4LZLA

Structure of the inactive form of the regulatory domain from the repressor of iron transport regulator (ritr)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
123
structure length
123
Chain Sequence
GKRILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQTDYDLILLNVNLGDMMAQDFAEKLSRTKPASVIMILDHWEDLQEELEVVQRFAVSYIYKPVLIENLVARISAIFRGRDFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defining the Aspartate-Less Receiver (ALR) Domains: Structure and Activation of RitR from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae 2061617
molecule tags Transcription
molecule keywords Response regulator
total genus 44
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lzlA00
4QPJC 2V0NA 3LUKA 3O2SB 4JB0A 4QYMA 5IULC 4YGXB 2PAFA 1TVMA 3I5AA 3H1GA 3CG0A 3KJXA 4WZZA 3OQNA 1P6QA 2FQXA 4WXMA 1F4VA 1T34A 3FFXA 1QO0D 4D74A 3LUGA 3I42A 2CD7A 2QSJA 5EWMA 2MYUA 3N0XA 6ABPA 3KLOA 2XDYA 1F51E 3OMXA 3NBMA 1EWKA 3LUFA 3MYYA 4P1ZA 3GBVA 1URPA 3MA0A 3OLYA 3SNKA 3HSYA 4KVFA 2FKAA 3KYJB 3TO5A 2A9RA 5KQPA 3OLZA 3KCNA 1BDIA 2A9PA 5KQGA 3H5LA 5BRJA 3QLUA 4QYWA 1Z25A 5TQ2A 4RK4A 4W5QA 1FFWA 2PJUA 4NV3A 3ROTA 4RK5A 4MR7A 4RZSA 1U04A 3IP6A 1PNTA 4JB2A 1MVOA 1USIA 4MR9A 1D1PA 3O21A 3EQ2A 2WY2D 1KRWA 5ABPA 2B1JA 4RU1A 1I3CA 4KV7A 1YTUA 2R25B 1DBWA 1JYEA 5IEBA 4G0MA 4GPAA 3Q7SA 5GQSA 3SM9A 3LUHA 2PUDA 1DJMA 1DG9A 5TPWA 4MS3B 1GCGA 3LOPA 3H5IA 2WJAA 1D5WA 3O1IC 5IC5A 3C3KA 3CKMA 2IDMA 4MLCA 2H0AA 3CNBA 2VUHB 4N0PA 4KNYA 4RKRA 1C4WA 1APBA 2WRZA 2HSGA 1ZGZA 2ZWMA 1U0SY 2PUBA 5FBHA 1NXPA 4TLLB 3H6HA 4PYRA 2MYPA 2FVYA 1EFAA 1AB6A 4XAQA 3CZCA 2PL9A 4GNRA 2WWVD 5EWJB 1GUDA 5C5CA 4MS4B 4MS1B 2JB9A 2LUOA 1R8JA 4QICA 3HM9A 1JDPA 1XHFA 3OM0A 2JVJA 2M98A 3RVSA 1S8NA 1LBIA 4L85A 3RVLA 1AB5A 2HJ9A 2NZUG 1E6LA 1USKA 5FBKA 1YVUA 1ZHHA 3TD9A 2PL1A 1JH9A 1D4ZA 2IPLA 4Z4CA 2FN8A 3JS5A 4RXMA 4G0OA 4IMIB 2QU7A 4N76A 2MYNA 2FQWA 4RXTA 1BDJA 1Z16A 4XARA 4DN6A 1GLGA 3KYIB 3QLUC 4RY0A 4ETMA 4G0ZA 5FWXA 3H5VA 3H1FA 4KFCA 1QNLA 4TMYA 1CYEA 4LZLA 1SXGA 1DC8A 2OQRA 4ZMRA 1A2OA 1Z12A 1M5TA 3C3WA 2QV0A 1NXTA 3H75A 4Q6BA 1DBPA 2M1ZA 5EWLA 4EYOA 2L2QA 3N8IA 1DRKA 1FFGA 1PHRA 1ZVVA 4G0QA 3EDCA 3LUDA 2FN9A 5JNWA 3CLKA 3L6UA 1NXWA 2JVKA 1EWTA 4YWHA 3HUTA 4NCBA 1B00A 5HSGA 1QQBA 4OTZA 3RVJA 3B2NA 1E6KA 4HNQA 3GV0A 1NTRA 1DC7A 4Z4EA 1KMIY 1Z15A 5TQJA 2A9QA 4MPTA 1A0OA 5EWJA 4KZKA 2FQYA 2FTKE 1QO0A 2E4UA 2DRIA 5BQ3A 1NY5A 4UHJA 3QK7A 1KGSA 1LK0A 4RK0A 2PMCA 2NT4A 3G1WA 4RK7A 1ZGGA 1W9HA 3JVDA 3O1JC 3OM1A 1E6MA 5BRAA 4H60A 1DZ3A 2N9UA 3HO1A 4XFKA 4LE1A 2GBPA 4KQCA 3RVNA 3UKJA 4YR7A 3TMYA 4MR8A 4P98A 5TQ0A 3N0RA 4EUKA 4MS3A 1JL3A 3GA5A 5E3JA 3N53A 3GWGA 1USGA 1YMVA 1LBHA 1K68A 3CU5A 5HKOA 3UK0A 2R4QA 3HVRA 3KHTA 1EAYA 4MR8B 2ID9A 3MQ4A 2FEPA 3NNSA 7ABPA 4LE0A 4NQRA 5D2CA 2FMHA 4MLDA 4YP9A 4JP1A 4MR9B 3O1HB 3P9YA 1NATA 2ZAYA 3Q41A 4OATA 2R48A 2GWRA 1DP4A 4MRMA 1YK1A 4RS3A 4YO7A 3SG0A 1QPZA 5KWSA 4F3TA 3DGEC 3OMWA 5T7BA 2FLWA 4CBVA 1TM2A 3NHMA 4OG2A 1BA2A 3ILHA 4XASA 3BREA 1ZN2A 3C6QA 1Z2EA 1PEYA 2MSKA 3D8UA 3E3MA 3F6CA 3HCWA 2PUAA 3DLHA 3CFYA 3BRSA 5IBQA 4Z4GA 4W5TA 4E7OA 5EWMB 2ID7A 1RNLA 3CZ5A 5KC8A 1JFSA 2JCGA 2FXIA 3JTEA 1TLFA 4JA2A 3EODA 3DZDA 3TX6A 3RVOA 3T8YA 4S04A 4EGSA 4KPYA 3HDVA 3IPCA 5TQ0B 1JF8A 3Q9SA 2PUFA 4Z4HA 4RK1A 3MMNA 3JPWA 4HNRA 5B3JA 4ETIA 1ZH2A 1FQWA 4TN5A 4Z9AA 5FWYA 2IOYA 3IDOA 1YS7A 1K66A 3O74A 4Q7EA 2E4ZA 5F64A 1MIHA 3OLVA 2J48A 4EYKA 3E61A 1QMPA 2QVGA 5CNIA 1ISSA 4EVQA 3HS3A 5IUNC 4DQDA 4FE7A 1BAPA 2FMFA 3LKVA 3QELB 3HJFA 2RJNA 2L17A 2X7XA 2IYNA 4F06A 1TMYA 4ML3A 1QQAA 3DLBA 4G86A 4LDZA 1RXEA 1BVHA 3GT7A 3LFTA 1QP7A 3CG4A 3T6KA 4IF4A 2F8TA 2MYTA 3QELA 2OENG 1JYFA 1ZITA 1PEAA 1YS6A 3QLTA 4PE5B 2R47A 1ISRA 4MS1A 3S99A 3K4HA 3A0RB 1LJLA 4N03A 3CTPA 2YHAA 3Q7TA 1QKKA 4LRQA 2TMYA 3IP7A 1Z17A 1DRJA 2MSLA 2PUGA 1XWWA 1JHZA 3LUAA 3M9WA 1ZDMA 3EJWA 5JNTA 3RH0A 1EWVA 3W9SA 1FSPA 2HQRA 1DCMA 6CHYA 2HQOA 1JFTA 5B3JC 2FLKA 1LJUA 2B4AA 1ZESA 4RXUA 4NCAA 5CNMA 5DLEA 2P4UA 2E4VA 3KKEA 3QLVA 4XLTA 3I09A 2O20A 3JVIA 2CHEA 5TPZD 1KRXA 1OXKB 2FW0A 2GX6A 3FFWA 4H3HB 3RQIA 5CNKA 4S05A 1BDHA 1VPWA 1WETA 4MS4A 3HZHA 5KQMA 1J56A 2WMYA 4RSMA 5PNTA 5JNUA 1VRVA 3OLXA 4MRMB 1W25A 2Q5CA 4G97A 4O1IA 1Y1LA 3O2QB 5IX8A 1U8TA 1VKRA 3OQOA 4LDAA 2JRLA 2GI4A 4RWEA 1H9CA 1SD5A 2LIVA 4TLMB 1D2AA 2QXYA 4NICA 4YLEA 5HQJA 1CEYA 2WB4A 2RGYA 1ZH4A 3GBPA 5KC9A 1JWLA 3KG2A 1VLZA 4YRZA 2MSWA 4KMRA 2P9HA 4N41A 3FDFA 3BRQA 1SRRA 4G0PA 4MQFA 2KYRA 5CNJA 1NXSA 1GCAA 3FFTA 2RDMA 3CRNA 5TQ2B 4N47A 1Z2DA 2NT3A 3A0UA 4PZ0A 4WUTA 3QLVC 3Q7RA 1SXHA 4YCSA 1C0EA 3O2JA 1M2EA 3OLWA 4G0XA 3DBIA 3R0JA 4F12A 1QP4A 3OQMA 4Z99A 5TPZA 1YK0A 2JBAB 4M88A 4D6YA 5T3YA 3QX8A 2LPMA 2H3HA 3CS3A 1ZAYA 1OXBB 1CHNA 3H5WA 2PLNA 3RVKA 3VNBA 1YMUA 2JK1A 3NNDA 4KRFA 5JNSA 2NZVG 3LMKA 2JBAA 3LKBA 4W5NA 4F11A 2FMKA 1HEYA 3IPAA 3FMVA 3N6VA 4EYQA 2BGGA 3ROFA 5EWLB 1JX6A 4Z0NA 1DBQA 1MB0A 3HV2A 4WT7A 2YHBA 3F7NA 4O1HA 4ETNA 5KQLA 4MGEA 3G85A 4RKQA 4L4UA 1D1QA 3SY8A 3URMA 4RDCA 5JNVA 5JNRA 3L49A 1Z26A 4EYGA 4N0QA 3MIZA 1ABEA 4ZYLA 4KK3A 4JASB 3UUGA 1SXIA 3A10A 2E4YA 3A3KA 4IMJB 5GOTA 1UDRA 4IRXA 4MQFB 3FGZA 4DADA 5IEJA 3K9CA 2QW1A 3HK2A 3KLNA 3SAJA 4YS6A 4ZJPA 1FFSA 2I6FA 3M6MD 2AYXA 3KSMA 3RVMA 3D02A 4RV5A 1L5YA 4O5AA 5I4CA 2IPMA 1JBEA 5JS2A 4EY3A 3HEBA 3O75A 2IPAB 3EGCA 1XHEA 3EULA 1QP0A 3HDGA 5JS1A 4ZMSA 3QEMA 1E2BA 4ZPJA 4E7PA 2GKGA 8ABPA 4MQEB 2JVIA 2FEKA 3EQZA 4MQEA 2IKSA 3NHZA 3QEMB 1P8AA 3KS9A 2CHFA 4W5OA 4WXEA 5TE9A 2PKXA 2PUEA 1IIBA 3H5TA 3H5OA 5DKFA 1DCFA 1RPJA 3JY6A 2QZJA 2NUBA 2RJOA 5KI6A 2HQBA 5TPWB 3H1EA 5DGCA 4Z9BA 4XXHA 1P6UA 1YIOA 1ABFA 4G0YA 3T95A 1TJYA 2E4XA 3MM4A 1L5ZA 4OLBA 2E4WA 4PEVA 4FB4A 1RZRD 2FSPA 4FE4A 2AYZA 3SQNA 1U2QA 4OLAA 3OO1A 3VNAA 4MR7B 1NXOA 1PNRA 4JAVC 2VUIB 4KQ9A 3RVQA 4MAAA 4EVSA 3M9XA 2W42A 1RZRA 1M5UA 2CWDA 2FEWB 4WWHA 5BR1A 2PUCA 1ZY2A 4HYEA 3BILA 3C97A 4IILA 3RVPA 4IGAA 5ED4A 1RXIA 3OO0A 3EAFA 3HUUA 5C5EA 2IPNA 3KTOA 4H3KB 3C3MA 2LBPA 4OBBA 4RY8A 4EVRA 4KREA 3BBLA 3TB6A 3GYBA 4F8JA 3MF4A 1Z18A 3N0WA 1MB3A 1P2FA 3Q15C 4HNSA 4PICA 2LP4Y 3LUCA 4D6XA 4UHKA 2PE5A 1NXVA 2VYCA 1EHCA 3RVRA 4KK4A 3N75A 5FWXB 3ILYA 3LTEA 3IP9A 5IUKC 1M2FA 4YV7A 1Z13A 3CHYA 3GRCA 3I45A 3IP5A 1JDNA 5CHYA 2QVCA 2FMIA 2A9OA 4Z4IA 4B09A 3T38A 4W5RA 3NNNA 2HPHA 4LE2A 1U2PA 5DCLA 4RY9A 3H6GA 5IUJC 3LUJA 1A04A 1GUBA 3DGFC 1JFVA 3HXMA 3F6PA 3JPYA 5FWYB 2F8SA 1JLKA 2VK2A 3F73A 3GL9A 4RK6A 1PUXA 2WJWA 5DTEA 3QEKA 9ABPA 4Z4FA 4JOQA 5HM6A 4MYRA 1DCKA 1MAVA 1NXXA 2L18A 2QR3A 2L19A 3QX9A 4Y9TA 4LX8A 4Q6WA
chains in the Genus database with same CATH superfamily
5EZYB 1CETA 1JT2A 1XKTA 2H11A 4G5SA 3RYIA 1XD2B 3GN2A 4OREX 3K31A 3OQNA 4M0DA 1WCV1 4E6PA 1WIWA 4ZCRA 4KDCA 5CCBA 1PR2A 1AKUA 4HN2A 3RAFC 3UHAA 1G3IA 5HK8A 1HKUA 1MX3A 2WHQA 4IXDA 5AXCA 5IBPA 2X76A 4EO4A 1H6AA 3OMXA 4PONA 5CH8A 4ZVMA 3UV6A 2Z4TA 4V2IA 3ANXA 4D8XA 4LRTB 5FI0B 4E32A 4TLAA 5TEVA 2C29D 1NJ5A 3H7AA 4NAUA 1GPMA 3SPXA 1WDLA 4ESVA 2I87A 1K4MA 3JVUA 3T12A 4G9EA 1T1SA 4R68A 3NIGB 3RT9A 3W5SA 1FU8A 4E30A 3JQDA 2BR5A 1LY1A 3OSZA 1CQJB 4ISBA 4MR7A 3NKVA 3OCYA 1U04A 1TZKA 1CDZA 1PNTA 2OCDA 2XMGA 3AF1A 3DDZX 3IIJA 3M6FA 3Q9NA 1YU6A 1UIMA 5BORA 3U3KA 2F9FA 1KRWA 1EP2B 2OAQ1 2TSYB 3A36A 1GP2A 4J2HA 4R1MA 3BULA 4E2FA 5JXGA 3I64A 3V3TA 3M6IA 1JG1A 2C7VA 2IXGA 3FBTA 2G9RA 4ZAXA 2C8LA 4C2UA 2GO7A 3H0EA 4D57A 3E1GA 3LOPA 3O92A 3TCNA 1MORA 3WLFA 4M55A 3RUCA 2QLTA 3KR2A 3T9BA 1X87A 2GPBA 2HK8A 1GKIA 1UKAA 2HMWA 4BNFA 2GQ0A 2P4EA 3OQIA 4MWBA 1QTQA 4U2BA 1SCDA 4J1QA 5LC1A 1ZJ6A 3SXUB 5K0TA 4QASA 1I14A 4HDNA 5A5FA 2JEZA 4M0CA 3IEMA 1BX0A 2MYPA 4G4SP 4KPUB 1F6BA 3ZXUB 3SEFA 4J29A 1AQLA 1ZXLA 2H1IA 2UVPA 4EW1A 5C5CA 1PQYA 1D9ZA 1WU8A 3P0FA 4NP6A 3VZRA 1BQEA 2O8FA 4QSMA 3EVGA 3PWZA 4P7KA 2NW6A 3PNKA 3L8GA 4Q4LA 3K8ZA 4H17A 4QFCA 3TNLA 2O2SA 3VJMA 4ARBA 2HJ9A 1I1OA 2E6KA 1SBQA 1B0PA 1I6WA 2NPOA 2ZBRA 3KVOA 3QOFA 4JUDX 2BJWA 3D5TA 3OVMA 2XCUA 3ZN2A 3VR3A 1JH9A 5TVKA 3VO1A 4I5EA 3K7EA 2CNBA 2P7IA 5JCJA 4J1TA 2Y1XA 2WU3A 3GDOA 4Y2YA 3HN7A 2ZU6A 3R0XA 2SKDA 3PCXA 1LLCA 4ZZ0A 3U40A 4U5QA 3MS7A 4G0ZA 2GZAA 4OGWA 2C1XA 3I8XA 1P5ZB 1V96A 2CHUA 1T4CB 1T4CA 3IT2A 3U3OA 5BVGA 1QTRA 4C6HA 4QVIA 4GWKA 5AH0A 3SZRA 5AXDA 3N8IA 4NATA 2QZ4A 1CZNA 2VPZA 3G0CA 1OIXA 4R31A 1FFDA 3L6UA 3RW9A 4RTOA 4I0WB 4Z0PA 4P3OA 2QN3A 1F0KA 4MVJH 1I1QB 4Y9UA 1K3TA 2KPOA 1L8XA 1IN6A 2MCFA 2KMLA 1JLLA 1GL7A 1B8VA 1E1LA 2ZCJA 1V26A 1ZYUA 1GZHB 2FEMA 4E13A 1FMCA 2DSTA 1RYEA 4S12A 1PZGA 5JRZA 1XOIA 2DFVA 4RSGA 5BW6B 4MW4A 3SHVA 4BO0A 4KZKA 4HDOB 3K30A 3P9PA 1P1KA 3FPHA 3GUZA 4RVCA 4JLDA 1UL1X 2ZSJA 4FGLA 4R83A 5GP1A 1CF4A 3ASZA 3BXFA 3F74A 1Y3AA 1WP9A 3OM1A 1USUA 5KNBD 1TW2A 4Z2YA 4D2IA 2YIMA 1GG2A 3QA3E 4AJ9A 3NFYA 1AKMA 4XGIA 3T7EA 3EFOB 2ECKA 3WYDA 1N2CE 3OZDA 1FUYB 2WWTA 3EVNA 3QV2A 4P5EA 4XCQA 1M2KA 2ZPTX 3OT1B 2OYRA 1XGKA 3AR5A 1H9AA 3GIDA 4TL8A 1YMVA 3QJGA 4WLEA 3ELDA 3TLZA 3N74A 5BNIA 2RHDA 1VI5A 3PP8A 1IBRA 4MR8B 5JDCC 1JEOA 3V8PA 1SC9A 3QKRB 2V74B 3U3RA 2XODA 3ZNNA 1KYYA 2GCGA 1KZ9A 1R9MA 2ATCA 1E3SA 1R50A 2WPDA 2PU5A 3DBOB 4GKBA 1MA3A 2H2GA 1NIJA 1PKXA 1T8PA 1SBNE 2QD2A 3VPDA 3TTWA 3PHHA 1H2EA 4NBKA 4DMKA 4K6CA 5C46F 5KJ6A 4NYJQ 4YT8A 3QP9A 1UOPA 1S96A 3EBPA 4Q7LA 2W6ID 2XF8A 4E5YA 4JU8A 1O9GA 1NUUA 1YR7A 3GEDA 4G41A 3NCHA 3MCWA 4MGIR 1GU1A 5FOTA 5U1PA 4KR3A 5DU2A 3V8QA 2ZE6A 4PPFA 1M1YE 3ABZA 1QWOA 4EW3A 3ET4A 1QX4A 2WT4A 3B89A 2F67A 2ZYVX 2F3RA 3H9EO 5KVSA 2VCHA 2WM9B 3BRSA 4Z4GA 1GL3A 4S2UA 2BFPA 1RNLA 4F8EA 1RAHA 4RCYA 2JG3A 1UH5A 4YP7A 4D3SA 3HU1A 4J0HA 2MR6A 1N6OA 4CQMA 4JA2A 5LQSA 2VSXA 1JKJA 2XYGA 2XYRA 5CW1A 4B3GA 3F78A 2FQQA 2QRUA 5EMNA 1LF5A 1L7DA 2C99A 2AX3A 4XWWA 2H1RA 3SF8B 4UAVA 5FI3A 2ZVJA 2OOSA 3FNIA 3EFOA 4MIOA 4U2GA 4R0NA 4ETIA 3NTRA 5BUSA 1JH8A 3G5TA 3ZWQA 2CNLA 2O8DB 1A77A 5B1HA 3AKZA 4JUAA 2DJ5A 4A0QA 1PWXA 2E4ZA 2VSYA 5LXTB 2Z1NA 3QITA 3DE0X 1Z36A 1P73A 4UNSA 5ER6A 3I9V6 1Q19A 3KWFA 1N6PA 2FMFA 1BVYF 3EZ9A 4M1QA 4GLBA 4R16A 2PL3A 3ER9A 4HV4A 4J7AA 2A1UA 1B0AA 1T0IA 1TUBB 3R5FA 4IIDA 4UPEA 2AJ8A 4QOHA 5ECGC 4ML3A 2DF8A 5JC8A 1TAUA 5EG5A 3TH5A 4GPBA 3M33A 2MSDB 4U7WA 3K32A 3ADOA 4DNXA 2LCFA 5EN4A 2CMGA 2XIQA 1Z7GA 5HEKA 3ZBQA 4DR3B 5KHOC 2HA4A 1V1MA 2KBEA 1M67A 3NC1C 2RH5A 1U0LA 1UBCA 5KWIA 1N3IA 1SIOA 4PHCA 5HQ3B 4TVSA 1Y5LA 3PJFA 1YS6A 3KV1A 4BKQA 4A6XA 4TYNA 1QS0A 2YDYA 3V6MA 4BEVA 1I13A 5AOAA 3R5JA 3BMQB 4BX9A 3RDPA 3NV9A 1SBIA 1SCNE 2IE8A 2OFXA 3FCXA 5THKA 1GXSA 2TMYA 1VG0B 1ILWA 4HXFB 3K1AA 2XZLA 2DWPA 4U9IS 1JFFA 2MSLA 3GT4A 3WO1A 4PV7A 3TNFA 2PGDA 3EJWA 1UJBA 5HR5A 3AFMA 4AWAA 4D9FA 5ITZB 1SD1A 1QIJA 4B7AA 2I4LA 1ST2A 1PR6A 1RWVA 1CXZA 4JFAA 4AZ0B 2QLMA 1DCMA 3BHJA 2XDWA 3HNRA 4IV8A 2F1HA 2HQOA 2Z4RA 2INGX 3SC4A 3TI9A 1O7JA 1A5TA 3H5RA 3NYQA 3U13A 1S3GA 5JD5A 4HQRA 4ZCSA 1AA9A 2ATEA 4AJ4A 1KSHA 3IQXA 1RRCA 2CHEA 1VYHA 1BEEA 3DVRX 3LL7A 3HCCA 5CNKA 3WRVA 1WU7A 2VBCA 1WETA 1JA0A 2Z0MA 2VVTA 1N5RA 4F84A 4ODIA 4ZAFA 4RSMA 3FWHA 3NVAA 3OLXA 1TI7A 2YJ6A 3NTLA 1U0NA 2ACWA 2OZPA 4O1IA 4JEHA 4O4JF 3UA3A 4DQ0A 1PS8A 2P3SA 3ZE9A 1JA1A 1F38A 3W2IA 4Q4CA 4HAWA 3EC1A 4C7OA 1A97A 1VKRA 1MA0A 3HMQA 4JOCA 5M2QA 3HLTA 2UYCA 2AD1A 2YMLA 3COPA 1SCUA 5FEUA 3CJTA 2JLYA 3I32A 3TKLA 4O2AA 5AVOA 3M1AA 4IS2A 2W5UA 5IKOA 1RPAA 1EP1B 1UDBA 1C3JA 2PA0A 2AXNA 5HQTA 1H9CA 1U6JA 2O2DA 4FUQA 4QIHA 2SECE 3QE4A 1NP3A 4UCQA 3GUYA 1ZH4A 2CYBA 4FFSA 1SUFA 2HA2A 1JXQA 1GGNA 3MHPA 1MMFB 2GJ4A 3F8WA 3ANLA 4IVPA 4HX2A 4PC7A 4KIUA 1T2EA 1F3LA 5I9SA 2PEYA 4B48A 1SUCA 2FI1A 3G2IA 1AM4D 2N42A 2X0FA 1VE7A 2ZR9A 3W0LB 2A5DA 5DBGA 4C2TA 2XQKA 2Q3MA 3T3PB 1A88A 2ID8A 5IDQA 3KOOA 3V2UA 1JG3A 3PD0A 4G63A 3L3BA 2FF7A 2A5GA 2O59A 3M5PA 5CDFE 1S4MA 3SYRA 2BAGA 2FG6C 5JSYA 1IJFA 1VCHA 1J22A 1KDOA 3NT5A 3TQIA 1Y6RA 5D1HA 2D2XA 4OKSA 2CVOA 2TMDA 3CEMA 2WAAA 2XQIA 3JQQA 1Y7IA 1BWQA 4FINA 4GR9A 3KUKA 3QUBA 4QBFA 2IX9A 4CMCA 5KEIA 1NRIA 4ZZ1A 2JBWA 3ETCA 3JASB 3ZC3A 1ICIA 3KOYA 5C18A 4FS3A 1JHVA 2NUTA 2OORA 5A4AA 4NDAA 3HC7A 1OTHA 3IHLA 3OLQA 2PLFA 3N6VA 1SHZA 3P45A 4LRUA 3VH3A 3K9QO 3D1LA 2BGGA 4WKCA 1SBCA 2IJGX 1NOKA 1J5EB 1C1DB 3L84A 3F7NA 4POOA 3DVAB 3GGCA 4L4UA 5L3QA 4N9QA 1I7NA 3CE9A 2NWQA 1DV1A 1KJWA 4L50A 2MSNA 2DLCX 1Z5PA 5HZGA 4L8FA 5DHUA 4CM9A 1SXJC 3DTVD 3KZVA 4PLYA 4PSVA 1ABEA 1E7RA 3UTDA 5IT9A 3HTXA 1EX7A 1KOFA 2JAWA 1QAQA 1E59A 4JROA 3T0IA 5FFNA 3I3SR 3LQ2A 2I03A 1F2UB 4RA9A 3UKDA 4OKIA 2LCQA 5IEJA 1P1HA 1WUKS 3PVZA 5ICMA 2CLSA 1G4UR 1WX1A 3X1ZA 2ERCA 2C2YA 5B64A 1KSFX 1Q5PA 3GQVA 1DO2A 3TN7A 5BUZA 4MITA 3CVXA 1NQ5A 1U0EA 4BP3A 4IJUA 2GZHA 4IDAA 1O95A 3L92A 2CFTA 2IOHA 3I12A 2PT7A 4YXFA 1PJ3A 2X41A 2R62A 2YS6A 1DOAA 1ID1A 3SYTA 3AUJB 3X2SA 3OE4A 1QP0A 3HCDA 2GJ9A 3R3VA 2WWGA 3EZNA 3FNFA 6Q21A 1Y1TA 3OJLA 4M7RA 4C4XA 3JQEA 3D6VA 1I80A 4I9UA 1L5HA 2QTWB 5JQGF 4CMEA 3UMRA 5F7XA 3QE3A 5KWEA 5FUXA 2K6GA 3MAJA 4GE0A 1DCFA 1O2DA 2H92A 3EGXA 4CIXA 2X0DA 1N5DA 2FY8A 4NZPA 2JIOA 2P6NA 3ZY2A 2C78A 5DGCA 2D5CA 1OXSC 2AN4A 2JANA 2C8KA 2NZ8A 2Y1CA 2VNHA 1R0YA 2QVYX 4JZKA 1SVOA 3RVDA 1D2RA 1DRUA 2BKVA 2PS3A 3TRJA 4D8TA 2UKDA 4CVNA 3P9NA 4KGVA 2FWAA 3INRA 3NHBA 1FP4B 4DR6B 5EP2A 4OI0A 2FSPA 2A1TS 2X4IA 4QQ8A 2H2IA 4Q9HA 1GNTA 4DVGA 3MAAC 2DKOA 3PIRA 1HLPA 3HXTA 4DNPA 3FYHA 2YMMA 1MXHA 2X7HA 2H3EA 3IURA 4MB6A 3WBJA 3ZK9A 3E5MA 4PHGA 4YUVA 5C7IO 4HYEA 4CN8A 1KBZA 2WP0A 3HA3A 4DXAA 1RXIA 2CW5A 2QM0A 4ZI2A 1OLOA 3N39C 4MYSA 3KTOA 4B34A 2FK8A 2HSEA 4Y7CA 4QZVA 4NEGA 3CCCA 4TM8A 5F1YA 4F4FA 1GITA 3CLHA 3GNTA 1JGTA 3AHJA 3F3SA 3N0WA 1KQOA 4JLJA 4M53A 1IUKA 4YRSA 2VHTA 3FOFC 2WHPB 3GJ3A 1JU4A 1P2FA 1YHNA 1G0NA 1YJ5A 3QWBA 2JFOA 4ID3A 3HJAA 1PV4A 4OQDA 4IHJB 3A3OA 3P0IA 4WY2A 5CVCA 1VBKA 2FZCA 4AFNA 4YFYA 4C6TB 3H16A 4AG3A 1G8HA 2WAXA 4WD3A 1JQ5A 1M1NB 1NI5A 1YKSA 2FB9A 3RSOA 4A9AA 3G9XA 3PFGA 1P61B 1PT8A 3NNNA 1U8XX 4EA8A 5ARBA 1L8AA 2FN7A 2P6RA 1JPVA 3V4OA 3ZWXA 2I3GA 1SC6A 3DYBA 2Y4OA 3ELWA 4YRGA 5B12A 1YQXA 3CW8X 5F3DA 4CV3A 3L5KA 4LG1A 1GTVA 1RWXA 1U6IA 2P2CA 3MWEA 4JOSA 1J8DA 3B3QA 1ZI8A 3SYLA 1DCKA 1QCZA 1F4PA 1NBEA 1ZVKA 2B4QA 2EYQA 3IVAA 1XMQB 1VLJA 4Q15A 1L1RA 4K3UA 4M2LA 4C5BA 1SG6A 5A04A 4KYIB 1UXJA 3QLJA 4BU1A 1SKBA 3HVUA 4JYAB 3QFRA 1NBME 4LJ8A 4BMOB 5B7PA 2Y67A 1OTYA 4XSHA 6ABPA 3KLOA 3DDCA 1PNOA 1SK8A 3K0BA 3LH5A 3VU3A 4JJ7A 1JG6A 1KJJA 1YSCA 3ZUGA 4BLPA 3GBVA 5K3SA 4CF5A 3R8CA 3K94A 4URYR 1RWBA 2FKAA 5FBLB 3KQUA 5IVPA 1L8LA 3AWDA 2JLCA 4XLLA 2WIBA 1BDIA 2YBDA 1QO7A 4MUXA 1EXWA 4LWQA 2YH2A 1V8FA 4X1KB 3NAGA 1JLHA 1U99A 1LQTA 1PLKA 3SDZA 4E15A 1INLA 1XK7A 1WDKA 3JZMA 4MVCA 5E7QA 1IXKA 4EMUA 2YFHA 5SY4A 3VTZA 2GHIA 2JH3A 1XRQA 1WXFA 3FNEA 1EK2A 3V7YA 2VDNB 3FI9A 2B1JA 3DD1A 1I3CA 3QKRA 4LJ7A 4F9GA 2FF5A 1E58A 4DSZA 1JHXA 1U7UA 4QJ3A 1XVTA 3HFRA 3QEBZ 5DMHA 5CXSA 2XNKA 4M60A 4M0PA 1KYQA 1NJ2A 5AK5A 3L07A 3OOEA 2V96A 5DYWA 5LA6F 1H0RA 1D5WA 3GWZA 5EP4A 3VH1A 2YS7A 1QH1B 2QI9F 2H0AA 3BKXA 2F1RA 1CPYA 1Z5ZA 4XPIB 2IF0A 4JLSA 4PX3A 5BV0A 2WRZA 1R7RA 1LSUA 3PNQA 4LV5B 4MQMA 4X61A 3UENA 4FZ3A 3MXOA 3OU6A 4W7IA 5CVEA 5EJIA 4R2HA 1DFIA 3B1KA 4M1KA 5EE9A 5ERXA 3VKFA 3WGYA 3WJ2A 5IHPA 5MN4A 3IQZA 2C3MA 1GUDA 1ZI9A 4D42A 2FW6A 4KRYA 4GP6A 1HYBA 1E9FA 1Y81A 2IUYA 1XHFA 2ALJA 3GMIA 3BCHA 4J7CA 1HH4A 4MH0R 1S8NA 4DC1A 4G8DA 3AUTA 1CUAA 4QTUB 3B9PA 3KKZA 3ZHOA 5FBKA 2VP2A 1CJMA 1RXUA 4M36A 2EX1A 5T4BA 4RAQA 4AJKA 1KEEB 2ECOA 3OQBA 1NBAA 1IE3A 1R8XA 2Q5LA 4GI1A 4R2IA 5U4QA 3NLLA 2QA5A 3KZOA 4IMIB 4AICA 1RM5A 4BFXA 3QFTA 1RYHA 1RYDA 2XEXA 4J4HA 4PHTA 4UUPA 4WFKA 2O1SA 1ISPA 1UF9A 3QI7A 3QTBA 3RIXA 3ORSA 3EWNA 4BGIA 2CDNA 1EFVB 2ZS9A 3FHTA 2O3SA 2FPKA 3KFXA 3BJZA 1J70A 4DL9A 1DTSA 5BSFA 4X44A 4DIKA 3O8QA 3QM1A 4TRNA 1BXKA 5KREA 4TN1A 1JQKA 5M34A 5K7SA 1WD5A 4E2YA 4REQB 4FQ8A 2OAEA 3TRDA 4OJTA 4ZCMA 2LIPA 1XDWA 3C3WA 3DE6X 1E4EB 4GPZA 2HIHA 2PMFA 3AKDA 1H5UA 3KTAB 1J20A 4EF6A 3U9SA 1FLVA 4X24A 1H0KA 4OAQA 4B6QA 4W4TA 3ICVA 1ND6A 2EKQA 4IJ6A 2PT5A 4OLJA 1P3DA 4U7PB 5JRJA 3QWIA 4YA6A 3W5DA 3ADBA 4YDRA 4DUGA 3L8EA 4PN7A 1GDHA 2C7PA 1JXOA 5K6AA 3PJGA 1HT3A 3HUTA 4X6XA 1SVUA 1K8YB 2WT9A 3KV3O 4MPPA 2QD1A 3BEOA 4OP1A 4YBZA 5FAXA 2XVMA 1D6MA 1TMKA 4LS3A 3MPUA 1Z07A 1DAEA 1AKTA 5I9LA 2ODPA 4HNQA 4YAKA 1M0EA 1JQJC 4ZOBA 1P75A 4EX7A 3AY3A 4FS8A 2FQ1A 5AKEA 1IY0A 1G2PA 2ILVA 4HQ0A 4YV1A 1QO0A 2ZB8A 3TR5A 1R0BA 3V2GA 1J23A 1KI3A 3N2YA 1U9ZA 2UYGA 3K2BA 5AK6A 1GUYA 2PMCA 4LC1A 1SOUA 2X5OA 1JKMA 1ZHFA 3ZQ6A 2XB9A 3TCXB 4CV0A 4YYZA 1SXJE 2Q3FA 4WDQA 2DETA 5IJWA 3JSXA 3QI2A 3SSOA 3X1MA 1T5IA 2VZLA 3G2JA 4Y7DA 1NC1A 1UKVY 1S1CA 4MQ6A 1ENPA 1QGDA 4MUNA 2I2CA 1F1BA 4KXQA 4ZRNA 2G1KA 1W5SA 1P9WA 2WIKA 4DWWA 3KB2A 5TQ0A 2HWYA 1XZGA 2VKTA 4RD0A 1RI1A 4XVRA 2AOXA 2V7XA 4UMEA 5EJ5A 5LOVF 4NOMA 3AWIA 4CWAA 4O59O 1OAOA 2BMVA 1TA0A 3PXDA 4B3BA 4LE0A 1HE3A 1DJNA 1RFLA 2C2WA 2HF8A 1TKRA 2VTDA 4M4SA 5DO9A 1NLFA 4YP9A 5J59A 3SMQA 1XZIA 3O1HB 5CJPA 1NATA 4ZKEA 4K6OA 3SFZA 2X8WA 1SBZA 3A6ZA 4HNTA 3K73O 2GN2A 2PUWA 3CPHA 1N33B 3HYTA 1TOAA 1DP4A 1BE8A 2FSVA 5EIWA 4YO7A 1TECE 3U7RA 3PEEA 4Q18A 4F4UA 4DUZB 4F3TA 3B1WA 4FU0A 2B99A 1H2FA 2C2XA 1T8UA 4N9WA 3QY0A 2WYHA 1TM2A 4MX8A 4J6EA 4WOJA 4HZUA 1EINA 1XRJA 1YULA 5ESWA 1FNBA 4U1RA 4G4GA 2DBVO 1E20A 2D3WA 3FKQA 5JZOA 1ZN2A 3GMDA 1PEYA 4E70A 2CYCA 4WKOA 4DDHA 4GPEA 1V9CA 3PT5A 4XX1A 4G9GA 3SEQA 1XP5A 3MWYW 1M8PA 3RFUA 4IUYA 1L9XA 2REQA 2IP4A 3MMXA 4KN6A 9LDBA 1TLFA 1O6BA 2FMUA 3DZDA 4GP9A 5JSQA 3CN7A 2NGRA 4H16A 1GO2A 1L7QA 3HDVA 1Y6ZA 3IPCA 4HLCA 2NTYC 1R0CA 3OWHA 4J43A 5IYZA 1R0RE 1YFKA 3QNUA 3SQOA 1VIAA 3M1YA 4K6GA 4ZRMA 2XUAA 3BVPA 3R9KA 4U2EA 1Y1RA 1FNMA 4H2DA 4KLNA 1DBRA 1JR4A 2C9OA 5BVHB 2V4MA 2XCQA 3DZGA 1YZGA 1D2GA 1AGRA 3VQTA 3WGKA 3K0CC 1JJIA 1JWBB 2PKQO 1UKBA 3CBQA 4ZYWA 4DV6B 1OZ0A 2WE8A 4R9SA 4PCLA 2RGWA 3OEHA 3W9BA 3QXCA 2UVDA 2WIDA 5EPOA 2QEQA 4NBUA 3EAGA 1H93A 4MDYA 2HL6A 4CL0A 3BGSA 1TQ2A 4NU8X 4CMBA 4D26A 1JBQA 1GPJA 4YV2A 2VF5X 2XCRB 2CDRA 3HWX1 3EYWA 3M6UA 2JIZD 3W5IA 2WF6A 4E4RA 3BDVA 4IFBA 4KH0A 2FWJA 1JDBC 1AV7A 4HFNA 4H1HA 2G36A 3HO8A 5I4BA 3TZHA 1D07A 2XWSA 2A30A 5CHEA 2J41A 2O8NA 3LF1A 4G24A 5C1BA 3NGXA 3WIOA 5L3VA 5L51A 2RAUA 1G20E 1RKBA 1W49A 2HEIA 1AGYA 2KBFA 1O5IA 1SN7A 2PFSA 2R6AA 2PM8A 3EOZA 1HYQA 4HEHA 4PYLA 2Q28A 4GMGA 3JQAA 1U7ZA 1NMQA 5CB8A 4YHHB 2G1UA 2R2GA 4LF6B 4RD3A 5KBYA 1QHGA 2GZ1A 4CF7A 5I9MA 2ZITA 1NJ6A 2IUUA 1QJCA 1RJFA 1YFZA 1RTKA 1ZDMA 3HBJA 3IT0A 3ONEA 4MIKA 1WPXA 2Z2IA 5JJ5A 2VHWA 2X0RA 3LCJA 3QPDA 4QQRA 4RC9A 3VOAA 2ZXUA 1N9GB 1YOVA 4ZEVA 1PJZA 1DWOA 2MSEB 3DUWA 2W2NA 3C70A 4OIMA 1UXKA 5CIQA 4AP9A 3V2IA 3QYFA 2FWIA 1L0BA 4RA6A 3IR6A 3RADC 5A5DA 2JIQA 2QJFA 3D81A 5JMTA 1ECGA 2I8LA 3RODA 3HM2A 2HU8A 3THWB 2HBQA 3IOEA 3JVIA 5DYNA 4D0GA 4WZAA 1BDHA 1CQWA 2ID4A 5E6SB 2RI0A 4WGGA 3QIAA 2C2HA 1JFLA 3ND7A 5SV2A 4DDUA 3DE1X 3R3SA 3HNOA 4BX0A 1A71A 2OSVA 4KE8A 1J2TA 3TIGA 1E6WA 2GEKA 3A6EA 1NF9A 1U2TA 3CEAA 1AQUA 3P97A 4GLFA 3IKVA 4B3FX 4P0QB 5C8YB 3REQA 1FXUA 5AM3A 1W25A 2VDVE 3WIEA 3DZBA 4NR0A 4KOAA 1YL5A 2OMEA 1BYIA 1X8XA 2ORIA 4V03A 3BCSA 4ILEA 4HVCA 3GFOA 3N86A 5CRIA 1UWVA 3IE0A 4GKVA 3PQ5A 2QZ9A 3F4BA 4YH1A 2C9DA 5F5XA 3RTAA 3ZS8A 3CV3A 3NDRA 5ITVA 4OGGA 4FLMA 4R9UC 1CRQA 2MIIA 1NQVA 3A9CA 3I2JA 3F98A 4DCNA 1I7LA 1P7YA 3GBPA 2ZJ8A 5HMMA 2V7EA 1IATA 1GRVA 1LZLA 1RHUA 4PNZA 1KEZA 4A7PA 4UUNA 2EFEB 1G55A 4G8JA 2Z2JA 2ZUDA 2OC4A 2HRDA 4KTTE 3E35A 5EXSA 1P39A 3PX7A 2ZRIA 4HNAA 2I4TA 4ARCA 3K15A 1SBTA 4KKVA 3SJUA 5AO9A 4PBTA 3IVCA 1Q7EA 2QM8A 4QBIA 4ANFA 3GDWA 2OV6A 2ZJ5A 3HA7A 3UT0A 5IXSA 4WKBA 1LEHA 5D8DA 1ULZA 4K40A 3CLRC 3H17A 3PFNA 3D59A 3VPSA 4KR7A 1XQVA 4OU5A 4XQ9A 5C4IA 2DUWA 1ORHA 1C29B 4WVLA 3UN1A 3FOBA 4HH0A 2A6PA 4PYIA 1PGJA 3B1YA 3L4EA 5BURA 2IWHA 1JSXA 3N9IA 1TC1A 5B7GA 1QGAA 4LQDA 5T3YA 4BNXA 3STHA 3J7AC 1Y3DE 3ESAA 1CRLA 4UAGA 3DOJA 2PR2A 3EIOA 2O3QA 5F73A 3O3OB 3ZCPA 2G71A 2Y0DA 2DGDA 3BUSA 2IYAA 2R60A 1Z2OX 2ZTLA 3PPYA 3THXA 3RS8A 1M75A 3PNLA 2NZVG 3IKJA 2A9KA 5EZQA 1OLUA 4GKKB 5A4KA 1CVLA 1CNEA 4LOLA 1E4EA 3FNBA 5AIAA 3OCJA 1DT3A 4MKFA 4EM6A 1JX6A 3CVUA 3M49A 1B8UA 1ZCBA 3IAM6 3O84A 3QF4A 4GOOD 4MGKR 2R6R1 4O1HA 3DEHA 2XOEA 2F4NA 1C3XA 2HLHA 4HDAA 4FM9A 3OOSA 2AN9A 1R4MB 3DAYA 2R8XA 3L4BC 4OI2A 4QUAA 2DTEA 3M7IA 3W2HA 4BLOA 4ESHA 2BGRA 3IODA 4FC6A 1B6GA 1QQ7A 1JQBA 1ZH8A 1P5HA 1PG2A 3M4YA 1BKDR 2H9IA 3NFRA 4FLFA 2IUSA 3ZX4A 1P4SA 2XQVA 1RVV1 3GLFB 1CCWA 1GT6A 3QXXA 3PFFA 5H4HA 4BV2A 4YJGA 1PYDA 3CIFA 5C51B 3S2ZA 2CEAA 2PGLA 2Y1OA 1V16A 4I3FA 3B5IA 3N76A 2XNSA 3GARA 2BCEA 2C9YA 3DPIA 2VRNA 5CX4A 5DK4A 2J9YB 1Q57A 5DLPA 5HA5A 5LA6B 2QX6A 2RHCA 4XX0B 3TKYA 2ZT8A 3DNMA 3IP3A 3R44A 4B5LA 1K92A 4ENQA 3PNVA 4C20A 3GNLA 3EXHC 1U7XA 2WYUA 3GEGA 2C97A 8ABPA 1DIRA 1PDOA 2C7GA 3IKLA 4BQOA 1OAAA 4TUYF 5ALNA 3FPJA 2OY0A 3UJCA 1OX4A 1PZNA 4ALIA 2X4LA 3RJMA 1NBOA 1OTXA 1Y8RA 2X3UA 4ZCLA 1ULSA 3VPHA 1UBEA 4UXJA 2YV3A 3FM9A 1JIQA 3DB1A 1LS6A 2HJSA 1CY2A 2YW2A 4M0UA 2ZRGA 2HCTA 3S2GA 5K3AA 4XSVA 2I6SA 1C7QA 1VKNA 2E4XA 1T6BY 3KQPA 3SSNA 5A0TA 1IQRA 3GFSA 4W7SA 1A9XB 3ZBTA 2EC5A 4R1SA 5EQFA 1QH8B 4CIBA 3HKBB 1R10A 1OFHA 2QMOA 3W5VA 1FYVA 2XAUA 3BQ9A 1TCCA 1RWKA 3RM3A 1N5OX 4A0GA 4ENPA 3DZ8A 4KQ9A 2C3UA 2IIPA 3GCGA 3Q4GA 3VC3A 5A6SA 1UT5A 3WIVA 4DV0B 2GM3A 1V5WA 2XPCA 5SICE 3R0ZA 1RRGA 3I92A 4HFRA 1N7JA 3HUEA 4GAEA 1U4SA 5TV2A 1UKYA 4PZDA 3OZGA 4CLXA 5K0SA 1HA3A 4H3KB 3C3MA 1H3EA 3PQFA 4XX0A 1X1QA 5KTOA 3R9XB 4A5OA 5IXJA 5KWVA 2OYSA 4B83A 4YN3A 2HSZA 2QMZA 3WLEA 1A5AB 4CT4B 4UD6A 4LXIA 3PYXA 2XD4A 4ZEWA 1U6KA 1YDWA 3ZHZA 4DMLA 4F5WA 3KKLA 1IYZA 2VYCA 1N8NA 4L4RA 1EHCA 1TCUA 1WP4A 4XCVA 5ICFA 5A3VA 1V1RA 3TE6A 3WQBA 3I9NA 1GWNA 1FC0A 2FPMA 1NF3A 5DSXA 3TLGA 5IUKC 3VYWA 2IT1A 1MW9X 1YZFA 4DCTA 1ESMA 1ZKDA 4UVHA 1ZA1A 2EATA 4C7JA 3EWSA 2BZ1A 1N2GA 1QV6A 3IQGX 2WG1A 5CHYA 4W5RA 3ZV6A 1PNVA 5EXTA 2IV2X 4KODA 3TD2A 3UB3A 2H4JA 3H6GA 2VPPA 4N0MA 1MGOA 1KAGA 3A6GA 4FFNA 2UUBB 1GUBA 4DQKA 3ACDA 1T3SA 4ZGBA 1G7CA 2QG9A 3LT4A 4D0NA 1EJBA 3SDSA 3MJRA 2A5JA 5K8LA 1CUJA 3EUEA 3HJRA 2V3CC 3WGZA 1PG0A 4S0XA 2H57A 3K71B 3U7GA 3GVPA 4D8WA 1X39A 3WQQA 4NJOA 1JQLB 2IYRA 3ZWBA 2JFUA 1Z5WA 3OE5A 1EVIA 4Y0VA 4DXHA 3GRZA 4YGXB 4JX8A 3ZWYA 4CQLA 5JQWA 1D09A 1UMBA 1P6QA 2IZ6A 1BVUA 4GX0A 4OMDA 5KMGA 5KYWB 1Q1ZA 2XHEA 4RLSA 2HFJA 3H9CA 3FGPA 1Z6XA 3P2OA 4ZARA 2YWJA 3W5UA 5DIZA 3PC8A 1TUGA 5BOSB 3H84A 3K6KA 4P1ZA 4TMVA 4X3PA 4ZAYA 1TTQB 1A9ZA 3P52A 2NSJA 1XNGA 5L6LB 5M04A 4B81A 3FGOA 3O2NA 2OCYC 5F35A 4OK6A 5G3YA 2A9PA 4DLVA 4QGSA 3KU4A 4IZ6A 4OOEA 2ES4A 1V7QA 4DCVA 1A7UA 1E3IA 4B79A 1KAEA 4F45A 4L8GA 3EEOA 4GHWA 1LTKA 1YS1X 2C7OA 3UVEA 3ETEA 4TWAA 4ARAA 2P77A 2O5EA 4MR9A 3HP4A 1WG8A 3NHLA 4Y0AA 5B1YA 5G0WA 2YN2A 3JD1A 2ZQZA 3SJZA 4MKRA 3FNHA 4W6QA 2R1VA 3KO8A 5FHRA 2C5BA 3OE7A 3Q2KA 1Z8FA 2UYYA 4G07A 3LUHA 1YKFA 3EOAI 4H27A 5D87A 5DNWA 2WG2A 5G4KB 3VR5A 4B43A 3CVWA 1SCUB 4I14A 3SKYA 3EGXB 2FHPA 1VKHA 4N0PA 3I53A 5H3LA 2YNMC 1Q50A 4R8RA 2NPFA 1EP3B 1HDGO 2QL9A 4B8YA 1TB4A 2GGSA 1DMRA 2EGGA 2IOFK 4TMKA 4TLLB 5C8YA 3REQB 1IG3A 3W04A 4AAYA 4DTCA 1B0UA 2X8BA 4B4UA 5HRUA 2QRNA 2R84A 3PQEA 4YRCA 3ITNA 4FBGA 3ETJA 3EXIB 4MZXA 5EWJB 4EUFA 1E2HA 1P4JA 3SK0A 3NB0A 1VECA 2OCAA 3E1KA 3U7EB 5HKKA 3P2IA 4YECA 1JG2A 5EYPB 4XWYA 5F1PA 1LNSA 3LHSA 2P1ZA 3N2KA 3OX3A 5K0JA 3W8FA 3EG5A 4JSTA 2WILA 4QA9A 5JD6A 2IW1A 2PX0A 3LYUA 1UOOA 3NW9A 3IMFA 4PO1A 1X38A 1N9GA 1YOVB 2IP2A 1EHIA 3OOYA 5FR1A 3FMPB 3M70A 3FSGA 4Q16A 2FR8A 4OU4A 4PC1A 2PS1A 2YXPX 4FMCB 2VDUE 5T67A 5LU9A 4BE7B 1XE3A 3K1AB 3RC2A 2QIPA 4O5OA 3SFTA 4EF4A 2V6GA 3T3HA 5FTKA 1CZUA 4IF6A 5KYNA 3PRHA 2D3TA 4FWBA 2OTCA 5BMVB 1WCIB 4NIMA 5HMLA 2GAAA 1M0WA 2BFEA 1JKXA 1RC1A 5CYPA 4ND1A 4K86A 4W5HA 1CUEA 2R6CA 4FBMA 1BFKA 2B1IA 2V7QD 4R81A 3HDJA 1GYRA 4L5CA 1PVOA 3IUBA 1B00A 3HY4A 4ZTZB 1M3SA 1ISFA 3SGLA 1X19A 1MEJA 3LC0A 4I4LA 3KQOA 3MZ0A 4KFSA 1Z15A 5KUTA 3KYDB 5AP9A 5H68A 3TRKA 4DABA 3VDXA 4TKVA 5E4FA 5D86A 1P4HA 4QYXA 3DP7A 1LK5A 1ACLA 3UOAB 2CV1A 1IXYA 2JCYA 4U9HS 1ISHA 1CRZA 1Q0PA 4YJKA 5AT1A 1QU2A 3LVRE 5CMLA 5FOWA 1X1RA 4WKGA 4R01A 3RFVA 2HT1A 1JEYA 4Q4DA 3ZJ4A 2G77B 2QTHA 2W8ZA 2WIFA 3ED5A 4RFLA 5JPDA 4G0UA 1KEVA 3V6LA 2C59A 3O9ZA 4NEHB 4UE3S 3B6IA 5EZYF 4BBJA 4F2GA 3U7HB 2XUOA 1Y4ZA 3HMKA 2BFFB 3KOWA 3QIVA 3TMYA 4R9VA 5LQRA 5B3AA 1H6DA 1MW8X 4ZQGA 3VKWA 4ZOLF 2JFPA 3N53A 1GGFA 1JKJB 1YKGA 3QGMA 2QT0A 2WFZA 4UBKA 4MRAA 2ZB4A 3C45A 1PT9A 3ETLA 5D2CA 4KXMA 4K46A 4XDYA 5JJLA 1U2ZA 1MAHA 1SHUX 2KLHA 3HABA 1ARZA 2NTEA 2ZIXA 3AB3A 1RLUA 3F6SA 4ZN6A 3O8CA 2G1JA 2JI8A 4XWTA 3UH1A 3DCYA 3NQ41 3NBAA 3WI7A 4L6CA 1K3FA 2J33A 5C7YA 1OH6A 4BQFA 4IGEA 4F3RA 1STOA 1K9VF 2CXXA 1Z5UA 2G8NA 4FNAA 2ETXA 4KBYA 4E4TA 3QFHA 4C29A 2UAGA 2MT9A 5L4LA 5JAHA 2VG8A 1RZVA 1MV8A 4NAHA 2WJ3A 4KAXA 4HNSA 2QTVB 4WK2B 2AFRA 3F6CA 4BCBA 5H83A 1C3OA 1U3VA 3DZCA 4GVLA 2R11A 1GL9B 4J7XA 5IBQA 4W5TA 4D3YA 1J1ZA 3PPWA 1Q3TA 2VP6A 4M86A 2EKDA 2OZLA 4V39A 2B37A 4BGVA 2JFXA 2GNPA 1Z38A 2DR3A 4B85A 4CV2A 4F5YA 3ZHSA 5B4VA 4XRGA 1YA8A 1R1DA 3K09C 4GF5A 1JIIA 3NBKA 1V7PC 3VISA 4BFYA 4ARIA 3LF2A 4LJ5A 2F3TA 4XOUA 3KSZO 3NHYA 1AF4A 1BVRA 1RU3A 2YYZA 3QHQA 3L40A 4J91A 4K81B 4UBJA 3TWOA 4E2XA 1N7HA 5FWYA 3AO0B 3BX1A 4BRZA 2O2ZA 3TXAA 4YT5A 1RCUA 4FYWA 4RIGA 3DAOA 3URKA 3NTVA 4OH1A 4BWVA 5JEEA 1OB5A 3I2KA 3KEQA 2GFIA 2J48A 2YYYA 5AW7A 5F1KA 2B4YA 1EFVA 3FRHA 2C9CA 5DBFA 4C0AC 1JDUA 3COYA 4QPCA 1E2JA 3A4LA 4ZU3A 5JNLA 1FFXB 1TAHA 3ZWDA 3KE8A 3FWYA 3NAZA 2IYNA 3R3JA 1CYDA 1R16A 2A5FA 4FR2A 4DLSA 1ES9A 1TMYA 2PT6A 4L8WB 1GADO 3TG8A 4LHEA 2ZJZA 1R4NB 3GT7A 3M6LA 4FYMA 3U49A 4Z53A 4FPXA 4Q66C 1CDDA 3P2YA 2C4NA 2IYUA 3I76A 3P19A 1BMFA 2V6JA 3GVCA 4JS0A 4U2CA 4HG2A 4LXQA 4PIVA 4Q1EA 1CR2A 3MJTA 3I5XA 1NUAA 3EH2A 5DHQA 2C5HA 4E09A 1L4HA 2K7ZA 4Q1DA 2VT2A 5J2TB 4HH4A 4C5CA 1ZO8A 3H1TA 4HN4B 2QR2A 3L1HA 2J0SA 4ZZ2A 1NNLA 1P44A 1QV9A 3GFGA 1IVNA 3QKSB 4UTPA 1Z6TA 1K5PA 4WJZA 2AKEA 3VPCA 4B32A 2UXBB 1RC8A 3USES 4A73A 1QR2A 2GAJA 3GFRA 1MOPA 3AR2A 4JCOA 1U7HA 2KSQA 3V8EA 4MNTA 1N6LA 3WIDA 4BTVA 3SF8A 4TXLA 2XD9A 1UDXA 2EKBA 2WWXA 2X77A 2ZIEA 3AW9A 1SMKA 4ECAA 5CEFA 5H4GA 4FOLA 4JYBA 4KR6A 1JJVA 2KLBA 4YAWA 4BNLA 3CNNA 1EVQA 3O3MB 3NTQA 4IZIA 2JA2A 4WXRA 1Y3CE 3RS2A 1G6KA 4NCAA 1TLLA 5FYQA 1UBLS 5HF5A 3TQTA 3EPPA 3I09A 2PL5A 2AQIA 1QX3A 2R86A 4WI1A 3VR1A 2MMCA 5ICGA 4LISA 3DAHA 1COWD 1QIKA 4MLPA 3OZ7A 3PDUA 3ZIAD 1OIWA 1J56A 3HCBA 1CV2A 5E4JA 5J1TB 3NX4A 1M6HA 3LLCA 2BHSA 1UPFA 3FVTA 2Y93A 3WB1A 3R0VA 4E2ZA 4X91A 3DAFA 2ZWVA 4K9KA 2WYWA 1BWSA 1L5MA 1U8AA 3DFKA 4YTEA 2D62A 1KY4A 1AX9A 1L5QA 1YBVA 3QBTA 4PNPA 4X84A 3PITA 3EAQA 3IVMA 4OA8A 3NT4A 4QHYA 1V16B 4RPHA 2XUHA 3ODGA 4RWEA 5EHGA 4EGJA 3BIXA 5TS3A 4YCMA 5GIPE 3JALA 4XGKA 2OV4A 1OX6A 1Q7TA 3AU8A 3JD4A 1ZL2A 1IN7A 3AOEC 4UEKA 1QTNA 1VMAA 5BSKA 5KQRA 1XRMA 3L4BA 5E7JA 3DW1X 3R9IA 1Y7TA 3FFTA 2IK8A 3E0QA 5ELMA 1VBNA 3PLNA 2X14A 2ZWAA 1G8PA 3IELA 4F3CA 3L6BA 2BFOA 1L2TA 3DL4A 3IXMA 1YFLA 2X2EA 2MR5A 1AY0A 3H97A 4PZ0A 4L8VA 1XZMA 3O2JA 3EVBA 5LKRA 3BMXA 3W1EA 2EJTA 2OEPA 3D6NB 4IIFA 3QG1A 3V4ZA 1F0YA 1DMSA 4EHJA 3SC3A 3R8FA 2QIOA 2HGZA 4L08A 4A5SA 2V5AA 4DZRA 5IJ9B 2JBAB 3IEXA 3STUA 5LJLA 3DLCA 2NUPA 2HPAA 1A8UA 3ND8A 4IJQA 4LNAA 4CEIB 2VPWA 2VP5A 2KW5A 3MTJA 5F52A 1LVUA 1ZCZA 4S1PA 3I58A 4FMDF 2VDOB 1ZGBA 3DXZA 4C01A 2P9JA 1IWBB 4HWOA 1BXZA 1ONOA 1L4GA 1UIRA 1YT5A 2FFQA 4CMIA 1PAUA 2HWXA 2IYSA 3B9QA 1KI7A 3H0CA 2HO5A 3DHVA 3L7CA 3VR4H 5IPFA 5JY6A 2Z6AA 3A6KA 3MBIA 4JT4A 4ETNA 3AL2A 3BQNB 4RW0A 1G5RA 1EU1A 1KYXA 4LEIA 4C7MA 3EGEA 1ESEA 5HCUA 1KYIA 3RAPR 2NO0A 1CS0A 3QKIA 3V2HA 5CR9A 2NG1A 3F4LA 4G5OA 2NU8A 5A5VA 3C7CB 1E9BA 1U3TA 2ZTMA 1DEKA 1W9MA 1E1KA 3G3EA 4K2AA 1WO8A 1OWPA 1JQAA 1M7BA 2LWIA 2XVAA 3HWSA 4HWSA 4R7GA 1IULA 2XKAA 4ZOLB 2QN8A 4AULA 3A9UA 1L5WA 1DPFA 1FP4A 1EMDA 5WRFA 1VYVA 1YONA 4BL5A 2JJMA 4PC6A 1C8LA 1B3RA 2Q7XA 4RVFA 4YRBA 5SYMA 2EKZA 3DC7A 4X71A 2EERA 2TMKA 1LPMA 1PV1A 3LXUX 3ZHQA 1R8YA 5EC8A 4J49A 4Y2XA 1GM5A 4EY3A 5DF1A 3L8FA 1XHEA 2D0DA 3EMDA 3T3OA 2IHZA 4ZMSA 4BTLA 1UZAA 4RABA 2FUEA 5BQ5A 4BNIA 2V98A 4UZEA 1S7CA 2IH4A 1W7AA 3PDWA 5LB2A 2BRUC 1Z63A 1RABA 1VPLA 1UBJS 2IKSA 3F6BX 4I2VA 4QUIA 3LOUA 1G5TA 4TYMA 2GN9A 3KS9A 2QRVB 1SXQA 3PC7A 3T5GA 1CEQA 1FSFA 1GAJA 1J0EA 3B7WA 3H5TA 1I1HA 4K6HA 2BFBB 5FQNA 3T5PA 1WCXA 1U7OA 3ZGVA 4EI8A 1EFDN 1N1GA 3QTTA 6ADHA 1XFDA 2HQBA 5F33A 4YYEA 1R18A 2E1PA 4Z9BA 2C0CA 2I55A 1FEZA 2P5YA 1P6UA 4EPVA 1YIOA 5EGSA 4J76A 1A1SA 2A7QA 2I1VB 2I3ZA 3AV0B 3N59A 1NJ8A 2P2SA 2Z1DA 4Y2JA 5GGYA 3SE0A 1KU0A 4JI0B 3HB0A 1PJSA 1PUJA 2DH5A 4DFDA 3GXOA 2P90A 3OUTA 2Q3DA 3FBGA 4UASA 2AVNA 2PGIA 4IICA 1PNRA 2ZUEA 4OQQA 3HYCA 2JJ1A 1N6HA 1KK1A 4INPA 5J63A 2GYUA 4LTMA 2H51A 1OW3B 4TOIA 2PXXA 3EVCA 2ZJYA 1SVIA 3NP7A 2IIBA 2BEUA 4JB8A 1DKPA 2HMUA 4MXDA 3REGA 1ZY2A 5K8CA 1KI2A 1QQTA 2VR1A 3C97A 3BWMA 3M81A 5KNDH 2IY9A 1YQUA 4HVLA 3X3HA 1MT0A 2FP4A 3UEOA 3UC9A 1U9IC 4F8JA 2RBGA 4YI5A 5KWJA 5AM0A 4U00A 3OTQA 4KIJA 3ZJTA 3WGTA 3ZY6A 1KOJA 4K88A 5MGBA 5KAMA 2VYNA 3PRYA 4KK4A 1JZQA 1GNRA 2J0QA 2B9VA 3CRRA 5J47A 2TMGA 3IUJA 3DMNA 2EU8A 4HB2A 1P3JA 3GRCA 5A06A 1BGWA 1TKBA 1KJIA 3IPRA 3U26A 4AZ3B 3LV8A 2RB5A 3FTPA 3ZHXA 1A3CA 2ZJ7A 2XADA 3EMBA 4GO1A 2QGNA 4ZPXA 3LUJA 1N2OA 1YBAA 1P8JA 3DZKA 2VJNA 2A0KA 4RVHA 1Q6ZA 3OCZA 1AQYA 4HMOA 2HN9A 2ODQA 2AH5A 2YWHA 3SYNA 1CERA 1N77A 3SQMA 2O8DA 4XCXA 3NYRA 1UMKA 3F73A 1LF0A 2GZDA 3QSGA 3BB3A 1CZRA 4FGWA 3TQRA 1T6XA 2B7LA 2JGNA 3QNWA 3WX0A 1DKLA 2XUJA 4DC9A 1CE8B 1DKRA 2GEFA 2FDXA 1DTWB 2BFCB 5IYZB 2Z2YA 3LBFA 3LY8A 3SN6A 1MXFA 4HWPA 4UMFA 4FR0A 5L9AA 5AW1A 1MX1A 4PM4A 4TMXA 4DYVA 3S1LA 2PAFA 2AK2A 3H1GA 1W4RA 2MOKA 2UZ1B 4UD2A 4WXMA 2F1KA 1DIGA 1JHRA 4QJ5A 4UNQA 3RUIA 4CEIA 1KY5A 2Q2VA 4DDKA 1E9AA 5CGQB 3UW3A 1J1UA 3LQQA 1FYEA 5IJ9A 2YY5A 3K92A 3OICA 1GCUA 3HDTA 3HXLA 3QUTA 5DOVA 1QIEA 4O2LA 4BJ5A 2JPDA 1GA1A 4Y1GA 3UGKA 3ZXSA 3TFOA 4JEIA 3U9TA 2HXSA 1GA6A 5FOVA 3KCNA 1H2WA 1TF5A 2VXYA 2VKQA 3FOEC 3QLUA 2ZSBA 1JHQA 1GZVA 3GRPA 3OX1A 1T0PA 4PGGA 5ECWA 3NIBA 1BCSA 3THSA 3L18A 2KQUA 3OFSA 1ICEA 4W5QA 2XX3A 1H1TA 1XALA 4U3JA 1QO9A 3T34A 4PTYA 3OFND 3I28A 1XTRA 3NM6B 5FX2A 1RRFA 2AF3C 4Q9NA 2WSSD 5CX1B 1AD2A 4P4NA 3E23A 3BMCB 3M3DA 3T7AA 3FI0A 3PSAA 4NCKA 3PR3A 4DNFA 1B1CA 1XVAA 2Q4RA 3OT1A 5I7VA 3EBLA 3O7WA 3QX7A 2A35A 3Q8KA 1S3IA 2AV6A 1M1ZA 1CVRA 2GN0A 3ZCQA 3SHQA 3V80A 3CSUA 2P2DA 1T25A 2VUHB 3GIWA 4J2TA 4N5LA 1WNFA 4CKEB 5DTQA 5J4YA 1APBA 2BZSA 3ROPA 4B4WA 4JEUA 3ZIDA 1YVRA 1SEPA 1U0SY 4GVPA 4RTNA 2IPXA 3X1JA 3I2GA 3INTA 1CY8A 2ZI9A 4Z7OB 1N1EA 3WWZA 2FZEA 1P0QA 4JXKA 2NQTA 3EIEA 4GNRA 4XAQA 1QS0B 4YJ2F 4MS4B 5BV1A 3O8RA 2JJ2A 3WRWA 1R0ZA 3RWMB 2NNWB 5EQDA 5CDHA 2BEWA 2JVJA 4QXPA 4XM1A 1VSUA 2O2HA 2RGNA 3HDHA 4L85A 2OHGA 5PGMA 4BQEA 2H1HA 4DIBA 1YC5A 4ZC1A 4Z86A 2IFTA 4QNRA 1ZHHA 3UBMA 5B6IA 1ZZEA 2GCEA 4YLGA 1QGUA 2Q3CA 2FWBA 5ALOA 2YUTA 3KPUA 4US1R 1PT5A 1UKEA 2YFYA 3LY7A 4OXXA 1TYZA 2M1XA 2XOXA 4O4LB 4JT9A 3WK5A 5CK4A 3UPUA 4PZEA 2AJTA 1Y48E 2E89A 1GRCA 3BDAA 4IDQA 1QKIA 4N3AA 2ZZKA 2YZKA 4RTLA 5FV4A 2QMEA 1CUZA 3VMFA 2A78A 1N78A 3O4GA 1TIPA 4GX2A 3VR2D 2D5BA 1LA2A 2DHEA 2RHJA 2ZTVA 3ECAA 5IKPA 4OI1A 2EBHX 1XEWY 3H1FA 3MINB 2H1WA 4HH1A 2BOVA 4N5DA 1ULTA 1SXGA 1EM6A 4JYCA 1W85B 4PRKA 1Z12A 1M5TA 1UOEA 2RBEA 3QHAA 2AKYA 5LUAA 2POCA 3KQHA 4E2WA 3AY7A 1Q21A 2HAEA 3FHJA 2AT1A 3I1IA 3JAWB 1KI4A 4KQMA 4CMIB 1T5DX 4OQEA 2OQIA 2RK6A 3AHGA 5CB6A 4UEOA 4ZTUB 1QHHA 3EXG1 4U4AA 3WKAA 2W8BB 2QNBA 3EEIA 3FDJA 4MW0A 4NVRA 4O2AF 3TRFA 1SKMA 4PZUA 4LZWA 5CDFA 2GTIA 1YNOA 2QLFA 2O9JA 2A3RA 5B3KA 1TTTA 3BB4A 2SNIE 2WSYB 4JGBA 3DEJA 1OPRA 4DCGA 3AF5A 5DASA 1T0UA 4UXHA 3GV0A 1NTRA 4QGHA 4ND8A 4YI3A 4BFUA 4ER3A 2EFYA 2GK7A 5JECA 2C98A 2F48A 3T3NA 2BKEA 2WKRA 1JN0A 3QBVA 1YUBA 1G21A 4AF7A 2ZBFA 3IVRA 1XX6A 1AXGA 1TCBA 3L7OA 4KAAA 1QOPB 3U6KA 5BQ3A 3BHNA 2D5LA 3CKLA 3EZGA 2P9YA 3HCPA 3OI7A 1N8KA 4UHJA 5HIMA 1F4LA 1YDHA 4EB0A 4N0EA 1GKUB 1EBFA 1VP9A 5KINB 1IZYA 3O1JC 1F7VA 5C31A 4MW5A 4XI9A 1EWQA 3E22B 4PC2A 1T9ZA 3VZPA 4GUAA 3FR8A 5KVVA 5IS2A 4E21A 3ZK7A 4QRDA 2BKUA 1BQ4A 5TGZA 1GR1A 1OWNA 2WSIA 1U9JA 4MR8A 3TR6A 2AC4A 4MW2A 4Z7JA 1UBRS 5KO2A 3S28A 1LDGA 5FOQA 1Y3FE 4L6AA 4XGNA 3JX9A 4M9XA 3OKAA 4RVGA 3DQQA 2ZU0C 4RKWA 3DMTC 4PX9A 5T41A 3VHLB 2HMAA 4QEDA 4RAOA 4KUEA 5FL7A 2JH9A 3DJYA 3GEHA 3OP1A 3RFTA 5MFZA 2QN2A 5ES4B 5T8KA 5K6AC 3LECA 3PXUA 3SP1A 2FPIB 4I6EA 4EHLA 4WECA 4BNVA 1RHJA 4EY7A 3RC3A 1BHQ1 2J3HA 4II2A 3BWEA 1BW9B 5LQUA 4PPNA 2BTOA 1RLJA 4PC3A 5BN5A 3HN2A 1NHGA 1W0JA 3CX8A 5DISB 1G60A 3CH5A 3OU2A 4MOWA 4PGMA 4KXVA 4PR0A 1QU3A 2WF7A 2OG1A 4JSYA 1Z2EA 5BNFA 3AHEA 4TXMA 4C06A 4F93B 5FWNA 1TZCA 1A7JA 2JGIA 3AUFA 2QHXA 2HRZA 2CWWA 3L7AA 3TBFA 4RTMA 3FHLA 2GA9A 4FC7A 3PA6A 1Q1QA 2E6UX 4KQEA 1TO6A 2E49A 4OP2A 3SX2A 5LSAA 2A0XA 4AJNA 4F56A 4BB9A 2D8MA 5IBCA 4S04A 4KPYA 2V7BA 1WB6A 2R6GA 2VIIA 3NDBB 1JHPA 3WMRA 3N2IA 4RK1A 1UJ5A 4V0NA 5A6VA 2ANCA 3TXYA 3KEMA 1YCDA 5EZ6B 3KQWA 5CT8A 2J7KA 5E4YA 1PW7A 1YL7A 1FRQA 3TQQA 3TYXA 2C5GA 3LXXA 2H1OA 2FCRA 1K6EA 2VSFA 2ZBEA 1Z6YA 1S9DA 1M2JA 4W9MC 3M4NA 4EHFA 2D1FA 1H6CA 1VJCA 2H5LA 4J7UA 3AP3A 2F59A 1MFZA 1DIAA 4YACA 4EYKA 1ZINA 1XVIA 1G5QA 1XMIA 2HFKA 2R85A 5ALGA 5FPKA 2E85A 3VSEA 3U4QB 2CL6X 4NBVA 4EB6A 1GNVA 2WKWA 4Q5IA 3P32A 5D6NA 5JLJA 3ICQB 3EDMA 2QPTA 1YGPA 5DI9A 2V7UA 3H6KA 3IULA 4MSUA 3TQOA 1Z5VA 2Q4TA 3SS8A 4AJ2A 3DLBA 4PYQA 1RXEA 1Z0AA 3LFTA 1R9JA 4MO9A 4RVSA 2Q7DA 4ZU1X 2XE8A 2NXEA 2GJ8A 4N6NA 3K70C 1GTL1 3UY4A 5BWNA 4HTFA 4EKIA 1MC5A 3TEJA 1Q11A 2BEWB 1D6JA 2HLDD 3QLTA 1QQ5A 5CEJA 4DPMA 4MS1A 2BISA 1JTFA 1AC5A 1V8OA 4FDUA 4GX5A 2VS1A 4RZ3A 2G67A 2IQ5A 4LDQA 3A9RA 4YUWA 4RGQA 3FSRA 3SBOA 4KB5A 3H9GA 3A6FA 3SQDA 4ND4A 2VF7A 3W8RA 2XMDA 3A3PA 1K8RA 2OCIA 3ZWWA 1MU0A 2BSQA 2GZMA 1RKXA 2QUHA 4CMKA 4Z49A 1ZEMA 5EXEA 4DILA 1NI4A 2ZIFA 1WUTA 2YWBA 5EMHA 1ZOSA 4K9LA 1E92A 4DMCA 5DX8A 3DCJA 4I46A 3TTUA 5HJ5A 2UXCB 1QRRA 2CJPA 3E8XA 1G4HA 6CHYA 1Q22A 2RCYA 3HXPA 1ILEA 2AFHA 2HRRA 3H5AA 4D79A 4TKUA 4DLPA 5BW8A 3U5ZB 4RLHA 1Q17A 2ZWIA 1E2LA 3E84A 4R0MA 4XVCA 4EJ2A 3SVLA 1DGQA 1XC7A 1OXKB 5FBQB 1W0CA 1FF9A 2V59A 1V5GA 2IEBA 3HI4A 3MJ4A 1N1DA 4AY3A 2QI9C 1RE1A 3EPRA 2EL9A 3N8GA 4RJ2A 4UE2A 2B7CA 3BIFA 4Y6SA 3AR7A 5DN6A 3WLRA 3ZWPA 4YJ2B 5IAAA 4YP0A 2YWCA 3A7DA 4RZ2A 3HVKA 3PDCA 1U0JA 2Q9CA 3ENNA 4QU9A 4QQFA 4BWYA 4JH0A 4V02A 4DF3A 3TPZA 3NDIA 4NXMB 4I1UA 2ABWA 3GBSA 1U3GA 4CDMA 5E3HA 2ZRQA 4DZZA 2IYPA 4H1UA 4F6RB 5JLAA 2QROA 3VR4A 2GI4A 2I7TA 2YHIB 2YVLA 3KVVA 4KWHA 5EKUA 3W4IA 1C41A 2HH9A 3MLBA 2K5UA 1T2CA 1OREA 3IDFA 2WB4A 2E0IA 4TZ6A 2I6UA 1SA0A 2V8BA 2CCGA 3PKIA 1VKOA 4FJ2A 4LHSA 2RIPA 2OFWA 1F2UA 1GGKA 2VLIA 4OHVA 3BSSA 2KYRA 4NZ9A 5CNJA 3PQ4A 1D6SA 3FCCA 1QZUA 2ACVA 2DHQA 4DJ5X 4A15A 4CTMA 4Z3OA 3D7NA 5I8WA 2PH3A 2WE7A 1WL8A 1SXHA 4NG4A 1C0EA 1ZLYA 2BC9A 4E4YA 2ZULA 3BTSA 1TA4A 2ZKLA 4D8VA 5A62A 2R00C 5F12A 1SKAA 4RLFA 3OA2A 3RIMA 1O0SA 3R6WA 3A27A 4G3XA 4F2HA 2J0EA 3OQMA 2ZM6B 4QXMA 4PQYA 3KQMA 3IFSA 1KI6B 2E4AA 1G42A 2IXBA 2XYQA 2ADMA 3ENZA 1ISGA 3GJSA 3GU3A 3S8YA 3F7TA 3PGMA 3WGLA 4QYIA 3AETA 2GPAA 1M9NA 2F43B 4A2PA 1J2RA 4J3JA 4BVHA 5FEMA 2BBTA 3FFBA 2QL5A 1DUIA 2PKYX 1WOMA 4GXQA 2Q1WA 1PI3A 3IMGA 4XRRA 1U1EA 5KYYA 4KRFA 1RAAA 4PG8A 4P83A 2QENA 1ZOPA 1UEJA 3IPAA 2HM7A 3G79A 1OXUA 3RU9A 1BE6A 2GXAA 1A82A 4DLRA 3AL3A 2GWHA 4H15A 3WGUA 2V54A 4RKQA 2C5EA 3DTYA 4Q4HA 5EJAA 4BXOB 1JU9A 2ZIGA 1NLYA 2BE9A 2IYWA 1BCRA 1YUNA 4XLZA 3CN9A 3ESXA 2XCLA 1QANA 3O91A 4DSAA 1R88A 2IDJA 3ACCA 3D8NA 1UZNA 1Y4SA 3LSYA 1DLJA 4ZT7A 1SXIA 2XQFA 3PC4A 4B9EA 5DN6D 5DTIA 3N8DA 1RWQA 1DDGA 1NTOA 3RIHA 3IH5A 5JH7F 1V4VA 3A1NA 3LWZA 3KT3A 2QJRA 4PX2A 3FVVA 2GLXA 3O94A 4DCUA 2W22A 1Z75A 1FMLA 4AM8A 1TQ6A 4DCCA 1L1QA 2VTBB 1C2TA 5A9SB 3DYVA 2PWYA 4V3BA 4XR9A 4QHTA 4RFSA 2XY4A 5F2NA 3LC1O 2DJIA 2YRXA 3HDGA 5LLSA 1M8FA 1AUPA 4JGIA 2DPMA 1Z4LA 4K9NA 4NCHA 3OTGA 3WNVA 1W59A 1YRAA 2BI4A 4N54A 1UPCA 5LNK6 2RFLA 1BMTA 1DQPA 3DP9A 4S1WA 3SICE 3DTNA 2RHLA 2XJ9A 3KX2A 4MWDA 4EZBA 4IJKA 3UFXA 2CL5A 4X45A 3REOA 1XVVA 1UWLA 2FPPB 2JEOA 3BICA 5KI6A 4BEJA 2GR9A 1T5SA 2VDWA 3BWVA 4U9UA 2HKIA 4IOJA 5TXGA 3OM9A 1G7RA 1K1EA 1IOVA 4H7DA 3TAXA 1XROA 3PA8A 5I47A 1CQIB 1WF6A 3UXMA 2IBSA 2XBMA 1A2BA 5TT0A 4JI8B 4X62B 3Q8MA 4TZTA 3K0HA 4JYMA 5GJBA 1CUBA 2WAOA 4K9SA 5T6MA 1GKYA 2FJ0A 1CDEA 2VK4A 4U63A 4NULA 1IN1A 3TM5A 1RXYA 1Z2AA 4IHQA 2V8OA 3DOFA 3DLAA 4EVSA 3N87A 3PNYA 2Y77A 1HYEA 2JHGA 1A5BB 3A1FA 4Y6OA 3O4FA 5LMZA 3KSUA 2EJBA 3L8DA 2YKGA 2IU3A 3VR0A 5IFLA 3PGVA 4KNVA 4H9GA 5EINA 3DMHA 3H0KA 1XYYA 3EZFA 2Z43A 3ZDRA 1DB3A 1SOAA 3GYGA 1JRLA 1U5BA 4M76B 5HDBB 2Y99A 3GYBA 4KREA 1ML4A 3C8UA 3EXHA 3FPAA 3PGLA 3PK0A 4K6FA 5DW0A 2GKSA 4AO8A 5KMGB 1FTSA 4DYDA 2Q9UA 4MUIA 1Y5RA 4IG9A 5GVRA 5T6BA 1PKEA 2WBLC 3IIMA 4HMPA 3ZGYA 1SUPA 3GLFA 2FZVA 2EQBA 4EY8A 1P7PA 5D1NA 4AWBA 4ZOQI 4U0JA 3RRMA 8OHMA 4RS4A 3LVQE 1OGYA 2HJVA 4O4IB 1N0UA 3PC6A 4DA4A 2PBRA 2REOA 4QOFA 3M5CA 3T38A 2HPHA 2GKOA 2P0YA 5ALXA 6REQA 1T8SA 1T6YA 2A92A 5GZ1A 3RTCA 3PXXA 1MT3A 2X8JA 3A58B 4FCWA 2NQ8A 2FFHA 4FN4A 4TYPA 3W8NA 1Q91A 4Q7JB 3JPYA 1O5OA 5L4NA 1QG2A 4H6PA 2JJ1D 3U1TA 3AM1A 4M37A 3WDMA 4MVYA 5EIEA 5JU6A 1KO8A 1O6CA 3MERA 4Y1EA 1AV6A 2QG4A 2OGWA 3QEKA 2ZIZA 3ZR4B 2BGMA 4M22A 1KYZA 2JIMA 1X8LA 3Q40A 2ZRKA 1XQXA 2R8ZA 4EY4A 4IX1A 2ZDGA 3SJBA 1L7PA 2X15A 3PF8A 2I22A 4I4TB 1H4QA 3DS8A 4II7A 3B2EA 4X94A 1P29A 1YOBA 4CCYB 1SAYA 4RM2A 5AR1A 1OVGA 1QKJA 4CQMB 2XWPA 3BIJA 3FDZA 3PEVA 3RJ9A 3J81k 3AKEA 2G0AA 4ZCIA 3N0XA 2I2BA 2HHCA 1F20A 4UMVA 3VDRA 3MYYA 1XPJA 3QYAA 1O87A 1V35A 3B82A 1URPA 4MJLA 1MRZA 2E87A 2RG7A 3CLUD 4OQFA 3KYJB 1FLNA 3BSYA 4JI5B 3OSUA 3DNFA 1E5TA 1V11A 3SJAA 3E0XA 1W34A 4EUEA 2XDQA 4L9WA 1NFQA 1YJBA 2HJRA 2A7XA 2VDPB 2FFBA 2Q0QA 2QT9A 2JIZA 4PZAA 4R3NA 3ROXA 2JLXA 4YJ3A 7MHTA 1VMEA 5CLHA 1J8QA 1JHAA 3CLUC 3HFJA 2PUJA 1EQUA 5FFFA 2RHGB 4WA7A 4I81A 1M2VA 4KGXA 4CJXA 5LMNB 5IEBA 4AXBA 5FAKA 2IDKA 4XTCS 3Q7SA 3W77A 2PUDA 2QN6A 2J4CA 2WQZA 4NBLA 5FULA 3GRUA 4HB0A 3ADKA 1RR6A 1AHNA 1U4NA 2PMWB 2PXCA 3D6JA 3DQPA 1QDLB 4G0VA 2A86A 2NO6A 3DXFA 4PGHA 1FFEA 2GEBA 1YQEA 2HWUA 5JSHA 1JIKA 3EEFA 4FQ7A 5ARDA 2C9ZA 1AO0A 2ZWMA 3PC2A 4JOBA 1PW5A 2AMLA 1NAIA 4I55A 4R2WA 1E1NA 2W4IA 4B82A 4BATA 2CSXA 4IDPA 3HACA 1JHYA 4C7VA 3CBGA 1EFAA 1Z29A 2BMFA 3LBAA 3MEQA 4MS1B 1UBGA 1EAMA 1DIBA 2VP4A 3VR3D 1OLXB 4P86A 5JJBA 5TSDA 1UWKA 5LYJF 3ASYA 2JLBA 2OGZA 3V1TC 2QY9A 4RL4A 3WJ7A 3TSYA 3T15A 2ZDHA 1KAQA 1L9KA 4D3ZA 4CTOA 2FMTA 4QGGA 2AW3A 1GFWA 4YRTA 1BD3A 1B6RA 1UJ2A 4ZC8A 2BCGY 3W6UA 3I2FA 1VJDA 1YJAA 2XA1A 4URHA 2VBGA 4KACA 5ETJA 4EG1A 3C1OA 5IT4A 3PV0A 4LF8B 4AUKA 4M0LA 4W6ZA 3D3KA 4DN6A 3N0TA 3TNJA 4RSRA 2JZNA 3OE7D 4OPMA 4C08A 5FWXA 5FNVB 3GO4A 3TJZA 3F3YA 4KQGA 4D45A 1H8EA 3GN1A 3T7DA 2PV0A 2OQRA 3A1EA 1A8IA 3QF4B 5P8WA 4WBNB 1A2OA 1JT9A 1F14A 1PJ2A 4J07A 4HP8A 4OBWA 5F23A 3WMFA 3E3LA 5FLEX 2I4MA 4AUMA 3R6GA 4DV3B 3EPLA 1JE1A 3TX2A 2QMYA 3CLSD 1W2HA 1YL6A 3L4JA 1UBUS 4Q9IA 3SCZA 1OXXK 2DVMA 3AZQA 4PZZA 4WW0A 1B41A 5KNDA 1EFRA 2NU6B 3HU3A 1IZZA 3VPBA 2WKQA 4KPEC 2FH5B 4OTZA 1HK7A 5EJ9A 4O0MA 5DHAA 1AHHA 2Q4EA 3NXSA 4OYRA 1C8KA 3TQHA 1NV9A 2OCGA 1G5FA 3D3EA 4D8YA 1C3LA 2GNOA 3DE5X 3HU2A 3UUWA 4C1NA 2XCIA 2GZ2A 1GRRA 1TM1E 4CKCB 2WNHA 2ZR0A 3NO4A 1XAHA 1NG9A 3PGJA 3M1IA 4TVBA 3WMEA 3LWNA 1YUMA 5DHFA 1O95C 2X7JA 1W9HA 5F7JA 1IRXA 2AB0A 3AVWA 1T1RA 1CJTC 5BVHA 3Q6NA 3KE9A 4KO8A 2EG9A 1GPUA 1D6NA 4TMTA 1DV2A 4X8OA 2ZSIA 5BR7A 4LE1A 4KQCA 3UKJA 4TKZA 3WRYC 2JAQA 1WCYA 4YUZA 1O03A 2HA6A 2ISSD 2PSSA 1TU3A 1P7ZA 4M7WA 2X3FA 2I4OA 1A2QA 3KAPA 4ZV7A 3AFGA 2QQ5A 4GX1A 4F97A 1MBZA 3KHTA 4NE2A 1EAYA 3WICA 5GJWC 1XJ0A 1ETUA 2GYVA 1VDMA 4MLDA 1DKUA 1ORDA 4PHHA 4XQEA 3GEMA 4ADSG 5CTJA 3ORFA 3AM3A 4OATA 4M7PA 3I8SA 2X8LA 1ZWKA 4U3JB 4WOKA 5AJUA 3VDMA 1Y9ZA 4MRMA 1X0VA 1HFWA 2Z2KA 4HBZA 2IXTA 4P4TA 4PXAA 1BS9A 4REOA 5C1IA 3K9HA 5LP1A 1FE8A 2O2JA 1CT9A 3K2IA 3AY6A 3NHMA 3PXAA 4IDGA 5L3ZA 2XVXA 1RQLA 3K09A 4C87A 4ON9A 1HT0A 3DBLA 3ENKA 1WKVA 3M6WA 3UOGA 3FA2A 3SEAA 2HV8A 2PY6A 1AUXA 4OAOA 1H1LA 3HKEB 4WK6A 5KNCA 1PJQA 1ZIYA 3AEUA 5KYVA 1P9LA 1RIIA 4E7OA 5EWMB 2ID7A 1ZMRA 2FEOA 4IHJF 5KC8A 2W58A 3P0RA 1KFJB 2W8BA 4KO3S 1KOLA 1VXRA 3TQSA 1OPXA 4PYMA 4G8BA 3T8YA 2J9GA 2VUSA 4MPDA 3HBMA 2O0LA 3TL6A 2FW1A 5TQ0B 4AQ7A 2ZXEA 2EOAA 4FCCA 2HHHB 1F8FA 1ZONA 2OZKA 2TYSB 4G6ZA 4KFTA 4HNRA 1MC8A 1NURA 2EJCA 2YJ5A 3VDQA 2H4ZA 3MD9A 1QDUA 1N36B 4JVSB 3TJMA 2FFRA 2Q0SA 4RJTA 2ZP1A 1OZAA 1V47A 2GCOB 2ST1A 1JAIA 1QZZA 1X14A 1N34B 1CFZA 3O74A 4BMVA 3VO9A 3QF7A 5F64A 2YV4A 4MJXA 2PDAA 3UWMA 1P2TA 3UICA 2N0SA 5A71A 5IH7A 5JJIA 2WI8A 3NBZC 1QVAA 1N1MA 3TAUA 1VE5A 1AS3A 4Y1RA 4TYWA 3ZWKA 3HJBA 4O2BA 2WUFA 2QGZA 3NALA 1W94A 2AFVA 1GNSA 2HA0A 2ZT7A 1E99A 1WY7A 1SR8A 3NZEA 4KXNA 4LY0A 4OMCA 3EUFA 4PLGA 4QUEA 2ZUBA 4URUR 4HNUA 2G04A 5B2FA 1C0LA 2DUJA 3WK9A 3TTXA 3VZCA 3D31A 3I6QA 2C61A 4ZVKA 2VA8A 3H2ZA 4PG7A 4Q1AA 2CZCA 2XUDA 5TQVA 3U7FB 3WP0A 2PBZA 4B6OA 1E64A 1U0HC 2JIRA 3AU9A 1HG1A 3RC1A 5F2KA 4PLWA 4WOPA 3ICWA 1H65A 4PGAA 3I39X 2VNKA 4Z3DA 1B73A 2Y1FA 4YLYA 3K35A 3ADDA 1OE0A 2ADOA 3VNSA 1FVFA 2QTAA 1DFHA 2Q3JA 4CIVA 2X0EA 2JLAA 1SJ9A 2CSUA 1TQ4A 3N7TA 4U2DA 2P91A 1CUCA 3CURA 1JPJA 2J1LA 1GU7A 3CW9A 3W9YA 3CVYA 4P4SB 5AK0A 1HDIA 5EQTA 3U4GA 3LK6A 1TIBA 5L8VA