4LZIA

Characterization of solanum tuberosum multicystatin and significance of core domains
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
277
structure length
277
Chain Sequence
GFTEVPFPNSPEFQDLTRFAVHQYNKDQNAHLEFVENLNVKKQVVAGMLYYITFAATDGGKKKIYETKIWVKVWENFKKVVEFKLVGDDSAKLGGIINVPFPNNPEFQDLARFAVQDYNKKENAHLEFVENLNVKEQLVAGMLYYITLVAIDAGKKKIYEAKIWVKEWENFKKVIEFKLIGDDSAIIGGFTDVPFPNNPEFQDLARFAVQDYNKKENAHLEYVENLNVKEQLVAGMIYYITLVATDAGKKKIYEAKIWVKEWEDFKKVVEFKLVGDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of Solanum tuberosum Multicystatin and the Significance of Core Domains.
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Hydrolase inhibitor
molecule keywords Multicystatin
total genus 69
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4lziA02
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4lziA03
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4lziA01
1EQKA 2CH9A 5A0OB 3MWZA 1DVDA 1MOLA 1TIJA 1NB5I 1N5PA 4TX4A 1KWIA 5LC7A 4N6NB 3KSED 1FA3A 1GD3A 4CCVA 1STFI 4ZM8A 2O9UX 4N6LA 1N5HA 3S67A 1LXEA 1N9JA 2KXGA 3PYJA 1IV9A 1RN7A 2W9PA 3L0RA 3NX0A 1G96A 1GD4A 3Q2PA 4N6UA 1PFPA 3SVAA 5LC6A 5EQLA 3GAXA 4N6TA 5ELUA 3IMAB 4N6V0 1A67A 3QRDA 3KFQC 3UL5A 1CEWI 1WNHA 3UL6A 4IT7A 4LZIA 4N6OB 3LH4A 4EYCA 1A90A 1M9GA 3PXMA 3PS8A 1CYUA 2W9QA 5ELJA 1DVCA 1NB3I 1MNLA 4N6MA 2BO9B 1FUWA 2OCTA 1YVBI 1R4CA 1ROAA 3K9MC 1CYVA 1IV7A
chains in the Genus database with same CATH superfamily
3MWZA 1V74A 2HMKB 1GY5A 3DGNA 4HM4B 5M1AA 1RSNA 1STFI 2O3OA 3G16A 1N5HA 1W6YA 1E3RA 1AVLA 2KXGA 1FGOA 4EV2A 1IV9A 1YJN3 3T8NA 4FMAA 3Q2PA 5CF1A 3EN8A 3TDGA 1K41A 1B2XA 2GBWB 2SBLA 1WQLB 2XF3A 4I4KA 4EYCA 3FG4A 3DGOA 2CFGA 1NO3A 5IG0A 4MMYB 5AEWB 3WA2X 1VQO3 1F8NA 3HIGA 3CCR3 1C7HA 3T0UA 2GSPA 1M1K4 1I3IA 2GU1A 5GSPA 1ISKA 2BMOB 3MG3A 4IIAA 1IVVA 3LTAA 2E2VA 3NBRA 2HMLB 3F7XA 1W2ZA 2CWTA 2D42A 3FGYA 5TGNA 1A2VA 3NXJA 5CK6A 2MC8A 4STDA 3U97A 3S27A 2W6JH 1L5GB 5AIGA 1SIHA 2BHMA 5IG5A 1BGSA 1TJDA 1GOVA 2QA43 5LC6A 3I563 4BIRA 1I70A 2R41A 2CFWA 1LOVA 1S5AA 1LOWA 3DY5A 3NV0A 5DRVA 4L8PA 3LT9A 3T8UA 1JBRA 1M9GA 1FGMA 1U5OA 1VQ43 2F56A 5BU4A 2YFJB 4XDWA 1CQSA 3SOYA 5EVHA 2OTL3 4J5GA 2XRXB 3D4AA 3F7SA 1CH0A 4RBNA 3DZLA 3SOAA 1GOYA 3ALAA 3MYTA 3FCSB 1ULIB 1VZZA 3NV0B 4X2OA 1I2FA 1OHSA 3SLUA 3H3HA 1OGZA 3FG3A 4HZ9B 1ASKA 2CFDA 1B21A 2GBXB 1IDPA 1N8R4 2HMMB 2D1WA 5IW9A 4FCMA 3GRDA 1J2BA 5I97A 1RGHA 3A5EA 4H3UA 4R1KA 4O02B 1Q824 2HMOB 2RNTA 3GWRA 1ROVA 2AADA 2BO9B 1UI8A 2MF7A 3CU3A 4KT3B 3X3XA 3X3YA 4XDVA 2CC3A 4R9KA 1GY6A 4WFOA 1EQKA 1KSIA 1RTUA 1FW7A 1DVDA 2W56A 8CHOA 4LGQA 1YJ93 3F9SA 1HKXA 3OV4A 3CCU3 1YIT3 2E2TA 3KIIA 3LMLA 2Y74A 1RDSA 1VQP3 4NPBA 4QWTA 1HZ1A 4X2HA 4MEIA 1IT7A 1AY7A 1JKGB 2OWPA 1Q9EA 1B3SA 7RNTA 2XGLA 2W56B 1B20A 2KRTA 2OOVC 3CCJ3 1AV4A 5STDA 3UB1A 3SX1A 3X42A 3CC23 4KZ1A 1OACA 4CPKA 1IQYA 1NJI4 3FG1A 3FKAA 4N6MA 1BANA 2Z7AA 3D79A 2KF3A 1BVIA 1RCLA 3JVCA 1JKGA 2BU4A 3LTCA 1GMRA 1I8VA 1TIJA 3ROBA 1N5PA 3SXXA 5KP4A 3J7Yd 4FMBA 1RNBA 1VQ93 1X1XA 2Q07A 2F4YA 5AIIA 2UUGC 2I9WA 3OWSA 1Q40B 4RNYA 5CLKA 3PCRA 1BRGA 2OOVA 3V99A 4KFFA 2IA7A 1FYSA 2GXFA 1JNQA 1UGHI 1UDII 1BSCA 1GD4A 3STDA 1BNRA 2BNGA 3UJMA 5M19A 2IMJA 4WP5A 1NWWA 2H0HA 1RLSA 3AHSA 1GY7A 1LQGC 4XM4A 5D82A 4AKYA 3CCM3 1A2KA 1RGEA 1B2SA 6STDA 1LVNA 1FA3A 1LNIA 1NNVA 1KC84 3EB8A 1SJWA 3KZTA 3OX9A 1UUWB 1N9EA 1TTOA 5JPUA 2E2UA 5BVBA 5IF6A 1O7HB 4BU4A 1BNIA 3HZPA 4OK0A 5A0OB 3CCQ3 1QJGA 2C11A 4HOHA 4BL2A 3RGAA 4U13A 4LYLB 4FMCA 1RGGA 3IJEB 2CK3H 3QK9A 1ULJB 2W9PA 4WHAA 1G96A 3WA3A 5BXQA 1M1XB 3KSPA 2P09A 1W02A 5IERA 1OUNA 1OPYA 2WGOA 2P05A 3DUKA 5JPPA 4K90B 1QALA 2GEYA 1TP6A 3WDGB 2XSOB 4AKZA 1PU4A 2F86B 1Y4KA 3DXOA 1K28A 1SARA 4WYKB 1Q42A 2ZDJA 3SYUA 3ZG5A 4LMIA 1EG9B 1BRHA 4HM8B 1QAKA 2INXA 4K61A 3S5CA 3CPOA 2IUKA 2WOHA 1NDOB 1R4YA 3KSED 7GSPA 1RGAA 2XSHB 4DKIA 1VQ83 1BAOA 2F5WA 1AR0A 2O9UX 1RJOA 3LYGA 3Q3FA 4N6LA 4OUQA 1QVG2 3CC43 5AEUB 1JZDA 3SVAA 5RNTA 1OHOA 2V1LA 3UNLA 1G02A 2M7OA 2AAEA 3DGYA 3EQQB 1I3FA 4GL6A 5G2GA 4N6OB 2YFLB 4K1UA 1B2ZA 2LQVA 3CCE3 1UCLA 3EN1B 1RNTA 3D5IA 1FGTA 4CDLA 1FUWA 1YVBI 3JUNA 1GMQA 3N9HA 5KP3A 1CYVA 1FUTA 1YVSA 1EKMA 1PYLA 1DE3A 1JN5A 2BIRA 3LXUX 5G1KA 2BMQB 3RGRA 3G0KA 1BU4A 4XBYA 4CCVA 1FUSA 1HYFA 1OF5B 3E99A 2CHCA 5IEOA 4BTXA 3CME3 3LTBA 3O8YA 1UW1A 1K734 1D6UA 1JB4A 2Y73A 1ZO2A 4LEHA 1AVKA 4KVHA 1WTHA 1VQL3 1UCJA 3FZWA 2WO0A 3I0YA 3LOYA 1BOXA 2QGUA 2W03A 2L1SA 1T3BA 3AGOA 3IMAB 5EQLA 3VF1A 4BL3A 5AYSC 4BTYA 5BIRA 1DMNA 3G713 1DMQA 4IT7A 4PEJA 2J8XB 3V98A 1RN4A 1Q40A 1UI7A 3B4PA 5DREA 5EEOA 2OCTA 2P38A 4ILFA 4N6UA 3KE7A 4XB5A 2QIYA 8RNTA 1N8QA 1B27A 1W7CA 3GSPA 1BUQA 1C54A 1IVXA 2KCDA 1VQ73 4GSPA 2UGIA 4HBRA 1EUIC 1OGXA 1BNJA 1BUJA 1LXEA 1KD14 4O3VA 2P0XA 3NM2A 1TUHA 3GZYB 3CPW2 3LTDA 3N8BA 2C10A 1JZOA 3EJVA 1JRQA 2W2CA 3K5TA 2IUJA 3DGMA 2ZL8A 3BNEA 4N6V0 5D83A 1A67A 4Q53A 3CC73 4HM6B 1KQS2 3G8ZA 1WMOA 1LOYA 2QEX3 1X1UA 4HM0B 3PS8A 3CXC2 1Q864 3BNCA 1BNGA 4BTWA 1HU9A 2HMJB 4HJLB 1OCVA 2GEXA 3AGNA 3K9MC 3BB9A 2CH9A 1IT8A 3B7CA 1IVWA 1MOLA 3CMA3 1Z1SA 4TX4A 5AIFA 3NUVA 1MWSA 4KFDA 1QAFA 3SEDA 2WOFA 1JV2B 2B24B 3PGBA 3B4OA 3FLJA 2KF4A 2Z6BA 1DYUA 2R4IA 3BU4A 4WYKA 4EXRA 1BRNL 3V92A 5IG4A 1BNFA 2HMNB 1MWTA 3ER7A 3HK4A 3UL5A 2XFTA 2L4VA 1GSPA 1RGCA 4N3VA 1BRKA 1Q7HA 2STDA 1IK3A 1ZS7A 3BLZA 5ELJA 4JF8A 1YIJ3 5IG3A 4KFEA 1O7MB 3ZFZA 3DGLA 1EA2A 3D9RA 3FF2A 5IEPA 1JBSA 1I2EA 5HGRA 2A15A 4FR9A 1TRQA 2RCDA 3S67A 4HYZA 3GZRA 2CWUA 3LZAA 3CCL3 6GSPA 4J5KA 2KF6A 1QVF2 1LOXA 3HI7A 1BSAA 2BMRB 2F99A 1D6YA 1BRIA 1JN5B 3QRDA 4XBXA 3D5GA 3G4S3 1IYYA 3MHEA 3WOEB 1MWRA 2CFLA 1OF5A 3K7CA 1VQM3 1B2UA 1BRJA 1SPUA 3DMCA 3OWUA 1MNLA 4RNTA 2B1XB 2CIUA 5FW5A 1W2B2 2W04A 2RFRA 1DETA 1SIIA 1BSBA 1RRHA 1ROAA 2XFSA 3NBBA 4LSOA 3CNMA 3DM8A 2RGQA 1GOUA 3X3ZA 1K8A4 1VQN3 1E97A 1RRLA 4HM1B 1KWIA 3BNBA 1E3VA 4N6NB 4FCZA 2GU3A 3CNXA 1I0VA 4FMDA 2UX0A 3Q1CA 2ML6A 4L7KA 2K54A 1WMPA 3HIIA 2CWVA 3EX9A 1M904 2K3DA 3L0RA 4EC6A 3KCHA 2CFKA 2JDIH 2WGQA 3OW22 3U1WA 1X1YA 3FF0A 1EEJA 3K63A 5ELUA 1AQZA 1GMPA 2BT3A 5KP1A 1RHLA 4R9LA 2YX9A 1A90A 3JUMA 1S723 4CJNA 1WMNA 3NM7A 2K0MA 4HM3B 4K1VA 5AI1A 1RGFA 2ML5A 1MWUA 4MMXB 3LT8A 3F8XA 4O8SA 2FXTA 1WNHA 1BNSA 3HX8A 3NQZA 4R4KA 4EW5A 1O7NB 4GHOA 1T2HA 3DH2A 1RN1A 4AEQA 3EBYA 3WMDA 1I0XA 2FGTA 4ZM8A 1Q7Y4 1D6ZA 1UUGB 1FGQA 2F5MA 1V57A 2PZVA 4J8TA 4R80A 3S29A 1VQ63 3FSDA 2CG1A 3EBTA 3S28A 1G0TA 1RGLA 2KF5A 2SARA 3F14A 3MSOA 3B8LA 5CF2A 3GAXA 2H0GA 4RNZA 4RZMA 5CXOA 4EV5A 2XR8B 1Q814 1CEWI 1STDA 2OQEC 3UL6A 1YNVX 3HOHA 3PXMA 1O7PB 1A2PA 2W9QA 1UCKA 2ZA4A 1NB3I 2YFIB 3URPA 3ZG0A 1RMSA 1TFKA 4O2HA 3WODG 5HOHA 1W4NA 7STDA 1JB2A 3CD63 1T2IA 3F40A 1FGRA 2W0QA 3FH1A 3MG2A 3H51A 3MPHA 5M18A 2HOHA 1SQWA 3GZBA 2RSXA 3CCS3 4I5QA 1YHQ3 1MGRA 3BNDA 3KKGA 1JBTA 5JBSA 2OQEA 4HVNA 3OWYA 4J9AA 3WHOA 1IVUA 4EBGA 1LQMB 2XGNA 3BIRA 5D81A 3VGNA 3PZWA 1W6GA 1VQ53 2KAAA 3ECFA 1TRPA 3KFQC 2P0MA 3N54B 4HM5B 3JUQA 3CCV3 1B2MA 1BRSA 4LZIA 1LNHA 1NU3A 1TFOA 1UUVB 1CYUA 1YGEA 3MKIA 1US1A 3GZXB 4G1MB 4HAAA 4L8OA 2CX1A 1DMMA 3VSYA 2Z77A 3EC9A 4MMZB 1R4CA 1IQ8A 1FZUA 1IV7A 4HM2B 1MGWA 3MG1A 2CKFB 1NB5I 4HZBB 3JUPA 1BNEA 1W00A 3A76A 3D3LA 1ZX2A 3K0ZA 3M8CA 1BSDA 1X1WA 4FCJA 4MJDA 5AIHA 9RNTA 3AMOA 3NX0A 3Q90A 1PFPA 1O7GB 3JUOA 4NREA 4N6TA 2ZHXB 1I2GA 2Z76A 3X41A 1U8CB 1TU5A 1W6CA 3NHXA 1RKYA 1JB5A 3I553 4HM7B 4H61A 3KN4A 2IYJA 3EE1A 3RNTA 1QMAA 3RDEA 1PY3A 1O7WB 2OTJ3 2F98A 1GYBA 4IPBA 3AMOB 3PCSA 5FGOA 4NHFA 4ORLA 1JJ22 3WR2A 2JQ5A 3LH4A 1LRAA 4XBTA 1BIRA 1W5ZA 4HKVB 1VQK3 1W01A 3F8HA 5LC7A 1GD3A 2PNCA 1YI23 1YGWA 1T5YA 5AYRB 1BSEA 1GS3A 1RGKA 2XEPA 3WOFB 1IQXA 3NQYA 5G1LA 1N9JA 2RBIA 4GB5A 4JRFA 2XH9A 1RN7A 3PYJA 2C4BA 1ZGXA 2H0IA 2IY2A 3X40A 1RCKA 3G6E3 1IU7A 2LYXA 1UGIA 3EF8A 5IENA 1K9M4 1V58A 2CX0A 1OHPA 1YJW3 2FNQA 1VQQA 4WWUC 1DVCA 3OXAA 4OVMA 3EHCA 1UCIA 2CW9A 3AHWA 6RNTA 3IPTA 1OH0A 2CG0A 3NBJA
chains in the Genus database with same CATH topology
3MWZA 1V74A 2HMKB 1GY5A 3DGNA 4HM4B 1STFI 2O3OA 3G16A 1N5HA 1W6YA 1E3RA 1AVLA 2KXGA 1FGOA 4EV2A 1IV9A 1YJN3 3T8NA 4FMAA 3Q2PA 5CF1A 3EN8A 3TDGA 1K41A 2GBWB 2SBLA 1WQLB 2XF3A 4I4KA 4EYCA 3FG4A 3DGOA 2CFGA 1NO3A 5IG0A 4MMYB 5AEWB 3WA2X 1VQO3 1F8NA 3HIGA 3CCR3 1C7HA 3T0UA 1M1K4 2GU1A 1ISKA 2BMOB 3MG3A 4IIAA 1IVVA 3LTAA 2E2VA 3NBRA 2HMLB 3F7XA 1W2ZA 2CWTA 2D42A 3FGYA 5TGNA 1A2VA 3NXJA 5CK6A 2MC8A 4STDA 3U97A 3S27A 2W6JH 1L5GB 5AIGA 1SIHA 2BHMA 5IG5A 2QA43 5LC6A 3I563 2CFWA 1S5AA 3DY5A 3NV0A 3T8UA 5DRVA 4L8PA 3LT9A 1M9GA 1FGMA 1U5OA 1VQ43 2YFJB 4XDWA 1CQSA 3SOYA 5EVHA 2OTL3 2XRXB 3F7SA 4RBNA 3DZLA 3SOAA 3ALAA 3MYTA 3FCSB 1ULIB 1VZZA 3NV0B 4X2OA 1OHSA 3SLUA 3H3HA 1OGZA 3FG3A 4HZ9B 1ASKA 2CFDA 2GBXB 1IDPA 1N8R4 2HMMB 2D1WA 5IW9A 4FCMA 3GRDA 1J2BA 5I97A 4H3UA 4R1KA 4O02B 1Q824 2HMOB 3GWRA 3CU3A 1ROVA 2BO9B 1UI8A 2MF7A 3X3XA 3X3YA 4XDVA 2CC3A 4R9KA 1GY6A 4WFOA 1EQKA 1KSIA 1DVDA 2W56A 8CHOA 4LGQA 1YJ93 3F9SA 1HKXA 3OV4A 3CCU3 2E2TA 3KIIA 3LMLA 2Y74A 1VQP3 4QWTA 4X2HA 4MEIA 1IT7A 1JKGB 2OWPA 2XGLA 2W56B 2KRTA 3CCJ3 2OOVC 1AV4A 5STDA 3UB1A 3SX1A 3X42A 3CC23 4KZ1A 1OACA 1IQYA 1NJI4 3FG1A 3FKAA 4N6MA 2Z7AA 3JVCA 1JKGA 3LTCA 1TIJA 3ROBA 1N5PA 3SXXA 5KP4A 3J7Yd 4FMBA 1VQ93 2Q07A 5AIIA 3OWSA 2I9WA 4RNYA 1Q40B 5CLKA 3PCRA 2OOVA 3V99A 4KFFA 2IA7A 2GXFA 1JNQA 3STDA 1GD4A 2BNGA 3UJMA 2IMJA 4WP5A 1NWWA 5D82A 3CCM3 1GY7A 4XM4A 4AKYA 1A2KA 6STDA 1LVNA 1FA3A 1KC84 3EB8A 1SJWA 3KZTA 3OX9A 1UUWB 1N9EA 5JPUA 2E2UA 5BVBA 5IF6A 1O7HB 4OK0A 3HZPA 5A0OB 3CCQ3 1QJGA 2C11A 3RGAA 4U13A 4FMCA 3IJEB 2CK3H 3QK9A 1ULJB 2W9PA 4WHAA 1G96A 3WA3A 5BXQA 1M1XB 3KSPA 2P09A 1W02A 5IERA 1OUNA 1OPYA 2WGOA 2P05A 3DUKA 5JPPA 4K90B 1QALA 2GEYA 1TP6A 3WDGB 2XSOB 4AKZA 1PU4A 2F86B 1Y4KA 3DXOA 1K28A 4WYKB 1Q42A 2ZDJA 4LMIA 1EG9B 4HM8B 4K61A 1QAKA 2INXA 3S5CA 3CPOA 2IUKA 2WOHA 1NDOB 1YIT3 3KSED 1VQ83 2XSHB 2O9UX 1AR0A 4N6LA 1RJOA 3LYGA 4OUQA 1QVG2 3CC43 5AEUB 3SVAA 1OHOA 2V1LA 3UNLA 2M7OA 3EQQB 4GL6A 5G2GA 4N6OB 2YFLB 4K1UA 2LQVA 3CCE3 3EN1B 1FGTA 4CDLA 1FUWA 1YVBI 3JUNA 3N9HA 5KP3A 1CYVA 1EKMA 1JN5A 3LXUX 2BMQB 3RGRA 3G0KA 4XBYA 4CCVA 1OF5B 3E99A 2CHCA 5IEOA 4BTXA 3CME3 3LTBA 3O8YA 1UW1A 1K734 1D6UA 1JB4A 2Y73A 1ZO2A 4LEHA 1AVKA 4KVHA 1WTHA 1VQL3 3FZWA 3I0YA 2WO0A 3LOYA 2QGUA 2W03A 5EQLA 3IMAB 3VF1A 4BTYA 5AYSC 1DMNA 3G713 1DMQA 4IT7A 4PEJA 3V98A 1UI7A 1Q40A 5DREA 3B4PA 5EEOA 2OCTA 2P38A 4N6UA 3KE7A 4XB5A 2QIYA 1N8QA 1W7CA 1BUQA 1IVXA 2KCDA 1VQ73 4HBRA 1OGXA 1LXEA 1KD14 4O3VA 2P0XA 3NM2A 1TUHA 3GZYB 3CPW2 3LTDA 3N8BA 2C10A 3EJVA 1JRQA 2W2CA 3K5TA 2IUJA 3DGMA 2ZL8A 3BNEA 4N6V0 5D83A 1A67A 4Q53A 3CC73 4HM6B 1KQS2 3G8ZA 1WMOA 2QEX3 4HM0B 3PS8A 3CXC2 1Q864 3BNCA 4BTWA 1HU9A 2HMJB 4HJLB 1OCVA 2GEXA 3K9MC 3BB9A 2CH9A 1IT8A 3B7CA 1IVWA 1MOLA 3CMA3 1Z1SA 4TX4A 5AIFA 3NUVA 4KFDA 1QAFA 3SEDA 2WOFA 1JV2B 2B24B 3PGBA 3B4OA 3FLJA 2Z6BA 1DYUA 2R4IA 4WYKA 4EXRA 3V92A 5IG4A 2HMNB 3ER7A 3HK4A 3UL5A 2XFTA 2L4VA 4N3VA 1IK3A 2STDA 3BLZA 1YIJ3 5ELJA 4JF8A 5IG3A 4KFEA 1O7MB 3DGLA 1EA2A 3D9RA 3FF2A 5IEPA 5HGRA 2A15A 4FR9A 2RCDA 3S67A 4HYZA 3GZRA 2CWUA 3LZAA 3CCL3 1QVF2 1LOXA 3HI7A 2BMRB 2F99A 1D6YA 1JN5B 3QRDA 4XBXA 3G4S3 3MHEA 3WOEB 1VQM3 2CFLA 1OF5A 3K7CA 1SPUA 3DMCA 3OWUA 1MNLA 2B1XB 2CIUA 5FW5A 1W2B2 2W04A 2RFRA 1SIIA 1RRHA 4LSOA 1ROAA 2XFSA 3NBBA 3CNMA 3DM8A 2RGQA 3X3ZA 1K8A4 1VQN3 1E97A 1RRLA 4HM1B 1KWIA 3BNBA 1E3VA 4N6NB 4FCZA 2GU3A 3CNXA 4FMDA 2UX0A 3Q1CA 2ML6A 4L7KA 2K54A 1WMPA 3HIIA 2CWVA 3EX9A 1M904 4EC6A 3L0RA 2CFKA 2JDIH 2WGQA 3OW22 3U1WA 3FF0A 3K63A 5ELUA 2BT3A 5KP1A 4R9LA 2YX9A 1A90A 3JUMA 1S723 1WMNA 3NM7A 2K0MA 4HM3B 4K1VA 5AI1A 2ML5A 4MMXB 3LT8A 3F8XA 4O8SA 2FXTA 1WNHA 3HX8A 4R4KA 3NQZA 1O7NB 4AEQA 3EBYA 3WMDA 2FGTA 4ZM8A 1Q7Y4 1D6ZA 1FGQA 2PZVA 4J8TA 4R80A 3S29A 1VQ63 3FSDA 2CG1A 3EBTA 3S28A 3F14A 3MSOA 3B8LA 5CF2A 3GAXA 4RNZA 4RZMA 5CXOA 4EV5A 2XR8B 1Q814 1CEWI 1STDA 2OQEC 3UL6A 3PXMA 1O7PB 2W9QA 1NB3I 2YFIB 1TFKA 4O2HA 3WODG 1W4NA 7STDA 1JB2A 3CD63 3F40A 1FGRA 2W0QA 3FH1A 3MG2A 3H51A 3MPHA 1SQWA 3GZBA 2RSXA 3CCS3 1YHQ3 3BNDA 3KKGA 5JBSA 2OQEA 4HVNA 3OWYA 4J9AA 4EBGA 1IVUA 2XGNA 5D81A 3VGNA 3PZWA 1W6GA 1VQ53 3ECFA 3KFQC 2P0MA 3N54B 4HM5B 3JUQA 3CCV3 4LZIA 1LNHA 1NU3A 1TFOA 1UUVB 1CYUA 1YGEA 3MKIA 1US1A 3GZXB 4G1MB 4L8OA 1DMMA 3VSYA 2Z77A 3EC9A 4MMZB 1R4CA 1IQ8A 1IV7A 4HM2B 3MG1A 2CKFB 1NB5I 4HZBB 3JUPA 1W00A 3A76A 3D3LA 1ZX2A 3K0ZA 3M8CA 4FCJA 4MJDA 5AIHA 3AMOA 3NX0A 3Q90A 1PFPA 1O7GB 3JUOA 4NREA 4N6TA 2Z76A 3X41A 1U8CB 1TU5A 1W6CA 3NHXA 1RKYA 1JB5A 3I553 4HM7B 4H61A 3KN4A 3EE1A 1QMAA 3RDEA 2OTJ3 1O7WB 2F98A 1GYBA 4IPBA 3AMOB 3PCSA 5FGOA 4NHFA 4ORLA 1JJ22 2JQ5A 3LH4A 4XBTA 1W5ZA 1VQK3 4HKVB 1W01A 3F8HA 5LC7A 1GD3A 2PNCA 1YI23 1T5YA 5AYRB 1GS3A 2XEPA 3WOFB 1IQXA 3NQYA 1N9JA 4GB5A 4JRFA 2XH9A 1RN7A 3PYJA 3X40A 3G6E3 1IU7A 2LYXA 3EF8A 5IENA 1K9M4 1OHPA 1YJW3 2FNQA 4WWUC 1DVCA 3OXAA 4OVMA 3EHCA 2CW9A 3IPTA 1OH0A 2CG0A 3NBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQK A;  2CH9 A;  5A0O B;  3MWZ A;  1DVD A;  1MOL A;  1TIJ A;  1NB5 I;  1N5P A;  4TX4 A;  1KWI A;  5LC7 A;  4N6N B;  3KSE D;  1FA3 A;  1GD3 A;  4CCV A;  1STF I;  4ZM8 A;  2O9U X;  4N6L A;  1N5H A;  3S67 A;  1LXE A;  1N9J A;  2KXG A;  3PYJ A;  1IV9 A;  1RN7 A;  2W9P A;  3L0R A;  3NX0 A;  1G96 A;  1GD4 A;  3Q2P A;  4N6U A;  1PFP A;  3SVA A;  5LC6 A;  5EQL A;  3GAX A;  4N6T A;  5ELU A;  3IMA B;  4N6V 0;  1A67 A;  3QRD A;  3KFQ C;  3UL5 A;  1CEW I;  1WNH A;  3UL6 A;  4IT7 A;  4LZI A;  4N6O B;  3LH4 A;  4EYC A;  1A90 A;  1M9G A;  3PXM A;  3PS8 A;  1CYU A;  2W9Q A;  5ELJ A;  1DVC A;  1NB3 I;  1MNL A;  4N6M A;  2BO9 B;  1FUW A;  2OCT A;  1YVB I;  1R4C A;  1ROA A;  3K9M C;  1CYV A;  1IV7 A; 
#chains in the Genus database with same CATH topology
 3MWZ A;  1V74 A;  2HMK B;  1GY5 A;  3DGN A;  4HM4 B;  5M1A A;  1RSN A;  1STF I;  2O3O A;  3G16 A;  1N5H A;  1W6Y A;  1E3R A;  1AVL A;  2KXG A;  1FGO A;  4EV2 A;  1IV9 A;  1YJN 3;  3T8N A;  4FMA A;  3Q2P A;  5CF1 A;  3EN8 A;  3TDG A;  1K41 A;  1B2X A;  2GBW B;  2SBL A;  1WQL B;  2XF3 A;  4I4K A;  4EYC A;  3FG4 A;  3DGO A;  2CFG A;  1NO3 A;  5IG0 A;  4MMY B;  5AEW B;  3WA2 X;  1VQO 3;  1F8N A;  3HIG A;  3CCR 3;  1C7H A;  3T0U A;  2GSP A;  1M1K 4;  1I3I A;  2GU1 A;  5GSP A;  1ISK A;  2BMO B;  3MG3 A;  4IIA A;  1IVV A;  3LTA A;  2E2V A;  3NBR A;  2HML B;  3F7X A;  1W2Z A;  2CWT A;  2D42 A;  3FGY A;  5TGN A;  1A2V A;  3NXJ A;  5CK6 A;  2MC8 A;  4STD A;  3U97 A;  3S27 A;  2W6J H;  1L5G B;  5AIG A;  1SIH A;  2BHM A;  5IG5 A;  1BGS A;  1TJD A;  1GOV A;  2QA4 3;  5LC6 A;  3I56 3;  4BIR A;  1I70 A;  2R41 A;  2CFW A;  1LOV A;  1S5A A;  1LOW A;  3DY5 A;  3NV0 A;  5DRV A;  4L8P A;  3LT9 A;  3T8U A;  1JBR A;  1M9G A;  1FGM A;  1U5O A;  1VQ4 3;  2F56 A;  5BU4 A;  2YFJ B;  4XDW A;  1CQS A;  3SOY A;  5EVH A;  2OTL 3;  4J5G A;  2XRX B;  3D4A A;  3F7S A;  1CH0 A;  4RBN A;  3DZL A;  3SOA A;  1GOY A;  3ALA A;  3MYT A;  3FCS B;  1ULI B;  1VZZ A;  3NV0 B;  4X2O A;  1I2F A;  1OHS A;  3SLU A;  3H3H A;  1OGZ A;  3FG3 A;  4HZ9 B;  1ASK A;  2CFD A;  1B21 A;  2GBX B;  1IDP A;  1N8R 4;  2HMM B;  2D1W A;  5IW9 A;  4FCM A;  3GRD A;  1J2B A;  5I97 A;  1RGH A;  3A5E A;  4H3U A;  4R1K A;  4O02 B;  1Q82 4;  2HMO B;  2RNT A;  3GWR A;  1ROV A;  2AAD A;  2BO9 B;  1UI8 A;  2MF7 A;  3CU3 A;  4KT3 B;  3X3X A;  3X3Y A;  4XDV A;  2CC3 A;  4R9K A;  1GY6 A;  4WFO A;  1EQK A;  1KSI A;  1RTU A;  1FW7 A;  1DVD A;  2W56 A;  8CHO A;  4LGQ A;  1YJ9 3;  3F9S A;  1HKX A;  3OV4 A;  3CCU 3;  1YIT 3;  2E2T A;  3KII A;  3LML A;  2Y74 A;  1RDS A;  1VQP 3;  4NPB A;  4QWT A;  1HZ1 A;  4X2H A;  4MEI A;  1IT7 A;  1AY7 A;  1JKG B;  2OWP A;  1Q9E A;  1B3S A;  7RNT A;  2XGL A;  2W56 B;  1B20 A;  2KRT A;  2OOV C;  3CCJ 3;  1AV4 A;  5STD A;  3UB1 A;  3SX1 A;  3X42 A;  3CC2 3;  4KZ1 A;  1OAC A;  4CPK A;  1IQY A;  1NJI 4;  3FG1 A;  3FKA A;  4N6M A;  1BAN A;  2Z7A A;  3D79 A;  2KF3 A;  1BVI A;  1RCL A;  3JVC A;  1JKG A;  2BU4 A;  3LTC A;  1GMR A;  1I8V A;  1TIJ A;  3ROB A;  1N5P A;  3SXX A;  5KP4 A;  3J7Y d;  4FMB A;  1RNB A;  1VQ9 3;  1X1X A;  2Q07 A;  2F4Y A;  5AII A;  2UUG C;  2I9W A;  3OWS A;  1Q40 B;  4RNY A;  5CLK A;  3PCR A;  1BRG A;  2OOV A;  3V99 A;  4KFF A;  2IA7 A;  1FYS A;  2GXF A;  1JNQ A;  1UGH I;  1UDI I;  1BSC A;  1GD4 A;  3STD A;  1BNR A;  2BNG A;  3UJM A;  5M19 A;  2IMJ A;  4WP5 A;  1NWW A;  2H0H A;  1RLS A;  3AHS A;  1GY7 A;  1LQG C;  4XM4 A;  5D82 A;  4AKY A;  3CCM 3;  1A2K A;  1RGE A;  1B2S A;  6STD A;  1LVN A;  1FA3 A;  1LNI A;  1NNV A;  1KC8 4;  3EB8 A;  1SJW A;  3KZT A;  3OX9 A;  1UUW B;  1N9E A;  1TTO A;  5JPU A;  2E2U A;  5BVB A;  5IF6 A;  1O7H B;  4BU4 A;  1BNI A;  3HZP A;  4OK0 A;  5A0O B;  3CCQ 3;  1QJG A;  2C11 A;  4HOH A;  4BL2 A;  3RGA A;  4U13 A;  4LYL B;  4FMC A;  1RGG A;  3IJE B;  2CK3 H;  3QK9 A;  1ULJ B;  2W9P A;  4WHA A;  1G96 A;  3WA3 A;  5BXQ A;  1M1X B;  3KSP A;  2P09 A;  1W02 A;  5IER A;  1OUN A;  1OPY A;  2WGO A;  2P05 A;  3DUK A;  5JPP A;  4K90 B;  1QAL A;  2GEY A;  1TP6 A;  3WDG B;  2XSO B;  4AKZ A;  1PU4 A;  2F86 B;  1Y4K A;  3DXO A;  1K28 A;  1SAR A;  4WYK B;  1Q42 A;  2ZDJ A;  3SYU A;  3ZG5 A;  4LMI A;  1EG9 B;  1BRH A;  4HM8 B;  1QAK A;  2INX A;  4K61 A;  3S5C A;  3CPO A;  2IUK A;  2WOH A;  1NDO B;  1R4Y A;  3KSE D;  7GSP A;  1RGA A;  2XSH B;  4DKI A;  1VQ8 3;  1BAO A;  2F5W A;  1AR0 A;  2O9U X;  1RJO A;  3LYG A;  3Q3F A;  4N6L A;  4OUQ A;  1QVG 2;  3CC4 3;  5AEU B;  1JZD A;  3SVA A;  5RNT A;  1OHO A;  2V1L A;  3UNL A;  1G02 A;  2M7O A;  2AAE A;  3DGY A;  3EQQ B;  1I3F A;  4GL6 A;  5G2G A;  4N6O B;  2YFL B;  4K1U A;  1B2Z A;  2LQV A;  3CCE 3;  1UCL A;  3EN1 B;  1RNT A;  3D5I A;  1FGT A;  4CDL A;  1FUW A;  1YVB I;  3JUN A;  1GMQ A;  3N9H A;  5KP3 A;  1CYV A;  1FUT A;  1YVS A;  1EKM A;  1PYL A;  1DE3 A;  1JN5 A;  2BIR A;  3LXU X;  5G1K A;  2BMQ B;  3RGR A;  3G0K A;  1BU4 A;  4XBY A;  4CCV A;  1FUS A;  1HYF A;  1OF5 B;  3E99 A;  2CHC A;  5IEO A;  4BTX A;  3CME 3;  3LTB A;  3O8Y A;  1UW1 A;  1K73 4;  1D6U A;  1JB4 A;  2Y73 A;  1ZO2 A;  4LEH A;  1AVK A;  4KVH A;  1WTH A;  1VQL 3;  1UCJ A;  3FZW A;  2WO0 A;  3I0Y A;  3LOY A;  1BOX A;  2QGU A;  2W03 A;  2L1S A;  1T3B A;  3AGO A;  3IMA B;  5EQL A;  3VF1 A;  4BL3 A;  5AYS C;  4BTY A;  5BIR A;  1DMN A;  3G71 3;  1DMQ A;  4IT7 A;  4PEJ A;  2J8X B;  3V98 A;  1RN4 A;  1Q40 A;  1UI7 A;  3B4P A;  5DRE A;  5EEO A;  2OCT A;  2P38 A;  4ILF A;  4N6U A;  3KE7 A;  4XB5 A;  2QIY A;  8RNT A;  1N8Q A;  1B27 A;  1W7C A;  3GSP A;  1BUQ A;  1C54 A;  1IVX A;  2KCD A;  1VQ7 3;  4GSP A;  2UGI A;  4HBR A;  1EUI C;  1OGX A;  1BNJ A;  1BUJ A;  1LXE A;  1KD1 4;  4O3V A;  2P0X A;  3NM2 A;  1TUH A;  3GZY B;  3CPW 2;  3LTD A;  3N8B A;  2C10 A;  1JZO A;  3EJV A;  1JRQ A;  2W2C A;  3K5T A;  2IUJ A;  3DGM A;  2ZL8 A;  3BNE A;  4N6V 0;  5D83 A;  1A67 A;  4Q53 A;  3CC7 3;  4HM6 B;  1KQS 2;  3G8Z A;  1WMO A;  1LOY A;  2QEX 3;  1X1U A;  4HM0 B;  3PS8 A;  3CXC 2;  1Q86 4;  3BNC A;  1BNG A;  4BTW A;  1HU9 A;  2HMJ B;  4HJL B;  1OCV A;  2GEX A;  3AGN A;  3K9M C;  3BB9 A;  2CH9 A;  1IT8 A;  3B7C A;  1IVW A;  1MOL A;  3CMA 3;  1Z1S A;  4TX4 A;  5AIF A;  3NUV A;  1MWS A;  4KFD A;  1QAF A;  3SED A;  2WOF A;  1JV2 B;  2B24 B;  3PGB A;  3B4O A;  3FLJ A;  2KF4 A;  2Z6B A;  1DYU A;  2R4I A;  3BU4 A;  4WYK A;  4EXR A;  1BRN L;  3V92 A;  5IG4 A;  1BNF A;  2HMN B;  1MWT A;  3ER7 A;  3HK4 A;  3UL5 A;  2XFT A;  2L4V A;  1GSP A;  1RGC A;  4N3V A;  1BRK A;  1Q7H A;  2STD A;  1IK3 A;  1ZS7 A;  3BLZ A;  5ELJ A;  4JF8 A;  1YIJ 3;  5IG3 A;  4KFE A;  1O7M B;  3ZFZ A;  3DGL A;  1EA2 A;  3D9R A;  3FF2 A;  5IEP A;  1JBS A;  1I2E A;  5HGR A;  2A15 A;  4FR9 A;  1TRQ A;  2RCD A;  3S67 A;  4HYZ A;  3GZR A;  2CWU A;  3LZA A;  3CCL 3;  6GSP A;  4J5K A;  2KF6 A;  1QVF 2;  1LOX A;  3HI7 A;  1BSA A;  2BMR B;  2F99 A;  1D6Y A;  1BRI A;  1JN5 B;  3QRD A;  4XBX A;  3D5G A;  3G4S 3;  1IYY A;  3MHE A;  3WOE B;  1MWR A;  2CFL A;  1OF5 A;  3K7C A;  1VQM 3;  1B2U A;  1BRJ A;  1SPU A;  3DMC A;  3OWU A;  1MNL A;  4RNT A;  2B1X B;  2CIU A;  5FW5 A;  1W2B 2;  2W04 A;  2RFR A;  1DET A;  1SII A;  1BSB A;  1RRH A;  1ROA A;  2XFS A;  3NBB A;  4LSO A;  3CNM A;  3DM8 A;  2RGQ A;  1GOU A;  3X3Z A;  1K8A 4;  1VQN 3;  1E97 A;  1RRL A;  4HM1 B;  1KWI A;  3BNB A;  1E3V A;  4N6N B;  4FCZ A;  2GU3 A;  3CNX A;  1I0V A;  4FMD A;  2UX0 A;  3Q1C A;  2ML6 A;  4L7K A;  2K54 A;  1WMP A;  3HII A;  2CWV A;  3EX9 A;  1M90 4;  2K3D A;  3L0R A;  4EC6 A;  3KCH A;  2CFK A;  2JDI H;  2WGQ A;  3OW2 2;  3U1W A;  1X1Y A;  3FF0 A;  1EEJ A;  3K63 A;  5ELU A;  1AQZ A;  1GMP A;  2BT3 A;  5KP1 A;  1RHL A;  4R9L A;  2YX9 A;  1A90 A;  3JUM A;  1S72 3;  4CJN A;  1WMN A;  3NM7 A;  2K0M A;  4HM3 B;  4K1V A;  5AI1 A;  1RGF A;  2ML5 A;  1MWU A;  4MMX B;  3LT8 A;  3F8X A;  4O8S A;  2FXT A;  1WNH A;  1BNS A;  3HX8 A;  3NQZ A;  4R4K A;  4EW5 A;  1O7N B;  4GHO A;  1T2H A;  3DH2 A;  1RN1 A;  4AEQ A;  3EBY A;  3WMD A;  1I0X A;  2FGT A;  4ZM8 A;  1Q7Y 4;  1D6Z A;  1UUG B;  1FGQ A;  2F5M A;  1V57 A;  2PZV A;  4J8T A;  4R80 A;  3S29 A;  1VQ6 3;  3FSD A;  2CG1 A;  3EBT A;  3S28 A;  1G0T A;  1RGL A;  2KF5 A;  2SAR A;  3F14 A;  3MSO A;  3B8L A;  5CF2 A;  3GAX A;  2H0G A;  4RNZ A;  4RZM A;  5CXO A;  4EV5 A;  2XR8 B;  1Q81 4;  1CEW I;  1STD A;  2OQE C;  3UL6 A;  1YNV X;  3HOH A;  3PXM A;  1O7P B;  1A2P A;  2W9Q A;  1UCK A;  2ZA4 A;  1NB3 I;  2YFI B;  3URP A;  3ZG0 A;  1RMS A;  1TFK A;  4O2H A;  3WOD G;  5HOH A;  1W4N A;  7STD A;  1JB2 A;  3CD6 3;  1T2I A;  3F40 A;  1FGR A;  2W0Q A;  3FH1 A;  3MG2 A;  3H51 A;  3MPH A;  5M18 A;  2HOH A;  1SQW A;  3GZB A;  2RSX A;  3CCS 3;  4I5Q A;  1YHQ 3;  1MGR A;  3BND A;  3KKG A;  1JBT A;  5JBS A;  2OQE A;  4HVN A;  3OWY A;  4J9A A;  3WHO A;  1IVU A;  4EBG A;  1LQM B;  2XGN A;  3BIR A;  5D81 A;  3VGN A;  3PZW A;  1W6G A;  1VQ5 3;  2KAA A;  3ECF A;  1TRP A;  3KFQ C;  2P0M A;  3N54 B;  4HM5 B;  3JUQ A;  3CCV 3;  1B2M A;  1BRS A;  4LZI A;  1LNH A;  1NU3 A;  1TFO A;  1UUV B;  1CYU A;  1YGE A;  3MKI A;  1US1 A;  3GZX B;  4G1M B;  4HAA A;  4L8O A;  2CX1 A;  1DMM A;  3VSY A;  2Z77 A;  3EC9 A;  4MMZ B;  1R4C A;  1IQ8 A;  1FZU A;  1IV7 A;  4HM2 B;  1MGW A;  3MG1 A;  2CKF B;  1NB5 I;  4HZB B;  3JUP A;  1BNE A;  1W00 A;  3A76 A;  3D3L A;  1ZX2 A;  3K0Z A;  3M8C A;  1BSD A;  1X1W A;  4FCJ A;  4MJD A;  5AIH A;  9RNT A;  3AMO A;  3NX0 A;  3Q90 A;  1PFP A;  1O7G B;  3JUO A;  4NRE A;  4N6T A;  2ZHX B;  1I2G A;  2Z76 A;  3X41 A;  1U8C B;  1TU5 A;  1W6C A;  3NHX A;  1RKY A;  1JB5 A;  3I55 3;  4HM7 B;  4H61 A;  3KN4 A;  2IYJ A;  3EE1 A;  3RNT A;  1QMA A;  3RDE A;  1PY3 A;  1O7W B;  2OTJ 3;  2F98 A;  1GYB A;  4IPB A;  3AMO B;  3PCS A;  5FGO A;  4NHF A;  4ORL A;  1JJ2 2;  3WR2 A;  2JQ5 A;  3LH4 A;  1LRA A;  4XBT A;  1BIR A;  1W5Z A;  4HKV B;  1VQK 3;  1W01 A;  3F8H A;  5LC7 A;  1GD3 A;  2PNC A;  1YI2 3;  1YGW A;  1T5Y A;  5AYR B;  1BSE A;  1GS3 A;  1RGK A;  2XEP A;  3WOF B;  1IQX A;  3NQY A;  5G1L A;  1N9J A;  2RBI A;  4GB5 A;  4JRF A;  2XH9 A;  1RN7 A;  3PYJ A;  2C4B A;  1ZGX A;  2H0I A;  2IY2 A;  3X40 A;  1RCK A;  3G6E 3;  1IU7 A;  2LYX A;  1UGI A;  3EF8 A;  5IEN A;  1K9M 4;  1V58 A;  2CX0 A;  1OHP A;  1YJW 3;  2FNQ A;  1VQQ A;  4WWU C;  1DVC A;  3OXA A;  4OVM A;  3EHC A;  1UCI A;  2CW9 A;  3AHW A;  6RNT A;  3IPT A;  1OH0 A;  2CG0 A;  3NBJ A; 
#chains in the Genus database with same CATH homology
 3MWZ A;  1V74 A;  2HMK B;  1GY5 A;  3DGN A;  4HM4 B;  1STF I;  2O3O A;  3G16 A;  1N5H A;  1W6Y A;  1E3R A;  1AVL A;  2KXG A;  1FGO A;  4EV2 A;  1IV9 A;  1YJN 3;  3T8N A;  4FMA A;  3Q2P A;  5CF1 A;  3EN8 A;  3TDG A;  1K41 A;  2GBW B;  2SBL A;  1WQL B;  2XF3 A;  4I4K A;  4EYC A;  3FG4 A;  3DGO A;  2CFG A;  1NO3 A;  5IG0 A;  4MMY B;  5AEW B;  3WA2 X;  1VQO 3;  1F8N A;  3HIG A;  3CCR 3;  1C7H A;  3T0U A;  1M1K 4;  2GU1 A;  1ISK A;  2BMO B;  3MG3 A;  4IIA A;  1IVV A;  3LTA A;  2E2V A;  3NBR A;  2HML B;  3F7X A;  1W2Z A;  2CWT A;  2D42 A;  3FGY A;  5TGN A;  1A2V A;  3NXJ A;  5CK6 A;  2MC8 A;  4STD A;  3U97 A;  3S27 A;  2W6J H;  1L5G B;  5AIG A;  1SIH A;  2BHM A;  5IG5 A;  2QA4 3;  5LC6 A;  3I56 3;  2CFW A;  1S5A A;  3DY5 A;  3NV0 A;  3T8U A;  5DRV A;  4L8P A;  3LT9 A;  1M9G A;  1FGM A;  1U5O A;  1VQ4 3;  2YFJ B;  4XDW A;  1CQS A;  3SOY A;  5EVH A;  2OTL 3;  2XRX B;  3F7S A;  4RBN A;  3DZL A;  3SOA A;  3ALA A;  3MYT A;  3FCS B;  1ULI B;  1VZZ A;  3NV0 B;  4X2O A;  1OHS A;  3SLU A;  3H3H A;  1OGZ A;  3FG3 A;  4HZ9 B;  1ASK A;  2CFD A;  2GBX B;  1IDP A;  1N8R 4;  2HMM B;  2D1W A;  5IW9 A;  4FCM A;  3GRD A;  1J2B A;  5I97 A;  4H3U A;  4R1K A;  4O02 B;  1Q82 4;  2HMO B;  3GWR A;  3CU3 A;  1ROV A;  2BO9 B;  1UI8 A;  2MF7 A;  3X3X A;  3X3Y A;  4XDV A;  2CC3 A;  4R9K A;  1GY6 A;  4WFO A;  1EQK A;  1KSI A;  1DVD A;  2W56 A;  8CHO A;  4LGQ A;  1YJ9 3;  3F9S A;  1HKX A;  3OV4 A;  3CCU 3;  2E2T A;  3KII A;  3LML A;  2Y74 A;  1VQP 3;  4QWT A;  4X2H A;  4MEI A;  1IT7 A;  1JKG B;  2OWP A;  2XGL A;  2W56 B;  2KRT A;  3CCJ 3;  2OOV C;  1AV4 A;  5STD A;  3UB1 A;  3SX1 A;  3X42 A;  3CC2 3;  4KZ1 A;  1OAC A;  1IQY A;  1NJI 4;  3FG1 A;  3FKA A;  4N6M A;  2Z7A A;  3JVC A;  1JKG A;  3LTC A;  1TIJ A;  3ROB A;  1N5P A;  3SXX A;  5KP4 A;  3J7Y d;  4FMB A;  1VQ9 3;  2Q07 A;  5AII A;  3OWS A;  2I9W A;  4RNY A;  1Q40 B;  5CLK A;  3PCR A;  2OOV A;  3V99 A;  4KFF A;  2IA7 A;  2GXF A;  1JNQ A;  3STD A;  1GD4 A;  2BNG A;  3UJM A;  2IMJ A;  4WP5 A;  1NWW A;  5D82 A;  3CCM 3;  1GY7 A;  4XM4 A;  4AKY A;  1A2K A;  6STD A;  1LVN A;  1FA3 A;  1KC8 4;  3EB8 A;  1SJW A;  3KZT A;  3OX9 A;  1UUW B;  1N9E A;  5JPU A;  2E2U A;  5BVB A;  5IF6 A;  1O7H B;  4OK0 A;  3HZP A;  5A0O B;  3CCQ 3;  1QJG A;  2C11 A;  3RGA A;  4U13 A;  4FMC A;  3IJE B;  2CK3 H;  3QK9 A;  1ULJ B;  2W9P A;  4WHA A;  1G96 A;  3WA3 A;  5BXQ A;  1M1X B;  3KSP A;  2P09 A;  1W02 A;  5IER A;  1OUN A;  1OPY A;  2WGO A;  2P05 A;  3DUK A;  5JPP A;  4K90 B;  1QAL A;  2GEY A;  1TP6 A;  3WDG B;  2XSO B;  4AKZ A;  1PU4 A;  2F86 B;  1Y4K A;  3DXO A;  1K28 A;  4WYK B;  1Q42 A;  2ZDJ A;  4LMI A;  1EG9 B;  4HM8 B;  4K61 A;  1QAK A;  2INX A;  3S5C A;  3CPO A;  2IUK A;  2WOH A;  1NDO B;  1YIT 3;  3KSE D;  1VQ8 3;  2XSH B;  2O9U X;  1AR0 A;  4N6L A;  1RJO A;  3LYG A;  4OUQ A;  1QVG 2;  3CC4 3;  5AEU B;  3SVA A;  1OHO A;  2V1L A;  3UNL A;  2M7O A;  3EQQ B;  4GL6 A;  5G2G A;  4N6O B;  2YFL B;  4K1U A;  2LQV A;  3CCE 3;  3EN1 B;  1FGT A;  4CDL A;  1FUW A;  1YVB I;  3JUN A;  3N9H A;  5KP3 A;  1CYV A;  1EKM A;  1JN5 A;  3LXU X;  2BMQ B;  3RGR A;  3G0K A;  4XBY A;  4CCV A;  1OF5 B;  3E99 A;  2CHC A;  5IEO A;  4BTX A;  3CME 3;  3LTB A;  3O8Y A;  1UW1 A;  1K73 4;  1D6U A;  1JB4 A;  2Y73 A;  1ZO2 A;  4LEH A;  1AVK A;  4KVH A;  1WTH A;  1VQL 3;  3FZW A;  3I0Y A;  2WO0 A;  3LOY A;  2QGU A;  2W03 A;  5EQL A;  3IMA B;  3VF1 A;  4BTY A;  5AYS C;  1DMN A;  3G71 3;  1DMQ A;  4IT7 A;  4PEJ A;  3V98 A;  1UI7 A;  1Q40 A;  5DRE A;  3B4P A;  5EEO A;  2OCT A;  2P38 A;  4N6U A;  3KE7 A;  4XB5 A;  2QIY A;  1N8Q A;  1W7C A;  1BUQ A;  1IVX A;  2KCD A;  1VQ7 3;  4HBR A;  1OGX A;  1LXE A;  1KD1 4;  4O3V A;  2P0X A;  3NM2 A;  1TUH A;  3GZY B;  3CPW 2;  3LTD A;  3N8B A;  2C10 A;  3EJV A;  1JRQ A;  2W2C A;  3K5T A;  2IUJ A;  3DGM A;  2ZL8 A;  3BNE A;  4N6V 0;  5D83 A;  1A67 A;  4Q53 A;  3CC7 3;  4HM6 B;  1KQS 2;  3G8Z A;  1WMO A;  2QEX 3;  4HM0 B;  3PS8 A;  3CXC 2;  1Q86 4;  3BNC A;  4BTW A;  1HU9 A;  2HMJ B;  4HJL B;  1OCV A;  2GEX A;  3K9M C;  3BB9 A;  2CH9 A;  1IT8 A;  3B7C A;  1IVW A;  1MOL A;  3CMA 3;  1Z1S A;  4TX4 A;  5AIF A;  3NUV A;  4KFD A;  1QAF A;  3SED A;  2WOF A;  1JV2 B;  2B24 B;  3PGB A;  3B4O A;  3FLJ A;  2Z6B A;  1DYU A;  2R4I A;  4WYK A;  4EXR A;  3V92 A;  5IG4 A;  2HMN B;  3ER7 A;  3HK4 A;  3UL5 A;  2XFT A;  2L4V A;  4N3V A;  1IK3 A;  2STD A;  3BLZ A;  1YIJ 3;  5ELJ A;  4JF8 A;  5IG3 A;  4KFE A;  1O7M B;  3DGL A;  1EA2 A;  3D9R A;  3FF2 A;  5IEP A;  5HGR A;  2A15 A;  4FR9 A;  2RCD A;  3S67 A;  4HYZ A;  3GZR A;  2CWU A;  3LZA A;  3CCL 3;  1QVF 2;  1LOX A;  3HI7 A;  2BMR B;  2F99 A;  1D6Y A;  1JN5 B;  3QRD A;  4XBX A;  3G4S 3;  3MHE A;  3WOE B;  1VQM 3;  2CFL A;  1OF5 A;  3K7C A;  1SPU A;  3DMC A;  3OWU A;  1MNL A;  2B1X B;  2CIU A;  5FW5 A;  1W2B 2;  2W04 A;  2RFR A;  1SII A;  1RRH A;  4LSO A;  1ROA A;  2XFS A;  3NBB A;  3CNM A;  3DM8 A;  2RGQ A;  3X3Z A;  1K8A 4;  1VQN 3;  1E97 A;  1RRL A;  4HM1 B;  1KWI A;  3BNB A;  1E3V A;  4N6N B;  4FCZ A;  2GU3 A;  3CNX A;  4FMD A;  2UX0 A;  3Q1C A;  2ML6 A;  4L7K A;  2K54 A;  1WMP A;  3HII A;  2CWV A;  3EX9 A;  1M90 4;  4EC6 A;  3L0R A;  2CFK A;  2JDI H;  2WGQ A;  3OW2 2;  3U1W A;  3FF0 A;  3K63 A;  5ELU A;  2BT3 A;  5KP1 A;  4R9L A;  2YX9 A;  1A90 A;  3JUM A;  1S72 3;  1WMN A;  3NM7 A;  2K0M A;  4HM3 B;  4K1V A;  5AI1 A;  2ML5 A;  4MMX B;  3LT8 A;  3F8X A;  4O8S A;  2FXT A;  1WNH A;  3HX8 A;  4R4K A;  3NQZ A;  1O7N B;  4AEQ A;  3EBY A;  3WMD A;  2FGT A;  4ZM8 A;  1Q7Y 4;  1D6Z A;  1FGQ A;  2PZV A;  4J8T A;  4R80 A;  3S29 A;  1VQ6 3;  3FSD A;  2CG1 A;  3EBT A;  3S28 A;  3F14 A;  3MSO A;  3B8L A;  5CF2 A;  3GAX A;  4RNZ A;  4RZM A;  5CXO A;  4EV5 A;  2XR8 B;  1Q81 4;  1CEW I;  1STD A;  2OQE C;  3UL6 A;  3PXM A;  1O7P B;  2W9Q A;  1NB3 I;  2YFI B;  1TFK A;  4O2H A;  3WOD G;  1W4N A;  7STD A;  1JB2 A;  3CD6 3;  3F40 A;  1FGR A;  2W0Q A;  3FH1 A;  3MG2 A;  3H51 A;  3MPH A;  1SQW A;  3GZB A;  2RSX A;  3CCS 3;  1YHQ 3;  3BND A;  3KKG A;  5JBS A;  2OQE A;  4HVN A;  3OWY A;  4J9A A;  4EBG A;  1IVU A;  2XGN A;  5D81 A;  3VGN A;  3PZW A;  1W6G A;  1VQ5 3;  3ECF A;  3KFQ C;  2P0M A;  3N54 B;  4HM5 B;  3JUQ A;  3CCV 3;  4LZI A;  1LNH A;  1NU3 A;  1TFO A;  1UUV B;  1CYU A;  1YGE A;  3MKI A;  1US1 A;  3GZX B;  4G1M B;  4L8O A;  1DMM A;  3VSY A;  2Z77 A;  3EC9 A;  4MMZ B;  1R4C A;  1IQ8 A;  1IV7 A;  4HM2 B;  3MG1 A;  2CKF B;  1NB5 I;  4HZB B;  3JUP A;  1W00 A;  3A76 A;  3D3L A;  1ZX2 A;  3K0Z A;  3M8C A;  4FCJ A;  4MJD A;  5AIH A;  3AMO A;  3NX0 A;  3Q90 A;  1PFP A;  1O7G B;  3JUO A;  4NRE A;  4N6T A;  2Z76 A;  3X41 A;  1U8C B;  1TU5 A;  1W6C A;  3NHX A;  1RKY A;  1JB5 A;  3I55 3;  4HM7 B;  4H61 A;  3KN4 A;  3EE1 A;  1QMA A;  3RDE A;  2OTJ 3;  1O7W B;  2F98 A;  1GYB A;  4IPB A;  3AMO B;  3PCS A;  5FGO A;  4NHF A;  4ORL A;  1JJ2 2;  2JQ5 A;  3LH4 A;  4XBT A;  1W5Z A;  1VQK 3;  4HKV B;  1W01 A;  3F8H A;  5LC7 A;  1GD3 A;  2PNC A;  1YI2 3;  1T5Y A;  5AYR B;  1GS3 A;  2XEP A;  3WOF B;  1IQX A;  3NQY A;  1N9J A;  4GB5 A;  4JRF A;  2XH9 A;  1RN7 A;  3PYJ A;  3X40 A;  3G6E 3;  1IU7 A;  2LYX A;  3EF8 A;  5IEN A;  1K9M 4;  1OHP A;  1YJW 3;  2FNQ A;  4WWU C;  1DVC A;  3OXA A;  4OVM A;  3EHC A;  2CW9 A;  3IPT A;  1OH0 A;  2CG0 A;  3NBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...