4LZIA

Characterization of solanum tuberosum multicystatin and significance of core domains
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
277
structure length
277
Chain Sequence
GFTEVPFPNSPEFQDLTRFAVHQYNKDQNAHLEFVENLNVKKQVVAGMLYYITFAATDGGKKKIYETKIWVKVWENFKKVVEFKLVGDDSAKLGGIINVPFPNNPEFQDLARFAVQDYNKKENAHLEFVENLNVKEQLVAGMLYYITLVAIDAGKKKIYEAKIWVKEWENFKKVIEFKLIGDDSAIIGGFTDVPFPNNPEFQDLARFAVQDYNKKENAHLEYVENLNVKEQLVAGMIYYITLVATDAGKKKIYEAKIWVKEWEDFKKVVEFKLVGDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multicystatin
publication title Characterization of Solanum tuberosum Multicystatin and the Significance of Core Domains.
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Hydrolase inhibitor
total genus 69
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4lziA02
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4lziA03
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4lziA01
4N6OB 4TX4A 1IV7A 1RN7A 1NB5I 1GD3A 1YVBI 5A0OB 5LC6A 3S67A 1DVDA 1G96A 2KXGA 5ELJA 3SVAA 1A90A 4N6UA 5LC7A 3LH4A 3NX0A 3IMAB 1CYUA 3UL6A 2W9QA 1N5PA 4EYCA 1GD4A 4N6NB 3GAXA 4N6MA 1STFI 2BO9B 1R4CA 3PXMA 3PS8A 3UL5A 1NB3I 1CEWI 2CH9A 2OCTA 1M9GA 4CCVA 1MNLA 1TIJA 2W9PA 3MWZA 1A67A 1N5HA 4N6LA 4N6TA 4N6V0 1EQKA 3KSED 5ELUA 1DVCA 1LXEA 2O9UX 1FA3A 1N9JA 4ZM8A 5EQLA 4IT7A 1FUWA 1IV9A 1WNHA 1MOLA 1CYVA 1ROAA 3Q2PA 3K9MC 1PFPA 3PYJA 1KWIA 4LZIA 3KFQC 3L0RA 3QRDA
chains in the Genus database with same CATH superfamily
2OTL3 4K1VA 1SIHA 5IF6A 1VQO3 1T3BA 2HMNB 1MWRA 1V58A 1DMMA 2W03A 4CDLA 5AIGA 3PGBA 1X1YA 2H0HA 1UCLA 3FH1A 3N9HA 5IG3A 1LRAA 5CLKA 5BVBA 9RNTA 3CME3 5LC6A 1FGOA 2E2UA 3FF0A 3I553 1IVXA 1JN5A 3LT8A 1OF5B 4L8PA 2INXA 3CCR3 1T2HA 1TJDA 3LH4A 3CNMA 3NXJA 2CW9A 5FW5A 3NBBA 2PNCA 2XGLA 3S5CA 3UJMA 1VQK3 4EXRA 2MC8A 1B2ZA 3NBRA 3NX0A 1BSEA 2W0QA 1PY3A 4RZMA 1QAFA 3IMAB 2CC3A 2AAEA 3WOEB 4HM5B 3F40A 1Q42A 5IERA 4HYZA 4R9LA 1UUWB 4O8SA 2BHMA 4EBGA 1UCIA 3HIGA 1ASKA 1GS3A 1UCJA 3B8LA 4MJDA 4EYCA 5IW9A 1RKYA 3S28A 4OVMA 5HGRA 4H61A 2I9WA 3PXMA 6STDA 3U97A 3BNCA 2P0MA 2L1SA 3RGAA 4LSOA 2KAAA 4X2OA 1JKGA 1MGRA 1Q9EA 3ROBA 2BU4A 2GBXB 4XB5A 2O3OA 2YFJB 5G1KA 3K7CA 3T0UA 7GSPA 1I0VA 2WO0A 4NPBA 2GSPA 1TIJA 2XEPA 3LT9A 3MWZA 4FCJA 3X40A 5D83A 3SOAA 3KCHA 1KC84 4H3UA 1N5HA 5AI1A 3V92A 2F4YA 4FMAA 1EA2A 2ZHXB 1GYBA 3HIIA 4PEJA 3JUMA 3ZFZA 2K54A 1OACA 1L5GB 1E97A 3NHXA 1TTOA 1WQLB 1I8VA 2RFRA 1EQKA 3DUKA 4O3VA 3A76A 5FGOA 1DVCA 1JZOA 5CF2A 2QEX3 1Q40A 3CCU3 1Q7Y4 1N8R4 1LXEA 1FYSA 3X3YA 1BIRA 1GY7A 2CWVA 3KE7A 1JV2B 5IG5A 1JBRA 5CK6A 2QA43 1FZUA 1YJ93 2Y73A 1GOUA 3LZAA 3K63A 1BRJA 1ZO2A 2YFLB 2HMKB 1W5ZA 2F56A 4IPBA 3WR2A 4ZM8A 2CK3H 4HJLB 3I563 4STDA 3HI7A 3KZTA 4K61A 1ZS7A 4L8OA 1YIT3 1IT8A 1TU5A 1MOLA 3EQQB 1CYVA 2OQEA 3JUNA 1IU7A 1VQN3 4O02B 4WYKA 1M1XB 1RGHA 4GSPA 3MKIA 3EN1B 3FG4A 4K90B 1RDSA 4WHAA 5EVHA 4BTXA 5AYRB 1JRQA 5IG0A 2W6JH 4HOHA 2CWUA 2F98A 3VF1A 4G1MB 5M18A 1R4YA 5KP4A 1BRGA 2CG0A 3FZWA 3KN4A 4N6OB 1S5AA 2R41A 3D5IA 3AGOA 3OV4A 1GSPA 2BNGA 5STDA 2IYJA 2P05A 5CF1A 1X1WA 3F8XA 1JBSA 3OX9A 3UNLA 1IQYA 2QIYA 5CXOA 2D1WA 2F5WA 2OOVC 4XDVA 3DGMA 3LOYA 3AMOA 2RSXA 3PZWA 1SPUA 1GD3A 4Q53A 1NB5I 3LMLA 1E3RA 1EKMA 1RGGA 3DZLA 2HMMB 3X3XA 1FGQA 1RJOA 1W02A 2C10A 1YGWA 3CPOA 3LTBA 4HM4B 2H0GA 2IMJA 1A90A 3PCRA 2OOVA 3CC73 3J7Yd 4N6UA 2FXTA 5KP1A 1OF5A 5EEOA 1YI23 1KD14 1PYLA 1BVIA 2Z77A 4CJNA 1G02A 2XSHB 1N9EA 4KFDA 3OWYA 3Q1CA 2BT3A 3EBTA 3MYTA 2XR8B 2P09A 4BU4A 1O7PB 2JQ5A 4R9KA 2CWTA 5AIFA 2CG1A 4XBYA 1YGEA 1CYUA 3UL6A 1NWWA 1BANA 1RGCA 3DGNA 1KSIA 1N5PA 4HBRA 2WGQA 1RCKA 4AKZA 3X3ZA 2FGTA 1GD4A 4R4KA 3IPTA 1K9M4 4U13A 1IYYA 1FGMA 1UI7A 1YJW3 5AYSC 4RBNA 2PZVA 3DGLA 5BU4A 2IA7A 1VQP3 1YHQ3 3B4OA 1IT7A 3MSOA 1VQ93 5AIHA 4HM1B 4L7KA 1CEWI 2GXFA 1RLSA 1CH0A 2OCTA 1BRSA 1W6GA 3NM7A 2YX9A 1LOVA 3QK9A 4IIAA 3LTDA 3ALAA 5D82A 2KF5A 4DKIA 4XBTA 4RNYA 4HZBB 3EE1A 5I97A 1ZGXA 4K1UA 4XM4A 3SOYA 1A67A 3KIIA 1RCLA 3OW22 1F8NA 2KRTA 2HMJB 3DH2A 1B20A 1Q7HA 3AHWA 1BU4A 1LQGC 1JBTA 5D81A 3BLZA 3DXOA 4N6TA 1W6YA 4J8TA 5M1AA 1MWUA 3F7SA 1M904 3RGRA 1BRNL 2LQVA 4FCZA 3U1WA 2FNQA 4EV5A 1BNEA 3KSED 5ELUA 4KFFA 1JJ22 5JPUA 3G0KA 4HM8B 1YIJ3 3HK4A 1RNTA 4EV2A 3DMCA 1BRHA 3CPW2 4MMXB 3NV0B 3OWUA 1AV4A 3Q3FA 1VQ83 3ZG0A 4EW5A 3D3LA 1G0TA 3N8BA 2O9UX 1U5OA 1LOWA 5GSPA 1MWTA 3BNBA 1RMSA 3VSYA 4BL3A 3SEDA 1QALA 4WFOA 4I5QA 5EQLA 5KP3A 1N8QA 1O7HB 2BMQB 3PCSA 3CXC2 1D6ZA 1WNHA 2AADA 1BNRA 4BIRA 1ROAA 1HZ1A 2SARA 1ULJB 3JVCA 4J5GA 3WOFB 1W00A 1JN5B 2P0XA 1RGAA 1I2GA 3ZG5A 1PFPA 3CCL3 1W01A 2CFDA 2ZL8A 1K41A 3GZRA 4HM7B 1Z1SA 3PYJA 3EB8A 7RNTA 4J5KA 4QWTA 1KWIA 3OWSA 4NHFA 5DREA 1QMAA 3H3HA 1BNIA 1RGKA 3KFQC 3V98A 3QRDA 1IK3A 1BNFA 1QAKA 7STDA 2KCDA 1RHLA 3SXXA 2SBLA 3FF2A 1E3VA 2Z6BA 3WDGB 1AVLA 4TX4A 1UI8A 3F8HA 1VQ63 3FCSB 1B2MA 2UGIA 4HVNA 2Z7AA 1SQWA 1RN7A 4WWUC 2IUKA 1UGHI 1GY6A 1AR0A 3E99A 3ECFA 2M7OA 2XH9A 1HKXA 1PU4A 2RGQA 1I3FA 4FMCA 4MMYB 3DGYA 1I0XA 4CPKA 4LGQA 1G96A 1C54A 1JKGB 3SVAA 1O7NB 1I2FA 5JBSA 2ML6A 1DMNA 3MG2A 3I0YA 1YJN3 5AEUB 3GZYB 1OGXA 2B1XB 1BUJA 1W2B2 3G8ZA 4LEHA 3D79A 4R80A 3Q90A 2HOHA 1A2PA 4BTYA 2B24B 1FGTA 1GMPA 1TP6A 4JF8A 1US1A 3CC23 1BNSA 1BNJA 1UDII 1X1XA 5IENA 1OCVA 1U8CB 2CIUA 4HM2B 3CU3A 1DYUA 3G16A 2BO9B 2CX0A 2W56B 3FGYA 1M1K4 3FG3A 1JB4A 1EEJA 2F99A 1NB3I 2C11A 2K0MA 1FW7A 3HOHA 1BRKA 1SIIA 1O7MB 1GOYA 1BSBA 3LYGA 1UUGB 1Y4KA 1GY5A 1FUTA 1JB2A 1MGWA 2KF4A 1CQSA 2XFTA 3FSDA 4CCVA 2R4IA 4OUQA 3SLUA 2V1LA 4HZ9B 3GZBA 3WODG 2E2VA 5IEOA 1OPYA 1KQS2 2RCDA 2CFKA 3SYUA 1IVWA 3GZXB 2KF3A 4KVHA 4N6LA 1QVF2 1EG9B 3GRDA 3OXAA 5G1LA 1OUNA 1AVKA 1O7WB 2D42A 1IQ8A 5IEPA 1BSDA 2CFWA 3AGNA 3EX9A 1W6CA 3WHOA 3DM8A 1Q814 1OHOA 3LTCA 1HYFA 1B2SA 1LVNA 2Q07A 3F7XA 4FMDA 1NJI4 2HMLB 1JZDA 1SJWA 3CNXA 3D5GA 1FUSA 1WMPA 1RN1A 3NQZA 1VZZA 5AEWB 1VQ43 1RN4A 4EC6A 2MF7A 1D6YA 3EF8A 6RNTA 1W4NA 3S27A 1N9JA 2C4BA 3KKGA 1B27A 1V57A 1UUVB 3RDEA 2GEYA 4KZ1A 3EHCA 1Q824 3MG1A 3FLJA 3AMOB 2RNTA 2UX0A 1IV9A 2WOHA 4GB5A 4XBXA 1BRIA 3EJVA 1B2UA 1BUQA 1EUIC 3FG1A 4J9AA 1T2IA 1OHPA 4AKYA 2GBWB 1TRQA 3NBJA 4HKVB 3CCE3 3Q2PA 3K9MC 4MEIA 1FGRA 1DETA 5TGNA 3X41A 8RNTA 3NM2A 1BSAA 2W04A 5DRVA 5BXQA 1YVSA 1QJGA 1UW1A 1WMNA 3URPA 3UB1A 1BNGA 2RBIA 4HM6B 3T8NA 3ER7A 3JUPA 1RNBA 3L0RA 2XRXB 3BIRA 2GU3A 8CHOA 2CFGA 1K8A4 1VQQA 1X1UA 1GMQA 1VQL3 3FKAA 1AQZA 4X2HA 3CD63 1IDPA 2UUGC 3BB9A 4HM0B 1IV7A 1UCKA 1W7CA 3V99A 3MG3A 4ILFA 1YNVX 4KT3B 1BGSA 4ORLA 1YVBI 1RTUA 4FR9A 3T8UA 3F9SA 1C7HA 5A0OB 1IVVA 4LMIA 4GL6A 1T5YA 2JDIH 5G2GA 4HAAA 3S67A 4BL2A 1DVDA 2CFLA 3SX1A 1LQMB 2KXGA 4FCMA 4MMZB 5ELJA 1S723 3CMA3 5LC7A 5JPPA 1JB5A 3B4PA 3O8YA 1ROVA 3WA3A 3VGNA 2ZDJA 3DGOA 3M8CA 1W2ZA 2CX1A 3NQYA 1J2BA 1NU3A 4O2HA 4XDWA 1IQXA 1ZX2A 1B2XA 3N54B 2IUJA 1K28A 2GEXA 1GMRA 1JNQA 2KF6A 5BIRA 3EN8A 1NDOB 4AEQA 2W9QA 2L4VA 2J8XB 2A15A 4BTWA 1NNVA 1OHSA 1I2EA 2OWPA 4N6NB 1K734 3D4AA 1BSCA 3GSPA 3GAXA 4N6MA 3G4S3 1STFI 2QGUA 1R4CA 1SARA 3IJEB 3MHEA 3NUVA 2W56A 3G6E3 4FMBA 3CCM3 2XF3A 3PS8A 3UL5A 2K3DA 2YFIB 2ML5A 4HM3B 4LYLB 4RNTA 5AIIA 2STDA 1VQM3 3GWRA 2BMRB 3BU4A 1TRPA 1GOVA 1LOYA 2CH9A 4GHOA 1B21A 4N3VA 1M9GA 3HX8A 1QVG2 5HOHA 1MNLA 3CCQ3 2OQEC 2XSOB 3A5EA 1WTHA 3DY5A 3JUQA 1RRLA 3LTAA 1Q864 2W9PA 3K0ZA 2BMOB 6GSPA 1UGIA 1O7GB 3TDGA 1DE3A 2Y74A 4OK0A 4WP5A 1B3SA 3BNEA 1OH0A 2XGNA 3BNDA 2XFSA 3D9RA 3MPHA 1ISKA 1D6UA 2CKFB 4KFEA 4N6V0 1WMOA 1AY7A 3WA2X 1LNIA 1TFKA 3G713 1BAOA 1TFOA 1DMQA 1RGEA 1I3IA 1MWSA 1RGLA 1HU9A 1Q40B 2GU1A 3RNTA 5RNTA 3CCV3 1VQ73 2OTJ3 1ULIB 2ZA4A 2H0IA 3LXUX 3CCJ3 3X42A 3KSPA 3HZPA 4I4KA 1VQ53 1RRHA 2F5MA 1OGZA 3B7CA 2CHCA 3WMDA 5M19A 3CC43 1IVUA 1FA3A 1BOXA 1V74A 1STDA 2LYXA 4RNZA 1A2KA 2WGOA 3JUOA 3EC9A 4IT7A 3S29A 1FUWA 2BIRA 1LNHA 2HMOB 1A2VA 2P38A 2IY2A 4JRFA 2W2CA 2F86B 4R1KA 4WYKB 3K5TA 5IG4A 1RSNA 3STDA 3AHSA 3EBYA 2E2TA 1TUHA 2WOFA 1LOXA 1RGFA 3H51A 1I70A 2Z76A 1NO3A 3F14A 4NREA 4LZIA 3NV0A 3CCS3
chains in the Genus database with same CATH topology
2OTL3 4K1VA 1SIHA 5IF6A 1VQO3 2HMNB 1DMMA 2W03A 4CDLA 5AIGA 3PGBA 3FH1A 3N9HA 5IG3A 5CLKA 5BVBA 3CME3 5LC6A 1FGOA 2E2UA 3FF0A 3I553 1IVXA 1JN5A 3LT8A 1OF5B 4L8PA 2INXA 3CCR3 3LH4A 3CNMA 3NXJA 2CW9A 5FW5A 3NBBA 2PNCA 2XGLA 3S5CA 3UJMA 1VQK3 4EXRA 2MC8A 3NBRA 3NX0A 2W0QA 4RZMA 1QAFA 3IMAB 2CC3A 3WOEB 4HM5B 3F40A 1Q42A 5IERA 4HYZA 4R9LA 1UUWB 4O8SA 2BHMA 4EBGA 3HIGA 1ASKA 1GS3A 3B8LA 4MJDA 4EYCA 5IW9A 1RKYA 3S28A 4OVMA 5HGRA 4H61A 2I9WA 3PXMA 6STDA 3U97A 3BNCA 2P0MA 3RGAA 4LSOA 4X2OA 1JKGA 3ROBA 4XB5A 2GBXB 2O3OA 2YFJB 3K7CA 3T0UA 2WO0A 1TIJA 2XEPA 3LT9A 3MWZA 4FCJA 3X40A 5D83A 3SOAA 1KC84 4H3UA 1N5HA 5AI1A 3V92A 4FMAA 1EA2A 3HIIA 1GYBA 4PEJA 3JUMA 2K54A 1OACA 1L5GB 1E97A 3NHXA 1WQLB 2RFRA 1EQKA 3DUKA 4O3VA 3A76A 5FGOA 1DVCA 5CF2A 2QEX3 3CCU3 1Q40A 1Q7Y4 1N8R4 1LXEA 3X3YA 2CWVA 1GY7A 3KE7A 5IG5A 1JV2B 5CK6A 2QA43 1YJ93 2Y73A 3LZAA 3K63A 1ZO2A 2YFLB 2HMKB 1W5ZA 4IPBA 4ZM8A 3I563 2CK3H 4HJLB 4STDA 3HI7A 3KZTA 4K61A 4L8OA 1YIT3 1IT8A 1TU5A 1MOLA 3EQQB 1CYVA 2OQEA 3JUNA 1IU7A 1VQN3 4O02B 4WYKA 1M1XB 3MKIA 3EN1B 3FG4A 4K90B 5EVHA 4WHAA 4BTXA 5AYRB 1JRQA 5IG0A 2W6JH 2CWUA 2F98A 3VF1A 4G1MB 5KP4A 2CG0A 3FZWA 3KN4A 4N6OB 1S5AA 3OV4A 5STDA 2BNGA 2P05A 5CF1A 3F8XA 3OX9A 3UNLA 1IQYA 2QIYA 5CXOA 2D1WA 2OOVC 4XDVA 3DGMA 3LOYA 3AMOA 2RSXA 3PZWA 1SPUA 1GD3A 4Q53A 1NB5I 3LMLA 1E3RA 1EKMA 3DZLA 3X3XA 2HMMB 1FGQA 1RJOA 1W02A 2C10A 4HM4B 3CPOA 3LTBA 2IMJA 1A90A 3PCRA 2OOVA 3CC73 3J7Yd 4N6UA 2FXTA 5KP1A 1OF5A 5EEOA 1YI23 1KD14 2Z77A 2XSHB 1N9EA 4KFDA 3OWYA 3Q1CA 2BT3A 3EBTA 3MYTA 2XR8B 2P09A 1O7PB 2JQ5A 4R9KA 2CWTA 5AIFA 2CG1A 4XBYA 1YGEA 1CYUA 3UL6A 1NWWA 3DGNA 1KSIA 1N5PA 4HBRA 2WGQA 4AKZA 3X3ZA 2FGTA 1GD4A 4R4KA 3IPTA 1K9M4 4U13A 1FGMA 1UI7A 1YJW3 5AYSC 4RBNA 2PZVA 3DGLA 2IA7A 1VQP3 1YHQ3 3B4OA 1IT7A 3MSOA 1VQ93 5AIHA 4HM1B 4L7KA 1CEWI 2GXFA 2OCTA 1W6GA 3NM7A 2YX9A 3QK9A 4IIAA 3LTDA 3ALAA 5D82A 4XBTA 4RNYA 4HZBB 3EE1A 5I97A 4K1UA 4XM4A 3SOYA 1A67A 3KIIA 3OW22 1F8NA 2KRTA 2HMJB 5D81A 3BLZA 3DXOA 4N6TA 1W6YA 4J8TA 3F7SA 1M904 3RGRA 2LQVA 4FCZA 3U1WA 2FNQA 4EV5A 3KSED 5ELUA 4KFFA 1JJ22 5JPUA 3G0KA 4HM8B 1YIJ3 3HK4A 4EV2A 3DMCA 3CPW2 4MMXB 3NV0B 3OWUA 1AV4A 1VQ83 3D3LA 3N8BA 2O9UX 1U5OA 3VSYA 3BNBA 3SEDA 1QALA 4WFOA 5EQLA 5KP3A 1N8QA 1O7HB 2BMQB 3PCSA 3CXC2 1D6ZA 1WNHA 1ROAA 1ULJB 3JVCA 3WOFB 1W00A 1JN5B 2P0XA 1PFPA 3CCL3 1W01A 2CFDA 2ZL8A 1K41A 3GZRA 4HM7B 1Z1SA 3PYJA 3EB8A 4QWTA 1KWIA 3OWSA 4NHFA 5DREA 1QMAA 3H3HA 3KFQC 3V98A 3QRDA 1IK3A 1QAKA 7STDA 2KCDA 3SXXA 2SBLA 3FF2A 1E3VA 2Z6BA 3WDGB 1AVLA 4TX4A 1UI8A 3F8HA 1VQ63 3FCSB 4HVNA 2Z7AA 1SQWA 1RN7A 4WWUC 2IUKA 1GY6A 1AR0A 3E99A 3ECFA 2M7OA 2XH9A 1HKXA 1PU4A 2RGQA 4FMCA 4MMYB 4LGQA 1G96A 1JKGB 3SVAA 1O7NB 5JBSA 2ML6A 1DMNA 3MG2A 3I0YA 1YJN3 5AEUB 3GZYB 1OGXA 2B1XB 1W2B2 3G8ZA 4LEHA 4R80A 3Q90A 4BTYA 2B24B 1FGTA 1TP6A 4JF8A 1US1A 3CC23 5IENA 1OCVA 1U8CB 2CIUA 4HM2B 3CU3A 1DYUA 3G16A 2BO9B 3FGYA 2W56B 1M1K4 3FG3A 1JB4A 2F99A 1NB3I 2C11A 2K0MA 1SIIA 1O7MB 3LYGA 1Y4KA 1GY5A 1JB2A 4CCVA 1CQSA 2XFTA 3FSDA 2R4IA 4OUQA 3SLUA 2V1LA 4HZ9B 3GZBA 3WODG 2E2VA 5IEOA 1OPYA 2RCDA 2CFKA 1IVWA 3GZXB 4KVHA 4N6LA 1QVF2 1EG9B 3GRDA 3OXAA 1OUNA 1AVKA 1O7WB 2D42A 1IQ8A 5IEPA 2CFWA 1Q814 3EX9A 1W6CA 3DM8A 1OHOA 3LTCA 1LVNA 2Q07A 3F7XA 4FMDA 1NJI4 2HMLB 3CNXA 1SJWA 1WMPA 3NQZA 1VZZA 5AEWB 1VQ43 4EC6A 2MF7A 1D6YA 3EF8A 1W4NA 3S27A 1N9JA 3KKGA 1UUVB 3RDEA 2GEYA 4KZ1A 3EHCA 1Q824 3MG1A 3FLJA 3AMOB 2UX0A 1IV9A 2WOHA 4GB5A 4XBXA 3EJVA 1BUQA 3FG1A 4J9AA 1OHPA 4AKYA 2GBWB 3NBJA 4HKVB 3CCE3 3Q2PA 3K9MC 4MEIA 1FGRA 5TGNA 3X41A 3NM2A 5DRVA 2W04A 5BXQA 1QJGA 1UW1A 1WMNA 3UB1A 4HM6B 3T8NA 3ER7A 3JUPA 3L0RA 2XRXB 2GU3A 8CHOA 2CFGA 1K8A4 1VQL3 3FKAA 4X2HA 3CD63 1IDPA 3BB9A 4HM0B 1IV7A 1W7CA 3V99A 3MG3A 4ORLA 1YVBI 4FR9A 3T8UA 3F9SA 1C7HA 5A0OB 1IVVA 4LMIA 4GL6A 1T5YA 2JDIH 5G2GA 3S67A 1DVDA 2CFLA 3SX1A 2KXGA 4FCMA 4MMZB 5ELJA 1S723 3CMA3 5LC7A 5JPPA 1JB5A 3B4PA 3O8YA 1ROVA 3WA3A 3VGNA 2ZDJA 3DGOA 3M8CA 1W2ZA 3NQYA 1J2BA 1NU3A 4O2HA 4XDWA 1IQXA 1ZX2A 3N54B 2IUJA 1KQS2 1K28A 2GEXA 1JNQA 3EN8A 1NDOB 4AEQA 2W9QA 2L4VA 4BTWA 2A15A 1OHSA 2OWPA 4N6NB 1K734 3G4S3 3GAXA 4N6MA 1STFI 2QGUA 1R4CA 3IJEB 3MHEA 3NUVA 2W56A 3G6E3 4FMBA 3CCM3 2XF3A 3PS8A 3UL5A 2YFIB 4HM3B 2ML5A 5AIIA 2STDA 1VQM3 3GWRA 2BMRB 2CH9A 4N3VA 1M9GA 3HX8A 1QVG2 3CCQ3 1MNLA 2OQEC 2XSOB 1WTHA 3DY5A 3JUQA 1RRLA 3LTAA 1Q864 2W9PA 3K0ZA 2BMOB 1O7GB 3TDGA 2Y74A 4OK0A 4WP5A 3BNEA 1OH0A 2XGNA 3BNDA 2XFSA 3D9RA 3MPHA 1ISKA 1D6UA 2CKFB 4KFEA 4N6V0 1WMOA 3WA2X 1TFKA 3G713 1DMQA 1TFOA 2GU1A 1HU9A 1Q40B 1VQ73 3CCV3 2OTJ3 1ULIB 3LXUX 3CCJ3 3X42A 3KSPA 3HZPA 4I4KA 1VQ53 1RRHA 1OGZA 3B7CA 2CHCA 3WMDA 3CC43 1IVUA 1FA3A 1V74A 4RNZA 1STDA 2LYXA 1A2KA 2WGOA 3JUOA 3EC9A 4IT7A 3S29A 1FUWA 1LNHA 2HMOB 1A2VA 2P38A 4JRFA 2W2CA 2F86B 4R1KA 4WYKB 3K5TA 5IG4A 3STDA 3EBYA 2E2TA 1TUHA 2WOFA 1LOXA 3H51A 2Z76A 1NO3A 3F14A 4NREA 4LZIA 3NV0A 3CCS3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6O B;  4TX4 A;  1IV7 A;  1RN7 A;  1NB5 I;  1GD3 A;  1YVB I;  5A0O B;  5LC6 A;  3S67 A;  1DVD A;  1G96 A;  2KXG A;  5ELJ A;  3SVA A;  1A90 A;  4N6U A;  5LC7 A;  3LH4 A;  3NX0 A;  3IMA B;  1CYU A;  3UL6 A;  2W9Q A;  1N5P A;  4EYC A;  1GD4 A;  4N6N B;  3GAX A;  4N6M A;  1STF I;  2BO9 B;  1R4C A;  3PXM A;  3PS8 A;  3UL5 A;  1NB3 I;  1CEW I;  2CH9 A;  2OCT A;  1M9G A;  4CCV A;  1MNL A;  1TIJ A;  2W9P A;  3MWZ A;  1A67 A;  1N5H A;  4N6L A;  4N6T A;  4N6V 0;  1EQK A;  3KSE D;  5ELU A;  1DVC A;  1LXE A;  2O9U X;  1FA3 A;  1N9J A;  4ZM8 A;  5EQL A;  4IT7 A;  1FUW A;  1IV9 A;  1WNH A;  1MOL A;  1CYV A;  1ROA A;  3Q2P A;  3K9M C;  1PFP A;  3PYJ A;  1KWI A;  4LZI A;  3KFQ C;  3L0R A;  3QRD A; 
#chains in the Genus database with same CATH topology
 2OTL 3;  4K1V A;  1SIH A;  5IF6 A;  1VQO 3;  1T3B A;  2HMN B;  1MWR A;  1V58 A;  1DMM A;  2W03 A;  4CDL A;  5AIG A;  3PGB A;  1X1Y A;  2H0H A;  1UCL A;  3FH1 A;  3N9H A;  5IG3 A;  1LRA A;  5CLK A;  5BVB A;  9RNT A;  3CME 3;  5LC6 A;  1FGO A;  2E2U A;  3FF0 A;  3I55 3;  1IVX A;  1JN5 A;  3LT8 A;  1OF5 B;  4L8P A;  2INX A;  3CCR 3;  1T2H A;  1TJD A;  3LH4 A;  3CNM A;  3NXJ A;  2CW9 A;  5FW5 A;  3NBB A;  2PNC A;  2XGL A;  3S5C A;  3UJM A;  1VQK 3;  4EXR A;  2MC8 A;  1B2Z A;  3NBR A;  3NX0 A;  1BSE A;  2W0Q A;  1PY3 A;  4RZM A;  1QAF A;  3IMA B;  2CC3 A;  2AAE A;  3WOE B;  4HM5 B;  3F40 A;  1Q42 A;  5IER A;  4HYZ A;  4R9L A;  1UUW B;  4O8S A;  2BHM A;  4EBG A;  1UCI A;  3HIG A;  1ASK A;  1GS3 A;  1UCJ A;  3B8L A;  4MJD A;  4EYC A;  5IW9 A;  1RKY A;  3S28 A;  4OVM A;  5HGR A;  4H61 A;  2I9W A;  3PXM A;  6STD A;  3U97 A;  3BNC A;  2P0M A;  2L1S A;  3RGA A;  4LSO A;  2KAA A;  4X2O A;  1JKG A;  1MGR A;  1Q9E A;  3ROB A;  2BU4 A;  2GBX B;  4XB5 A;  2O3O A;  2YFJ B;  5G1K A;  3K7C A;  3T0U A;  7GSP A;  1I0V A;  2WO0 A;  4NPB A;  2GSP A;  1TIJ A;  2XEP A;  3LT9 A;  3MWZ A;  4FCJ A;  3X40 A;  5D83 A;  3SOA A;  3KCH A;  1KC8 4;  4H3U A;  1N5H A;  5AI1 A;  3V92 A;  2F4Y A;  4FMA A;  1EA2 A;  2ZHX B;  1GYB A;  3HII A;  4PEJ A;  3JUM A;  3ZFZ A;  2K54 A;  1OAC A;  1L5G B;  1E97 A;  3NHX A;  1TTO A;  1WQL B;  1I8V A;  2RFR A;  1EQK A;  3DUK A;  4O3V A;  3A76 A;  5FGO A;  1DVC A;  1JZO A;  5CF2 A;  2QEX 3;  1Q40 A;  3CCU 3;  1Q7Y 4;  1N8R 4;  1LXE A;  1FYS A;  3X3Y A;  1BIR A;  1GY7 A;  2CWV A;  3KE7 A;  1JV2 B;  5IG5 A;  1JBR A;  5CK6 A;  2QA4 3;  1FZU A;  1YJ9 3;  2Y73 A;  1GOU A;  3LZA A;  3K63 A;  1BRJ A;  1ZO2 A;  2YFL B;  2HMK B;  1W5Z A;  2F56 A;  4IPB A;  3WR2 A;  4ZM8 A;  2CK3 H;  4HJL B;  3I56 3;  4STD A;  3HI7 A;  3KZT A;  4K61 A;  1ZS7 A;  4L8O A;  1YIT 3;  1IT8 A;  1TU5 A;  1MOL A;  3EQQ B;  1CYV A;  2OQE A;  3JUN A;  1IU7 A;  1VQN 3;  4O02 B;  4WYK A;  1M1X B;  1RGH A;  4GSP A;  3MKI A;  3EN1 B;  3FG4 A;  4K90 B;  1RDS A;  4WHA A;  5EVH A;  4BTX A;  5AYR B;  1JRQ A;  5IG0 A;  2W6J H;  4HOH A;  2CWU A;  2F98 A;  3VF1 A;  4G1M B;  5M18 A;  1R4Y A;  5KP4 A;  1BRG A;  2CG0 A;  3FZW A;  3KN4 A;  4N6O B;  1S5A A;  2R41 A;  3D5I A;  3AGO A;  3OV4 A;  1GSP A;  2BNG A;  5STD A;  2IYJ A;  2P05 A;  5CF1 A;  1X1W A;  3F8X A;  1JBS A;  3OX9 A;  3UNL A;  1IQY A;  2QIY A;  5CXO A;  2D1W A;  2F5W A;  2OOV C;  4XDV A;  3DGM A;  3LOY A;  3AMO A;  2RSX A;  3PZW A;  1SPU A;  1GD3 A;  4Q53 A;  1NB5 I;  3LML A;  1E3R A;  1EKM A;  1RGG A;  3DZL A;  2HMM B;  3X3X A;  1FGQ A;  1RJO A;  1W02 A;  2C10 A;  1YGW A;  3CPO A;  3LTB A;  4HM4 B;  2H0G A;  2IMJ A;  1A90 A;  3PCR A;  2OOV A;  3CC7 3;  3J7Y d;  4N6U A;  2FXT A;  5KP1 A;  1OF5 A;  5EEO A;  1YI2 3;  1KD1 4;  1PYL A;  1BVI A;  2Z77 A;  4CJN A;  1G02 A;  2XSH B;  1N9E A;  4KFD A;  3OWY A;  3Q1C A;  2BT3 A;  3EBT A;  3MYT A;  2XR8 B;  2P09 A;  4BU4 A;  1O7P B;  2JQ5 A;  4R9K A;  2CWT A;  5AIF A;  2CG1 A;  4XBY A;  1YGE A;  1CYU A;  3UL6 A;  1NWW A;  1BAN A;  1RGC A;  3DGN A;  1KSI A;  1N5P A;  4HBR A;  2WGQ A;  1RCK A;  4AKZ A;  3X3Z A;  2FGT A;  1GD4 A;  4R4K A;  3IPT A;  1K9M 4;  4U13 A;  1IYY A;  1FGM A;  1UI7 A;  1YJW 3;  5AYS C;  4RBN A;  2PZV A;  3DGL A;  5BU4 A;  2IA7 A;  1VQP 3;  1YHQ 3;  3B4O A;  1IT7 A;  3MSO A;  1VQ9 3;  5AIH A;  4HM1 B;  4L7K A;  1CEW I;  2GXF A;  1RLS A;  1CH0 A;  2OCT A;  1BRS A;  1W6G A;  3NM7 A;  2YX9 A;  1LOV A;  3QK9 A;  4IIA A;  3LTD A;  3ALA A;  5D82 A;  2KF5 A;  4DKI A;  4XBT A;  4RNY A;  4HZB B;  3EE1 A;  5I97 A;  1ZGX A;  4K1U A;  4XM4 A;  3SOY A;  1A67 A;  3KII A;  1RCL A;  3OW2 2;  1F8N A;  2KRT A;  2HMJ B;  3DH2 A;  1B20 A;  1Q7H A;  3AHW A;  1BU4 A;  1LQG C;  1JBT A;  5D81 A;  3BLZ A;  3DXO A;  4N6T A;  1W6Y A;  4J8T A;  5M1A A;  1MWU A;  3F7S A;  1M90 4;  3RGR A;  1BRN L;  2LQV A;  4FCZ A;  3U1W A;  2FNQ A;  4EV5 A;  1BNE A;  3KSE D;  5ELU A;  4KFF A;  1JJ2 2;  5JPU A;  3G0K A;  4HM8 B;  1YIJ 3;  3HK4 A;  1RNT A;  4EV2 A;  3DMC A;  1BRH A;  3CPW 2;  4MMX B;  3NV0 B;  3OWU A;  1AV4 A;  3Q3F A;  1VQ8 3;  3ZG0 A;  4EW5 A;  3D3L A;  1G0T A;  3N8B A;  2O9U X;  1U5O A;  1LOW A;  5GSP A;  1MWT A;  3BNB A;  1RMS A;  3VSY A;  4BL3 A;  3SED A;  1QAL A;  4WFO A;  4I5Q A;  5EQL A;  5KP3 A;  1N8Q A;  1O7H B;  2BMQ B;  3PCS A;  3CXC 2;  1D6Z A;  1WNH A;  2AAD A;  1BNR A;  4BIR A;  1ROA A;  1HZ1 A;  2SAR A;  1ULJ B;  3JVC A;  4J5G A;  3WOF B;  1W00 A;  1JN5 B;  2P0X A;  1RGA A;  1I2G A;  3ZG5 A;  1PFP A;  3CCL 3;  1W01 A;  2CFD A;  2ZL8 A;  1K41 A;  3GZR A;  4HM7 B;  1Z1S A;  3PYJ A;  3EB8 A;  7RNT A;  4J5K A;  4QWT A;  1KWI A;  3OWS A;  4NHF A;  5DRE A;  1QMA A;  3H3H A;  1BNI A;  1RGK A;  3KFQ C;  3V98 A;  3QRD A;  1IK3 A;  1BNF A;  1QAK A;  7STD A;  2KCD A;  1RHL A;  3SXX A;  2SBL A;  3FF2 A;  1E3V A;  2Z6B A;  3WDG B;  1AVL A;  4TX4 A;  1UI8 A;  3F8H A;  1VQ6 3;  3FCS B;  1B2M A;  2UGI A;  4HVN A;  2Z7A A;  1SQW A;  1RN7 A;  4WWU C;  2IUK A;  1UGH I;  1GY6 A;  1AR0 A;  3E99 A;  3ECF A;  2M7O A;  2XH9 A;  1HKX A;  1PU4 A;  2RGQ A;  1I3F A;  4FMC A;  4MMY B;  3DGY A;  1I0X A;  4CPK A;  4LGQ A;  1G96 A;  1C54 A;  1JKG B;  3SVA A;  1O7N B;  1I2F A;  5JBS A;  2ML6 A;  1DMN A;  3MG2 A;  3I0Y A;  1YJN 3;  5AEU B;  3GZY B;  1OGX A;  2B1X B;  1BUJ A;  1W2B 2;  3G8Z A;  4LEH A;  3D79 A;  4R80 A;  3Q90 A;  2HOH A;  1A2P A;  4BTY A;  2B24 B;  1FGT A;  1GMP A;  1TP6 A;  4JF8 A;  1US1 A;  3CC2 3;  1BNS A;  1BNJ A;  1UDI I;  1X1X A;  5IEN A;  1OCV A;  1U8C B;  2CIU A;  4HM2 B;  3CU3 A;  1DYU A;  3G16 A;  2BO9 B;  2CX0 A;  2W56 B;  3FGY A;  1M1K 4;  3FG3 A;  1JB4 A;  1EEJ A;  2F99 A;  1NB3 I;  2C11 A;  2K0M A;  1FW7 A;  3HOH A;  1BRK A;  1SII A;  1O7M B;  1GOY A;  1BSB A;  3LYG A;  1UUG B;  1Y4K A;  1GY5 A;  1FUT A;  1JB2 A;  1MGW A;  2KF4 A;  1CQS A;  2XFT A;  3FSD A;  4CCV A;  2R4I A;  4OUQ A;  3SLU A;  2V1L A;  4HZ9 B;  3GZB A;  3WOD G;  2E2V A;  5IEO A;  1OPY A;  1KQS 2;  2RCD A;  2CFK A;  3SYU A;  1IVW A;  3GZX B;  2KF3 A;  4KVH A;  4N6L A;  1QVF 2;  1EG9 B;  3GRD A;  3OXA A;  5G1L A;  1OUN A;  1AVK A;  1O7W B;  2D42 A;  1IQ8 A;  5IEP A;  1BSD A;  2CFW A;  3AGN A;  3EX9 A;  1W6C A;  3WHO A;  3DM8 A;  1Q81 4;  1OHO A;  3LTC A;  1HYF A;  1B2S A;  1LVN A;  2Q07 A;  3F7X A;  4FMD A;  1NJI 4;  2HML B;  1JZD A;  1SJW A;  3CNX A;  3D5G A;  1FUS A;  1WMP A;  1RN1 A;  3NQZ A;  1VZZ A;  5AEW B;  1VQ4 3;  1RN4 A;  4EC6 A;  2MF7 A;  1D6Y A;  3EF8 A;  6RNT A;  1W4N A;  3S27 A;  1N9J A;  2C4B A;  3KKG A;  1B27 A;  1V57 A;  1UUV B;  3RDE A;  2GEY A;  4KZ1 A;  3EHC A;  1Q82 4;  3MG1 A;  3FLJ A;  3AMO B;  2RNT A;  2UX0 A;  1IV9 A;  2WOH A;  4GB5 A;  4XBX A;  1BRI A;  3EJV A;  1B2U A;  1BUQ A;  1EUI C;  3FG1 A;  4J9A A;  1T2I A;  1OHP A;  4AKY A;  2GBW B;  1TRQ A;  3NBJ A;  4HKV B;  3CCE 3;  3Q2P A;  3K9M C;  4MEI A;  1FGR A;  1DET A;  5TGN A;  3X41 A;  8RNT A;  3NM2 A;  1BSA A;  2W04 A;  5DRV A;  5BXQ A;  1YVS A;  1QJG A;  1UW1 A;  1WMN A;  3URP A;  3UB1 A;  1BNG A;  2RBI A;  4HM6 B;  3T8N A;  3ER7 A;  3JUP A;  1RNB A;  3L0R A;  2XRX B;  3BIR A;  2GU3 A;  8CHO A;  2CFG A;  1K8A 4;  1VQQ A;  1X1U A;  1GMQ A;  1VQL 3;  3FKA A;  1AQZ A;  4X2H A;  3CD6 3;  1IDP A;  2UUG C;  3BB9 A;  4HM0 B;  1IV7 A;  1UCK A;  1W7C A;  3V99 A;  3MG3 A;  4ILF A;  1YNV X;  4KT3 B;  1BGS A;  4ORL A;  1YVB I;  1RTU A;  4FR9 A;  3T8U A;  3F9S A;  1C7H A;  5A0O B;  1IVV A;  4LMI A;  4GL6 A;  1T5Y A;  2JDI H;  5G2G A;  4HAA A;  3S67 A;  4BL2 A;  1DVD A;  2CFL A;  3SX1 A;  1LQM B;  2KXG A;  4FCM A;  4MMZ B;  5ELJ A;  1S72 3;  3CMA 3;  5LC7 A;  5JPP A;  1JB5 A;  3B4P A;  3O8Y A;  1ROV A;  3WA3 A;  3VGN A;  2ZDJ A;  3DGO A;  3M8C A;  1W2Z A;  2CX1 A;  3NQY A;  1J2B A;  1NU3 A;  4O2H A;  4XDW A;  1IQX A;  1ZX2 A;  1B2X A;  3N54 B;  2IUJ A;  1K28 A;  2GEX A;  1GMR A;  1JNQ A;  2KF6 A;  5BIR A;  3EN8 A;  1NDO B;  4AEQ A;  2W9Q A;  2L4V A;  2J8X B;  2A15 A;  4BTW A;  1NNV A;  1OHS A;  1I2E A;  2OWP A;  4N6N B;  1K73 4;  3D4A A;  1BSC A;  3GSP A;  3GAX A;  4N6M A;  3G4S 3;  1STF I;  2QGU A;  1R4C A;  1SAR A;  3IJE B;  3MHE A;  3NUV A;  2W56 A;  3G6E 3;  4FMB A;  3CCM 3;  2XF3 A;  3PS8 A;  3UL5 A;  2K3D A;  2YFI B;  2ML5 A;  4HM3 B;  4LYL B;  4RNT A;  5AII A;  2STD A;  1VQM 3;  3GWR A;  2BMR B;  3BU4 A;  1TRP A;  1GOV A;  1LOY A;  2CH9 A;  4GHO A;  1B21 A;  4N3V A;  1M9G A;  3HX8 A;  1QVG 2;  5HOH A;  1MNL A;  3CCQ 3;  2OQE C;  2XSO B;  3A5E A;  1WTH A;  3DY5 A;  3JUQ A;  1RRL A;  3LTA A;  1Q86 4;  2W9P A;  3K0Z A;  2BMO B;  6GSP A;  1UGI A;  1O7G B;  3TDG A;  1DE3 A;  2Y74 A;  4OK0 A;  4WP5 A;  1B3S A;  3BNE A;  1OH0 A;  2XGN A;  3BND A;  2XFS A;  3D9R A;  3MPH A;  1ISK A;  1D6U A;  2CKF B;  4KFE A;  4N6V 0;  1WMO A;  1AY7 A;  3WA2 X;  1LNI A;  1TFK A;  3G71 3;  1BAO A;  1TFO A;  1DMQ A;  1RGE A;  1I3I A;  1MWS A;  1RGL A;  1HU9 A;  1Q40 B;  2GU1 A;  3RNT A;  5RNT A;  3CCV 3;  1VQ7 3;  2OTJ 3;  1ULI B;  2ZA4 A;  2H0I A;  3LXU X;  3CCJ 3;  3X42 A;  3KSP A;  3HZP A;  4I4K A;  1VQ5 3;  1RRH A;  2F5M A;  1OGZ A;  3B7C A;  2CHC A;  3WMD A;  5M19 A;  3CC4 3;  1IVU A;  1FA3 A;  1BOX A;  1V74 A;  1STD A;  2LYX A;  4RNZ A;  1A2K A;  2WGO A;  3JUO A;  3EC9 A;  4IT7 A;  3S29 A;  1FUW A;  2BIR A;  1LNH A;  2HMO B;  1A2V A;  2P38 A;  2IY2 A;  4JRF A;  2W2C A;  2F86 B;  4R1K A;  4WYK B;  3K5T A;  5IG4 A;  1RSN A;  3STD A;  3AHS A;  3EBY A;  2E2T A;  1TUH A;  2WOF A;  1LOX A;  1RGF A;  3H51 A;  1I70 A;  2Z76 A;  1NO3 A;  3F14 A;  4NRE A;  4LZI A;  3NV0 A;  3CCS 3; 
#chains in the Genus database with same CATH homology
 2OTL 3;  4K1V A;  1SIH A;  5IF6 A;  1VQO 3;  2HMN B;  1DMM A;  2W03 A;  4CDL A;  5AIG A;  3PGB A;  3FH1 A;  3N9H A;  5IG3 A;  5CLK A;  5BVB A;  3CME 3;  5LC6 A;  1FGO A;  2E2U A;  3FF0 A;  3I55 3;  1IVX A;  1JN5 A;  3LT8 A;  1OF5 B;  4L8P A;  2INX A;  3CCR 3;  3LH4 A;  3CNM A;  3NXJ A;  2CW9 A;  5FW5 A;  3NBB A;  2PNC A;  2XGL A;  3S5C A;  3UJM A;  1VQK 3;  4EXR A;  2MC8 A;  3NBR A;  3NX0 A;  2W0Q A;  4RZM A;  1QAF A;  3IMA B;  2CC3 A;  3WOE B;  4HM5 B;  3F40 A;  1Q42 A;  5IER A;  4HYZ A;  4R9L A;  1UUW B;  4O8S A;  2BHM A;  4EBG A;  3HIG A;  1ASK A;  1GS3 A;  3B8L A;  4MJD A;  4EYC A;  5IW9 A;  1RKY A;  3S28 A;  4OVM A;  5HGR A;  4H61 A;  2I9W A;  3PXM A;  6STD A;  3U97 A;  3BNC A;  2P0M A;  3RGA A;  4LSO A;  4X2O A;  1JKG A;  3ROB A;  4XB5 A;  2GBX B;  2O3O A;  2YFJ B;  3K7C A;  3T0U A;  2WO0 A;  1TIJ A;  2XEP A;  3LT9 A;  3MWZ A;  4FCJ A;  3X40 A;  5D83 A;  3SOA A;  1KC8 4;  4H3U A;  1N5H A;  5AI1 A;  3V92 A;  4FMA A;  1EA2 A;  3HII A;  1GYB A;  4PEJ A;  3JUM A;  2K54 A;  1OAC A;  1L5G B;  1E97 A;  3NHX A;  1WQL B;  2RFR A;  1EQK A;  3DUK A;  4O3V A;  3A76 A;  5FGO A;  1DVC A;  5CF2 A;  2QEX 3;  3CCU 3;  1Q40 A;  1Q7Y 4;  1N8R 4;  1LXE A;  3X3Y A;  2CWV A;  1GY7 A;  3KE7 A;  5IG5 A;  1JV2 B;  5CK6 A;  2QA4 3;  1YJ9 3;  2Y73 A;  3LZA A;  3K63 A;  1ZO2 A;  2YFL B;  2HMK B;  1W5Z A;  4IPB A;  4ZM8 A;  3I56 3;  2CK3 H;  4HJL B;  4STD A;  3HI7 A;  3KZT A;  4K61 A;  4L8O A;  1YIT 3;  1IT8 A;  1TU5 A;  1MOL A;  3EQQ B;  1CYV A;  2OQE A;  3JUN A;  1IU7 A;  1VQN 3;  4O02 B;  4WYK A;  1M1X B;  3MKI A;  3EN1 B;  3FG4 A;  4K90 B;  5EVH A;  4WHA A;  4BTX A;  5AYR B;  1JRQ A;  5IG0 A;  2W6J H;  2CWU A;  2F98 A;  3VF1 A;  4G1M B;  5KP4 A;  2CG0 A;  3FZW A;  3KN4 A;  4N6O B;  1S5A A;  3OV4 A;  5STD A;  2BNG A;  2P05 A;  5CF1 A;  3F8X A;  3OX9 A;  3UNL A;  1IQY A;  2QIY A;  5CXO A;  2D1W A;  2OOV C;  4XDV A;  3DGM A;  3LOY A;  3AMO A;  2RSX A;  3PZW A;  1SPU A;  1GD3 A;  4Q53 A;  1NB5 I;  3LML A;  1E3R A;  1EKM A;  3DZL A;  3X3X A;  2HMM B;  1FGQ A;  1RJO A;  1W02 A;  2C10 A;  4HM4 B;  3CPO A;  3LTB A;  2IMJ A;  1A90 A;  3PCR A;  2OOV A;  3CC7 3;  3J7Y d;  4N6U A;  2FXT A;  5KP1 A;  1OF5 A;  5EEO A;  1YI2 3;  1KD1 4;  2Z77 A;  2XSH B;  1N9E A;  4KFD A;  3OWY A;  3Q1C A;  2BT3 A;  3EBT A;  3MYT A;  2XR8 B;  2P09 A;  1O7P B;  2JQ5 A;  4R9K A;  2CWT A;  5AIF A;  2CG1 A;  4XBY A;  1YGE A;  1CYU A;  3UL6 A;  1NWW A;  3DGN A;  1KSI A;  1N5P A;  4HBR A;  2WGQ A;  4AKZ A;  3X3Z A;  2FGT A;  1GD4 A;  4R4K A;  3IPT A;  1K9M 4;  4U13 A;  1FGM A;  1UI7 A;  1YJW 3;  5AYS C;  4RBN A;  2PZV A;  3DGL A;  2IA7 A;  1VQP 3;  1YHQ 3;  3B4O A;  1IT7 A;  3MSO A;  1VQ9 3;  5AIH A;  4HM1 B;  4L7K A;  1CEW I;  2GXF A;  2OCT A;  1W6G A;  3NM7 A;  2YX9 A;  3QK9 A;  4IIA A;  3LTD A;  3ALA A;  5D82 A;  4XBT A;  4RNY A;  4HZB B;  3EE1 A;  5I97 A;  4K1U A;  4XM4 A;  3SOY A;  1A67 A;  3KII A;  3OW2 2;  1F8N A;  2KRT A;  2HMJ B;  5D81 A;  3BLZ A;  3DXO A;  4N6T A;  1W6Y A;  4J8T A;  3F7S A;  1M90 4;  3RGR A;  2LQV A;  4FCZ A;  3U1W A;  2FNQ A;  4EV5 A;  3KSE D;  5ELU A;  4KFF A;  1JJ2 2;  5JPU A;  3G0K A;  4HM8 B;  1YIJ 3;  3HK4 A;  4EV2 A;  3DMC A;  3CPW 2;  4MMX B;  3NV0 B;  3OWU A;  1AV4 A;  1VQ8 3;  3D3L A;  3N8B A;  2O9U X;  1U5O A;  3VSY A;  3BNB A;  3SED A;  1QAL A;  4WFO A;  5EQL A;  5KP3 A;  1N8Q A;  1O7H B;  2BMQ B;  3PCS A;  3CXC 2;  1D6Z A;  1WNH A;  1ROA A;  1ULJ B;  3JVC A;  3WOF B;  1W00 A;  1JN5 B;  2P0X A;  1PFP A;  3CCL 3;  1W01 A;  2CFD A;  2ZL8 A;  1K41 A;  3GZR A;  4HM7 B;  1Z1S A;  3PYJ A;  3EB8 A;  4QWT A;  1KWI A;  3OWS A;  4NHF A;  5DRE A;  1QMA A;  3H3H A;  3KFQ C;  3V98 A;  3QRD A;  1IK3 A;  1QAK A;  7STD A;  2KCD A;  3SXX A;  2SBL A;  3FF2 A;  1E3V A;  2Z6B A;  3WDG B;  1AVL A;  4TX4 A;  1UI8 A;  3F8H A;  1VQ6 3;  3FCS B;  4HVN A;  2Z7A A;  1SQW A;  1RN7 A;  4WWU C;  2IUK A;  1GY6 A;  1AR0 A;  3E99 A;  3ECF A;  2M7O A;  2XH9 A;  1HKX A;  1PU4 A;  2RGQ A;  4FMC A;  4MMY B;  4LGQ A;  1G96 A;  1JKG B;  3SVA A;  1O7N B;  5JBS A;  2ML6 A;  1DMN A;  3MG2 A;  3I0Y A;  1YJN 3;  5AEU B;  3GZY B;  1OGX A;  2B1X B;  1W2B 2;  3G8Z A;  4LEH A;  4R80 A;  3Q90 A;  4BTY A;  2B24 B;  1FGT A;  1TP6 A;  4JF8 A;  1US1 A;  3CC2 3;  5IEN A;  1OCV A;  1U8C B;  2CIU A;  4HM2 B;  3CU3 A;  1DYU A;  3G16 A;  2BO9 B;  3FGY A;  2W56 B;  1M1K 4;  3FG3 A;  1JB4 A;  2F99 A;  1NB3 I;  2C11 A;  2K0M A;  1SII A;  1O7M B;  3LYG A;  1Y4K A;  1GY5 A;  1JB2 A;  4CCV A;  1CQS A;  2XFT A;  3FSD A;  2R4I A;  4OUQ A;  3SLU A;  2V1L A;  4HZ9 B;  3GZB A;  3WOD G;  2E2V A;  5IEO A;  1OPY A;  2RCD A;  2CFK A;  1IVW A;  3GZX B;  4KVH A;  4N6L A;  1QVF 2;  1EG9 B;  3GRD A;  3OXA A;  1OUN A;  1AVK A;  1O7W B;  2D42 A;  1IQ8 A;  5IEP A;  2CFW A;  1Q81 4;  3EX9 A;  1W6C A;  3DM8 A;  1OHO A;  3LTC A;  1LVN A;  2Q07 A;  3F7X A;  4FMD A;  1NJI 4;  2HML B;  3CNX A;  1SJW A;  1WMP A;  3NQZ A;  1VZZ A;  5AEW B;  1VQ4 3;  4EC6 A;  2MF7 A;  1D6Y A;  3EF8 A;  1W4N A;  3S27 A;  1N9J A;  3KKG A;  1UUV B;  3RDE A;  2GEY A;  4KZ1 A;  3EHC A;  1Q82 4;  3MG1 A;  3FLJ A;  3AMO B;  2UX0 A;  1IV9 A;  2WOH A;  4GB5 A;  4XBX A;  3EJV A;  1BUQ A;  3FG1 A;  4J9A A;  1OHP A;  4AKY A;  2GBW B;  3NBJ A;  4HKV B;  3CCE 3;  3Q2P A;  3K9M C;  4MEI A;  1FGR A;  5TGN A;  3X41 A;  3NM2 A;  5DRV A;  2W04 A;  5BXQ A;  1QJG A;  1UW1 A;  1WMN A;  3UB1 A;  4HM6 B;  3T8N A;  3ER7 A;  3JUP A;  3L0R A;  2XRX B;  2GU3 A;  8CHO A;  2CFG A;  1K8A 4;  1VQL 3;  3FKA A;  4X2H A;  3CD6 3;  1IDP A;  3BB9 A;  4HM0 B;  1IV7 A;  1W7C A;  3V99 A;  3MG3 A;  4ORL A;  1YVB I;  4FR9 A;  3T8U A;  3F9S A;  1C7H A;  5A0O B;  1IVV A;  4LMI A;  4GL6 A;  1T5Y A;  2JDI H;  5G2G A;  3S67 A;  1DVD A;  2CFL A;  3SX1 A;  2KXG A;  4FCM A;  4MMZ B;  5ELJ A;  1S72 3;  3CMA 3;  5LC7 A;  5JPP A;  1JB5 A;  3B4P A;  3O8Y A;  1ROV A;  3WA3 A;  3VGN A;  2ZDJ A;  3DGO A;  3M8C A;  1W2Z A;  3NQY A;  1J2B A;  1NU3 A;  4O2H A;  4XDW A;  1IQX A;  1ZX2 A;  3N54 B;  2IUJ A;  1KQS 2;  1K28 A;  2GEX A;  1JNQ A;  3EN8 A;  1NDO B;  4AEQ A;  2W9Q A;  2L4V A;  4BTW A;  2A15 A;  1OHS A;  2OWP A;  4N6N B;  1K73 4;  3G4S 3;  3GAX A;  4N6M A;  1STF I;  2QGU A;  1R4C A;  3IJE B;  3MHE A;  3NUV A;  2W56 A;  3G6E 3;  4FMB A;  3CCM 3;  2XF3 A;  3PS8 A;  3UL5 A;  2YFI B;  4HM3 B;  2ML5 A;  5AII A;  2STD A;  1VQM 3;  3GWR A;  2BMR B;  2CH9 A;  4N3V A;  1M9G A;  3HX8 A;  1QVG 2;  3CCQ 3;  1MNL A;  2OQE C;  2XSO B;  1WTH A;  3DY5 A;  3JUQ A;  1RRL A;  3LTA A;  1Q86 4;  2W9P A;  3K0Z A;  2BMO B;  1O7G B;  3TDG A;  2Y74 A;  4OK0 A;  4WP5 A;  3BNE A;  1OH0 A;  2XGN A;  3BND A;  2XFS A;  3D9R A;  3MPH A;  1ISK A;  1D6U A;  2CKF B;  4KFE A;  4N6V 0;  1WMO A;  3WA2 X;  1TFK A;  3G71 3;  1DMQ A;  1TFO A;  2GU1 A;  1HU9 A;  1Q40 B;  1VQ7 3;  3CCV 3;  2OTJ 3;  1ULI B;  3LXU X;  3CCJ 3;  3X42 A;  3KSP A;  3HZP A;  4I4K A;  1VQ5 3;  1RRH A;  1OGZ A;  3B7C A;  2CHC A;  3WMD A;  3CC4 3;  1IVU A;  1FA3 A;  1V74 A;  4RNZ A;  1STD A;  2LYX A;  1A2K A;  2WGO A;  3JUO A;  3EC9 A;  4IT7 A;  3S29 A;  1FUW A;  1LNH A;  2HMO B;  1A2V A;  2P38 A;  4JRF A;  2W2C A;  2F86 B;  4R1K A;  4WYK B;  3K5T A;  5IG4 A;  3STD A;  3EBY A;  2E2T A;  1TUH A;  2WOF A;  1LOX A;  3H51 A;  2Z76 A;  1NO3 A;  3F14 A;  4NRE A;  4LZI A;  3NV0 A;  3CCS 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...