4LZIA

Characterization of solanum tuberosum multicystatin and significance of core domains
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
277
structure length
277
Chain Sequence
b'GFTEVPFPNSPEFQDLTRFAVHQYNKDQNAHLEFVENLNVKKQVVAGMLYYITFAATDGGKKKIYETKIWVKVWENFKKVVEFKLVGDDSAKLGGIINVPFPNNPEFQDLARFAVQDYNKKENAHLEFVENLNVKEQLVAGMLYYITLVAIDAGKKKIYEAKIWVKEWENFKKVIEFKLIGDDSAIIGGFTDVPFPNNPEFQDLARFAVQDYNKKENAHLEYVENLNVKEQLVAGMIYYITLVATDAGKKKIYEAKIWVKEWEDFKKVVEFKLVGDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multicystatin
publication title Characterization of Solanum tuberosum Multicystatin and the Significance of Core Domains.
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Hydrolase inhibitor
total genus 69
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4lziA02
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4lziA03
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4lziA01
1A67A 1M9GA 2KXGA 3Q2PA 3S67A 1WNHA 4LZIA 1EQKA 4N6OB 4N6MA 2OCTA 4TX4A 4N6NB 1MOLA 1CYUA 3PXMA 4N6UA 3GAXA 1FA3A 1DVDA 1GD4A 2O9UX 5ELJA 1NB5I 1TIJA 1NB3I 4ZM8A 5A0OB 3NX0A 4N6LA 1YVBI 3PS8A 1PFPA 1LXEA 1CEWI 1FUWA 2W9PA 1A90A 2BO9B 1DVCA 5ELUA 2W9QA 3MWZA 3UL6A 3QRDA 1GD3A 1R4CA 1IV9A 1CYVA 5LC7A 3LH4A 1STFI 1RN7A 5LC6A 4IT7A 2CH9A 3KSED 3KFQC 4N6TA 5EQLA 3UL5A 1G96A 4EYCA 3PYJA 1N5HA 1N9JA 1ROAA 3L0RA 1KWIA 3IMAB 3SVAA 1IV7A 4CCVA 3K9MC 1MNLA 1N5PA 4N6V0
chains in the Genus database with same CATH superfamily
1A67A 1W2ZA 1A2KA 2GU1A 1JV2B 1I2EA 1UI8A 3EBTA 4X2HA 4QWTA 3VF1A 1LQGC 3LTBA 2BMOB 1AVLA 1V58A 1YHQ3 1RGFA 4O3VA 1EUIC 3D4AA 1MWRA 4N6MA 4FMCA 3X3ZA 3MPHA 1MOLA 1BANA 2F98A 4FCJA 3BU4A 2OOVA 3MKIA 1DMNA 3A5EA 3WDGB 3NV0A 3K0ZA 4J5KA 1UUVB 4FCMA 3EF8A 1GD4A 1N9EA 1OGXA 3G6E3 1IU7A 1FGTA 1W5ZA 2O3OA 2Z76A 3DZLA 1RCLA 5KP4A 2RCDA 1NNVA 3EQQB 2KF3A 3LT8A 3V98A 1JB5A 1ISKA 4WHAA 5G2GA 2WO0A 3CC23 1C7HA 1TIJA 3AGOA 4FCZA 5AIIA 3RGAA 1BIRA 4ZM8A 4N6LA 1B3SA 1YIJ3 1TRQA 3F40A 1JN5A 1GMRA 1BRJA 3MHEA 1BUJA 1IDPA 1W6CA 1PFPA 4FMDA 1UI7A 3FKAA 2IUKA 1EEJA 3U97A 1BNGA 1GY5A 1YGEA 2OOVC 2R41A 3GZXB 4IPBA 1VQ53 5JPUA 1MWSA 3EBYA 3LTDA 1VQ43 2CFWA 3G16A 1UCJA 1OCVA 2XH9A 2HMNB 3HK4A 5STDA 4EV2A 2F4YA 3DGYA 4RZMA 3EX9A 1E97A 1O7MB 2W9QA 3X42A 5IERA 5KP1A 2WOFA 1DYUA 3G713 2KCDA 3DMCA 1I3IA 3KN4A 3DUKA 3OX9A 2B24B 1BRNL 1D6YA 3BB9A 2CG1A 5IG3A 1VQ93 3PGBA 4GHOA 3FG4A 1LNIA 1I2GA 3I553 4KT3B 4KFDA 3X3XA 2GEXA 3B4PA 3ER7A 4HAAA 4ILFA 4GSPA 2KF5A 3T8NA 2WOHA 3T8UA 3BNEA 1UCLA 2Z6BA 1K9M4 2F56A 1HKXA 1W4NA 2CFDA 3ALAA 3O8YA 1GOUA 2AAEA 3CCS3 1D6UA 3QK9A 1Z1SA 3FLJA 3CCE3 4BTWA 4RBNA 2BMQB 1I8VA 1TTOA 2XF3A 3EN8A 1L5GB 3CU3A 1LRAA 2P38A 1DE3A 1V74A 2W04A 1O7GB 1SJWA 1T5YA 1X1UA 1Y4KA 2P09A 2XGNA 1ZGXA 3KSED 4HYZA 1LOXA 3KSPA 4U13A 2MC8A 5AEUB 1Q864 2ML5A 5D81A 5CF1A 1N5HA 1JB2A 2H0IA 3CXC2 3NHXA 5M19A 4WYKA 2GXFA 1GOYA 1FGOA 1OACA 4HZ9B 1IT8A 2UGIA 3FG1A 2Y73A 1YI23 5IG4A 1RKYA 2K0MA 1EKMA 4BL2A 3Q90A 1O7PB 2BIRA 3CC43 3K9MC 1IVUA 3N9HA 4H61A 1B2ZA 1YGWA 1N5PA 3NBRA 2CW9A 4J5GA 1IT7A 1VQO3 1BRIA 4OVMA 4PEJA 3GZYB 3Q2PA 5I97A 1YVSA 1BSBA 3PCSA 3S29A 1EQKA 2SBLA 2OCTA 2RNTA 2GSPA 4WP5A 2WGQA 2E2VA 2H0GA 3PCRA 3DM8A 1QAFA 3WODG 2INXA 2ZDJA 1TU5A 3PZWA 1RMSA 2HMLB 3F8HA 3CCV3 4CJNA 1FGMA 3GZRA 1BNJA 1BSAA 1PU4A 5HGRA 1YJ93 1JBTA 1JNQA 1AVKA 1W6GA 3F7XA 3WHOA 1FGQA 5ELJA 1VQN3 1HU9A 2C10A 1JBRA 2ML6A 1OPYA 2GEYA 1BUQA 1K41A 3FF2A 2BT3A 3LMLA 4J8TA 3NBBA 1NB5I 1FW7A 3SYUA 3DGMA 1MGRA 3K5TA 5D83A 3KKGA 5IW9A 5A0OB 4I4KA 5IEOA 3JUNA 3I0YA 3PS8A 3EJVA 1BNIA 3S28A 4EBGA 2CFGA 2CFKA 4OUQA 3G4S3 3URPA 4G1MB 1M904 2XR8B 1JRQA 2CWUA 2XFSA 4MMZB 3CCQ3 1LOYA 1OF5A 4WYKB 1JJ22 4MMXB 1VZZA 5FW5A 1RLSA 4L8PA 1BRKA 1A90A 2BO9B 5AIGA 7RNTA 5AYRB 3DGOA 1UW1A 2D1WA 5DRVA 1BSEA 3CCU3 3HOHA 1PY3A 3I563 3DXOA 3S5CA 1W2B2 1X1WA 1RGGA 2XSOB 3FF0A 3MWZA 3WA2X 1UCKA 3UL6A 2FXTA 1ZS7A 2B1XB 6STDA 1QMAA 2XEPA 2FGTA 2ZL8A 3DY5A 4IIAA 2BMRB 3LZAA 4HVNA 5CK6A 3FGYA 2F99A 4I5QA 3RDEA 2C4BA 1RGEA 2YX9A 1AQZA 1OH0A 4KZ1A 1JZOA 3GWRA 1D6ZA 3CCM3 3LT9A 1IV9A 1YIT3 4XBXA 3WA3A 2QEX3 1IYYA 1QJGA 2AADA 3CCL3 2KAAA 2QIYA 1BNRA 4CDLA 3SLUA 3JUMA 4K1UA 3IPTA 3LOYA 1S723 1NJI4 1I0VA 3D3LA 1Q42A 1STFI 3H51A 4ORLA 3G8ZA 3HIIA 3SXXA 3LTCA 3EB8A 1TFKA 3D9RA 1HZ1A 1BVIA 1FZUA 1BU4A 1W01A 2CH9A 2QGUA 2RFRA 1EG9B 1W7CA 3AHWA 1LNHA 4N6TA 4WFOA 1GY7A 1O7HB 4K1VA 5EQLA 1KQS2 4MMYB 3SEDA 3SX1A 1OF5B 1RNBA 2P0MA 2JDIH 1U8CB 2H0HA 1ULJB 2CKFB 1ROAA 1B2XA 1CQSA 2BHMA 4BL3A 1QAKA 1FGRA 1N8QA 1LVNA 1T2HA 1ROVA 3OXAA 1B20A 2CG0A 2XGLA 2W6JH 3EE1A 1ULIB 4STDA 3IMAB 4CCVA 5BXQA 1IV7A 5BVBA 2F5WA 1OHOA 2A15A 2C11A 2E2UA 3FH1A 1BNFA 6RNTA 4HM1B 4N6V0 1UGHI 2K54A 3M8CA 1B2UA 2IMJA 2KXGA 3S67A 1WNHA 1B21A 3GRDA 4LZIA 5IEPA 2PZVA 1I70A 1VQL3 1LOWA 4L7KA 4R9KA 4TX4A 3HZPA 1J2BA 4N6NB 5BIRA 1NDOB 4JRFA 1BNSA 1SPUA 3F8XA 1GMPA 1T3BA 3BLZA 1RN4A 4XDVA 1IK3A 3KIIA 1Q9EA 3PXMA 4HM0B 3GAXA 3LXUX 2L1SA 1Q7HA 3CME3 1FA3A 1DVDA 2O9UX 1NO3A 2IA7A 3MG2A 1IQ8A 1TP6A 1KSIA 1WMNA 2W2CA 5M1AA 4KFFA 5TGNA 1Q40A 4HM8B 1X1YA 2KF4A 2HOHA 3B4OA 1BRHA 1NB3I 3GSPA 3HX8A 4XBYA 2CHCA 3K63A 4NPBA 1RDSA 2LYXA 1E3VA 1ZX2A 1I0XA 3CNXA 3HI7A 1BOXA 3VGNA 4J9AA 3WR2A 4XBTA 1CEWI 3CNMA 1FUWA 3UJMA 2OQEA 4LSOA 4LYLB 1VQM3 3X3YA 1IVXA 2HMJB 1N8R4 1CH0A 1C54A 4GL6A 3E99A 4HM4B 3NQZA 1Q7Y4 1DVCA 1OHSA 1G02A 1G0TA 2CX0A 3NM2A 4XB5A 4EXRA 2IUJA 1QALA 3AHSA 3DH2A 3G0KA 2GBXB 1UCIA 2GBWB 2P0XA 2PNCA 3H3HA 4X2OA 5D82A 3AMOB 5IENA 1DMMA 1W02A 4WWUC 8RNTA 4FMAA 2W56A 3QRDA 4N3VA 2Q07A 3OV4A 4HM6B 1NU3A 3FSDA 1S5AA 4R80A 3LTAA 4H3UA 3T0UA 2I9WA 3TDGA 2UUGC 1RNTA 2CK3H 4HM3B 5M18A 3DGNA 4GB5A 3NUVA 3NXJA 1U5OA 1RRHA 4HM7B 1IQYA 1BSDA 5AIHA 4BTXA 3ZG0A 4RNTA 3BNDA 3X40A 1RJOA 1VQK3 1KD14 3MG1A 5IG5A 2HMKB 1BNEA 3Q3FA 1WTHA 1LQMB 4AKYA 3MSOA 1VQP3 5LC7A 1AY7A 4Q53A 4BIRA 3J7Yd 1KC84 1M1K4 3MYTA 2YFIB 3ROBA 4MEIA 1Q40B 2M7OA 3LH4A 2F5MA 3X41A 2OWPA 3STDA 2STDA 1SQWA 4NREA 2HMMB 3A76A 2JQ5A 2SARA 4FMBA 1RN7A 4LMIA 5JPPA 1B2SA 3NQYA 3BNCA 3V92A 1SIIA 1YJW3 4DKIA 3EC9A 3S27A 2IY2A 1FUTA 4NHFA 5AIFA 3F9SA 3UL5A 1G96A 4MJDA 4EYCA 3PYJA 3BIRA 4KVHA 8CHOA 1K734 1DETA 1RSNA 3KZTA 5RNTA 1TRPA 5FGOA 3RNTA 1TUHA 1T2IA 1UGIA 2E2TA 3L0RA 3Q1CA 4EV5A 4KFEA 2W03A 5G1LA 1GSPA 3OW22 5G1KA 1RGAA 1JBSA 2YFJB 1V57A 4O8SA 5AEWB 3EHCA 1B2MA 1A2PA 5AYSC 1IVWA 1K8A4 3K7CA 3JVCA 2R4IA 2W56B 3MG3A 1BSCA 2RBIA 2XSHB 3F7SA 1M9GA 1X1XA 4AEQA 9RNTA 2OTL3 2CWTA 1RGKA 4RNYA 1R4YA 5EVHA 2XFTA 1WMPA 4N6OB 2FNQA 3B8LA 4K90B 1NWWA 1OUNA 1GOVA 2Z77A 3JUPA 4R4KA 1SIHA 1UDII 4FR9A 1QVF2 1CYUA 2GU3A 3ZFZA 3NBJA 1HYFA 1MWTA 1AR0A 4HKVB 4N6UA 1M1XB 2RGQA 1O7WB 4HM5B 3D79A 3OWUA 4R9LA 5CXOA 5EEOA 5GSPA 2MF7A 2KF6A 1RGCA 3OWSA 5IG0A 3N54B 1GMQA 1LOVA 3WOFB 2WGOA 2IYJA 3KE7A 3CCR3 2HMOB 4HJLB 1W6YA 2LQVA 1TJDA 1MGWA 1MWUA 3D5IA 1JKGA 1B27A 3AMOA 3HIGA 4OK0A 3NX0A 1I3FA 1YVBI 2P05A 1ZO2A 3U1WA 3VSYA 2F86B 1RN1A 1W00A 1GY6A 5AI1A 5JBSA 1JB4A 1LXEA 3KCHA 3CMA3 2Y74A 1BRSA 3NV0B 4BU4A 2BNGA 1VQQA 4EW5A 3CD63 3CPOA 2W9PA 3IJEB 1OHPA 7STDA 1BRGA 1O7NB 2CIUA 2CX1A 3CC73 1I2FA 1GS3A 4XDWA 1AV4A 3CCJ3 1A2VA 3B7CA 3D5GA 4L8OA 5ELUA 4O02B 3RGRA 3JUOA 2V1LA 4K61A 3N8BA 1VQ83 1E3RA 3WMDA 1IVVA 1GD3A 3FG3A 1PYLA 2KRTA 1JN5B 1VQ73 1RHLA 2UX0A 1OGZA 2K3DA 3LYGA 3CPW2 1US1A 3EN1B 2OTJ3 1EA2A 2ZHXB 3SOAA 1WMOA 5HOHA 3AGNA 1SARA 1R4CA 4EC6A 2CC3A 3NM7A 1BAOA 1RGLA 3ECFA 1WQLB 3ZG5A 1Q814 4LGQA 3FCSB 4HM2B 4BTYA 1CYVA 1BGSA 1YNVX 2Z7AA 4O2HA 4RNZA 5CLKA 1GYBA 3JUQA 4HZBB 4AKZA 5CF2A 2ZA4A 3V99A 4R1KA 2QA43 1FYSA 3DGLA 1K28A 1FUSA 4HBRA 1QVG2 1RGHA 3GZBA 1DMQA 3UNLA 1JKGB 1JZDA 1UUWB 5LC6A 6GSPA 7GSPA 4IT7A 5IF6A 1F8NA 1VQ63 1IQXA 3FZWA 1UUGB 3KFQC 3BNBA 2J8XB 1RTUA 5DREA 1ASKA 5KP3A 2CFLA 4XM4A 2D42A 2W0QA 2L4VA 1TFOA 3SOYA 1RRLA 1Q824 1N9JA 2BU4A 4HOHA 3UB1A 3WOEB 5BU4A 3OWYA 2OQEC 3F14A 4CPKA 1YJN3 2YFLB 1KWIA 2CWVA 4LEHA 3SVAA 1RCKA 2RSXA 1MNLA 1STDA 4JF8A 2XRXB
chains in the Genus database with same CATH topology
1A67A 1W2ZA 1A2KA 2GU1A 1JV2B 1UI8A 3EBTA 4X2HA 4QWTA 3VF1A 3LTBA 2BMOB 1AVLA 1YHQ3 4O3VA 4N6MA 4FMCA 3X3ZA 3MPHA 1MOLA 2F98A 2OOVA 3MKIA 1DMNA 3WDGB 3NV0A 3K0ZA 1UUVB 4FCMA 3EF8A 1GD4A 1N9EA 1OGXA 3G6E3 1IU7A 1FGTA 1W5ZA 2O3OA 2Z76A 3DZLA 5KP4A 2RCDA 3EQQB 3LT8A 3V98A 1JB5A 1ISKA 4WHAA 5G2GA 2WO0A 3CC23 1C7HA 1TIJA 4FCZA 5AIIA 3RGAA 4ZM8A 4N6LA 1YIJ3 3F40A 1JN5A 3MHEA 1IDPA 1W6CA 1PFPA 4FMDA 1UI7A 3FKAA 2IUKA 3U97A 1YGEA 1GY5A 2OOVC 4IPBA 1VQ53 3GZXB 5JPUA 3EBYA 3LTDA 1VQ43 2CFWA 3G16A 3HK4A 1OCVA 2XH9A 2HMNB 5STDA 4EV2A 4RZMA 3EX9A 1E97A 1O7MB 2W9QA 3X42A 5IERA 5KP1A 2WOFA 1DYUA 3G713 2KCDA 3DMCA 3KN4A 3DUKA 3OX9A 2B24B 1D6YA 3BB9A 2CG1A 5IG3A 1VQ93 3PGBA 3FG4A 3I553 4KFDA 3X3XA 2GEXA 3B4PA 3ER7A 3T8NA 2WOHA 3T8UA 3BNEA 2Z6BA 1K9M4 3ALAA 1HKXA 1W4NA 2CFDA 3CCS3 3O8YA 1N8R4 1D6UA 3QK9A 1Z1SA 3FLJA 3CCE3 4BTWA 4RBNA 2BMQB 2XF3A 3EN8A 1L5GB 3CU3A 2P38A 1V74A 2W04A 1O7GB 1SJWA 1T5YA 2P09A 1Y4KA 2XGNA 3KSED 4HYZA 4U13A 2MC8A 1LOXA 3KSPA 5AEUB 1Q864 2ML5A 5D81A 5CF1A 1N5HA 1JB2A 3CXC2 3NHXA 4WYKA 2GXFA 1FGOA 1OACA 4HZ9B 1IT8A 3FG1A 2Y73A 1YI23 5IG4A 1RKYA 2K0MA 1EKMA 3Q90A 1O7PB 3CC43 3K9MC 1IVUA 3N9HA 4H61A 1N5PA 3NBRA 2CW9A 1IT7A 1VQO3 4OVMA 4PEJA 3GZYB 3Q2PA 5I97A 1EQKA 3PCSA 3S29A 2SBLA 2OCTA 4WP5A 2WGQA 2E2VA 3PCRA 3DM8A 1QAFA 3WODG 2INXA 2ZDJA 1TU5A 3PZWA 2HMLB 3CCV3 3F8HA 1FGMA 3GZRA 1PU4A 5HGRA 1YJ93 1JNQA 1AVKA 1W6GA 3F7XA 1FGQA 5ELJA 1VQN3 1HU9A 2C10A 2ML6A 1OPYA 2GEYA 1BUQA 1K41A 3FF2A 2BT3A 3LMLA 4J8TA 3NBBA 1NB5I 3DGMA 3K5TA 5D83A 3KKGA 5IW9A 5A0OB 4I4KA 5IEOA 3JUNA 3I0YA 3PS8A 3EJVA 3S28A 4EBGA 2CFGA 2CFKA 4OUQA 3G4S3 4G1MB 1M904 2XR8B 1JRQA 2CWUA 2XFSA 4MMZB 3CCQ3 1OF5A 4WYKB 1JJ22 4MMXB 1VZZA 5FW5A 4L8PA 1A90A 2BO9B 5AIGA 5AYRB 3DGOA 1UW1A 2D1WA 5DRVA 3CCU3 3I563 3DXOA 3S5CA 1W2B2 2XSOB 3FF0A 3MWZA 3WA2X 3UL6A 2FXTA 2B1XB 6STDA 1QMAA 2XEPA 2FGTA 2ZL8A 3DY5A 4IIAA 2BMRB 3LZAA 4HVNA 5CK6A 3FGYA 2F99A 3RDEA 2YX9A 1OH0A 4KZ1A 3GWRA 1D6ZA 3CCM3 3LT9A 1IV9A 1YIT3 4XBXA 3WA3A 2QEX3 1QJGA 3CCL3 2QIYA 4CDLA 3SLUA 3JUMA 4K1UA 3IPTA 3LOYA 1S723 1NJI4 3D3LA 1Q42A 1STFI 3H51A 4ORLA 3G8ZA 3HIIA 3SXXA 3LTCA 3EB8A 1TFKA 3D9RA 4FCJA 1W01A 2CH9A 2QGUA 2RFRA 1EG9B 1W7CA 4WFOA 1LNHA 4N6TA 5EQLA 1GY7A 1O7HB 4K1VA 5IEPA 1KQS2 4MMYB 3SEDA 3SX1A 1OF5B 2P0MA 2JDIH 1U8CB 1ULJB 2CKFB 1ROAA 1CQSA 2BHMA 1QAKA 1FGRA 1N8QA 1LVNA 3OXAA 1ROVA 2CG0A 2XGLA 2W6JH 3EE1A 1ULIB 4STDA 3IMAB 4CCVA 5BXQA 1IV7A 5BVBA 1OHOA 2A15A 2C11A 2E2UA 3FH1A 4HM1B 4N6V0 2K54A 3M8CA 2IMJA 2KXGA 3S67A 1WNHA 3GRDA 1VQL3 4LZIA 2PZVA 4L7KA 4R9KA 4TX4A 3HZPA 1J2BA 4N6NB 1NDOB 4JRFA 1SPUA 3F8XA 3BLZA 4XDVA 1IK3A 3KIIA 3PXMA 4HM0B 3GAXA 3LXUX 3CME3 1FA3A 1DVDA 2O9UX 1NO3A 2IA7A 3MG2A 1IQ8A 1TP6A 1KSIA 1WMNA 2W2CA 4KFFA 5TGNA 1Q40A 4HM8B 3B4OA 1NB3I 3HX8A 4XBYA 2CHCA 3K63A 2LYXA 1E3VA 1ZX2A 3CNXA 3HI7A 3VGNA 4J9AA 4XBTA 1CEWI 3CNMA 1FUWA 3UJMA 2OQEA 4LSOA 1VQM3 3X3YA 1IVXA 2HMJB 4GL6A 3E99A 4HM4B 3NQZA 1Q7Y4 1DVCA 1OHSA 3NM2A 4XB5A 4EXRA 2IUJA 1QALA 3G0KA 2GBXB 2P0XA 2GBWB 2PNCA 3H3HA 4X2OA 5D82A 3AMOB 5IENA 1DMMA 1W02A 4WWUC 4FMAA 2W56A 3QRDA 4N3VA 2Q07A 3OV4A 4HM6B 1NU3A 3FSDA 1S5AA 4R80A 3LTAA 4H3UA 3T0UA 2I9WA 3TDGA 2CK3H 4HM3B 3DGNA 4GB5A 3NUVA 3NXJA 1U5OA 1RRHA 4HM7B 1IQYA 5AIHA 4BTXA 3BNDA 3X40A 1RJOA 1VQK3 1KD14 3MG1A 5IG5A 2HMKB 1WTHA 4AKYA 3MSOA 1VQP3 5LC7A 4Q53A 1KC84 3J7Yd 1M1K4 3MYTA 2YFIB 3ROBA 4MEIA 1Q40B 2M7OA 3LH4A 3X41A 2OWPA 3STDA 2STDA 1SQWA 4NREA 2HMMB 3A76A 2JQ5A 4FMBA 1RN7A 4LMIA 5JPPA 3NQYA 3BNCA 3V92A 1SIIA 1YJW3 3EC9A 3S27A 4NHFA 5AIFA 3F9SA 3UL5A 1G96A 4MJDA 4EYCA 3PYJA 4KVHA 8CHOA 1K734 3KZTA 5FGOA 1TUHA 2E2TA 3L0RA 3Q1CA 4EV5A 4KFEA 2W03A 3OW22 2YFJB 4O8SA 5AEWB 3EHCA 5AYSC 1IVWA 1K8A4 3K7CA 3JVCA 2R4IA 2W56B 3MG3A 2XSHB 3F7SA 1M9GA 4AEQA 2OTL3 2CWTA 4RNYA 5EVHA 2XFTA 1WMPA 4N6OB 2FNQA 3B8LA 4K90B 1NWWA 1OUNA 2Z77A 3JUPA 4R4KA 1SIHA 4FR9A 1QVF2 1CYUA 2GU3A 3NBJA 4HKVB 4N6UA 1AR0A 1M1XB 2RGQA 1O7WB 4HM5B 3OWUA 4R9LA 5CXOA 5EEOA 2MF7A 3OWSA 5IG0A 3N54B 3WOFB 2WGOA 3KE7A 3CCR3 2HMOB 4HJLB 1W6YA 2LQVA 1JKGA 3AMOA 3HIGA 4OK0A 3NX0A 3U1WA 1YVBI 2P05A 1ZO2A 3VSYA 2F86B 1W00A 1GY6A 5AI1A 5JBSA 1JB4A 1LXEA 3CMA3 2Y74A 3NV0B 2BNGA 3CD63 3CPOA 2W9PA 3IJEB 1OHPA 7STDA 1O7NB 2CIUA 3CC73 1GS3A 4XDWA 1AV4A 3CCJ3 1A2VA 3B7CA 4L8OA 5ELUA 4O02B 3RGRA 3JUOA 2V1LA 4K61A 3N8BA 1VQ83 1E3RA 3WMDA 1IVVA 1GD3A 3FG3A 2KRTA 1JN5B 1VQ73 2UX0A 1OGZA 3LYGA 3CPW2 1US1A 3EN1B 2OTJ3 1EA2A 3SOAA 1WMOA 4EC6A 1R4CA 2CC3A 3NM7A 3ECFA 1WQLB 1Q814 4LGQA 3FCSB 4HM2B 4BTYA 1CYVA 2Z7AA 4O2HA 4RNZA 5CLKA 1GYBA 3JUQA 4HZBB 4AKZA 5CF2A 3V99A 4R1KA 2QA43 3DGLA 1K28A 4HBRA 1QVG2 3GZBA 3UNLA 1DMQA 1JKGB 1UUWB 5LC6A 4IT7A 5IF6A 1F8NA 1VQ63 1IQXA 3FZWA 3KFQC 3BNBA 5DREA 1ASKA 5KP3A 2CFLA 4XM4A 2D42A 2W0QA 2L4VA 1TFOA 3SOYA 1RRLA 1Q824 1N9JA 3UB1A 3WOEB 3OWYA 2OQEC 3F14A 1YJN3 2YFLB 1KWIA 2CWVA 4LEHA 3SVAA 2RSXA 1MNLA 1STDA 4JF8A 2XRXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A67 A;  1M9G A;  2KXG A;  3Q2P A;  3S67 A;  1WNH A;  4LZI A;  1EQK A;  4N6O B;  4N6M A;  2OCT A;  4TX4 A;  4N6N B;  1MOL A;  1CYU A;  3PXM A;  4N6U A;  3GAX A;  1FA3 A;  1DVD A;  1GD4 A;  2O9U X;  5ELJ A;  1NB5 I;  1TIJ A;  1NB3 I;  4ZM8 A;  5A0O B;  3NX0 A;  4N6L A;  1YVB I;  3PS8 A;  1PFP A;  1LXE A;  1CEW I;  1FUW A;  2W9P A;  1A90 A;  2BO9 B;  1DVC A;  5ELU A;  2W9Q A;  3MWZ A;  3UL6 A;  3QRD A;  1GD3 A;  1R4C A;  1IV9 A;  1CYV A;  5LC7 A;  3LH4 A;  1STF I;  1RN7 A;  5LC6 A;  4IT7 A;  2CH9 A;  3KSE D;  3KFQ C;  4N6T A;  5EQL A;  3UL5 A;  1G96 A;  4EYC A;  3PYJ A;  1N5H A;  1N9J A;  1ROA A;  3L0R A;  1KWI A;  3IMA B;  3SVA A;  1IV7 A;  4CCV A;  3K9M C;  1MNL A;  1N5P A;  4N6V 0; 
#chains in the Genus database with same CATH topology
 1A67 A;  1W2Z A;  1A2K A;  2GU1 A;  1JV2 B;  1I2E A;  1UI8 A;  3EBT A;  4X2H A;  4QWT A;  3VF1 A;  1LQG C;  3LTB A;  2BMO B;  1AVL A;  1V58 A;  1YHQ 3;  1RGF A;  4O3V A;  1EUI C;  3D4A A;  1MWR A;  4N6M A;  4FMC A;  3X3Z A;  3MPH A;  1MOL A;  1BAN A;  2F98 A;  4FCJ A;  3BU4 A;  2OOV A;  3MKI A;  1DMN A;  3A5E A;  3WDG B;  3NV0 A;  3K0Z A;  4J5K A;  1UUV B;  4FCM A;  3EF8 A;  1GD4 A;  1N9E A;  1OGX A;  3G6E 3;  1IU7 A;  1FGT A;  1W5Z A;  2O3O A;  2Z76 A;  3DZL A;  1RCL A;  5KP4 A;  2RCD A;  1NNV A;  3EQQ B;  2KF3 A;  3LT8 A;  3V98 A;  1JB5 A;  1ISK A;  4WHA A;  5G2G A;  2WO0 A;  3CC2 3;  1C7H A;  1TIJ A;  3AGO A;  4FCZ A;  5AII A;  3RGA A;  1BIR A;  4ZM8 A;  4N6L A;  1B3S A;  1YIJ 3;  1TRQ A;  3F40 A;  1JN5 A;  1GMR A;  1BRJ A;  3MHE A;  1BUJ A;  1IDP A;  1W6C A;  1PFP A;  4FMD A;  1UI7 A;  3FKA A;  2IUK A;  1EEJ A;  3U97 A;  1BNG A;  1GY5 A;  1YGE A;  2OOV C;  2R41 A;  3GZX B;  4IPB A;  1VQ5 3;  5JPU A;  1MWS A;  3EBY A;  3LTD A;  1VQ4 3;  2CFW A;  3G16 A;  1UCJ A;  1OCV A;  2XH9 A;  2HMN B;  3HK4 A;  5STD A;  4EV2 A;  2F4Y A;  3DGY A;  4RZM A;  3EX9 A;  1E97 A;  1O7M B;  2W9Q A;  3X42 A;  5IER A;  5KP1 A;  2WOF A;  1DYU A;  3G71 3;  2KCD A;  3DMC A;  1I3I A;  3KN4 A;  3DUK A;  3OX9 A;  2B24 B;  1BRN L;  1D6Y A;  3BB9 A;  2CG1 A;  5IG3 A;  1VQ9 3;  3PGB A;  4GHO A;  3FG4 A;  1LNI A;  1I2G A;  3I55 3;  4KT3 B;  4KFD A;  3X3X A;  2GEX A;  3B4P A;  3ER7 A;  4HAA A;  4ILF A;  4GSP A;  2KF5 A;  3T8N A;  2WOH A;  3T8U A;  3BNE A;  1UCL A;  2Z6B A;  1K9M 4;  2F56 A;  1HKX A;  1W4N A;  2CFD A;  3ALA A;  3O8Y A;  1GOU A;  2AAE A;  3CCS 3;  1D6U A;  3QK9 A;  1Z1S A;  3FLJ A;  3CCE 3;  4BTW A;  4RBN A;  2BMQ B;  1I8V A;  1TTO A;  2XF3 A;  3EN8 A;  1L5G B;  3CU3 A;  1LRA A;  2P38 A;  1DE3 A;  1V74 A;  2W04 A;  1O7G B;  1SJW A;  1T5Y A;  1X1U A;  1Y4K A;  2P09 A;  2XGN A;  1ZGX A;  3KSE D;  4HYZ A;  1LOX A;  3KSP A;  4U13 A;  2MC8 A;  5AEU B;  1Q86 4;  2ML5 A;  5D81 A;  5CF1 A;  1N5H A;  1JB2 A;  2H0I A;  3CXC 2;  3NHX A;  5M19 A;  4WYK A;  2GXF A;  1GOY A;  1FGO A;  1OAC A;  4HZ9 B;  1IT8 A;  2UGI A;  3FG1 A;  2Y73 A;  1YI2 3;  5IG4 A;  1RKY A;  2K0M A;  1EKM A;  4BL2 A;  3Q90 A;  1O7P B;  2BIR A;  3CC4 3;  3K9M C;  1IVU A;  3N9H A;  4H61 A;  1B2Z A;  1YGW A;  1N5P A;  3NBR A;  2CW9 A;  4J5G A;  1IT7 A;  1VQO 3;  1BRI A;  4OVM A;  4PEJ A;  3GZY B;  3Q2P A;  5I97 A;  1YVS A;  1BSB A;  3PCS A;  3S29 A;  1EQK A;  2SBL A;  2OCT A;  2RNT A;  2GSP A;  4WP5 A;  2WGQ A;  2E2V A;  2H0G A;  3PCR A;  3DM8 A;  1QAF A;  3WOD G;  2INX A;  2ZDJ A;  1TU5 A;  3PZW A;  1RMS A;  2HML B;  3F8H A;  3CCV 3;  4CJN A;  1FGM A;  3GZR A;  1BNJ A;  1BSA A;  1PU4 A;  5HGR A;  1YJ9 3;  1JBT A;  1JNQ A;  1AVK A;  1W6G A;  3F7X A;  3WHO A;  1FGQ A;  5ELJ A;  1VQN 3;  1HU9 A;  2C10 A;  1JBR A;  2ML6 A;  1OPY A;  2GEY A;  1BUQ A;  1K41 A;  3FF2 A;  2BT3 A;  3LML A;  4J8T A;  3NBB A;  1NB5 I;  1FW7 A;  3SYU A;  3DGM A;  1MGR A;  3K5T A;  5D83 A;  3KKG A;  5IW9 A;  5A0O B;  4I4K A;  5IEO A;  3JUN A;  3I0Y A;  3PS8 A;  3EJV A;  1BNI A;  3S28 A;  4EBG A;  2CFG A;  2CFK A;  4OUQ A;  3G4S 3;  3URP A;  4G1M B;  1M90 4;  2XR8 B;  1JRQ A;  2CWU A;  2XFS A;  4MMZ B;  3CCQ 3;  1LOY A;  1OF5 A;  4WYK B;  1JJ2 2;  4MMX B;  1VZZ A;  5FW5 A;  1RLS A;  4L8P A;  1BRK A;  1A90 A;  2BO9 B;  5AIG A;  7RNT A;  5AYR B;  3DGO A;  1UW1 A;  2D1W A;  5DRV A;  1BSE A;  3CCU 3;  3HOH A;  1PY3 A;  3I56 3;  3DXO A;  3S5C A;  1W2B 2;  1X1W A;  1RGG A;  2XSO B;  3FF0 A;  3MWZ A;  3WA2 X;  1UCK A;  3UL6 A;  2FXT A;  1ZS7 A;  2B1X B;  6STD A;  1QMA A;  2XEP A;  2FGT A;  2ZL8 A;  3DY5 A;  4IIA A;  2BMR B;  3LZA A;  4HVN A;  5CK6 A;  3FGY A;  2F99 A;  4I5Q A;  3RDE A;  2C4B A;  1RGE A;  2YX9 A;  1AQZ A;  1OH0 A;  4KZ1 A;  1JZO A;  3GWR A;  1D6Z A;  3CCM 3;  3LT9 A;  1IV9 A;  1YIT 3;  4XBX A;  3WA3 A;  2QEX 3;  1IYY A;  1QJG A;  2AAD A;  3CCL 3;  2KAA A;  2QIY A;  1BNR A;  4CDL A;  3SLU A;  3JUM A;  4K1U A;  3IPT A;  3LOY A;  1S72 3;  1NJI 4;  1I0V A;  3D3L A;  1Q42 A;  1STF I;  3H51 A;  4ORL A;  3G8Z A;  3HII A;  3SXX A;  3LTC A;  3EB8 A;  1TFK A;  3D9R A;  1HZ1 A;  1BVI A;  1FZU A;  1BU4 A;  1W01 A;  2CH9 A;  2QGU A;  2RFR A;  1EG9 B;  1W7C A;  3AHW A;  1LNH A;  4N6T A;  4WFO A;  1GY7 A;  1O7H B;  4K1V A;  5EQL A;  1KQS 2;  4MMY B;  3SED A;  3SX1 A;  1OF5 B;  1RNB A;  2P0M A;  2JDI H;  1U8C B;  2H0H A;  1ULJ B;  2CKF B;  1ROA A;  1B2X A;  1CQS A;  2BHM A;  4BL3 A;  1QAK A;  1FGR A;  1N8Q A;  1LVN A;  1T2H A;  1ROV A;  3OXA A;  1B20 A;  2CG0 A;  2XGL A;  2W6J H;  3EE1 A;  1ULI B;  4STD A;  3IMA B;  4CCV A;  5BXQ A;  1IV7 A;  5BVB A;  2F5W A;  1OHO A;  2A15 A;  2C11 A;  2E2U A;  3FH1 A;  1BNF A;  6RNT A;  4HM1 B;  4N6V 0;  1UGH I;  2K54 A;  3M8C A;  1B2U A;  2IMJ A;  2KXG A;  3S67 A;  1WNH A;  1B21 A;  3GRD A;  4LZI A;  5IEP A;  2PZV A;  1I70 A;  1VQL 3;  1LOW A;  4L7K A;  4R9K A;  4TX4 A;  3HZP A;  1J2B A;  4N6N B;  5BIR A;  1NDO B;  4JRF A;  1BNS A;  1SPU A;  3F8X A;  1GMP A;  1T3B A;  3BLZ A;  1RN4 A;  4XDV A;  1IK3 A;  3KII A;  1Q9E A;  3PXM A;  4HM0 B;  3GAX A;  3LXU X;  2L1S A;  1Q7H A;  3CME 3;  1FA3 A;  1DVD A;  2O9U X;  1NO3 A;  2IA7 A;  3MG2 A;  1IQ8 A;  1TP6 A;  1KSI A;  1WMN A;  2W2C A;  5M1A A;  4KFF A;  5TGN A;  1Q40 A;  4HM8 B;  1X1Y A;  2KF4 A;  2HOH A;  3B4O A;  1BRH A;  1NB3 I;  3GSP A;  3HX8 A;  4XBY A;  2CHC A;  3K63 A;  4NPB A;  1RDS A;  2LYX A;  1E3V A;  1ZX2 A;  1I0X A;  3CNX A;  3HI7 A;  1BOX A;  3VGN A;  4J9A A;  3WR2 A;  4XBT A;  1CEW I;  3CNM A;  1FUW A;  3UJM A;  2OQE A;  4LSO A;  4LYL B;  1VQM 3;  3X3Y A;  1IVX A;  2HMJ B;  1N8R 4;  1CH0 A;  1C54 A;  4GL6 A;  3E99 A;  4HM4 B;  3NQZ A;  1Q7Y 4;  1DVC A;  1OHS A;  1G02 A;  1G0T A;  2CX0 A;  3NM2 A;  4XB5 A;  4EXR A;  2IUJ A;  1QAL A;  3AHS A;  3DH2 A;  3G0K A;  2GBX B;  1UCI A;  2GBW B;  2P0X A;  2PNC A;  3H3H A;  4X2O A;  5D82 A;  3AMO B;  5IEN A;  1DMM A;  1W02 A;  4WWU C;  8RNT A;  4FMA A;  2W56 A;  3QRD A;  4N3V A;  2Q07 A;  3OV4 A;  4HM6 B;  1NU3 A;  3FSD A;  1S5A A;  4R80 A;  3LTA A;  4H3U A;  3T0U A;  2I9W A;  3TDG A;  2UUG C;  1RNT A;  2CK3 H;  4HM3 B;  5M18 A;  3DGN A;  4GB5 A;  3NUV A;  3NXJ A;  1U5O A;  1RRH A;  4HM7 B;  1IQY A;  1BSD A;  5AIH A;  4BTX A;  3ZG0 A;  4RNT A;  3BND A;  3X40 A;  1RJO A;  1VQK 3;  1KD1 4;  3MG1 A;  5IG5 A;  2HMK B;  1BNE A;  3Q3F A;  1WTH A;  1LQM B;  4AKY A;  3MSO A;  1VQP 3;  5LC7 A;  1AY7 A;  4Q53 A;  4BIR A;  3J7Y d;  1KC8 4;  1M1K 4;  3MYT A;  2YFI B;  3ROB A;  4MEI A;  1Q40 B;  2M7O A;  3LH4 A;  2F5M A;  3X41 A;  2OWP A;  3STD A;  2STD A;  1SQW A;  4NRE A;  2HMM B;  3A76 A;  2JQ5 A;  2SAR A;  4FMB A;  1RN7 A;  4LMI A;  5JPP A;  1B2S A;  3NQY A;  3BNC A;  3V92 A;  1SII A;  1YJW 3;  4DKI A;  3EC9 A;  3S27 A;  2IY2 A;  1FUT A;  4NHF A;  5AIF A;  3F9S A;  3UL5 A;  1G96 A;  4MJD A;  4EYC A;  3PYJ A;  3BIR A;  4KVH A;  8CHO A;  1K73 4;  1DET A;  1RSN A;  3KZT A;  5RNT A;  1TRP A;  5FGO A;  3RNT A;  1TUH A;  1T2I A;  1UGI A;  2E2T A;  3L0R A;  3Q1C A;  4EV5 A;  4KFE A;  2W03 A;  5G1L A;  1GSP A;  3OW2 2;  5G1K A;  1RGA A;  1JBS A;  2YFJ B;  1V57 A;  4O8S A;  5AEW B;  3EHC A;  1B2M A;  1A2P A;  5AYS C;  1IVW A;  1K8A 4;  3K7C A;  3JVC A;  2R4I A;  2W56 B;  3MG3 A;  1BSC A;  2RBI A;  2XSH B;  3F7S A;  1M9G A;  1X1X A;  4AEQ A;  9RNT A;  2OTL 3;  2CWT A;  1RGK A;  4RNY A;  1R4Y A;  5EVH A;  2XFT A;  1WMP A;  4N6O B;  2FNQ A;  3B8L A;  4K90 B;  1NWW A;  1OUN A;  1GOV A;  2Z77 A;  3JUP A;  4R4K A;  1SIH A;  1UDI I;  4FR9 A;  1QVF 2;  1CYU A;  2GU3 A;  3ZFZ A;  3NBJ A;  1HYF A;  1MWT A;  1AR0 A;  4HKV B;  4N6U A;  1M1X B;  2RGQ A;  1O7W B;  4HM5 B;  3D79 A;  3OWU A;  4R9L A;  5CXO A;  5EEO A;  5GSP A;  2MF7 A;  2KF6 A;  1RGC A;  3OWS A;  5IG0 A;  3N54 B;  1GMQ A;  1LOV A;  3WOF B;  2WGO A;  2IYJ A;  3KE7 A;  3CCR 3;  2HMO B;  4HJL B;  1W6Y A;  2LQV A;  1TJD A;  1MGW A;  1MWU A;  3D5I A;  1JKG A;  1B27 A;  3AMO A;  3HIG A;  4OK0 A;  3NX0 A;  1I3F A;  1YVB I;  2P05 A;  1ZO2 A;  3U1W A;  3VSY A;  2F86 B;  1RN1 A;  1W00 A;  1GY6 A;  5AI1 A;  5JBS A;  1JB4 A;  1LXE A;  3KCH A;  3CMA 3;  2Y74 A;  1BRS A;  3NV0 B;  4BU4 A;  2BNG A;  1VQQ A;  4EW5 A;  3CD6 3;  3CPO A;  2W9P A;  3IJE B;  1OHP A;  7STD A;  1BRG A;  1O7N B;  2CIU A;  2CX1 A;  3CC7 3;  1I2F A;  1GS3 A;  4XDW A;  1AV4 A;  3CCJ 3;  1A2V A;  3B7C A;  3D5G A;  4L8O A;  5ELU A;  4O02 B;  3RGR A;  3JUO A;  2V1L A;  4K61 A;  3N8B A;  1VQ8 3;  1E3R A;  3WMD A;  1IVV A;  1GD3 A;  3FG3 A;  1PYL A;  2KRT A;  1JN5 B;  1VQ7 3;  1RHL A;  2UX0 A;  1OGZ A;  2K3D A;  3LYG A;  3CPW 2;  1US1 A;  3EN1 B;  2OTJ 3;  1EA2 A;  2ZHX B;  3SOA A;  1WMO A;  5HOH A;  3AGN A;  1SAR A;  1R4C A;  4EC6 A;  2CC3 A;  3NM7 A;  1BAO A;  1RGL A;  3ECF A;  1WQL B;  3ZG5 A;  1Q81 4;  4LGQ A;  3FCS B;  4HM2 B;  4BTY A;  1CYV A;  1BGS A;  1YNV X;  2Z7A A;  4O2H A;  4RNZ A;  5CLK A;  1GYB A;  3JUQ A;  4HZB B;  4AKZ A;  5CF2 A;  2ZA4 A;  3V99 A;  4R1K A;  2QA4 3;  1FYS A;  3DGL A;  1K28 A;  1FUS A;  4HBR A;  1QVG 2;  1RGH A;  3GZB A;  1DMQ A;  3UNL A;  1JKG B;  1JZD A;  1UUW B;  5LC6 A;  6GSP A;  7GSP A;  4IT7 A;  5IF6 A;  1F8N A;  1VQ6 3;  1IQX A;  3FZW A;  1UUG B;  3KFQ C;  3BNB A;  2J8X B;  1RTU A;  5DRE A;  1ASK A;  5KP3 A;  2CFL A;  4XM4 A;  2D42 A;  2W0Q A;  2L4V A;  1TFO A;  3SOY A;  1RRL A;  1Q82 4;  1N9J A;  2BU4 A;  4HOH A;  3UB1 A;  3WOE B;  5BU4 A;  3OWY A;  2OQE C;  3F14 A;  4CPK A;  1YJN 3;  2YFL B;  1KWI A;  2CWV A;  4LEH A;  3SVA A;  1RCK A;  2RSX A;  1MNL A;  1STD A;  4JF8 A;  2XRX B; 
#chains in the Genus database with same CATH homology
 1A67 A;  1W2Z A;  1A2K A;  2GU1 A;  1JV2 B;  1UI8 A;  3EBT A;  4X2H A;  4QWT A;  3VF1 A;  3LTB A;  2BMO B;  1AVL A;  1YHQ 3;  4O3V A;  4N6M A;  4FMC A;  3X3Z A;  3MPH A;  1MOL A;  2F98 A;  2OOV A;  3MKI A;  1DMN A;  3WDG B;  3NV0 A;  3K0Z A;  1UUV B;  4FCM A;  3EF8 A;  1GD4 A;  1N9E A;  1OGX A;  3G6E 3;  1IU7 A;  1FGT A;  1W5Z A;  2O3O A;  2Z76 A;  3DZL A;  5KP4 A;  2RCD A;  3EQQ B;  3LT8 A;  3V98 A;  1JB5 A;  1ISK A;  4WHA A;  5G2G A;  2WO0 A;  3CC2 3;  1C7H A;  1TIJ A;  4FCZ A;  5AII A;  3RGA A;  4ZM8 A;  4N6L A;  1YIJ 3;  3F40 A;  1JN5 A;  3MHE A;  1IDP A;  1W6C A;  1PFP A;  4FMD A;  1UI7 A;  3FKA A;  2IUK A;  3U97 A;  1YGE A;  1GY5 A;  2OOV C;  4IPB A;  1VQ5 3;  3GZX B;  5JPU A;  3EBY A;  3LTD A;  1VQ4 3;  2CFW A;  3G16 A;  3HK4 A;  1OCV A;  2XH9 A;  2HMN B;  5STD A;  4EV2 A;  4RZM A;  3EX9 A;  1E97 A;  1O7M B;  2W9Q A;  3X42 A;  5IER A;  5KP1 A;  2WOF A;  1DYU A;  3G71 3;  2KCD A;  3DMC A;  3KN4 A;  3DUK A;  3OX9 A;  2B24 B;  1D6Y A;  3BB9 A;  2CG1 A;  5IG3 A;  1VQ9 3;  3PGB A;  3FG4 A;  3I55 3;  4KFD A;  3X3X A;  2GEX A;  3B4P A;  3ER7 A;  3T8N A;  2WOH A;  3T8U A;  3BNE A;  2Z6B A;  1K9M 4;  3ALA A;  1HKX A;  1W4N A;  2CFD A;  3CCS 3;  3O8Y A;  1N8R 4;  1D6U A;  3QK9 A;  1Z1S A;  3FLJ A;  3CCE 3;  4BTW A;  4RBN A;  2BMQ B;  2XF3 A;  3EN8 A;  1L5G B;  3CU3 A;  2P38 A;  1V74 A;  2W04 A;  1O7G B;  1SJW A;  1T5Y A;  2P09 A;  1Y4K A;  2XGN A;  3KSE D;  4HYZ A;  4U13 A;  2MC8 A;  1LOX A;  3KSP A;  5AEU B;  1Q86 4;  2ML5 A;  5D81 A;  5CF1 A;  1N5H A;  1JB2 A;  3CXC 2;  3NHX A;  4WYK A;  2GXF A;  1FGO A;  1OAC A;  4HZ9 B;  1IT8 A;  3FG1 A;  2Y73 A;  1YI2 3;  5IG4 A;  1RKY A;  2K0M A;  1EKM A;  3Q90 A;  1O7P B;  3CC4 3;  3K9M C;  1IVU A;  3N9H A;  4H61 A;  1N5P A;  3NBR A;  2CW9 A;  1IT7 A;  1VQO 3;  4OVM A;  4PEJ A;  3GZY B;  3Q2P A;  5I97 A;  1EQK A;  3PCS A;  3S29 A;  2SBL A;  2OCT A;  4WP5 A;  2WGQ A;  2E2V A;  3PCR A;  3DM8 A;  1QAF A;  3WOD G;  2INX A;  2ZDJ A;  1TU5 A;  3PZW A;  2HML B;  3CCV 3;  3F8H A;  1FGM A;  3GZR A;  1PU4 A;  5HGR A;  1YJ9 3;  1JNQ A;  1AVK A;  1W6G A;  3F7X A;  1FGQ A;  5ELJ A;  1VQN 3;  1HU9 A;  2C10 A;  2ML6 A;  1OPY A;  2GEY A;  1BUQ A;  1K41 A;  3FF2 A;  2BT3 A;  3LML A;  4J8T A;  3NBB A;  1NB5 I;  3DGM A;  3K5T A;  5D83 A;  3KKG A;  5IW9 A;  5A0O B;  4I4K A;  5IEO A;  3JUN A;  3I0Y A;  3PS8 A;  3EJV A;  3S28 A;  4EBG A;  2CFG A;  2CFK A;  4OUQ A;  3G4S 3;  4G1M B;  1M90 4;  2XR8 B;  1JRQ A;  2CWU A;  2XFS A;  4MMZ B;  3CCQ 3;  1OF5 A;  4WYK B;  1JJ2 2;  4MMX B;  1VZZ A;  5FW5 A;  4L8P A;  1A90 A;  2BO9 B;  5AIG A;  5AYR B;  3DGO A;  1UW1 A;  2D1W A;  5DRV A;  3CCU 3;  3I56 3;  3DXO A;  3S5C A;  1W2B 2;  2XSO B;  3FF0 A;  3MWZ A;  3WA2 X;  3UL6 A;  2FXT A;  2B1X B;  6STD A;  1QMA A;  2XEP A;  2FGT A;  2ZL8 A;  3DY5 A;  4IIA A;  2BMR B;  3LZA A;  4HVN A;  5CK6 A;  3FGY A;  2F99 A;  3RDE A;  2YX9 A;  1OH0 A;  4KZ1 A;  3GWR A;  1D6Z A;  3CCM 3;  3LT9 A;  1IV9 A;  1YIT 3;  4XBX A;  3WA3 A;  2QEX 3;  1QJG A;  3CCL 3;  2QIY A;  4CDL A;  3SLU A;  3JUM A;  4K1U A;  3IPT A;  3LOY A;  1S72 3;  1NJI 4;  3D3L A;  1Q42 A;  1STF I;  3H51 A;  4ORL A;  3G8Z A;  3HII A;  3SXX A;  3LTC A;  3EB8 A;  1TFK A;  3D9R A;  4FCJ A;  1W01 A;  2CH9 A;  2QGU A;  2RFR A;  1EG9 B;  1W7C A;  4WFO A;  1LNH A;  4N6T A;  5EQL A;  1GY7 A;  1O7H B;  4K1V A;  5IEP A;  1KQS 2;  4MMY B;  3SED A;  3SX1 A;  1OF5 B;  2P0M A;  2JDI H;  1U8C B;  1ULJ B;  2CKF B;  1ROA A;  1CQS A;  2BHM A;  1QAK A;  1FGR A;  1N8Q A;  1LVN A;  3OXA A;  1ROV A;  2CG0 A;  2XGL A;  2W6J H;  3EE1 A;  1ULI B;  4STD A;  3IMA B;  4CCV A;  5BXQ A;  1IV7 A;  5BVB A;  1OHO A;  2A15 A;  2C11 A;  2E2U A;  3FH1 A;  4HM1 B;  4N6V 0;  2K54 A;  3M8C A;  2IMJ A;  2KXG A;  3S67 A;  1WNH A;  3GRD A;  1VQL 3;  4LZI A;  2PZV A;  4L7K A;  4R9K A;  4TX4 A;  3HZP A;  1J2B A;  4N6N B;  1NDO B;  4JRF A;  1SPU A;  3F8X A;  3BLZ A;  4XDV A;  1IK3 A;  3KII A;  3PXM A;  4HM0 B;  3GAX A;  3LXU X;  3CME 3;  1FA3 A;  1DVD A;  2O9U X;  1NO3 A;  2IA7 A;  3MG2 A;  1IQ8 A;  1TP6 A;  1KSI A;  1WMN A;  2W2C A;  4KFF A;  5TGN A;  1Q40 A;  4HM8 B;  3B4O A;  1NB3 I;  3HX8 A;  4XBY A;  2CHC A;  3K63 A;  2LYX A;  1E3V A;  1ZX2 A;  3CNX A;  3HI7 A;  3VGN A;  4J9A A;  4XBT A;  1CEW I;  3CNM A;  1FUW A;  3UJM A;  2OQE A;  4LSO A;  1VQM 3;  3X3Y A;  1IVX A;  2HMJ B;  4GL6 A;  3E99 A;  4HM4 B;  3NQZ A;  1Q7Y 4;  1DVC A;  1OHS A;  3NM2 A;  4XB5 A;  4EXR A;  2IUJ A;  1QAL A;  3G0K A;  2GBX B;  2P0X A;  2GBW B;  2PNC A;  3H3H A;  4X2O A;  5D82 A;  3AMO B;  5IEN A;  1DMM A;  1W02 A;  4WWU C;  4FMA A;  2W56 A;  3QRD A;  4N3V A;  2Q07 A;  3OV4 A;  4HM6 B;  1NU3 A;  3FSD A;  1S5A A;  4R80 A;  3LTA A;  4H3U A;  3T0U A;  2I9W A;  3TDG A;  2CK3 H;  4HM3 B;  3DGN A;  4GB5 A;  3NUV A;  3NXJ A;  1U5O A;  1RRH A;  4HM7 B;  1IQY A;  5AIH A;  4BTX A;  3BND A;  3X40 A;  1RJO A;  1VQK 3;  1KD1 4;  3MG1 A;  5IG5 A;  2HMK B;  1WTH A;  4AKY A;  3MSO A;  1VQP 3;  5LC7 A;  4Q53 A;  1KC8 4;  3J7Y d;  1M1K 4;  3MYT A;  2YFI B;  3ROB A;  4MEI A;  1Q40 B;  2M7O A;  3LH4 A;  3X41 A;  2OWP A;  3STD A;  2STD A;  1SQW A;  4NRE A;  2HMM B;  3A76 A;  2JQ5 A;  4FMB A;  1RN7 A;  4LMI A;  5JPP A;  3NQY A;  3BNC A;  3V92 A;  1SII A;  1YJW 3;  3EC9 A;  3S27 A;  4NHF A;  5AIF A;  3F9S A;  3UL5 A;  1G96 A;  4MJD A;  4EYC A;  3PYJ A;  4KVH A;  8CHO A;  1K73 4;  3KZT A;  5FGO A;  1TUH A;  2E2T A;  3L0R A;  3Q1C A;  4EV5 A;  4KFE A;  2W03 A;  3OW2 2;  2YFJ B;  4O8S A;  5AEW B;  3EHC A;  5AYS C;  1IVW A;  1K8A 4;  3K7C A;  3JVC A;  2R4I A;  2W56 B;  3MG3 A;  2XSH B;  3F7S A;  1M9G A;  4AEQ A;  2OTL 3;  2CWT A;  4RNY A;  5EVH A;  2XFT A;  1WMP A;  4N6O B;  2FNQ A;  3B8L A;  4K90 B;  1NWW A;  1OUN A;  2Z77 A;  3JUP A;  4R4K A;  1SIH A;  4FR9 A;  1QVF 2;  1CYU A;  2GU3 A;  3NBJ A;  4HKV B;  4N6U A;  1AR0 A;  1M1X B;  2RGQ A;  1O7W B;  4HM5 B;  3OWU A;  4R9L A;  5CXO A;  5EEO A;  2MF7 A;  3OWS A;  5IG0 A;  3N54 B;  3WOF B;  2WGO A;  3KE7 A;  3CCR 3;  2HMO B;  4HJL B;  1W6Y A;  2LQV A;  1JKG A;  3AMO A;  3HIG A;  4OK0 A;  3NX0 A;  3U1W A;  1YVB I;  2P05 A;  1ZO2 A;  3VSY A;  2F86 B;  1W00 A;  1GY6 A;  5AI1 A;  5JBS A;  1JB4 A;  1LXE A;  3CMA 3;  2Y74 A;  3NV0 B;  2BNG A;  3CD6 3;  3CPO A;  2W9P A;  3IJE B;  1OHP A;  7STD A;  1O7N B;  2CIU A;  3CC7 3;  1GS3 A;  4XDW A;  1AV4 A;  3CCJ 3;  1A2V A;  3B7C A;  4L8O A;  5ELU A;  4O02 B;  3RGR A;  3JUO A;  2V1L A;  4K61 A;  3N8B A;  1VQ8 3;  1E3R A;  3WMD A;  1IVV A;  1GD3 A;  3FG3 A;  2KRT A;  1JN5 B;  1VQ7 3;  2UX0 A;  1OGZ A;  3LYG A;  3CPW 2;  1US1 A;  3EN1 B;  2OTJ 3;  1EA2 A;  3SOA A;  1WMO A;  4EC6 A;  1R4C A;  2CC3 A;  3NM7 A;  3ECF A;  1WQL B;  1Q81 4;  4LGQ A;  3FCS B;  4HM2 B;  4BTY A;  1CYV A;  2Z7A A;  4O2H A;  4RNZ A;  5CLK A;  1GYB A;  3JUQ A;  4HZB B;  4AKZ A;  5CF2 A;  3V99 A;  4R1K A;  2QA4 3;  3DGL A;  1K28 A;  4HBR A;  1QVG 2;  3GZB A;  3UNL A;  1DMQ A;  1JKG B;  1UUW B;  5LC6 A;  4IT7 A;  5IF6 A;  1F8N A;  1VQ6 3;  1IQX A;  3FZW A;  3KFQ C;  3BNB A;  5DRE A;  1ASK A;  5KP3 A;  2CFL A;  4XM4 A;  2D42 A;  2W0Q A;  2L4V A;  1TFO A;  3SOY A;  1RRL A;  1Q82 4;  1N9J A;  3UB1 A;  3WOE B;  3OWY A;  2OQE C;  3F14 A;  1YJN 3;  2YFL B;  1KWI A;  2CWV A;  4LEH A;  3SVA A;  2RSX A;  1MNL A;  1STD A;  4JF8 A;  2XRX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...