA 1E4YA 3QPVA 3GCGA 4OJKA 3GFPA 3I92A 4AK9A 1C4OA 2DHRA 3UK6A 1ZD9A 2GF0A 1KDPA 1MR3F 1CXZA 2Q3MA 1XMJA 4D80A 5GVRA 2IS6A 1G6OA 2HCBA 1COWA 1HTWA 3CR7A 1A1VA 1F2TA 2QPOA 3LX8A 4JT2A 2CLDX 4V0NA 2RHMA 2B92A 2WJJA 4TT3A 3IBYA 4C7OA 2OCBA 1Z0AA 4QHSA 2R6DA 2FFBA 3QVVA 5DYIA 4NTZA 1QDEA 3OE7D 3Q8XB 4MYCA 4IOJA 1N5KA 3QBVA 1M74A 2CDNA 1G9XA 2W58A 5E4FA 5AJWA 1NNEA 5KNBA 5JSZB 2QG6A 2QRNA 3U5ZB 2HF9A 3VFDA 1OKKA 3PEVA 1BIFA 4URZR 4KO8A 4OHVA 3EZ7A 4L15A 4US1R 3U60B 4P32A 3AVTA 4DCNA 2FPKA 4ZKDA 2GZHA 5L3RA 1M7BA 3CKLA 4B74A 1TL7C 1RPZA 1ZC3A 1UF9A 4B3BA 3I5YA 2GXUA 2JCSA 4R2IA 2NQ2C 4FD2A 2R6CA 3NEJA 2XSZD 1SGWA 3SS8A 4CYMA 2ZR9A 4KCGA 2QY9A 3B1WA 4MRVA 1AS2A 4NU0A 3TQFA 1YHNA 2OM2A 4BLRA 4V0KA 5FTJA 1Z0IA 1BOFA 2UZ3A 4XVRA 3B78A 4OJQA 5UKDA 3QJYA 3X1DA 621PA 3T1TA 3ZVNA 3X1ZA 3SU8A 2R2AA 4M53A 1AJEA 2GVZC 1XJQA 4LV5B 1LVGA 4KBFA 3B85A 4P33A 2N46A 3B2EA 4O3MA 2RGDA 3IQWA 4PC1A 3CUEF 1E9EA 1Q57A 1SKYE 2ZI4A 2QAGB 4OHZA 4C0HA 4D26A 3DVLA 3QENA 4Q9KA 1G21E 5KO2A 2EWVA 1ZIPA 1VHTA 3QG1A 5C4MA 3A37A 3OE7A 2ZETA 4B3XA 4PXAA 4BLSA 2F55A 1HE8B 2AK3A 2FPMA 3GJ3A 3RRNA 3CX8A 1N0UA 4B75A 1K8RA 3E1SA 4A4DA 2ZVQX 1CF4A 1XEWX 2CXXA 1BYUA 5HZKA 3GLGA 3TKLA 3K0CA 2AN9A 2EFGA 1OFTA 3W90A 3W3AA 4OQNA 3VKHA 4YLGA 3PUXA 1NVWQ 2P5SA 4NCIA 2XJ4A 1M7GA 2HJGA 1W0JD 2R8RA 4W5HA 4LJ9A 5IK2D 3A6PC 1AGRA 3LO5A 3W34A 5EJEA 3TUIC 4X8MA 4XWOA 4LYHA 1NBMD 3PEWA 2XSZA 4PAQA 4QFMA 3CWQA 4ACBA 4ZV4A 4CEIB 2DPXA 5AJZA 2D62A 4HDCA 4TLCA 5JI2E 1XB2A 1KK2A 1GDDA 1XCMA 2P6UA 5LD2C 5JS7A 2VP9A 4EPTA 4KAXA 1GOTA 4MGYR 3UKDA 3T34A 3QBTA 1JJVA 1W49A 4R2HA 3IIMA 2Q21A 1OHHD 3WNCA 4US2R 3BH7A 1MV5A 1G17A 2C78A 1W36B 3DOEA 3QXXA 4LBZA 3U7FB 4NYIQ 2ZJAA 4BFWA 1E2KA 2O0HA 1YRAA 2YKGA 3DMDA 2EU8A 1KNQA 2ZJ5A 4N0EA 3I5XA 2IEYA 2ERYA 1ZNXA 4IHQA 2BV3A 3A1UA 1OH7A 4E5UA 1N25A 4Q02A 2QRZA 2ZRAA 3HP1A 4M22A 4TL7A 4Q21A 2V8OA 1NF3A 2NMVA 1RIFA 4DLRA 1N6OA 3EC2A 1GFIA 3D3QA 1ZUNB 3NH9A 3BGWA 4M9XA 1KDRA 4D4JA 2DFKB 1AGPA 3CF6R 2DCUA 2DR3A 4RCYA 1YRBA 4XTRA 3AVVA 4HLQB 2ONKA 2VHTA 2B6HA 3S1AA 2WJHA 3V4FA 2QP4A 1GITA 1SVWA 1P6XA 2GRJA 5E7IA 3G5UA 5HE9A 5JWOA 2GXSA 4P31A 1AZSC 5FBVB 1E1QA 4EJSC 1SHKA 3HYRA 5KYKA 3DO6A 4DIDA 2C77A 2WWHA 3Q7PA 4CW7A 3W3ZB 3BRWD 3MWJA 2YC2C 2BCJQ 2QM7A 3RSOA 2DFTA 3CW2A 3K9HA 3SBEA 5FPKA 4QNRA 1Q20A 5K8IA 3THXB 3P27A 1JR3E 4A0FA 4HDOB 5FL7D 4DWJA 5HPYB 2PLRA 1FP7A 4I1UA 3AGPA 2WKPA 1PLJA 1XMVA 3LVRE 2GJ9A 3FHTA 2GCNA 2ZSAA 2FNAA 3CRMA 2IK8A 2RGNC 4KSCA 3GLFE 4S35A 4DLVA 3M4YA 4LJYA 4IRUB 1ZMXA 4Y0AA 5FBQB 2QTVB 1JR6A 2QM8A 2G0NA 2KE5A 1RRFA 2GDJA 3BB3A 4TLEA 3QG5A 2R6FA 3GLHA 4JIMA 4DHEA 4IOLA 3SYKA 2BWJA 3LLMA 3U3KA 2ODNA 3PEUA 4FMCF 4Q9JA 3B1XA 1GKYA 1F2TB 4WIAA 1AM4D 3R9WA 2WJYA 1W2HA 1S8FA 4C7OB 2J7PA 1AIPA 5TXGA 5L3QA 2ODBA 1XD8A 4QBFA 3AH8A 2BIFA 1IY2A 1X8JA 3VR6A 3N2IA 4JLOA 2JGNA 1Z63A 2QMEA 3VQTA 3QKRB 4BLQA 1GZSA 4M1OA 2VF7A 2ZTSA 3NBXX 4Q47A 3SJAA 1M1YE 2J0QA 1NKTA 1S1MA 1KYIA 3U3JA 4DDVA 4TSFD 4URYR 1P60A 4FIDA 4EPYA 3PQCA 4MGZR 1KMHA 1G5RA 2IYTA 3RANA 2C03A 1WP9A 4V02A 4TL6A 2QZ4A 2CBZA 1HA3A 1WCV1 5G3ZA 4LX0A 1FW6A 3OEED 3CX6A 1ZUIA 5DIFA 4AG6A 1YZUA 4IEEA 4HDQB 4I1VA 3ICQB 1DAGA 4KODA 2XB2A 2XXAA 1J90A 1US8A 2XZPA 3GEIA 5EUMA 3K0SA 4GL2A 2BBTA 5FI1B 1HQYE 1L4YA 4HZUA 1KSGA 5F9HA 4KU4A 2OSBA 4B35A 2F7SA 4NDZA 4Q7KA 1YKSA 4GZMA 5BYKA 3B9PA 3QY0A 2ECKA 4TMKA 3LWNA 4JLPA 2W6JA 4NZYA 1Z6AA 4DCVA 5JCPA 2EFHB 2EW1A 1IY1A 1YR9A 2ZI9A 2EFEB 2AX4A 3C41J 2JLXA 4PC3A 5GADl 2G88A 2QN6A 1W1WA 2RGEA 4PQRA 2V1XA 5EXXA 3SZRA 4B76A 4PC2A 3GQBA 1G8YA 2OUKA 2YHSA 3EZ2A 4HB3A 4KFSA 4ZI2A 3RC3A 1U81A 721PA 2X1VA 3HR7A 4BFYA 2FPLA 2VP2A 5JMTA 4Q4AA 3SI7A 3N2EA 2V6JA 2F1IA 2JASA 3L82B 4Q5IA 2JEOA 5IDVA 5B57C 4J0QA 1DELA 4PSAA 4Z8YA 3QF4B 3VR4A 2QAJA 4OHXA 5CJ2A 4OI0A 1CJMA 4GP6A 2ZJ2A 3UG6A 3OIVA 5EE1A 3BS4A 3M0EA 5EZ6B 4C0KA 4M0LA 4EPWA 2ORWA 4N1AA 4LV6A 1WBBA 2GAOA 2W0SA 4TSFA 4MGKR 4CEJB 3G82C 3GLGB 4OQLA 3HU1A 3WMEA 3DMNA 4JYBA 4YMWA 4KLNA 4H9GA 2ZE5A 3IQXA 1DG1G 1OYWA 4ZCLA 2CCGA 2OFOA 4AKGA 5LD2B 1AA9A 2RGBA 3I73A 4Q4LA 1DAFA 2ZI7A 3NWJA 4CRWB 1G3MA 3SOPA 4JKIA 1RFLA 5AJVB 2REBA 3B1ZA 4D0GA 5BN4A 3AF3A 4TMTA 4G0NA 5EXPA 3AGQA 4DDWA 2GXQA 2OEPA 4TMVA 5JJLA 2DWPA 4QJ5A 4YC7A 4AYTA 1ZIOA 4US0R 3RRYA 2C04A 2CEAA 4OQMA 3UMFA 4FINA 3C7KA 2KWIA 3EPJA 2PCJA 3L0IB 2O8DA 2OAQ1 4TN1A 1Q0UA 1Q1EA 5LDDC 3TSOA 1XTIA 4YDSA 3TW4A 1X86B 4YDHB 3KQUA 1E2LA 2V3CC 1P2UA 2ZYVX 1N5IA 1Z06A 5EXSA 3Q5EA 5K8LA 4L16A 1OXTA 4DZZA 3SQWA 3OHMA 3UWOA 2DFNA 1EX7A 4TMWA 1U8ZA 2GZAA 3I72A 3K9NA 5AJXA 5JEDA 1Z29A 4RKEA 4U02A 2I1QA 2J59A 1GL9B 4O2RA 2XNDD 3Q9LA 4TTQA 2VSXA 4LPSA 2P6RA 4QJ4A 3R9IA 2JA1A 4EJSB 1Z6YA 2KSQA 1GP2A 4JVMA 1IM2A 3REGA 1T8TA 2A78A 2IC5A 1GIAA 1ZM2A 4QGGA 1XXHE 2A5DA 3SC3A 3KL4A 3JVVA 1S4QA 2J87A 3FB4A 1HURA 1LV7A 1DG3A 1ZINA 1SQ5A 3ZIAD 2VP4A 1KY3A 5KTYA 5EP3A 2NO0A 1E2FA 2BCGY 2ZVPX 2ZYTX 3CZQA 3GP8A 1NIPA 5CJPA 1P9WA 2ATVA 3HJNA 1ETUA 4A8JC 4GRAA 4DLSA 4M1SA 4DIEA 1YU9A 2NO7A 5DN6A 4GOKA 1K6MA 3FOZA 4MYTA 1W4CA 2ZYUX 1E4VA 1X3SA 1ZUHA 2FF7A 2P0EA 4DLYA 2ZI5A 3ZQ6A 2OLJA 4P4UA 3U44A 3MFYA 1W4RA 5CITA 1OFIA 3EG5A 2XAUA 1G1MA 1OXUA 4MKGA 3DZ8A 3FE2A 4E09A 4MDEA 4Z1MA 4D2IA 2WZQA 3ADBA 4JL6A 1E2HA 3PITA 2FFHA 3B9QA 1GVNB 3GJXC 3M1IA 3EXAA 4Z54A 4B6EA 1KZ7B 2J45A 4EFMA 4DEYA 4TMZA 1GTVA 1ZM3A 3TW8B 2CJWA 2AWOA 3BAFA 4HLDA 3OFND 1ESNA 3OESA 1II8A 2JIZA 4KFRA 1G3QA 3H0KA 1GAJA 2RHDA 5FTNA 2FSIA 3K8YA 1D2MA 1JALA 2Z4SA 4B33A 5FFMA 3OF5A 4W7SA 1AKYA 1RYHA 4B43A 1TPZA 1B0UA 2P2LA 3BFVA 4LBWA 1Y3AA 4UXHA 2HLDA 2WKQA 2QQEA 2HXSA 2WTUA 2FU5C 2LKCA 3EIQA 4MRPA 3ZIAA 2P3SA 1RRGA 5FPTA 2A5FA 1AS0A 4CT4B 5D3QA 4GOXA 3CH5A 1Q3HA 3KKOA 1II0A 5KOYA 1GSIA 1TQDA 1G20E 1KMHB 4JYCA 4YMTA 3FMFA 3R7WB 4A6XA 4MYUA 4ZCMA 3U3RA 2N42A 4CVNA 2HF8A 3DM5A 2GEUA 4LBYA 2CL7X 3TSWA 2DFLA 2OCPA 1W36D 1DAMA 3TNFA 2QL6A 2VP6A 1KK0A 3AVQA 1XD2B 1WXQA 3OIYA 4PQYA 1BH2A 2D74A 2OXRA 1N6KA 3IIJA 3QQ5A 4R7ZA 4XSGA 3RRZA 2XXAB 4TYYA 2ZSDA 4PHFA 1E69A 3CH4B 3GLIE 4HZUB 5L8VA 3ZS9A 2RCNA 5EUQB 1G7SA 2CE7A 2OAP1 3UXMA 4ABYA 3BWDD 5FTKA 3IEVA 1XCPA 4JLNA 2W2XA 5C4GB 2KBEA 4JBYA 2HCJB 4YMUA 3MCAA 1AKEA 5DLQC 4BRWA 2AD1A 3B8HA 2CMKA 3ICEA 4GP7A 4HATA 1E9CA 2VEDA 4BFTA 1VMAA 2O8FB 2WJVA 3KJGA 3FPAA 1KO1A 4NCNA 3EASA 1R0XA 2EVWX 1VCOA 1NG9A 5DE3A 1FUKA 3MD0A 3WP0A 4L8GA 4KVGA 1NN3A 5FOXA 1SVIA 4MUAA 3L8YA 2PJZA 1OIXA 5GJWC 3AM1A 5GJBA 1Z0DA 1XX6A 4PC7A 3ZVRA 1VCIA 1D9ZA 4QBIA 3BH0A 3MJRA 1GNQA 3T1OA 4IDPA 5BXQC 3CZPA 1EK0A 2WAYA 4Q7JB 1P9RA 3HR8A 5SZIA 1QG4A 1TF2A 4KI0A 3I32A 2CL0X 4AIIA 2C95A 2EFDB 1S0UA 2PZGA 1KDTA 3TQCA 3ZZ0A 3H86A 4B71A 5KDDA 1ZAKA 4XJXA 1KZGB 1KKMA 2CNWA 1AQUA 1G7RA 3FMOB 2R44A 1I4LD 2G9NA 1UDWA 4RVCA 5FOVA 4OK3A 1J70A 4C3ZA 4JL8A 2D3WA 2WSSA 3MUFA 1OIWA 2AKAB 2J46A 4D4LA 1M8PA 4UKDA 3TE6A 3BXZA 3KQHA 1COWD 4Q1AA 4LJ7A 4JVLA 2ZE6A 3C16C 3HPRA 2REXB 1D2NA 1VCNA 3P20A 4Q1EA 3Q7QA 4Q7LA 2HT6A 4TT3D 1DADA 2OT3B 3NBFA 2IUTA 2IHBA 3RNLA 2IYSA 4U5XA 3CR8A 1YZNA 4A92A 4EQ6A 2ZRKA 3TVTA 1ZM9A 4KLZA 4B3DA 4ESHA 1KMQA 1OSNA 3B82A 3U61B 1OLOA 1CJVC 2GEVA 4G3XA 2ZPTX 4RFVA 3ZJYA 4ACAA 4B6FA 3HPQA 1XU4A 5DYGA 1OKKD 3RDPA 4LC0A 1DEKA 1UM8A 2GNOA 1XDBA 1N6LA 3H2YA 1QHGA 2IXGA 2F1HA 2H92A 2Z43A 2FSGA 4MUBA 5CK4A 1P7CA 1SVMA 1NLZA 3KKNA 1NP6A 4L5BA 4C0QC 3THXA 5KHOC 4UXJA 3ADDA 5K8UA 3FVQA 1FP6A 3BJIC 1RJ9A 4A8JB 1OJLA 2BMFA 2JAQA 5J4VA 1TEXA 3V4RA 2V7QD 2ZREA 4TQAA 1S1CA 2ANBA 3X1XA 1P9NA 3MGCA 2GBLC 2C98A 1VYUA 2WM9B 1EGAA 4GMXA 1TQ2A 3FFBA 3K53A 3RS7A 2QUZA 3TUJC 2VSFA 5B30A 3QXJA 3RYTC 2PCLA 3TRFA 4PHHA 1FTSA 3KJIA 1GRNA 4ZIRB 2IF2A 2AFHE 1MO4A 1LS1A 2XX3A 5L3SB 4IW3B 1OH6A 1JR3A 3U44B 4C2UA 1LW7A 2YINC 4XOIA 3O8RA 5SZHB 4TYWA 3CRQA 3U4QB 2ZR0A 4IDHA 5CLQA 2NZJA 4JSYA 1BO6A 2VHQA 3ZZTA 5JHHB 2YOHA 3QKRA 1KHTA 2N1BA 1YZLA 4QG7A 4F91B 3GLFA 2F1RA 1WDTA 2IS2A 2WIAA 2WWYA 2YWFA 1I2MA 3QVUA 1TF7A 2RGXA 3BBPA 3SBDA 1PUJA 4DB4A 2BMDA 2I4IA 1XZPA 2CJWB 3K09C 5HTKA 4ERNA 1IONA 3OEHD 1II8B 5IRCD 2ZI6A 2ZQ5A 1NMYA 3K0EA 2IT1A 3GJ6A 3MAAC 5CM9C 1UEIA 4GNKA 1FOEB 2NOAA 1E9DA 2WWGA 4POAA 1E9RA 2G3YA 2R6GA 2V7QA 5AUOB 1T5IA 3NEYA 1XP8A 2BMEA 4I1SA 3MMPA 4M1WA 1UPTA 2ZITA 3KFVA 4Q66C 3MJHA 1NVVR 4QGHA 3SQXA 5LBIA 2ORIA 4EFNA 1S9DA 2VP5A 1JQLB 2NO1A 4QM6A 3EZ6A 4TZ0A 3CF2A 3P26A 4AKIA 2O8BA 4OKSA 3IGFA 1KNXA 4HI0E 4LJ5A 1LS6A 2CCJA 4B34A 3UANA 3QNUA 1XBTA 4RD3A 2IWHA 2FSFA 5FBRB 1Z5ZA 3W8RA 3MWYW 5GJVC 5AUNB 2GESA 5ANRB 2ZM5A 2IYRA 1DS6A 4CEHA 5FH9A 1W48A 1FTNA 1MABA 1F2UA 2J0UA 3E5HA 4ZCIA 4NYMQ 4M1KA 3SE0A 1VYTA 1M2OB 1SXJE 5FUYA 2XTMA 1XCGB 4EAQA 5KUTA 3BFXA 1KAGA 4XVQA 1J2JA 1OFHA 3QF4A 4Q01A 1G8PA 5F2EA 1OH8A 3TH5A 1JECA 1RKBA 3VHLB 4I99A 1TTTA 4AYWA 3TAUA 2ZYWX 1QHSA 4CEJA 3KQLA 3IUYA 5JWHA 1UKVY 3O8CA 3FDIA 3NHBA 4CGZA 1P3JA 3PIRA 2VF8A 3OEHA 4RZUA 2IUUA 1P73A 2B8WA 4D82A 2IX3A 2AL7A 1SKYB 4Q7MB 4OK6A 2W2TA 3QIAA 1M34E 1E1QD 3W8NA 1S96A 4W9MC 1NN1A 2QTFA 1RYFA 1Z2AA 2OBNA 1R5NA 4MGIR 3LX5A 3OIUA 4Q1FA 1A2BA 4ZDJA 5JLJA 3D7MA 1G18A 1P2SA 2ORVA 2YNMA 1IXSB 1WF3A 3QF7A 4MRRA 2PT5A 1KO4A 3X1WA 4X8LA 3K70C 1E9BA 2H57A 4KYIB 2AR7A 4G5OA 2VL7A 4IEIA 3SHWA 1Z6XA 1Q21A 2ZEJA 4JVSB 3PR1A 1T91A 2A3RA 2BKEA 4LHZA 4LOAA 1WMSA 3U7HB 1L2TA 1Z47A 5TDHA 4BEJA 2Q9CA 1I4DD 4TLBA 4MDFA 3TR0A 4DBLC 1D8TA 4PPNA 2EQBA 2W6IA 2Z83A 1R8SA 4V0OA 1F60A 3P32A 5FR1A 4NP6A 4EIWA 1E0KA 4M9SA 5FOTA 3T12A 4DDUA 2FZLA 4R71A 1E79D 1GUAA 2A7QA 3ADCA 521PA 4EJSA 2J7PD 2GCOA 3LBNA 3TGPA 3DM9B 5CDFE 5JRZA 1E32A 3JZMA 4YXWA 1T9HA 4UNPA 4Q9IA 1IQPA 4EQ6B 2K5UA 3KB1A 3B6EA 3T5GA 1E3MA 4PR0A 1T8UA 2PX0A 1G291 1ZBDA 4HB4A 1E2NA 4PPQA 5EP1A 3SFZA 5A0FA 4IFBA 1KI1A 4L4UA 4CDGA 2Z5FA 3LXRA 2RGNA 4A0RA 3PENA 1P4SA 2LWIA 2W2VA 1Z08A 1CRQA 1XMIA 1L7VC 4G5SA 1W0KA 1HY3A 3FHOA 2J3EA 4GOJA 4KVAA 1LF5A 4JJZA 3VTKA 1ZD8A 2HDNB 4M9QA 1ZNZA 3H1TA 5FR2A 3R20A 4HZIA 1QHIA 1RJ9B 2BJWA 1AN0A 1OXSC 1XEWY 4FI3C 1JBKA 5FUVA 1LTQA 3B1VA 1W4BA 4ZI3A 3P4YA 4DSUA 1LNZA 1KOFA 2WWWA 2QSZA 4NONA 2OZEA 2V9PA 1OYYA 3I61A 4EPVA 2H5EA 4AKHA 2WJGA 3SN6A 1G5PA 3FTQA 3PUZA 2W6JD 4DT1A 4GI7A 2VRWA 4PSVA 2WWIA 4A36A 4DLWA 3JVUA 1Z8FA 5KU1A 2H18A 4UXIA 3NH6A 5P21A 5EE5B 2TMKA 1KI2A 3DOFA 1E79A 2AK2A 2D2FA 5JECA 3AVXA 3ZQJA 1E0SA 4LV8B 4Q19A 2F9MA 3SHFA 1NY6A 5H1YA 3AVYA 1A4RA 2ZJBA 3QEOA 2ZE7A 2G6BA 3IIKA 3OAAD 3QSYA 1IN7A 2FDCA 4IDNA 4NCJA 1X6VA 3GLFB 1J99A 5F3WB 1CU1A 4GPTA 3GJ0A 4K46A 1EFRA 3NVAA 4HAXA 3AEZA 5FUXA 1XF9A 4LRWA 2JLRA 3KJHA 1ODFA 2F1JA 4EFLA 3THYA 2XOKA 2ZRNA 3SJCA 3R7WA 1S3SA 1UBCA 1IJEA 2KBFA 4C2TA 2FGKA 2G1KA 2NPFA 4HAVA 3LQQA 3AVOA 5J4YA 1ELOA 1PVOA 1JXMA 1XD2A 3HWSA 2BKUA 3RVBA 2OILA 1IJFA 2BC9A 3DL0A 2XTNA 3FWYA 4EPRA 1WE2A 4LK2A 1H8HD 2QPAA 3ZZUA 4P4SA 1DAKA 2GK6A 1YZKA 2ZU6A 3FMPB 4RSGA 4UJ5A 4DEXA 5J4HA 2XZLA 1V43A 5HCIA 4JLJA 1T6NA 3QKSA 2OHFA 1MO5A 1IOZA 4ARZB 2O8BB 4DC9A 3IBGA 4KHZA 4QNMA 4K8OA 3RHFA 1U90A 2XNSA 5J40A 4JS0A 3GD7A 2RMKA 4G5RA 4ZDWA 5FPHA 4II7A 1KI6B 1NJGA 3K0AA 3THWA 3O8BA 4KV9A 1PV4A 1SHZA 2IYVA 4DSTA 5C1BA 2C5LA 3A58B 4GDFA 1A7JA 2O8FA 4MQBA 4CEHB 2ZRGA 2J0UB 1MABB 1F2UB 1TU3A 1ONBA 2CHVA 2O0JA 2W83A 3P4XA 4PPFA 3CONA 4OYHA 3OAAA 3L0SA 5BN5A 1X8KA 3GFOA 2QMUA 4XD7A 1U9IC 2WPDA 3CX7A 3TMKA 2IXFA 4BFVA 2ZJYA 2B21A 4DCTA 5JBQA 1G4UR 1OF1A 3RLFA 1JNYA 1R5BA 2O0KA 2VYFA 2O5VA 3MSXA 2R9VA 2ZSBA 3BD9A 4LHYA 4MYHA 4V03A 1Z07A 5LB2A 4AKEA 1ESMA 2CLSA 3AVWA 3DPUA 3KX2A 1CR0A 1CR1A 1JPJA 4OI2A 3CWZA 4DLZA 1HE1C 3LXXA 3THOA 2QU8A 2OG2A 2HUPA 1E9AA 3VNVA 5HCNA 1OW3B 2EYQA 3BORA 4WAUA 4BFXA 3AKEA 3TLXA 1RRPA 1PLLA 3K70B 2FG5A 4C0LA 2NO6A 3TK1A 1KIMA 1H8HA 2CL6X 3BIFA 3FKSA 4OQFA 3T06B 1FL9A 3ETLA 3SR0A 1FNMA 2GEDA 2OLKA 2C2HA 3CB4A 3ADKA 4MKIA 2P65A 4IVRA 4FMDF 2B7CA 1D2EA 3I1FA 5DN6D 5DI3B 3HU3A 3PXGA 2HJVA 4JL5A 2ZRMA 4CIDA 4RKFA 1E0AA 4PTLA 2ANCA 2PLFA 4ZDIA 4RFSB 3TUZC 4MITA 3EX7C 3AF1A 2WOOA 3CO5A 1QHNA 1IN4A 2NZ8A 2QT0A 4LHVA 3WP1B 3NBZC 2MSEB 3IHWA 4LHXA 4D0NA 2ZRCA 4LCBA 4EUNA 4Z1MD 1N6RA 1C1YA 5B58C 2CHGA 1OT3A 3BH6A 4P4TA 1XEFA 5EE9A 1ZRHA 5KPJA 3MRSA 1GKUB 4A0HA 3K9GA 5KDOA 1GL6A 1KSJA 2ASEA 4PPGA 4XSHA 5SZKB 3SNHA 3GEHA 2ZSEA 3WYFA 4BRUA 1UEJA 2ZRDA 4AG5A 2BM1A 4IDQA 2JIZD 4LYJA 2OFXA 2GCOB 2H1LA 1H65A 2AWNA 1VDZA 1LB1B 4A8JA 1GL7A 1NBME 2FX3A 2Z4RA 3VNUA 2CE2X 1KGDA 5IT5A 1E2GA 1ZVQA 1CEEA 4QHYA 4FW9A 1HT2E 1W5SA 1Z83A 2HLDD 2NTYC 2WHXA 3ZD6A 4LJ4A 5FBWB 2RB4A 3EZ9A 5FBLB 3T35A 4DCUA 4FMCB 2FOLA 2BMJA 3LLUA 4RD0A 4WZAE 2YC4C 1R7RA 4FWIB 3TVDA 1WB9A 2KB0A 3WBKA 2JLUA 1WQ1R 1ZM4A 4ITRC 1OPXA 1UKZA 4Q9HA 1MH1A 1E1RA 3I62A 3RWMB 4ZIRA 4RZXA 3SJBA 4PANA 1EX6A 2VP0A 3C14C 3AKDA 4YONB 2IHYA 2VQSA 1OXXK 5L3SA 4B2PA 4D81A 5HE8A 4OL0A 2J9RA 4KSBA 4D6PA 3U4QA 1MOZA 1HH4A 1LFDB 1XXHB 2IS1A 2JDID 4RD1A 2IWRA 4URXR 3WNDA 1YR6A 3GJ7A 3Q72A 4QRHA 1DAHA 3ZD7A 4GBMA 2IYXA 1X1SA 1G41A 2OESA 2J0VA 2HV8A 3LW7A 5BQ5A 4A6PA 4DSNA 4DT1B 2ZI3A 2RAPA 2OCYC 2QEQA 1E2PA 3ZLJA 1K5GA 2CK3D 2A5YB 1YZTA 3AUXA 3K0FA 2KJQA 5CK5A 2Q3HA 2F6RA 4LJ6A 2C99A 1J7KA 4YMVA 1TX4B 1G8FA 1TQ4A 3PUVA 4LZZA 4A2PA 5KSOA 3K1JA 2C9YA 3ZGXA 1AS3A 3G0HA 5F9FA 1E2MA 1U0HC 1XEXA 3EA5A 3MWLA 4AC9A 3EPLA 3LFUA 4C4PA 1IAQA 4PO9A 4BLOA 1G8GA 4LGMA 4GT1A 3ZYCA 2JJ8A 1CKEA 1SVOA 1N6IA 2FWRA 2VHCA 4KBGA 1CJKC 1ZU5A 4RY2A 3THYB 4LPKA 3REFA 4BFUA 4URVR 4TTRA 3AF2A 3DZDA 2FSHA 1GRRA 1E2JA 1UBEA 1S2MA 3LVQE 5AWFC 2VH5R 2BBSA 2DWOA 2XTZA 3AQ4A 2CNWD 3D31A 4XWKA 3EAQA 3KKMA 2PZFA 5JJIA 2J7KA 2ZJZA 3H4MA 5G41A 2IYUA 2WSSD 1X8LA 5KSZA 1DTSA 2EYUA 3EIHA 2J41A 2JDIA 2ZROA 3N5CA 4P4SB 3IPXA 1MKYA 4JKYA 2CCKA 2NGRA 3BOSA 3KFXA 1G4AE 5G53C 3QXSA 2ZUCA 4URUR 3QKSB 5E95A 3NC0C 1KK1A 2RGCA 2F43A 1XTJA 1N0VC 2P5TB 1IXZA 1O87A 5C46F 4IDOA 5AK0A 3SJZA 4NYIR 5D3MB 1ZC4A 3NXSA 1MT0A 4MKHA 3GPLA 2GKSA 2AKYA 2CK3A 3AKCA 3K0AB 3LY5A 5BW8A 3THWB 1R0ZA 2A5GA 2ZRFA 4LDJA 4MA4A 2IS4A 3PV0A 2AXNA 3CF0A 1VKJA 4RD6A 1BMFA 2GVDC 3KJEA 5E3HA 1HEIA 1T0HB 4ESVA 3KKPA 4KXFB 2QTHA 3KDSE 1U94A 821PA 4H1VA 4E07A 2IBMA 3GLIB 1KTVA 3VAAA 3QEJA 2NG1A 4QBHA 3TBKA 4BWYA 3EIEA 1HQCA 1XNJA 4F4CA 2OFWA 5CB8A 2WMOB 1CTQA 1GKIA 3E70C 2RGGA 1NN0A 2QGNA 4Q00A 5FL3A 2IL1A 1XPRA 1F6BA 2GCPA 2JATA 2RGAA 4NCHA 2D4HA 1HYQA 1KI8A 1TQ6A 4BFSA 1QHHA 3WRXC 1SXJC 3A4NA 4WA7A 1R0YA 1H8ED 5JZVA 5TV2A 2GJKA 2IYZA 1FPMA 4TL8A 3W6PA 1U8AA 2ZS9A 2J1LA 4IOKA 2XEXA 2NPIA 3QI2A 3EPHA 2GAAA 1F5NA 1KAOA 3UATA 4TLAA 5CLLA 2GXAA 2ZAOA 3IO3A 5JFGA 3VKGA 3EARA 3C5HA 2WICA 5J5CA 2FE4A 3F3YA 4Q03A 2OO7A 2ZXUA 3KXLA 4BLTA 4F92B 2HXYA 3U3OA 4PX9A 1RC8A 1JR3D 2IF0A 2ERXA 2GJ8A 1IHUA 1PZNA 4LI0A 1KJZA 2H16A 3GJ8A 4HAUA 5KNCA 1KI3A 1DAEA 1KO8A 5FOSA 1DPFA 2BDTA 4M1MA 4RD4A 4C0BA 3B13B 1YR7A 1NI3A 1T3LA 2VA8A 4N0DA 4ZDKA 1G7TA 1VIAA 3CPHA 1T5LA 3NC1C 3QOFA 2WBLC 1DBSA 1EFCA 4WOPA 2L0XA 2QI9C 4FMBB 4TMXA 1CJUC 1MRNA 221PA 2YV5A 3T61A 4HAWA 3O47A 2HT1A 3CRVA 2GBLA 3EPKA 5TVKA 2BHRA 1EFTA 1E2EA 4NCKA 2F9LA 1VHLA 3UPUA 1W47A 1QZXA 1N5JA 1AZTA 1UADA 4PQFA 1FFHA 3WHKA 1TU4A 5BYJA 3CPJB 2DY1A 1XMSA 4B3CA 4L9WA 5CDFA 5GVSA 4DXAA 1TEVA 2PMKA 2WJIA 1TAGA 1WBDA 4KJZA 4QOSA 3RS3A 2MMGA 1H8EA 2Y8EA 1HUQA 4DVGA 1JAHA 1YZQA 5FPSA 3SDZA 4NL4H 2ZS8A 1XWIA 4WXRA 5HKKD 2JLQA 1SULA 4EKDA 4D4KA 5DNYB 1XTRA 1U98A 1J8MF 3A1WA 1KJWA 5DH9A 3NIBA 3R9XA 4JT4A 4LUCA 2ZR7A 1W2GA 4NPHA 1UKYA 5A5GA 2YOFA 3IHLA 2LCFA 4XVUA 5AR1A 5FOUA 1U2RA 3K09A 2HEIA 5HZHA 1NY5A 3U7GA 4WVFA 2E87A 2JLVA 1EWQA 3C5CA 1DVRA 3D8BA 2BBWA 4Q1BA 1E96A 1C9KA 1YE8A 2JJ1D 3P1JA 4Q4HB 1CR2A 4D4MA 2ZRPA 4DLTA 3ONWA 4LYAA 3Q5DA 1UJ2A 1P61B 2EFCB 4PFSA 3W6NA 4QM7A 3PUYA 3IPYA 3W6OA 5TY0A 5M04A 3PFIA 4JLVA 4V0ME 4TYQA 4LJ8A 3K0FB 1Q1BA 4HAYA 4PZLA 2FEMA 1CRPA 2NIPA 2C9CA 4IJMA 1FMJA 4M8NE 4W5WA 1CLUA 1XTQA 2D2EA 2X19A 4TL9A 2QGZA 5CIWA 2FJUA 3FFAA 4B2LA 3K70D 3GMTA 1VG0B 3CNNA 4LY6A 1XEXB 2ZAMA 1Q12A 3A36A 4LBVA 2ONJA 1G8HA 4B47A 1MRSA 1KJYA 2AD5A 1VYVA 3B7GA 3CRRA 4IVQA 1Z22A 4BZPA 1N6NA 5FPYA 4ARZA 3BC1A 2GTPA 3QPUA 1L4UA 3GEEA 2GJSA 2FV8A 4UJ3A 4FN5A 2MSDB 3CNLA 5HKKA 2OE2A 2V55B 5CM8B 2JLSA 1KI6A 1YQTA 3KZ1E 1U8YA 2BM0A 1KK3A 2C96A 1P72A 4LYFA 4P3YA 4BPBA 5EP4A 4D0LB 3NDBB 1N2CE 1A5TA 4KITB 2J5XA 2R62A 1O3YA 1I2DA 1WA5A 1W5TA 1UKEA 2W6ID 1W7AA 3FKQA 4GZLA 1NVUQ 1QHXA 2JJ1A 2PH1A 2REOA 2MSCB 4LSGA 4B3GA 4HSEA 3QUSA 2HYDA 4M2LA 2F43B 3WNBA 3WRYC 4TYNA 2PEZA 4PO1A 1Z0JA 4B3FX 3BB1A 1JAIA 5SZJA 5DHFA 4YXWD 2GHIA 1IXRC 4ASUD 5AUPB 4FCVA 2AHOA 3D6TB 3AVUA 2VBCA 4AYXA 3A4MA 1U0LA 5TB5A 3IO5A 1II9A 1VTKA 3NTUA 1EG7A 1G16A 4KFUA 2BOVA 2FGJA 4G5QA 1QBKC 1XJ0A 1CS4C 2F3RA 4MH0R 3LW8A 1G7CA 1NSFA 1NLYA 1OXVA 1SXJB 4TQ9A 2OV2A 3EWSA 4JLKA 1W0KD 5JI3E 1JI0A 4HB2A 5H8WA 2A2ZA 2P6NA 5JRJA 5DI3A 5C18A 4QC2A 3VKWA 1V5WA 2YYZA 1LY1A 1CULC 5JS8A 2J0SA 2ODWA 3ASZA 2BJVA 1NN5A 4RFSA 3WY9A 2WIBA 4BECA 2ZUDA 4X8OA 1OB2A 5TMPA 1S3GA 1QHHB 2O8CB 4C30A 1XD9A 1UBGA 2VHUA 3BERA 1VCMA 3K0CC 4I1OA 1E2IA 2GWHA 1JXOA 4V0LA 3RABA 3NHAA 1MO3A 2DBYA 3SYLA 421PA 3WXMA 2IW3A 3F0TA 3NDPA 4GSYA 3UWKA 3ND8A 4A0GA 3QXHA 3MLEA 4WZ6A 4B48A 3RS4A 4DRZA 3TAHA 3RC8A 3E2IA 3L2OB 5DI9A 3PJRA 3AP2A 4NKRA 1T3HA 1OB5A 1QF9A 1E6CA 1UBFA 4ASUA 1EESA 1R10A 2W00A 4YMSA 3JZAA 4Q4JA 2JLYA 4Y0VA 1GNPA 1VPLA 2ZRBA 4E22A 4JBWA 4D25A 2AFIE 5JCZA 1EFRD 1T3SA 3R8FA 5E7MA 2VTKA 3ND9A 4OBEA 3V9PA 2O52A 2E1RA 2XOKD 3O8DA 1Z0KA 2X8AA 3L8ZA 1G5TA 3KTAA 4XH9B 3RS5A 3WYAA 2WKRA 2JLWA 5K8TA 4R9UC 5E7JA 1GWNA 5J4LA 1ZJ6A 2WWFA 4B32A 2CLCX 4EPXA 1ZCAA 4A9AA 1G19A 2MMCA 4GMDA 3PVSA 2YZ2A 4ZO4A 1W0JA 5IK2A 2FEOA 3EA0A 1PLKA 3T15A 1JB1A 3DDCA 1GM5A 1NBMA 1XXHA 4HLUA 4I81A 1R6BX 1TUIA 1XTKA 2QORA 5J4KA 2H7VA 4QGAA 4JSTA 1NMZA 1PUIA 4Q9LA 2QNRA 2XJ9A 3WBJA 3CIOA 4S2EA 3CRW1 5B64A 2NO9A 4HUQA 3AB3A 1CP2A 2V4ZA 2Z6VA 1D9XA 1E2QA 1JEDA 3KB2A 3SYNA 1L8QA 4C0AC 3U6BA 2QBYA 1B23P 1OHHA 4HLUC 2RH5A 1EFUA 2YJTD 3I3SR 2VPPA 3LNCA 3ZVMA 1OH5A 2ZU0C 1T4GA 2IYQA 4QGFA 1TUEA 3C8UA 3VU9A 3LQRA 3IKJA 4WW0A 2IUSA 5DSZA 2DWQA 2B7BA 4XD7D 4IXMA 3B60A 3VR3A 2WPDD 4JLBA 5CB6A 2FZ4A 2RKOA 2QMOA 3NBYC 1DO2A 1EWRA 3IDQA 1E98A 1N6HA 3PCRB 3UIEA 2Q0HA 4M1TA 2YOGA 1KI4A 3TJZA 1NIJA 1P2TA 1SVLA 3GFTA 2PZEA 3ZH9B 2D7DA 3DHWC 1W44A 2H17A 4O0MA 3N70A 1IN5A 2QE7D 3I8SA 3WMGA 4C0SA 1VIYA 4E03A 3RWOA 4N3NA 3VR1A 2CVFA 3RS2A 3FKSD 3IILA 1Q22A 1ZU4A 2CHQA 4KYUA 1TADA 2BBOA 5G3YA 3PEYA 3AF0A 4M9ZA 1ZYUA 3EW9A 1D6JA 4URWR 1XJCA 5EE0A 4NYJR 5EXTA 2I1VB 5FL7A 4Q18A 2ZS7A 1U9IA 1HT1E 5D3MA 3CBQA 2IXEA 4TQUS 1M7HA 4EDHA 2LKDA 4HEJA 3ECCA 1NSTA 2GZDA 1XRJA 2P67A 1ZW6A 4NMMA 2QMHA 1P75A 2Q9BA 2UZIR 2GK7A 3KUDA 3AP3A 1G6HA 3PG5A 5LB4A 3GLGE 4TZ6A 3GLIA 1N5LA 2V6IA 3M6AA 2WOJA 4A2WA 4XTCS 1TF5A 2PBRA 2WSMA 4UNSA 3UMRA 4BGDA 2ZE8A 4IFEA 2IYYA 4Q48A 1NRJB 3W5IA 4LC1A 2JJ2D 3CPEA 4ILEA 4PO8A 1QHYA 4Q1DA 2QQ0A 5FI0B 4A1FA 1JPNA 4JBXA 1Z6TA 4G01B 2V54A 4P0TA 1UAAA 2OBLA 3QXCA 3LH5A 2XGJA 4PZZA 1ZNYA 2QROA 3BK7A 2BEKA 2QP3A 3B5JA 2FMXA 2GA8A 1UFQA 4BLPA 2EWWA 2QE7A 3DKVA 3HU2A 4QL3A 1GILA 3AUYA 1S9HA 2YWEA 2C8VA 5FUWA 4A82A 2C9OA 1KY2A 4UNNA 5CYPA 1E1RD 1NL3A 4BUJA 2KI5A 1NVVQ 4ZPXA 4AY2A 3F5FA 4NHOA 4BZQA 2R65A 4CF7A 4JJKA 1T0JB 1K5DA 4BQSA 4BZXA 1Q1ZA 1QVRA 1VG9B 1FX0A 3C4JA 3U7EB 3OEEA 1ANKA 2QT1A 2G77B 3TIFA 1KI7A 1G3RA 2X77A 3QE0A 4UNQA 3RAPR 3U6KA 2DYKA 2DB3A 5KNDA 3LV8A 3I4LA 4A15A 1G64A 2VO1A 1ZD1A 1P2VA 1ZCBA 2XITA 3OIWA 5TARA 3VHXA 3VX3A 3ZS8A 2ZRLA 5CYOA 3Q3JB 5KPDA 3AP1A 1I4TD 4DLXA 3AKYA 4OK5A 2ATXA 2PMDA 3ASYA 4PAOA 3KUCA 4LJAA 2ODEA 1NLFA 1X1RA 2G1JA 2WVJA 3AV0B 1OV4A 3DEFA 2X2EA 4B73A 1D5CA 3TR5A 4PC6A 2JJ2A 1FNNA 4XWAA 4JMPA 2PX3A 4G5GA 1VG1A 1DOAA 3SEAA 5LPNA 1DARA 3RS0A 2O8EA 2YVUA 3VR5A 2ZJOA 1E9FA 1YJ5A 4JVNA 3X1YA 1OE0A 1GRQA 1JQJC 2PT7A 2ZANA 4Q4JB 1EXMA 1R2QA 3KXIA 4H1UA 4PHGA 4TTPA 5HR5A 3KXKA 3LD9A 1RVDA 2WV9A 3RSLA 4Z51A 1FQJA 5C2JB 5JHGB 3EWAA 4MRNA 3X2SA 1ZP6A 3KKQA 3KTAB 1E94E 4UQOA 5GJCA 3K9LA 4HAZA 3U3MA 3WMFA 4QJ3A 5DISB 3IEUA 4M1YA 1KO7A 2AXPA 2E9SA 2A30A 4OHWA 4WXPA 3LRPA 3T1QA 1DAIA 4PHTA 3S1AB 5CIQA 2FH5B 5AJYA 4MKFA 3WHLA 1P62B 1OFUX 5KSYA 5KSPA 5DO9A 4F4JA 4C9BA 3T1VA 5EP2A 4F4IA 3GLHE 1HV8A 1E0JA 2VSOA 1QG2A 1VG8A 2VHJA 2ZRHA 4Q4HA 2HYIC 4R98A 2A9KA 3A1VA 4UNRA 3KQKA 3V00A 2GILA 4OI4A 1G3IA 1YZGA 1AK2A 3CNOA 4HUQB 1IBRA 2QSYA 1XFAA 2PL3A 1BKDR 4NYMR 2GF9A 4QHTA 3J81k 1CBUA 4RJLA 4RZ2A 4NH0A 5EZ5A 4C0JA 2QBYB 1P5ZB 3H84A 4W5JA 1U99A 3I8XA 5FTMA 2H8KA 1BMFD 1SKQA 1W4AA 2WMNB 4BFZA 1AQYA 4DKXA 1TNDA 3HYTA 1RRCA 4MRSA 3VU9B 2GJAA 2YWGA 4B2IA 5JSZA 1TMKA 2F3TA 3VMFA 2SHKA 2I3BA 3FGNA 1M6NA 3QKTA 2BEJA 4IVPA 5IHPA 4B44A 5F98A 1QRAA 1SXJD 4YQFA 3GLHB 1PJRA 1GNRA 4KFTA 2D7CA 1NG1A 2XNDA 4FCWA 2XB4A 1F48A 1OIVA
chains in the Genus database with same CATH superfamily
2BFBA 3QQPA 3NGLA 3C74A 2QZJA 1J0EA 4RYLA 1L4EA 2ZUTA 3HTXA 2XMRA 3L4SO 3NR2A 3M49A 4LTNA 5F5NA 2NVUB 1XR3A 5A4JA 2C9DA 2FUKA 1W59A 2WE7A 2WT9A 1M73E 2P0AA 3L02A 4DTIA 1G63A 1L5VA 1DNPA 3EXIB 3OT1A 3G85A 4L02A 3K9CA 4UPVA 3DXZA 4OGKA 1U1FA 1DHTA 1RKQA 2ZR8A 1SUAA 2R3SA 3C3KA 3DFMA 2VF5X 4R83A 1RAEA 4XLLA 3B1YA 3AZOA 3ID6C 3RIGA 5F7OA 5GINE 2ZYDA 4YECA 4YK7A 4D4IA 2JAWA 1RE0A 2BDUA 1Y8ZA 5IBCA 3FYUA 3LBIA 1Q1QA 2AG5A 3K92A 2JLZA 2FQWA 2X5OA 2VIIA 4I9FA 5BQFA 1W94A 5HWSA 2M9MA 1LF0A 3PC6A 4QQ8A 4HT3B 1US8B 5JV5A 1L5OA 3PD0A 4RHFA 1E9SA 1GZ4A 4QXAA 2H1WA 5BNTA 4KK4A 5BSRA 2IXTA 4F3RA 1NVXQ 4HKTA 4RLFA 1AKMA 1YBAA 4BJ6A 3GPBA 3EZFA 4IKEA 1JAYA 4PLCA 3PHJA 4ROTA 4WN9A 4QOIA 1QK3A 3VSDA 4G86A 1RWWA 3KPVA 3A8TA 3HN6A 4M89A 3DXXA 6Q21A 5MN6A 1V5GA 1NJFA 1MO6A 1GZ7A 2CJYA 3K8ZA 5JMOA 3WYGA 1H0RA 4EGQA 2QJWA 4X8HA 1BYIA 2G0TA 2XWSA 1FLDA 2Z3VA 1Q44A 3FCCA 3OFNA 5H70A 1N7GA 3STVA 3ZG6A 1U0JA 4AZVA 5FOWA 2ZBRA 3I45A 1IY0A 3EVTA 2P1RA 1R0WA 2P79A 4DJTA 4JXZA 2QX4A 5JCJD 4WBSA 4YACA 1DAPA 3CSUA 2JGAA 3URKA 4TXNA 3RRMA 1I01A 1RQPA 1JJ7A 2XDQB 2C82A 3FCOA 5HSGA 3F73A 1Z2CA 1FQKA 4ZVOA 1Q1NA 3H1FA 4HX9A 2VNJA 1AT1A 1TEHA 1XZQA 1YFKA 2H51A 2EJWA 3SEFA 4FCTA 3W6UA 4B0PA 3EVNA 1WW3A 3A4LA 4AW9A 3AWIA 2YWHA 4LF8B 3U4MA 2A6PA 3AY7A 1J8YF 4P93A 3HCAA 1W85B 3KZOA 3VR2D 1NT4A 5GOZA 3DZGA 3ITNA 3IRUA 4NNJA 3QKUA 1ODLA 3KJNA 2OC4A 2XE6A 1QH1A 3FCXA 3GEDA 5MN4A 1A82A 1AUVA 4IXNA 5EE3A 4BO4A 3AIKA 2PIAA 3DNFA 4GOOD 4PYMA 3S1SA 1FDTA 1E8MA 1B73A 1BX1A 2E4ZA 2OSVA 3ZCTA 1CEXA 3PA6A 2QM0A 1SXQA 3K2BA 1GU0A 4F60A 3DKPA 2ADMA 3K0BA 1IWOA 2QYHA 4R5HA 4L75A 2C4HA 4FB4A 5KNBA 1WQ3A 4YRRA 4C21A 2QA5A 3P9RA 1GG2A 3M4JA 1VIDA 4MRMB 4QUJA 2VKQA 4F5ZA 1QIIA 2W2KB 1Z4IA 4CT5A 4ER5A 1DO0A 3A3YA 4F93B 5KB3A 1NYLA 2UVQA 2YWCA 3D43A 2Y67A 3AHJA 5AOVA 5LYYA 1A04A 5KOJA 4RV4A 2ZM6B 1OWOA 2NU9A 1OJ7A 2BKLA 3COPA 4YJHA 3G0GA 5A1JA 5D84A 3TSAA 3LBHA 3KQNA 3ZI7A 3I37X 2WB4A 3KR1A 1VMEA 1H5QA 3RYIA 1BMTA 3CLSD 4ZO6A 4QOJA 4AB1A 3UK0A 5M2QA 4P9NA 3EHEA 5CAEA 2V98A 3ZY4A 4YUYA 2Q9AA 1Q3TA 2D54A 1L5FA 1XPOA 1UFRA 4E1VA 4Y9DA 3NTQA 1PR6A 2D0IA 1N3BA 2TYSB 2G06A 4P08A 1NR1A 3EUAA 2OFFA 3G8YA 3U3DA 3NANA 4FLFA 4CTKA 1EQAA 4TWZA 3W5UA 4EW3A 3JRXA 2O7NA 1A1SA 1M1XB 1SXIA 1YVDA 2CVHA 1MIOA 2GRUA 4GFDA 3N8IA 1PHRA 2DAPA 4O02B 5CGZA 3VR2A 2IA5A 4O0LA 4O2LA 4RSMA 1RHUA 1BOOA 3GYGA 4C6TB 4M4SA 1E3IA 5H7XA 3AJ8A 2O5EA 2VT7A 3GMSA 3GCGA 1EX1A 1FFEA 3GFPA 3MTBA 4UU0A 4AK9A 4ZQFA 2OHGA 3O4IA 1B3RA 4PSDA 3FSRA 3F49S 4HDAA 1B6RA 3VVMA 3JVEA 3TZQA 2YS6A 4U0JA 3T7RA 4D80A 4K2AA 1Y9AA 5AM4A 3M89A 3IE1A 2IS6A 3GVHA 2JAOA 1DBWA 4GYKA 1Z8NA 3C3EA 1X7XB 4R0MA 1KYYA 2HSZA 2WT8A 1HTWA 1G8SA 3CR7A 3OE4A 1A1VA 4DE5A 1D7AA 2QRHA 4PHCA 4BQOA 3RS8A 3H2ZA 4BO2A 4C87A 5AIBA 2CLDX 6AT1A 2LZ0A 3O8OB 3WLHA 5ILOA 4N8DA 3GELA 3H5LA 1Z0AA 2WU0A 2I67A 4FOPA 1GARA 2Q2WA 2R6DA 4QHSA 4V0RA 3V8VA 4AKTA 5K9ZA 5DYIA 3OE7D 1JBEA 1NVKA 2XQKA 3Q8XB 3HY4A 4ZN6A 4FOSA 3GZTB 4BVJA 1R6UA 3QBVA 5A02A 3OOYA 2W58A 2HSWA 3JPWA 3WE7A 3SQMA 1S2IA 5LDHA 4G1CA 2BKXA 4GIBA 2VTBA 3JQGA 3GWGA 3JQ6A 3VFDA 3JVDA 3TF5A 2CLOB 3PEVA 4BO3A 4CJXA 3IKVA 2A4KA 3F6EX 4URZR 2MINA 1JDSA 2H2FA 4LRXA 4OHVA 4ETIA 1IBKB 4TWIA 4AMBA 1B15A 1XNHA 3B3AA 3LCJA 4US1R 4PNEA 3AVTA 3GLFB 3KKLA 2AQKA 2OOKA 2TECE 3BE5A 1XMXA 2GZHA 1DZ3A 2YXLA 1M7BA 1WDMA 3CKLA 4NLLA 4PG5A 4NVRA 4Z99A 3GU3A 4HK4A 5LXTA 3I5YA 1PYGA 1GAQA 2FZ5A 2C31A 3PX2A 2H29A 3V8RA 4L4ZA 4R2IA 4NQRA 3RVMA 4H17A 3DE2X 2XKBA 3K4HA 3PD1A 3WNZA 1XKLA 4KCGA 1AUQA 1D1PA 1C7RA 1ZMOA 2BLLA 2R00C 1M6YA 1T3ZA 3EEIA 4FGJA 4MRVA 3ANYB 1Z0IA 3OHSX 4XIFA 3RVJA 1BOFA 5DYTA 4ARAA 1NQOA 3B78A 4OJQA 4EEZA 4IDGA 1ORWA 3LLSA 3RCBA 4UASA 2E0IA 1A9QA 2ZSJA 3ONFA 4G4GA 1RLMA 5TR9A 1WUHS 3M9XA 3ZLVA 3M2TA 3X1ZA 4BEVA 5LA6F 3VPSA 2R2AA 4M53A 1UC9A 4FGWA 1XJQA 4YALA 5BVGB 2QD5A 2ATCA 5J63A 1GEGA 1Q7CA 1V7ZA 3B85A 3K05A 1VRWA 2QTGA 4EY6A 2XWJI 4CDMA 1I0LA 4HMPA 2JVKA 3CUEF 2EKLA 1SKYE 1TA4A 1VFPA 4IV5A 4LZAA 1AU9A 4Q05A 2QOEA 3QENA 2MYTA 4UVIA 2PZLA 5KO2A 1ZIPA 1FPQA 1M0WA 4MHTA 2FDRA 1ZCFA 3OE7A 4OP2A 4B3XA 4PXAA 4BLSA 1AX9A 1GQ2A 2QTWB 3CB2A 3GJ3A 2Q1XA 1QXSA 1Y5MA 2AC4A 2W48A 1VDMA 1QZ3A 2DJIA 3CX8A 3ENNA 4BP9A 1N75A 4B75A 3K6KA 3TD9A 3E6AA 2C42A 4AWBA 3USCS 2P9BA 2FEAA 5EVCA 2NYAA 3MYRA 3UQZA 1F6DA 1ULSA 1P0PA 1TOAA 3BIOA 1AUOA 2FG7C 3HDGA 3HKCB 3LGAA 4IQ4A 4BWFB 3GLGA 2VXBA 5G1NA 3K2IA 2NT3A 4EUFA 4GLLA 3LQYA 3GJQA 4CNBA 3W90A 1IK6A 3GJYA 4RBNA 1THMA 5FNVB 2QZPA 3ISJA 3OQ6A 5IUKC 4EG8A 4RTPA 2HEGA 3COJA 1H2AS 4EO9A 2R8RA 2HJGA 1W0JD 1T26A 5IK2D 2DBVO 4X65B 2PSHA 3A6PC 3VOBA 1XCJA 5EJEA 1OQAA 3T5TA 5IU6A 2JVIA 3S5UA 4PAQA 3HZOA 2I8AA 1UQRA 2EATA 3CWQA 4EABA 4ACBA 3U4AA 5ARBA 5AVQA 1ZZGA 1M2KA 2PWAA 5FV7A 4EMUA 4HNVA 3T5PA 1J0CA 2GUWA 2NYRA 1XB2A 1GDDA 3KKKA 3G2IA 1PZGA 1T2EA 2JL1A 5IUJC 2JHCA 3IODA 5C1IA 4MVJI 5JS7A 2Q3DA 2X4IA 1B00A 3AFIA 3GB9A 4MGYR 4I7EA 1HRDA 1JJVA 2AIRA 4M38A 5GIPE 5ITVA 2IJGX 1V0JA 1WCXA 3CISA 4P2BA 5KOIA 1OHHD 1PDVA 2FZCA 3BH7A 1NQTA 4JC8A 1H22A 4U9HS 3WNCA 4MLPA 3OU6A 4ZRDA 2XCUA 5CDSA 1E64A 3QXXA 1TO1E 2VXCA 2OAEA 2YASA 4AF6A 4S1WA 5B7QA 1YRAA 2C4VA 1KPHA 2UVPB 1NZDA 1NZFA 4N0EA 2CNKA 4OREX 2IEYA 2YNMC 4YMHA 1V8ZA 1ZOLA 4IHQA 1RKUA 2BV3A 2OP0A 2BKAA 1NJ6A 3L6EA 5EHXA 4LYEA 1N25A 5CEEA 1I3KA 2FUG6 2A9OA 1I24A 2P3QA 2QRZA 1UWLA 4Y2VA 4E7OA 2AEEA 5AVUA 3NMUF 4HQ6A 4M22A 4Z7OB 3K96A 4DLRA 5LU8A 4C4SA 5JVDF 1GFIA 5KJ6A 5CLGA 3NH9A 1QNFA 1VLHA 3C8HA 4M9XA 2FF5A 1QFMA 4X5OA 2ZK7A 3HUTA 1VPDA 4XTRA 4QLBA 4WK4B 4PFJA 2P5UA 5GIOE 2VHTA 4W99A 1L3BA 2VDPB 3GA5A 5HK8A 2C9BA 2WJHA 4IMIB 4V1CA 4M7PA 1HFJA 4ALLA 1LC0A 5JWOA 2EGGA 3D2LA 1XK7A 2QLLA 4YMIA 5EWMB 2EZUA 2QMZA 2F90A 2YQZA 2DUNA 3JVIA 3L6UA 3NIDB 2XE7A 1RM0A 1SHKA 5KYKA 3DO6A 1DKOA 4DIDA 4JP1A 2FOIA 3QM1A 4DIMA 3Q7PA 1NLMA 3C0KA 2QY6A 3NT4A 3MWJA 1P7VA 1WUTA 2QM7A 3W1WA 2DFTA 2YVLA 3FJOA 3G2LA 4EL5A 3BIXA 1Q11A 3ESZA 5KI6A 2EL9A 3E9ZA 5KJ1A 3SPXA 1FP7A 2AZTA 2XB6A 3JQ8B 2GN0A 4IHJA 1XMVA 1SB8A 3K5WA 2GCNA 2QVBA 1XMPA 2IK8A 3ET5A 3ENQA 4ZZIA 3RU2A 2Y2VA 1P4HA 2DRIA 3EMBA 3F9RA 1QANA 1UIRA 4S35A 1UPBA 1IUKA 2EV9A 2YDXA 4ZOEA 5B4VA 1K63A 2EKPA 4Y9UA 1A71A 3F47A 4R01A 1LPBB 5FBQB 1JR6A 1EK1A 4X60A 2JGDA 2QM8A 2FPGA 5DOZA 3OFJA 4ZZ1A 4LDRA 3RKRA 4RK0A 1RRFA 4MJXA 5ECYA 5HS6A 2B2CA 3UMCA 1E18A 1N2GA 2WHEA 3D0KA 2G4VA 1O2DA 2HF7A 5DBGA 4JIMA 4QVKA 4U7TB 3SYKA 1SZCA 2BWJA 5KTRA 2I3DA 3SHQA 4F8YA 4Q9JA 4RKRA 5C32A 3HDYA 4F2PA 2WJYA 3N2KB 4G1MB 4C7OB 4YVFA 5AW7A 2W6OA 1XD8A 3OLXA 3ZHOA 4CKYA 3RAFC 2WYVA 3LTEA 1VBFA 2BIFA 4HRXA 2OOSA 1YFZA 5E4YA 4JP3A 9ABPA 4NF2A 5IJAA 2Y1CA 4JLOA 4O1HA 3P52A 1Z63A 5ER6A 4J03A 3TOZA 1ZAYA 3ZHRA 1GAEO 4M1OA 2AZDA 1O95D 1ZZEA 2I3ZA 2J9FB 2P90A 3OICA 3OJWA 1SIUA 1GCAA 4CM8B 3SJAA 1M1YE 3W2GA 5F51A 1Y8RA 3BSSA 1KYIA 3DKKA 3ITDA 3R2JA 4DDVA 4LDZA 3P0HA 3R3UA 3HM9A 3QLUC 2H1SA 3V8NA 2RI0A 1KMHA 1G5RA 4JOSA 1GUFA 3CLTD 1WP9A 4R51A 2XVYA 3FYDA 4LY0A 3DMPA 1QK5A 3AOEA 1J0DA 5F3DA 3VGJA 5KNBD 1FW6A 2VOEA 5DIFA 1YZUA 4U7GA 2G4CA 2UVDA 3JYLA 1E1DA 5IULC 1F8XA 1QR6A 3QEAZ 5EUMA 1QC5B 3C6QA 3K0SA 1Z74A 1G59A 4J0KA 3ZWDA 4IIJF 4HZUA 1R0LA 2OSBA 1P91A 3GW8A 4NDZA 3D0QA 1ZJYA 4PQGA 4Q7KA 4LNAA 4QOHA 4UTXA 3ULKA 1BCRB 2ECKA 3IUMA 2BY4A 5TGTA 4NZYA 1AGYA 2W6JA 4RMGA 3UFXB 1MEOA 4DXDA 3ORHA 1EXWA 1NWCA 4ZAZA 2ZI9A 2EFEB 2AX4A 3C41J 4PGFA 2GX6A 4DQ0A 3A6GA 1ODCA 2HQ1A 2V1XA 4IJ6A 5EXXA 2MT9A 3KV1A 2YHUA 1Q83A 2YZKA 4NSNA 4PC2A 2YHSA 3EZ2A 5K8JB 1R27A 4ZI2A 1AMOA 1C7EA 2HK8A 5D1HA 5K0EA 1WCYA 2PWYA 2XIJA 3D64A 5TF4A 4GRIA 5BV7A 2ACWA 2EXXA 3SICE 2W9XA 2J3LA 1ORHA 3N2EA 2V6JA 3SI7A 2EC5A 3QYPA 1QIEA 3NNDA 4J0QA 5B57C 3PLRA 4OUDA 3A9CA 3R44A 5CJ2A 3TSCA 4OI0A 1VM6A 3UG6A 2ZJ2A 1EUZA 4AFNA 3A1EA 2B8JA 3OIVA 2JBAB 3BHIA 4QTXA 1DC8A 3Q9SA 1O1YA 3W2FA 4HNUA 4DV4B 3OLWA 3EIFA 4N1AA 3DLTA 4LV6A 3RM3A 1PSZA 1ZWLA 4D0RA 2VTDA 3HU1A 3RV3A 4KLNA 2YWXA 1E3SA 2WWTA 3N58A 1SIBE 4ZCLA 3GOQA 1M6HA 2APJA 5IXYA 3K8OE 2B9VA 3ZX5A 1J25A 5BR4A 4JWKA 3W78A 1DAFA 5AVKA 3ERCA 1YASA 4LGYA 4LECA 4NECA 5TJ9A 3N2GA 4CMGA 4XWWA 3N8HA 3DLBA 4D0GA 3L41A 3MJFA 1IQ0A 4TMTA 4AS2A 3AGQA 4DDWA 1EJ0A 1XZDA 2GXQA 2UZ1A 2NZWA 3MVEA 5J2UF 1UM9A 3REQA 4AYTA 1JU3A 5JS6A 1PU2A 1ZIOA 4I1YA 3BRSA 2YFQA 2C04A 3WIDA 1NW3A 3UMFA 4KQKA 3NZEA 1Q95A 1LBEA 1Y7LA 2KWIA 1P2GA 2NSLA 3FBWA 4MCJA 5EQFA 3FRJA 1SBZA 1UBSB 1B0AA 3G7SA 1Q1EA 3N3BC 5I4IA 1V11A 1WF6A 1NVMB 3TW4A 1X86B 1Q1GA 2ZWPA 1E2LA 1IDOA 1U7TA 2HGZA 2I1WA 4FOTA 4M1QA 4OG2A 3PGLA 1FU8A 2C5HA 2H1RA 1J22A 4BP8A 5KHLB 2R84A 2RH4A 4J49A 2QRPA 4YI5A 1QTIA 2D5CA 3DLAA 2ZIWB 4G37A 5FAKA 3Q5EA 1XNQB 5K8LA 4O59O 2CBGA 3SF0A 3BD6A 4L16A 4EG1A 5K2MA 1OXTA 2ZIEA 3OHMA 2DFNA 2JFVA 1FS4A 5L3ZA 1KFKB 2SKCA 1L6RA 1Z29A 2Q6LA 2GBFA 4M6WA 3TDMA 5M3BA 2I1QA 3KV3O 4UBLA 3IEPA 2XUDA 4Q3CA 3DL4A 3FPEA 5H9VA 1GPYA 1M67A 3H6KA 1Z6YA 3PJEA 4L22A 4RAQA 4GQIA 4NNOA 1E6LA 1L8AA 1ZM2A 1BS9A 4ZOBA 2JK0A 4QGGA 2POQX 3EZGA 1GNLA 1QE5A 3PL5A 5DSTA 3VHQA 2HGSA 3KL4A 3VMFA 3JVVA 4GMKA 1U4NA 4C4TA 4UM9B 4AJ1A 4ENRA 1HURA 3NAGA 1ZINA 4BMVA 2HAEA 1Q0SA 2D5LA 2VP4A 2BN4A 4NZZA 4BJ3A 3VNRA 3IKLA 4PCAA 2BCGY 5L51A 4F7DA 2BYTA 3HJRA 2NXEA 3BMOA 1NGSA 5IAJA 3GP8A 3A2NA 4HWPA 1ETUA 5IKOA 3DUFA 2PU5A 1ZNQO 1PJ2A 2RBEA 3BXFA 1YWGO 2RAVA 4NOJA 4P4NA 1R15A 1N4AA 1M33A 1DEXA 2WWRA 4DIEA 3A70A 1NNLA 4C04A 4EZEA 1E4VA 1X3SA 2PD4A 1K2VN 4ARUA 3CVVA 1MJFA 4C1NA 3L05A 3LCVB 1P5JA 2IP1A 2QN8A 4MARA 3T5MA 4P4UA 4DMUB 4ZJUA 4OP3A 3WI7A 4BMCA 4MQFB 1U4SA 2HSDA 1VHWA 4C07A 1TXGA 1VLZA 5HK9A 4UEQA 4MDEA 2A9FA 1FDOA 4Z4HA 4KQJA 1NU6A 3T7TA 2XQFA 3L7DA 2WZQA 4D2IA 4M37A 5ILGA 1VE5A 3ADBA 1A69A 1I3LA 2EP8A 4HYQA 1E2HA 2IZ1A 4R5MA 3FSJX 1HETA 1R6VA 4QRDA 3ZLTA 2E4XA 3M1IA 3EXAA 4Z54A 5JRDS 3W7AA 1KZ7B 4AY6A 1D4ZA 5BUSA 4TMZA 2CJWA 5C7YA 1XOIA 2BUCA 2Q6KA 4RGYA 1ZLYA 5CXQA 4MHOA 4JYZA 4MUNA 2IHNA 2TSYB 4KFRA 4JT8A 2Y1FA 3H0KA 2IOHA 2Q0XA 4DUPA 3K8YA 2GNPA 2Y6UA 4IIBA 4U2CA 3PGVA 5U4XA 1JALA 1OBHA 2NXCA 5DLYA 5FFMA 3RRBA 3U9TA 4EA6A 1NDQA 1AKYA 5CFOA 1TZCA 3HMQA 2E48A 4KPGA 2HJWA 2LP4Y 2XTJA 4R2JA 4RLHA 2CDCA 3KXDA 3QYFA 4UXHA 2HLDA 3DOCA 2YXPX 3LPMA 3TJMA 5L6LB 2JI7A 3EIQA 1IB6A 4RS3A 1NVBA 5FA8A 1HYBA 4YEDA 3DQQA 1RQ7A 3HCBA 5FPTA 3RVPA 4CHGA 3PNBA 4CT4B 2AN1A 2O5CA 4GOXA 4CLEA 3RFFA 1L8LA 3GLSA 4FFPA 1G20E 3FMFA 4RORA 3TN7A 1S2OA 1KJJA 1NR7A 2E55A 4RULA 2HF8A 3C87A 3ZU6A 1GTG1 2QR3A 3TSWA 5BPFA 2NYVA 3I2IA 1DAMA 4O63O 3QMVA 2NTNA 3KJXA 2VP6A 3OIYA 1XD2B 2Q5LA 3BEOA 4BEBA 4OGFA 3DV0B 2XXAB 3IIJA 2Y27A 4QSMA 1NYTA 3OQIB 4EW1A 3RU7A 4POOA 2OO5C 5FCDA 2VJMB 3CH4B 3GLIE 3ZGOA 4BUCA 2R6ZA 4DWVA 4WJLA 4N7MA 2CJFA 2HREA 2ZTVA 3THRA 5HIKA 4KAFA 3HB7A 3W4KA 1RHJA 2O20A 3KOWA 4I9UA 4WOJA 5FTKA 4E5SA 1IBLB 4ZEXA 3UHFA 2VF2A 2Q4EA 4QTZA 1YKFA 3BKXA 1F0KA 4WI1A 4H16A 2RHBA 4ZO7A 3MCAA 4YMUA 1Y1QA 2Z5LA 4WZBB 3UBTA 1UJ4A 5EIAA 4NCBA 4CQLB 2RGWA 2AGVA 3MGGA 2VZEA 5EKUA 4MW1A 4XDGA 4C2AA 4BB6A 2CXQA 4B84A 2CMKA 3DMRA 3TD6A 4WX2B 1M2VB 1MX1A 3GEMA 4EEKA 2WJVA 2O8FB 5HKOA 3QVGA 4E2FA 1MZPA 2X2OA 1PWEA 2F8TA 1KO1A 2PM8A 2WHYA 3L8EA 3E7FA 3ZCVA 4V3BA 3DHEA 1FUKA 3R23A 2G5PA 4L8GA 1NN3A 2KW5A 4J3NA 3EFOB 3IUSA 1WCIB 3X2FA 4TYMA 4YRKA 1ONPA 3ZU5A 1LJ8A 2DUJA 2XNCA 1QVWA 2O50A 2AOTB 3DHVA 4GEKA 4P2GA 5FAXA 5T5QA 1FSPA 3MJRA 3I42A 4UHFA 5BV2P 4IDPA 1EK0A 2B35A 3BULA 3BJZA 3L9XA 3R6WA 4B9EA 4CBVA 5KQRA 4KI0A 3BXHA 2JEYA 3WGJA 2BHNA 1Y4SA 3I32A 3CCFA 2CL0X 2EFDB 4OLBA 3HBAA 3LT2A 4F3TA 1KDTA 2P9GA 2FPIA 1C4XA 1KZGB 3RUCA 3WAKA 1E5QA 2GF2A 3A31A 4NR0A 3FMOB 1MFPA 2HHHB 1T1RA 3Q3EA 1I3CA 3AK4A 1XLUA 1AKQA 4RVCA 3SKVA 5BN4B 4JL8A 4KQCA 1F5SA 1OIWA 1CUJA 2AKAB 4EX7A 4KR3A 2LUOA 3GCDA 2P4HX 4D4LA 3EAGA 4UKDA 1MJGA 2AQ8A 1NQAO 2NU8B 2M1XA 3NM4A 4FXOA 3C16C 1HZZA 2ID4A 3IBFA 3G23A 3GH1A 4K3UA 5FP0A 4CUZA 1VCNA 1YOVB 1WB5A 3LL7A 2VWGA 4TT3D 4YRSA 5DMXA 1DADA 2FPUA 4ND6A 4NOMA 5C5IA 4TRRA 2OGSA 1K2WA 4ML3A 1YR1A 4A92A 1YZNA 3PC8A 4RANA 3A9SA 1RP1A 1C4WA 5JE8A 3ZWQA 1I2ZA 1DJMA 4FDMA 1CX9B 2XGSA 3HNOA 3L46A 4BKOA 3O0DA 3OKFA 1F7VA 3FETA 4F2GA 1P0FA 2GR9A 3TTSA 3WZ2A 4RFVA 3ZJYA 1R74A 1XU4A 3FZQA 3GP3A 3KVRA 5DYGA 1Y3BE 3AEYA 3DSRA 3JD4A 4NH4A 2GNOA 3RDPA 1GU7A 4UBKA 2N47A 4UHJA 4EELA 3Q8MA 2PX4A 1AKNA 1WMFA 3LIIA 2R2GA 4D3XA 1GDTA 3IB3A 1UOPA 1ZIXA 3P96A 4ND7A 4YRLA 4MUBA 2AFIA 4B82A 2YHBA 2ILVA 4DBVO 3O7WA 3AMVA 3KKNA 3VC2A 2Z8YA 1B43A 1ONOA 1KZHA 4C0QC 1G8AA 5KHOC 4UXJA 3HXTA 5K8UA 3GN2A 1CDDA 3AFNA 3TECE 5I5GA 3CLKA 1SKMA 3HO1A 2GN6A 2HHCA 2IU4A 2ZREA 2ZBDA 3V32A 4UUOA 1EBBA 6ADHA 4I50B 4TQAA 5ALEA 3NTVA 4K9KA 2QI9F 2OR3A 3A3KA 4REQA 4WEQA 2FQ1A 5SY6A 3WB0A 1GPAA 1UXHA 5U1PA 2I33A 2D1RA 2VP3A 2WM9B 5EINA 3AC0A 5CGQB 3FFBA 2G72A 3GX1A 3K53A 3V55A 5AXBA 3BZUA 4HJRA 1C0PA 1OUMA 3JARA 3FSGD 1ZHOA 2D4AA 4OQDA 2Z9DA 4WQMA 2FW9A 4MIEA 4M9RA 3H2KA 2GEFA 4PU0A 4GM4A 3DMFA 3V6MA 2GEBA 4FDTA 1GRNA 5HJ5A 3MSCA 1GG8A 1CHNA 2AMJA 4G0PA 4UDNA 1CIJA 3GZJA 3Q6MA 2J07A 4I8DA 1M2GA 1VKNA 1YHYA 1O97C 2XX3A 3G3EA 1P2FA 1SBNE 3OOHA 1JX6A 1LW7A 1RI2A 3AX6A 4G0YA 4HUJA 3GUYA 2BSQA 4G89A 1FFCA 5CLQA 5A05A 3M70A 2GEKA 3ZZTA 4FHCA 2H52A 2ZZNA 1H69A 3UFBA 2FLWA 3K8QA 5B1HA 1T4DA 4GYYA 5DKFA 3CO0S 3EGDA 5K3FB 4M7RA 2WWYA 3HBFA 4GPZA 3GOHA 4QEZA 3NV9A 3PNSA 5IMBA 2ZJ4A 2A5LA 4HWSA 4DMRA 2DTXA 5EHIA 2P2ZA 4FN4A 3Q8WA 3OTIA 4XCXA 4C7VA 3SFTA 3VPDA 1PUJA 3QEBZ 5G4LA 1U2ZA 3FPKA 5JZBA 1N4DA 2JCXA 3ELDA 4U1RA 4LZLA 4I4IA 3VDNB 1II8B 1YI0A 3O31A 1X7YB 2ZQ5A 1X9GA 1UDAA 4AP9A 4EGSA 1IVNA 3K0EA 1Y1SA 1SA0B 1ZO8A 5IAOA 3QPAA 1FOEB 3F4BA 4POAA 2WWGA 4BY9E 3BMCB 1OT5A 4QXMA 5ARDA 2P9QA 5CX1A 4GM0A 4ODIA 3VYUB 1LLFA 4YDQA 3NEYA 1QE3A 4BMSA 1FQWA 3C3BA 4WY2A 3UJCA 3QUBA 4JI8B 3OF3A 1U7DA 1UPTA 2ZITA 3JRWA 4D44A 1KEEB 2MSLA 3KFVA 4G07A 4ZYYA 5A2GA 3MJHA 2Z6UA 3OE1A 4QGHA 4AZ0B 2FRXA 3PZBA 2ORIA 2HLHA 4TKZA 4O8ZA 3C5VA 1N3LA 3H7AA 5ILQA 3Q15C 5AVJA 4TZ0A 3P26A 4P7KA 5ICCA 3F1KA 1NXVA 1M1YA 3A1FA 2NUTB 5BR1A 1KNXA 1J9GA 4LJ5A 3ASUA 3CGGA 5KEIA 3EK2A 1LS6A 2A3NA 2CCJA 4GUAA 1JYFA 2J09A 3K6RA 3PUHA 2IWHA 2FSFA 4EL0A 4BNTA 2PRSA 4ER7A 3N0TA 3I5MA 2FKNA 4G0XA 2UZAA 3U09A 1WB4A 1BHJA 3KT8A 2C2WA 4LXIA 4ZCIA 4M1KA 1I51A 1W52X 3OH8A 4B6PA 4GUDA 2GD6A 3BPSA 1VYTA 1XCLA 1M2OB 1SXJE 3FXAA 1QE0A 1XWWA 1UMBA 2XTMA 4MR7A 4RQTA 5FUYA 4RTNA 1YT5A 1D09A 1H2YA 1I2AA 5E6SA 5ESWA 1V4NA 3QF4A 4KUGA 5BSWA 3HH8A 2XH8A 2WU3A 4B45A 4IF4A 3ZXUB 2ZYWX 1QHSA 3Q40A 4YPFA 1ZK1A 2PQ2A 1GCGA 1VI6A 3OMWA 4CEJA 1AO0A 4WNAA 3NHBA 3WGZA 4GVPA 4TRJA 5DNEA 4UU1A 2XGMA 4IJWA 4A8PA 1RXSA 4J1NA 2IUUA 4CM6A 1P73A 2Y0PA 4ZYVA 2B8WA 3CE6A 1YXMA 1PT5A 4PAGA 1BXKA 2IYOA 4BS9A 4E33A 4OXRA 4WK0B 5F77A 5HOQA 5LQNA 2IX3A 3TTUA 4DUZB 2JCBA 1TDJA 5A9SB 2JFWA 1B2RA 1JIKA 1G21B 1I4WA 3QIAA 4KLCA 4RX1A 1JUDA 1M34E 5HKAA 4OAPA 4TRMA 5I48A 4MX8A 4U4AA 3IJ5A 1LU9A 1K6JA 3D0OA 1MXHA 3S29A 5B55A 4TKVB 5EIHA 4Z53A 1R5NA 2GLTA 3S2SA 4MGIR 1R9GA 1A2BA 4ZDJA 4R2LA 2RB5A 6REQA 1G18A 4G26A 3TPFA 4ZP1A 4MRRA 3ZWXA 5SY4A 3UMBA 3ZDFA 3CNEA 1XZGA 1ISJA 4Y18A 3M6VA 1AXEA 4TWBA 3O93A 2AE2A 2VL7A 4ZVSA 3OQOA 1Z6XA 2VPIA 3I6ZA 1Q21A 1V4VA 2X9GA 3SBDA 3ZI4A 5MF6A 1P1HA 5IBPA 1T91A 2A3RA 3R7SA 5LP6F 4LY9A 3OKAA 3V5NA 3MT0A 1K86A 3UWPA 5TDHA 4IP0A 4LGVA 3PWSA 4MDFA 1I4DD 1JSRA 1CZHA 2OCGA 2FQQA 3HKEB 1RJWA 4R54A 4RVUA 5D2CA 1D8TA 3WLQA 4N9QA 4DBLC 1O6FA 2CXRA 2EQBA 4PPNA 3RFVA 5CBPA 5ALFA 2UUAB 4YXFA 3F9IA 1DJOA 4HG2A 1XCOA 2PNJA 4EBBA 1NP3A 4NENA 3VH2A 5JIBA 1XLVA 1GT91 3IQDB 1B26A 4EGFA 3T12A 4QWMA 3W8DA 3S99A 3IESA 2BZGA 4R71A 1GUAA 2A7QA 3GVCA 4B71A 4DDUA 1XYGA 3CJTA 4D3ZA 4EJSA 1R8YA 3GN1A 3OFVA 1A88A 5D01A 9LDBA 1O0CA 3N2YA 2ONYA 3HYCA 3RU9A 2G5CA 3T5GA 1E3MA 3ZWCA 4PR0A 2PX0A 3VPFA 2PQ0A 1G291 2D5IA 2PVSA 4LS3A 5JNWA 2H1OA 4O29A 3C5EA 4UZFA 3S4YA 4PPQA 5EP1A 2XDWA 4G4JA 2L18A 4IFBA 1X94A 4Q7EA 3WB2A 2IIPA 3TO5A 4YT4A 1PG2A 1T6ZA 5IT9A 2AW5A 1I30A 2LWIA 2EOAA 2D0DA 5LMCA 1QLHA 1PT8A 2B8NA 5DASA 4GOJA 1LF5A 4FFNA 5BORA 2HDNB 5SYNA 4M9QA 3OA2A 3BDVA 3HGQA 3OZWA 1OD6A 2OWEA 5FR2A 3EXFA 4H77A 4ZGGA 3KVOA 2H63A 1AN0A 3O4FA 4MR8B 1Q84A 4R6WA 4W1PA 1QTQA 2VAWA 1ZR2A 2QW0X 4ZI3A 2HRRA 1KOFA 4GE3A 2PS1A 5IG2A 1UJBA 1RYZA 5C0OE 4CF6A 4KBYA 1FVFA 1TK2A 3K71B 4QPNA 1OTYA 2H5EA 3SG0A 5KJCA 4KMRA 3HJTA 1A95A 3PKIA 4Q16A 2VT3A 3FWZA 2FP3A 4TXJA 1I2CA 1M2NA 2AC2A 4GI7A 1WZCA 4RIGA 1YK1A 5A71A 2VPQA 4DCPA 4FYVA 3EVGA 1WKVA 4RADA 5JUWA 5KMGA 5BW5A 2VWPA 4UXIA 1VJCA 4I9HA 1DUVG 2NP6A 5DIZA 3RBVA 1GFSA 2RK3A 1VKZA 3OO1A 4MPTA 5ALDA 1QJ4A 2EL7A 1D4AA 3O03A 4DNQA 3ZQJA 4JI4B 1E0SA 3EWNA 3ISVA 4X1YB 1KE1A 5KX5A 3RYFB 3CNBA 4Q19A 4L8FA 2WA2A 4L6AA 5AKZA 2ZJBA 2O2CA 1T36B 2O4CA 4K6OA 4ECAA 2ZE7A 2G6BA 1PEKE 4IUCS 4N54A 3L8CA 1IN7A 3GNLA 4JC4A 4MQ5A 2NSDA 1J99A 1V96A 4QEKA 3QWBA 3KJZA 1PW5A 2WZCA 4GPTA 4L2IA 5A4IS 1WEHA 2QRGA 1F4PA 1XTUA 3AEZA 3H11B 1CQIA 4Y1GA 5A4MS 1XF9A 2FSVC 2JLRA 3A0RB 1X15A 4LRWA 4B7AA 5MFPA 3UMJA 4HDNB 2ZRNA 1UMDA 2FEPA 4D02A 1UBCA 1PFUA 1IJEA 1H4TA 1ZJZA 2KBFA 7ADHA 1CDEA 2FGKA 5JNUA 4OKNA 3OEYA 4R41A 2DUMA 4U9UA 5AXCA 1G0OA 3PHHA 1PVOA 3HWRA 1CP3A 4Z0HO 3PICA 1OU4A 1C1DA 1I6LA 1AZWA 1YBVA 2F48A 3C1AA 1UBJS 2GAFA 3IBTA 4I5FA 3LGSA 5DHTA 1NOJA 4LK2A 3Q8KA 1H8HD 3IXLA 4M49A 4OTZA 1DAKA 5IKXA 3K1ZA 3E9MA 1LZKA 2TRSB 2XF8A 1N9GB 3K31A 3KQMA 4GGMX 4KNVA 5C8YA 3QKSA 3T7JA 3KAKA 2X6QA 4MEAA 5KC8A 1PKXA 3WV5A 1KBOA 4DC9A 2NZ2A 2VJCA 4QNMA 4K8OA 5JJBA 1BQEA 1NV9A 1Q16A 3QVWA 4INPA 4Z4IA 3ENZA 4G5RA 2GAIA 2AFVA 5IC5A 1FFWA 1KI6B 2R8EA 4G5FA 1Z45A 3WK6A 5CB4A 2EIHA 2Q0SA 1Y1RA 3O8BA 1SHZA 2IYVA 2C5LA 1Y9JA 3GT0A 4I55F 2VHXA 2P6OA 4B3HA 3DAPA 4MQ6A 1MABB 1F2UB 2BRUA 4YCJA 3DONA 2HMUA 2CHVA 2W83A 3E0QA 5K6AC 1VGQA 1GTMA 4P3NA 1GGEA 5TPZA 4BBZA 3P4XA 3CONA 4A16A 3DLHA 1XDGA 4OYHA 3LA8A 5BN5A 3GFOA 2WPDA 4CLRA 1OASA 3M33A 3UOGA 4RESA 4QSHA 3TMKA 2ZJYA 2B21A 4DCTA 4UZSA 2X58A 1G4UR 1KJNA 2QVYX 4NJEB 1HLFA 4ER3A 3UAYA 2O0KA 3MSXA 3E7WA 3JY6A 1R9JA 4AKEA 1Z07A 2X1MA 4G1FA 5FBHA 4E2WA